4WFBQ

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with bc-3205
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
89
structure length
89
Chain Sequence
EARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVASVNIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S rRNA
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
molecule tags Ribosome
total genus 11
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wfbQ00
1H2VZ 3CCQS 1N52B 3H2UB 2YKAA 2M2BA 3MOJB 3THTA 4BS2A 2XS5A 2D3OR 3FEXB 3MD1A 4PR6A 1OWXA 2K3KA 2JRSA 2F9JA 2KU7A 2DGUA 3BO3A 2X1BA 2MZQA 2MMYA 3S6EA 2DITA 1VC0A 4QU6A 5IFMA 2MKIA 1QVGR 1WHVA 3MD3A 5HO4A 1VQ4S 2MQPA 3CMES 2BOPA 4WIIA 1WTBA 3MDFA 1X4AA 3G8TA 2RT3A 3VAMA 1D9AA 2DNHA 5GAGU 4WFNQ 2X1FA 5CA5A 2AYEA 2RQCA 5DM7Q 2DHAA 5JVGQ 1VQPS 1U1PA 1PGZA 2M0GB 3CCSS 1PO6A 2DNLA 1SXLA 1WEZA 5IM0A 3G4SS 5LJ5Y 4P6QA 1DZ5A 2GHPA 2MKSA 3S8SA 1YJWS 3CPWR 3CCMS 2M52A 1FHTA 2XNRA 2E5GA 4IUFA 2MKHA 1R8PA 3TP2A 3VAHA 5DDOC 1BY9A 2DIUA 2D9OA 3P49B 5GAEU 1WF2A 2OTLS 1ZZFA 1HA1A 2E5IA 2KHCA 4RU2A 2ERRA 2RRBA 2AYGA 3Q2SC 3PIPQ 1YHQS 1CVJA 1VQMS 2MJNA 1SJ4P 3U1LA 2U2FA 4CH0S 1X5OA 1WG4A 2OIHA 5LSOA 3TO8A 5GMKa 3MXHP 2M70A 3SDEA 4EGLA 2KI2A 1VC6A 2KXHA 2QEXS 2MQLA 1U1RA 1VQKS 1U1NA 1X4CA 1YJNS 4OZ0A 1DRZA 3PIOQ 2HGMA 3V4MA 1U1MA 3B4DA 1SJFA 3HI9A 2KT5A 2EK6A 2DHSA 4LJMA 3CTRA 2JX2A 2KRBA 3UCGA 4LIRA 3G96A 2L08A 3NS5A 3UCZP 1DBDA 2MB0B 5JVHQ 1VQ9S 1VQ8S 3I56S 5GVQA 2FPHX 1YWXA 2KM8B 2KM8C 2Q79A 3CMAS 2ZJPQ 1OO0B 2MQOA 2MZTA 1S79A 3CCUS 3G9CA 3NNHA 2CPEA 2OJ3A 2KFYA 1K9MT 1U2FA 2RNEA 2MGZB 2DNGA 3US5A 2XSFA 2MKCA 2YWKA 2DNZA 2EVZA 4WFBQ 4TU9A 1WEXA 1N88A 3EX7B 2CPDA 3D2WA 1FJCA 2CQDA 3P3DA 2WBRA 2KN4A 2M7SA 4Z2XA 4CQ1A 1UFWA 2CPYA 3MUTP 1WG1A 2LCWA 4LMZA 1Q81T 3P5TL 1WG5A 4QU7A 2MQQA 1JJ2R 4TU7A 2RVJA 1VQNS 1H6KX 2AYMA 1RKJA 2E5JA 1M5PC 4M5DB 1NU4A 4WCEQ 2M88A 3CXCR 3UCUP 1X0FA 4UQTA 1N54B 5LXRA 4YUDA 1N8RT 2FC9A 2U1AA 5DDRC 2DO4A 2YH1A 1NO8A 2DNPA 2RRAA 1XN9A 3R27A 3I55S 3S7RA 1O0PA 1U1KA 2FY1A 2MKJA 2A3JA 3CCRS 2LXUA 4F25A 4C0OC 2PEHA 2NZ4A 2CQ0A 2CPIA 2HGNA 5DDQC 3K0JA 3NMRA 5IQQA 5GAHU 2DHGA 5GADU 2RU3A 3NNCA 2DIVA 2MSSA 1M1KT 1VBYA 2CQHA 2O3DA 1VBXA 2DGWA 3VAIA 3DLLQ 1WHXA 4OZ1A 1FJEB 5DETA 2JVOA 2EK1A 1QVFR 1JJ4A 2LYVA 1YJ9S 3LQVA 4ERDA 3TYTA 2DH7A 2ADBA 4WF9Q 4ZKAA 1WI6A 1A7GE 1M5VC 5BJRA 2FHOB 2JVRA 4UY8T 1UW4A 2DGQA 1B7FA 3CCES 2MY8A 2KXNB 2XS7A 2JWNA 2VONA 1VQOS 4FXVA 1WF1A 4WKRA 2HVZA 2RQ4A 1ZZNA 3IWNC 1X4HA 2VOOA 2DHXA 2MZRA 2RS8A 2DO0A 1KD1T 3CF5Q 5IM0B 1X4BA 5FJ4A 4CH1A 3G8SA 2V94A 1URNA 1U6BA 1FT8A 2KXFA 2DNKA 2LA6A 2DNMA 2X1GA 1P27B 1WI8A 2CPZA 5D78A 1G2EA 3J7ZT 5CXTA 4Y0FA 4YB1P 1VC5A 2J0SD 1A9NB 2MY7A 2DISA 2CQBA 3VAKA 1S72S 2DGSA 5LXYA 4ED5A 3VAGA 2CPFA 2MJUA 2B0GA 4U67Q 1HD0A 1FXLA 2PE8A 1VBZA 2DGVA 4A8XA 2L9WA 2QFJA 3ULHA 2LEBA 1NJIT 3J7YU 2MPUA 2ZJQQ 2UP1A 3EGNA 3SDEB 4C4WA 3L3CA 3LPYA 2X1AA 2CPXA 1YIJS 1WHYA 2VOPA 3H2VE 2CJKA 5D77A 1VQ7S 1OIAA 1WWHA 2BZ2A 2XNQA 2F9DA 1KOHA 1U1OA 2KH9A 3G6ES 2M9KA 3R1LA 1X5TA 1YI2S 2J8AA 3CC7S 1HD1A 2MKKA 1M5OC 4IOCQ 2E44A 1M5KC 1U6FA 1DHMA 2DGXA 1UAWA 3CUNA 2DNQA 3BEGB 3SMZA 4PRFA 4C7QA 2RUGA 2GO9A 3R1HA 2DNRA 3S01A 2N82B 2DGOA 3VAFA 5HL7Q 3BO4A 2MQNA 3VALA 2MQMA 2L41A 1VQ5S 1R8HA 2DK2A 4CIOA 2AD9A 1WEYA 3RW7A 1X5SA 1X4EA 3CCLS 2F3JA 3FEYB 3SXLA 1P1TA 1SJ3P 2CQ4A 1F9FA 1AUDA 2D9PA 2KVIA 1SJRA 1U1LA 3UWTA 5H1SV 2I38A 3P6YC 2M8HA 2OSQA 1WHWA 2ZJRQ 2MSTA 3G71S 1X5PA 2HZCA 1FJ7A 1RK8A 1QM9A 2N7CA 1VQLS 4IOAQ 5CYJA 2MZJA 2KG1A 3BO2A 2LQ5A 2LEAA 1KC8T 2KYXA 2M4MA 2DB1A 2CQ1A 3CD6S 3MURP 1ZH5A 2ADCA 4J5OA 2SXLA 2XB2D 2CQCA 3Q2TC 1X4GA 1Q82T 1Q7YT 2AYBA 1JMTA 1SJQA 3MUMP 2YH0A 4FXWA 1K73T 1YTYA 1FNXH 2CQIA 1D8ZA 1H2TZ 2OTJS 2LMIA 2LXIA 5ITHA 1W2BR 1KQSR 3U1MA 2MHNA 3NS6A 2G0CA 2RS2A 2DH9A 2LECA 3UD4P 3UE2A 4TU8A 2CQPA 2CQ2A 5DDPC 2N3LA 2MZ1A 1K8AT 4Y00A 1HL6A 3EGZA 2MXYA 1IQTA 2I2YA 4QQBA 2MGZA 3VAJA 2DNNA 2LKZA 2DH8A 2G4BA 3DXBA 2YTCA 2CPJA 3CULA 3CCJS 3MUVP 3THPA 2LA4A 3HHNB 1H2UX 2J76E 2K8GA 3ZZYA 4QPTA 1FO1A 4YOEA 2HGLA 2DNYA 4PKDB 3MI7X 2CPHA 4F26A 5LJ3Y 1OPIA 4WFAQ 5MLCV 4W92B 4F02A 1M90T 2KRRA 2XS2A 2FC8A 2M8DB 2VODA 1WF0A 3NNAA 1YITS 1UP1A 1U1QA 2G1DA 3JB9k 1VQ6S 3N9UC 2N3OA 3RW6A 2DGTA 2MYFA 5LSLA 2QA4S 3BS9A 2J0QD 3VF0B 1KOOA 2CQGA 2OSRA 2KG0A 1X4DA 1JJHA 3OW2R 4W90B 1L3KA 3ZZZA 1Q86T 3CCVS 2NLWA 2MZSA 3CC2S 5DM6Q 3B4MA 2HYIB 5EN1A 1WELA 4TLQA 1X4FA 2DNOA 2E5HA 3IRWP 4V19X 2CQ3A 3UD3P 3CC4S 4IO9Q
chains in the Genus database with same CATH superfamily
4Z7CA 2CA9A 3GU0A 1NK9A 3MOJB 5DQHA 4Y3CA 1RHQB 2MZQA 3GTYX 4EFAC 1T3OA 3TA1A 2P9EA 1FJGF 3VHQA 2BOPA 4DFPA 2HHVA 3VAMA 1D9AA 1U1PA 3GSIA 4H4MA 3SEOA 5IM0A 5KFCA 4K4VA 4KKOB 2NXUA 2O67A 2W8KA 3WQPA 4OZJA 5M2RA 3W60A 1K47A 4QR2A 2ERRA 2AYGA 1IR0A 3PEJA 4EMDA 4IG0A 4FYDA 3IBFB 4J9UE 1S1UA 2G0JA 2V50A 3V6DB 1D8YA 3D66A 4YY3F 2AW0A 2HGMA 3M1VB 1JB0C 1IKVA 2H4WB 2K2PA 3ZTSA 5L39A 3NS5A 1AUSL 2YX1A 1JK9B 4Y28C 2V5HG 2B5JA 5I4MA 3R5CA 2VPYB 4ZPCA 4KHRA 3I56S 2FZGB 4JI0F 3KJNB 3TRGA 2VFTA 4USMA 2WONB 4F4WA 1OYDA 2CPEA 1S99A 5KFWA 5ETNA 5KAKA 3JQKA 2YWKA 1UA1A 3DRYA 4Z2XA 4G1PA 2PFDA 3JTNA 3TANA 4DFKA 4B3RJ 3O6QA 1EQMA 3HM9A 1HNVB 2EG2A 4QWAA 4WCEQ 5LSRA 1VK3A 1T95A 4UQTA 3BGRB 3NCPA 1RTHA 2B4UA 2HAIA 3D3CJ 1K1QA 5HSPA 2UUAF 5DRKA 1WKKA 1CS4A 2FUG9 2DHGA 1XNRJ 1YDLA 4YR2A 1NJWA 2O3DA 4CLLA 4KJIA 1TL7A 4ZCMA 3EICA 3Q23A 1ACMB 3L09A 3FUYA 1S1VA 1B0VA 1JKHB 4RBTA 3DM2A 2DH7A 4ED4A 2ZUAA 1EX8A 4DHVA 2VONA 2PN6A 2DHXA 3WDOA 4AXJA 2DR8A 3CF5Q 3D4JA 3M32B 4U7UD 2Y3YA 2DNKA 5E33A 5KFUA 1AW0A 1QJHA 1H0HB 4DFMA 5CXTA 1S72S 3OTOJ 2AF6A 4PWDB 1QTNB 4FYVB 3KLFA 1FWLA 2LEBA 5I3UB 2H5JB 2DVIA 2GGPB 4PG6A 1BWEA 4X4OA 4ZJQA 3DRRB 1PAEX 4NLTA 4ILMA 1WC4A 3AODA 1DQ9A 3PJWA 5BXIA 3J80Y 4JV0A 4KGZB 2KFZA 4JI7F 3MPVA 3BREA 3BDPA 3NMAA 4NLXA 2JLEA 3MAHA 4DJBA 5C24B 1KSPA 2LQBA 3BEGB 4NMLA 1TKTA 4DX8H 4CIOA 3I87A 3OPKA 2HIQA 3U02A 2BABA 2D9PA 1EIYB 2ZDOA 4CDIA 2BE9B 7AT1B 2C3PA 2HS0A 3DN9A 3OFFA 3M30A 2LQ9A 1HNIB 4WU2A 1RHMB 1VQLS 4C11B 4ZPWR 3QRPA 2YKQA 3DMJB 1D09B 2CQ1A 4GC7A 1HQEB 3EE3A 2SXLA 2VPWB 2I9SA 4DV5J 4CLTA 1SJQA 1U48A 2CKWA 2RS2A 1JXEA 2F4VF 4DV3F 4KT0C 1WKLA 2G9OA 2EFQA 4PPDA 4XDDA 4I7FB 2HVDA 4NA3A 3W2WA 1NJXA 1KS2A 2PMHA 3QFWA 1SKWA 3T5KA 1SQGA 3RW6A 3QPIA 3KLIB 2HFUA 2HYIB 5HMXA 1VI7A 1Z2ZA 4IR9A 1RT7B 3J7A1 4P7VA 1N52B 2YKAA 1FNOA 2M2BA 3HVTB 2N4CA 4ED3A 2I8EA 2K3KA 3DGPB 2J7WA 4O3SA 1WACA 4QU6A 1GXLA 2DBBA 4LREA 3MD3A 1FXRA 3OVAA 5ADZA 1R6YA 1HFEL 3MM7A 1ZPVA 5CA5A 2FLPA 1GTEA 4NLRA 3LTOA 2D7SA 2BE2A 2JEJA 4NLUA 3IGVA 5HVFA 3S8SA 4ZA1A 2KDOA 3C6TA 4DV7F 5D0HA 5DDOC 4EUVA 2EG1A 1WF2A 1NB7A 1HA1A 2V8VA 3PFEA 4RW4B 4PG8A 2D3O1 3NY0A 2E9TA 4ZITA 2GVDB 2RDJA 3U1LA 1KLMA 4C8OA 2EXUA 1BGXT 3RR8A 4WK3A 2PC6A 3V6HA 1VS3A 3BF4A 2ZBPA 4LF4J 4X65J 1QY7A 4ZLPA 3UFCX 3N28A 1U02A 5HBMA 4ZIVA 5B08A 5AE3A 3Q24A 2AX1A 1N33J 4X4SA 2B8QA 4KGVB 3LAMA 4DV6F 3P5BP 1RT4B 1GK8A 3AD8C 4GMKA 2DR6A 3CNQP 2RF2A 4ENOA 2OJ3A 3OD2A 1FKPA 2VDHA 3QATA 2RB7A 2DNZA 3DLEB 1UWBA 3OLBA 1LNQA 1VRQC 4HI2A 1SC3B 3K5PA 5KT7A 8RUCA 1CULA 3G82B 1A0OB 2HLUA 3PHEA 4Q0BA 1FF2A 3OHBA 2WTFA 2WCXA 1RAEB 4JP8A 3KK1B 1UVLA 3KK2A 2JHEA 5DDRC 3IWXA 1F3VA 1V5VA 4FPIA 2LP4A 4AE5A 2AJFE 5A6PA 4ZCKA 1VLOA 1U1KA 3MM5A 4DR6F 4L72B 5EWEA 3C8YA 4C0OC 2VPXB 5GAHU 2MSSA 2FHJA 2GVZA 3KKFA 4B3MJ 1HMVA 3IAM9 2APOA 1SIWB 4GKKF 1Q5YA 5KT3A 4ICLB 2RHQB 2XY6A 4Q8FA 1JLFB 2V4QA 2H54B 4PWUA 4NWBA 4WFXA 4EZ9A 1H72C 3QIDA 2BE7D 2CRLA 4UY8T 4C0BA 2XS7A 3CD0A 2GFFA 2J9DA 3NGUA 1HNXF 2DO0A 1EJ7L 1P1LA 2ZH5A 2QLFB 3IG1A 1GXTA 1E6VA 1TK0A 4K4WA 1G2EA 4G1QA 4WIQA 5LXYA 4M8LA 4NZ7A 2RKIA 3Q8VA 5C25A 1U0HB 5F8JA 4GVBA 4OJ3A 2I1RA 2KB2A 1V3SA 1ZPWX 3OJSA 5D4PA 3OFEA 2C2DA 3TUZC 4PG4A 1FKOA 2VOPA 1RB0A 5D77A 4X4VA 2CNLB 1U1OA 1QUPA 2RE1A 4JI8J 2J8AA 1M5OC 3CSKA 4U7UK 1M5KC 3T1YJ 2E1AA 2HAFA 1UJ4A 3HVAA 3S01A 2N82B 3GMGA 3A4TA 4Y2CA 2MQMA 3M8ZA 1R8HA 4B9MA 5HQLA 1X4EA 3UVJB 3RB4A 1F9FA 1OJ4A 3MEGB 1AUDA 4Z37A 4FXDA 2XYGB 5HROA 4F4ZA 4O44B 5CCMA 1RT3A 4DPYA 3KDNA 1P6TA 2I38A 3H42A 3PX6A 1S9GB 3PRBA 2HVEA 3PW2A 5F9NA 4KE5A 4FZVA 1CJVB 2MZJA 4AUKA 2ZE2A 5HN0A 4ZS6A 2KJWA 2IC3B 3THVA 1AB8A 1IVZA 3F41A 2X3DA 1Y5NB 1TL3A 1TL4A 2GAHC 2XB2D 1LFPA 3NS7B 1OSCA 4DG1A 2F63A 3ICLA 5HP1B 4ZLJA 2R42A 1GQEA 2R7RA 4PABA 4DR2F 1Y00A 3NS6A 5KFZA 1HI8A 2N3LA 4HEA9 4Y00A 3DDNA 4CTAA 1RTIA 1N5SA 1YX2A 1Q95G 3K2YA 2FVSA 2UUBF 1H2UX 4DUZJ 2V4JA 4NA1A 1G3OA 3P8BB 2BM0A 4LSZB 4WE1A 5MLCV 2QLBB 3GR0A 3BBCA 2YWGA 3KHLA 1SCJB 2L9NA 3OT9A 3JB9k 4YR0A 1U09A 4F2RA 2VFSA 4N41A 4XO0A 3MM8A 1RA7A 2DNOA 4OZ3A 3GLJA 2CJXB 2WRMA 2B51A 2OELA 1H2VZ 1HYSB 2V4RA 1YZ7A 2XLKA 3KHHA 4I68A 3OTBA 2RU9A 4OL8A 2UV8G 2A1BA 1AFIA 3D6MB 3MDFA 4RW8B 5B0GA 2BMBA 2DNLA 4Q8EA 2DEJA 3D9BA 5KFVA 2DD8S 3NGSA 2AJ0A 2EWHA 4MK9A 3VAHA 2D9OA 5GAEU 4K0KF 1MU2B 2P2CB 4Y2IA 2AJQA 5GMDA 4LVOP 4DI6A 2AEJA 3SDEA 4EGLA 4FKXA 4IOBA 4ZPBA 2A18A 2ZZTA 1GX5A 3AOCA 2ZUGA 1DRZA 1SPBP 2YBVA 3LP1A 3HI9A 3CJKA 3MM6A 4A8FA 3LP0A 4RUAA 2XMWA 1UPPA 1NRKA 4HL9A 3J7AN 2D3ZA 2BANB 1CC7A 5AJ3J 4C3MA 2NSBA 4C8ZA 4C8YA 1U2FA 1UCNA 3E3XA 3LF0A 1RADB 2R8HA 1N88A 2CPYA 2QGFB 3H8YA 1YG0A 1A6LA 4PQUA 1KWMA 3VVUA 4TU7A 2D41A 4DV2F 2CDQA 2V69A 2V67A 3I0RA 2DO4A 3EDRB 4JI3J 1TAUA 1M5HA 3LP2B 2N4DA 4MMOA 4NCAA 4GRSA 4NE9C 2HEKA 4IQMA 1BQNB 1SH0A 1EAYC 2GMLA 3H5XA 1YSJA 3LQVA 1ZA2B 4ZKAA 4QCLA 3AXMA 1I94F 3HFVA 1FJGJ 1WF1A 4OV6A 3QO9B 1N4LA 4B9NA 2ZH9A 1U6BA 4ZVOB 3FBFA 2FHKA 1TK8A 2MJUA 2B0GA 3PO5A 3ETMA 1FXLA 1VBZA 3ULHA 4CM2A 2UV8A 1ZYQA 2ZJQQ 1WHYA 5A8KB 2ZEJA 3M2UB 3BKFA 1DQ8A 3HXMA 4H4KC 4ELVA 4IKAA 1NM2A 3LUYA 1YK9A 4AQYF 1RTDA 5DG9A 3BR9A 1RUSA 1B64A 2DNQA 4I64A 4DSEA 1JLQA 4MFBB 2QN6B 2LFVA 3R1HA 5KT6A 3E01B 4DPUA 1WDDA 2B4VA 4M5GA 5IXUA 3VAFA 1RQ0A 1VQ5S 1EP4A 5J2MA 2VBYA 2PI4A 4MT1A 1NPPA 1N0VC 1UKUA 1S1TA 2KVIA 4O0IA 1SJRA 2ZBRA 4QWDA 1PBAA 3NWGA 5E2QA 1RCXB 3I0SB 4F36A 4DL3A 4KR0B 3DKDA 3KJVA 3UPFA 3CD6S 2CDRB 3MECB 2HKEA 4EK2A 5J2PB 2QL7B 1BUXA 1EKRA 5A0YB 3DLKB 2FJWA 4XPEA 2CQIA 5K8MA 5ITHA 3M8PA 2RILA 2IVFB 4DZ6A 1E6YA 2C3YA 1R8BA 4LRFA 2MTLA 2UUAJ 4B3SJ 1KLNA 4NCGB 3R7NB 2J76E 1W25A 2K8GA 1FO1A 4V1Ak 4LRDA 3OFHA 3QIPA 3GIJA 3PR5B 3GCXP 5ETMA 4RNMA 4KGKA 4M5DA 3DYAA 2ZITA 2B6AA 3HJVA 4RW6A 4LF9F 3VF0B 1SUQB 1TZ0A 1HWIA 4NXMF 5I42B 5E3CA 2GQ2A 3ZZZA 1DTTA 4PXBA 1S9EA 1HWJA 1CSJA 4V19X 2DKOB 1L3VA 4IO9Q 3AOBA 2B7BB 2HHTA 1QE1A 2XS5A 5D0RA 3FEXB 1Q8BA 2R7OA 3N01A 5AT1B 1BLUA 3C14A 4IR1A 2VHGA 4K4ZA 2FTRA 4A48A 2WOMB 2NREA 1PGZA 4FF4A 1RWUA 3C3LA 3GWCA 1LFWA 4P6QA 4GKJF 4OJHA 4JI7J 3HHLA 3GG1A 1HBUA 1IKWA 4B3OA 4ZJOA 2GQQA 4USKA 1ZZFA 2MKYA 1ROFA 2V63A 2V8DA 3CCTA 2QV6A 3Q2SC 1RT2A 2U2FA 2B9WA 2M70A 1UPMB 1OS5A 2ROPA 1VC6A 2KXHA 2GZOA 3MFIA 2QYCA 4KV8A 2XM3A 3RZAA 1TL5A 4ECRA 4KFBA 4JUZA 1IKXA 1S6QA 1DLOB 2QMUB 3BSCA 1CJUA 3OTCA 2XYPB 2ZJPQ 1YWXA 3H25A 4J9PA 3MF5A 2I6WA 3NRBA 2AZ3A 2IMOA 4ZK7M 2MGZB 4ES3A 2P9GA 2YKOA 2JFKA 4LFCJ 2F4VJ 5K14B 1CC8A 3TX8A 3H40A 4NEZA 5E3QA 1Q78A 1SIZA 1GAOA 3GE9A 1F60B 3P5TL 4IO1A 4QU7A 4ZCLA 2H5IB 1TMJA 1GFWB 1FA0A 2E5JA 2W4CA 1LWCB 1PJ5A 1M0SA 2U1AA 2XYHB 1FK9A 4OYXA 3L7PA 4FYYB 2V68A 3CD5A 5IQQA 4TLRA 2NXEA 1VBXA 2EI5A 3OTEA 2E5LJ 2IM2A 1FJEB 2DCUB 2LYVA 4RO0A 1SQEA 6AT1B 4ERDA 5KG5A 2K7JA 1RWOB 1UW4A 2ZD1B 1V5IB 3G8QA 3IO1A 5D3GA 3JYTA 5A8WB 3A8KA 2HZVA 1FT8A 4TXSA 3HSJA 2ZWOA 1FWPA 1VYAA 3DRPA 2DT9A 5CZVA 5H9FJ 2VC0A 4YB1P 2CPFA 3T41A 1LXNA 2RRNA 4DV7J 5DO2A 9RUBA 3EUNA 2VG6B 1RU2A 4W4MA 2FZCB 2FQQB 3BV8A 3AOAA 4ECTA 1R89A 2BW7A 5ETOA 5CCLA 1HNZJ 4ES1A 1T8EA 3HF5A 3V4IA 3OUYB 3Q8SB 3PNIA 2DXFA 2VJVA 4K59A 3TOQA 3E2EA 3AB2B 2VG5A 2F3JA 4L75A 2XMVA 4F50A 3HULA 1GMWD 4WP8A 3A1YG 3K5LA 3W9HA 1RDRA 3BGFA 3SSSA 1FE4A 1X0PA 2ACMA 1RAOA 4U96A 3PVXA 1T02A 2N7CA 3A3PB 2B56A 5J2NB 1SL2A 1LK7A 2VG7B 1FRXA 2DB1A 1JNRB 4DF8A 2Y8YA 4CO2A 5KFEA 5CD4A 2VQFF 4KHPF 5CZXA 1FDAA 3Q8PB 2WVCA 5C42B 4DCPB 5J2QA 4DCOB 4F3MA 3GJQB 4A4JA 4UQGA 3PX0A 2MZ1A 1YRXA 2V9KA 1NKCA 3VAJA 4DR3J 4IYQA 2J6TA 4OYIA 2G1HA 3L95X 1XBWA 2CPJA 2VFUA 1Z2LA 3OVSA 1S6OA 1UJ6A 3HZGA 5LJ3Y 4A8QA 5LMUJ 1OPIA 4GKKJ 4OHVA 1QD1A 4W92B 4P52A 2M8DB 1H98A 4ZVSB 2MYFA 2J0QD 4LSLB 4P2MA 2HNDA 4QWEA 3OW2R 2DHHA 1IWAA 3SSQA 1HNXJ 3FSXA 4EYIB 1HQUA 1R8AA 4F4KA 3C66A 2WZ1A 5DLGA 5IC4B 2YWFA 3BPSP 4N77A 5HQ8A 3EPGA 4RR5A 2B8PA 3DOLA 2NS1B 1N32J 3MAAB 2K1RB 1R7IA 3K57A 2DTJA 2VPZB 2NZCA 4M5NA 2C28A 3KYLA 2X1FA 4M63A 2PO4A 3AY0A 3P45B 3GIRA 2FGOA 5E3RA 2UXBF 4ZP7A 4HT5A 1T9XA 2IM1A 1ZAXA 2AQ4A 3ISZA 4ETXA 2CNKB 2KHCA 3PIPQ 4KAIA 4JB8B 3BPDA 2OAUA 5HLFB 2OPSA 3K17A 2IAJB 2XSJA 3I5CA 4NEYA 2KT5A 2EK6A 4DV0F 3HPOA 2WW4A 2KRBA 3NGRA 3BYPA 1V3RA 1G6BA 5BYRA 4I2QB 2YKPA 4OI0A 2XO7A 4YB5A 3DHXA 3NNHA 3Q8RB 4DR2J 1NLKL 2NYIA 2DNGA 3KJFB 3BZQA 4RNHA 4WFBQ 3D2WA 5B7WA 1Q8IA 3G86A 1PYOB 3JXOA 3MUTP 1RAHB 3PEHA 3H98A 3LALA 3LWMA 3BKTA 2UZAA 2RVJA 2PA8D 2V9WA 1XNQJ 3GFXA 2V2QA 4ED0A 4RBUA 3WIVA 1N54B 4RW9B 1FX4A 3D6HB 1JLGB 2IPOB 4MIAA 1Y4ZB 1YJTA 3POTA 2UUCJ 3M8YA 2AKWB 1FX2A 1SVDA 4I2PA 2ZHAA 4P75A 4ZP9A 3IGNA 2HHUA 5D15A 1HIYA 2J9EA 3FCWA 1ZAVA 6FDRA 3ZZ0A 3DLBA 4Y2AA 1TKXA 3TYTA 2H9ZA 2ADBA 1D9DA 2EFPA 4NLSA 3ET6A 2BDPA 1VRTB 1A7GE 1YBUA 1R31A 1PBUA 1NK5A 2Z0GA 1H74A 2BEFA 3QAUA 2JWNA 4HLBA 3R6GB 2RD5C 2VOOA 1C0TB 5FJ4A 1FD2A 4PZVA 2X1GA 1EHWA 3H4BA 1NCLA 4PXDA 2EEYA 5ETKA 3OR2B 1CG2A 5L46A 2HS4A 2QA2A 2YQ1A 3K5NA 4C4WA 2KKHA 2V34A 3FNNA 2UVUA 2HNYA 3M6VA 2B43A 4LF7F 5HANA 3ISND 3R3TA 3CCZA 2UUTA 3QGIA 2W9CA 1U6FA 4F0MA 3KMSA 4JV2A 2H4YB 4IG3A 5HJYA 3KK3B 3KG0A 2DNRA 3UNGC 3H5UA 1K1SA 2L41A 2E1PA 1FI4A 1J5OB 3PW5A 1X5SA 4BC9A 4X66F 4U9RA 1RYRA 2Y0SD 4OX9F 1U1LA 3KJQB 1OMSA 5CYQB 1WHWA 2Z30B 2G13A 1RK8A 4X4PA 1PC5A 3ONQA 2R7SA 2M4MA 2D1CA 2CVEA 1Q7YT 1Y7PA 1X7VA 3A8JA 3N5BA 4HH1A 2CJ9A 3QJJA 2GIFA 4YHHF 3TUPA 4LF5F 2FD2A 2I2YA 2CJAA 4M94A 4M95A 5KFMA 3CCJS 2VB6A 3MUVP 3EXYA 2W4PA 4QPTA 1U45A 4MH8A 4CNYA 3QAEA 4UOHA 1FRKA 3MI7X 2CPHA 2UU9J 5F8GA 2XS2A 4KIAA 4DX5A 3EMTA 1KBRA 1VQ6S 2GJFA 2DGTA 3SIPB 3R5BA 5LSLA 4OX6A 3K89A 2CQGA 4ANEA 1B0PA 3PV8A 3H59A 3IRXA 4O4GB 3MEEA 1I94J 4NCBA 5EN1A 1WELA 5I3PA 3C16A 3ITHA 3LO3A 3NBPA 3P49B 3CC4S 2XWYA 3S1TA 4K8RA 2BW2A 3THTA 2CWKA 2UUWA 1XMQJ 2F9JA 4DR1F 3KOAA 3DOKB 2E9RX 4F04B 1LW2B 4MK8A 3UN5A 3FFIB 4CH7A 2W9AA 4J9QA 3KLEA 2AYEA 5DM7Q 3LPEA 4U95A 1IM4A 1LWEB 1YJWS 4J9OA 2N7YA 3CCMS 2XNRA 2E5GA 2MKHA 1C4CA 1NPRA 5LMNF 4JI1J 3JSYA 1WC6A 2CVIA 5KG7A 2QYGA 2E5IA 3MFHA 1CVJA 3M6UA 1WG4A 1NZAA 2BQUA 2KYZA 2KJVA 2YNIA 3G2XA 4AL5A 4WKYA 2CYYA 1MLAA 2WVFA 4LBPA 4LIWA 1NNDA 1SC6A 1U26A 5K8NA 5BR8F 3ZXWA 2HQ3A 2VICA 4UOCA 2MB0B 3MCOA 1KFSA 5JVHQ 3DI6B 4FF1A 3OR1A 2OH2A 2DXEA 1NK7A 2DRBA 3HDSA 4K4SA 1LOUA 2ZH6A 2OLWA 4RBVA 1X9SA 4TU9A 3NP5A 3MMAB 2CADA 1U8WA 2C2RA 2W2QP 4H4OA 2B3TB 4CQ1A 1SKRA 5CAAA 1DAXA 3ILOA 3D28A 4PUOB 4DZDA 2CUYA 1KQGB 1M5PC 4IFVA 2M88A 3FCHA 3HO1A 5K9FA 2AP6A 4F8RA 1DTQB 3FEZA 1S9FA 2ZM6J 1Q8KA 3EXCX 1O0PA 1RWPB 4X4NA 2MKJA 4LF9J 3GIKA 1C2PA 2NZ4A 1GNKA 4NXMJ 1FXDA 2DIVA 1TVRB 2YKMB 1IM6A 1UWAA 3DFEA 3O1LA 1REVA 5HJXA 4JI2F 1WHXA 5A6WA 1JJ4A 2J0XA 4ITSA 1NSPA 2EBGA 1LWXA 1VGYA 1FVQA 1AZSB 4K4UA 4A47A 1M1GA 3CCES 1IBKF 5LOQA 3M9MB 3TVKA 5GAGI 4DSJA 4EBDA 1ZZNA 3IWNC 5MAOA 4ZVRB 4LQ9A 1KVKA 1PC4A 2C2ZB 2GAGC 2ILYA 2Y9HA 4GKJJ 1VC5A 1D3WA 1H38A 3OBIA 3MPDA 4DV4F 5SUHA 5DQGA 4OHYA 4ZVPB 2L9WA 4OYPA 3R5GA 4TYBA 1FCAA 3EGNA 5KTQA 2AIRB 4PG5A 2VH7A 2B9EA 4U8YA 3H2VE 2NUHA 3GYGA 1OIAA 3BN4A 1J5EF 4DV1F 2D74B 4DU8A 1QUVA 4ZHRA 1SV5B 4J91A 2HHWA 1QAIA 2E1CA 1S6UA 3D0HE 1JLAB 3CD7A 1NK6A 3DLHA 4FNIA 1S0NA 2PMWA 3PR4A 2DK2A 2WVDA 3RAQA 2P9CA 1JLEA 1N56A 1Q8LA 4GVLA 4USUA 3SCJE 4RUCA 3MEKA 2W7PA 3V81B 2YNFB 1RBAA 3PM9A 2L3MA 1UZHA 3P6YC 1X5PA 2HZCA 2OPPA 2IFXA 3PW0A 2KG1A 2LQ5A 2LEAA 4ID5A 2ASLA 3GSDA 3MM9A 1RBLA 3QNWB 4K4XA 1CQNA 1HWLA 1C1CA 4OHZA 1SC4B 2BJ1A 1YTYA 1HPZB 5J1PA 4LSNB 3FRZA 2FZKB 3DRSB 4DX6A 4O3QA 2CQ2A 3IC1A 1MG7A 2KO1A 5GADI 2XMAA 2YNGA 1T03B 2DNNA 4P72A 3OL6A 4C8NA 3TJ9A 1DQAA 3NKYA 3KNAA 4YOEA 4FP9A 2HGLA 1BMQB 4ECYA 2F5GA 1CJTB 3QWUA 2EFGA 3MMBA 4WFAQ 2QC3A 4KRWA 4F02A 1M90T 4HACA 3DLGB 5CQGA 1T9YA 1J27A 4ECZA 1WF0A 3PTWA 1YITS 1RT6B 2NSCA 2N3OA 5E3PA 1CBKA 5DLFA 4USTA 4EI2A 1S6PA 5F8IA 3KLGA 1P8GA 2MHEA 4W90B 3K8WA 1J2VA 1WC5A 2MZSA 3W5YA 5HAOA 4Y65A 1DFDA 3D6TB 1P9YA 2PFFB 1F5BA 3QLHB 3MGJA 5HMYA 2Z58B 1N5VA 4U6PA 2E7XA 1OYEA 2A10A 4KYZA 5IFMA 3TAMB 4C97A 4P10A 3UDLA 2BQ3A 2JLGA 1EETB 5JVGQ 2HMIB 2JC0A 3OTDA 1T0TV 1EB0A 3OJUA 4HTJA 3H20A 2M52A 4O3PA 1GX6A 4B17A 2Z56B 4YR3A 1R8PA 3A3NB 2HHQA 4ZN1A 1GT8A 4YDDB 1W2IA 3CJ8A 4WYWA 2XY5A 3CJ2A 4M5KA 1YHQS 2VQEJ 1R8CA 1R43A 2FLOA 5GAHI 1S1XB 4ZPTR 3D5MA 4A8OA 1VQKS 1HBMB 5L1JA 1RT5B 4ZIWA 1HBOA 5D0EA 3CJQA 4DLEA 4MYTA 5KFFA 1VRUA 4FDFA 2XWXA 1URRA 1Q53A 2BKOA 2XULA 5F8LA 2OPRA 2VQFJ 3V6KA 1RLCL 2OP5A 4FNHA 4OYWA 4TY8A 5AXLA 2XMTA 3CJ3A 3F0NA 2W2OP 1BQMA 4PPZA 1VIOA 5AXKA 4DR5F 2FIUA 3EX7B 1UFWA 3AJDA 3Q86A 4ED8A 4BWMA 2VJUA 1OQ6A 4IDKA 5CYMA 1C4AA 2RQMA 4GO5X 2RDIA 1S1WA 2QMWA 3D1QA 3TZZA 4YUDA 2LXFA 2BX6A 5FD1A 2DNPA 1WC0A 2XBPA 4IRKA 1FDNA 3W2VA 3PW7A 4QIEA 3ZTOA 1R0AB 5DQIA 2O1PA 5J1NA 2YPZA 5SZTA 2R7VA 3GB0A 2DGWA 3VAIA 3DDIA 3X3UA 2JVOA 2QTWA 2YKNA 1QVFR 3VZIA 4A8SA 1N6QB 2G2OA 3MMCB 3FMWA 1RXOB 2QT7A 1FRLA 3MOZA 4FBUA 4WF9Q 1FFGB 3TA2A 4AYBD 1M5VC 1LWFB 5T41A 2DGQA 3M05A 3BN7A 5B09A 5D4NA 4DL5A 3JQMA 4DX7A 5E0OA 4RLEA 4NRUA 4URQU 4DFJA 1X4BA 4ZVTB 1Q79A 3M2RA 4LF8F 1LW0B 5L8RC 2CAJA 4PG7A 3UW1A 1NUEA 2UXBJ 3GIIA 4B08A 2IM0A 4A8XA 1Y9OA 2MPUA 3GPAA 2PEBA 3UQSA 4MK7A 2CJKA 2BZ2A 3C15A 2XNQA 1OQ3A 5JUMA 4CLFA 3RRKA 2M9KA 1YI2S 3RAMA 1RAJA 3MMJA 3I6PA 5IC6B 3HSDA 1YLXA 2JNJA 4KC5A 1TKZA 5HL7Q 1RT1A 3FEYB 1JLCB 4JI6F 4PYDA 1XWLA 2WB1D 2EC2A 3H0PA 1U4BA 3DC2A 4JI4J 1UVKA 2ZJRQ 2W7AA 4P7TA 1DURA 3DOMB 5CYJA 3ZZTA 2FY8A 4J5OA 3Q2TC 2H3EB 4NI2A 3T1AA 3FGVA 2AYBA 4ER8A 1TL1A 1PG5B 2IHR1 5HK4A 4A8YA 4QIWD 2FJVA 3NG8A 2ZC3A 3RBDA 2DH9A 4NX9A 1IKYB 2ABYA 3GP9A 2GC8A 4CYUA 2VA2A 1U24A 3GR1A 2CNNB 1UVIA 2HZAA 1GTHA 4QQBA 5KFQA 2R8JA 2YX4A 2LKZA 2G4BA 4IH7A 5J1EB 2VBZA 3HHNB 5GAEI 4YP3A 4C2MA 5RUBA 2KT3A 5A8RA 2IJRA 4ECQA 4P2FA 1N5YB 3VGVA 1YKWA 1UMJA 4KO0B 2QA4S 3BS9A 3JAMU 2HBQB 2DR7A 1KOOA 1MROA 2E29A 3MPUB 4J9LA 1PIEA 1MSWD 2JH3A 2ZOFA 2CQ3A 4MJKA 3IS9A 3ISNC 3C2PA 3MCSA 1NEEA 2KU7A 4CO4A 3VGSA 3TARA 3NOGA 3HFZB 1VC0A 4DL6A 4EYHB 1TUVA 4A46A 3DU6A 3QT6A 1TV6B 2YNHA 4LF2A 3M8QB 3T5JA 1S12A 3QGHA 2RT3A 2DNHA 4DSKA 3IBWA 2XZWA 3KLHA 2MQ8A 5IV4A 3D1OA 4L74A 3CPWR 3E51A 2W2NP 4USHA 1FNMA 3CDBA 1BD6A 1RJJA 3JTOA 3I4PA 2V8PA 4RU2A 1IR2A 4ALZA 2RRBA 3GZ7A 1S5ZA 3C19A 2WAQD 3QT7A 2KI2A 1RCOB 4OX9J 2W9BA 2QEXS 2IBOA 5KT2A 4AD6A 1VLYA 1WD6A 4B3RF 2FJBB 2P6TA 4RW7A 3QJPA 4IFYA 1HNWF 3P4UB 2OPQA 1C0UA 4WP9A 1Z1ZA 3TI0A 1L3TA 2KFNA 4ED2A 4ATNA 3HVRA 1L3SA 1JLBA 4EO6A 2GHVC 1WSVA 1VQ9S 4JV5F 1Q5VA 4KHMA 2KM8B 1HWKA 1OO0B 2AEFA 1HLWA 3FKBA 4Q45A 2F40A 4DBQA 2E66A 1RYSA 4K2JA 2MKCA 4OI4A 4QIGA 4ZCIA 1WEXA 2XMJA 2D3UA 4USVA 2CZ4A 3JSRA 4DQRA 1C1BB 5G0RA 2OEMA 4RUHA 1WG5A 1XIQA 1RU1A 1HKAA 1HBNA 4RU9A 5K5MA 4BC7A 5LXRA 3R9LA 2ZH3A 2ZZMA 4NXNJ 2Q6BA 3ADAC 1CJKB 2A3JA 1KR4A 5KFAA 3RB6A 3UNYA 4N76A 2YQ3A 1FRHA 4PWWA 3V6JA 3DLLQ 1S57A 2EK1A 3SQGA 2FHJD 2ASJA 4B02A 4QW9A 4DR1J 1SL0A 2FLNA 5EX3A 4CO5A 2XZTB 4K4YA 4YEAA 2JDJA 4DR7F 4H4MB 5L1LA 4FF3A 4X2BA 5HMZA 5IM0B 3OL8A 1PYSB 2OO4A 3H90A 4UZBA 3PKMA 2GV1A 2F8EX 3FVYA 3PO4A 4ZVQB 4Y0FA 3AT1B 2MY7A 3O3LA 3ZZOA 4ED5A 2GIQA 2B9XA 4AFFA 1UEUA 3HMJG 3IXQA 5LMNJ 2UP1A 5ETSA 1GMUA 2W4DA 4IG0B 1YIJS 1S1UB 2UVRA 4X62F 4X4TA 4NYPA 3SZ2A 1FVSA 4NLWA 4CNZA 2KH9A 2CJQA 1IKVB 2E44A 4DCJB 3N6LA 1K0TA 3L9ZA 1DHMA 5KFHA 1KQFB 3RUBL 2VFRA 2B5JB 3T1HJ 3RTVA 4XDCA 2AD9A 3PYGA 5BYSA 4F4XA 1P1TA 2CQ4A 2W7OA 1BC6A 4M5MA 4F3OA 2BJ7A 4LF1A 1ZA1B 4LBIA 2I5JA 1V6HA 2AT1B 2AJ1A 4QBUA 3BO2A 4IRCA 1L5UA 1YQHA 3MEDA 3GG0A 2ZKUA 1P9QC 2CQCA 4URGA 3FSIA 3M2VA 2BJ9A 2Z57B 2HPUA 1RTHB 2LXIA 2H48B 2FB0A 1N48A 2ZH7A 3HX9A 3EYZA 1CS4B 3JSBA 1OPZA 5KFYA 2RH3A 1TL7B 3MHYA 3ZC4A 3ZZYA 5CH7B 1RTJA 2B7CB 1JIHA 2QSWA 3CDWA 5D0GA 3OXLA 1S1VB 2X51A 5F3ZA 3DM2B 1SBRA 2ATLA 2QIFA 1UP1A 4R5PA 4CCHA 4CLWA 2X7IA 4Y34A 1IBKJ 1L3KA 4QIVA 1QSLA 3DHWC 3CCVS 5HVGA 4TLQA 2ZBIA 2Z2MA 3L7OA 1T7PA 5LL6d 4Z7YA 3KLFB 2D3OR 2Z2LA 1OWXA 4I6WA 1QTMA 4Y2KA 3BO3A 2MMYA 3S6EA 3EZOA 1F9EB 2HNZA 1QVGR 2F1FA 1VQ4S 5F0UA 3OV7A 2MQPA 3CMES 2HFZA 4U8VA 3PHTA 1IJEB 4OV1A 4MKVA 4N8NA 1J5EJ 4QZVB 5FDLA 4ECWA 4DV1J 4AT1B 3C6UA 1DZ5A 1TKTB 2VBXA 3N79A 5CABA 4TKTA 2HBZB 2PGCA 4ID8A 3TQ1A 1MWQA 5H9FK 2HFNA 1M1HA 4K7QA 4R8UA 1SJ4P 1KONA 5DG8A 5LSOA 2Y1JA 3M30B 3UI3A 5T7LA 2ZZNA 4IRDA 1S59A 2ZBCA 1RISA 2ZVSA 4A8KA 2RSQA 2Q43A 2OEKA 2Q6CA 1IBMJ 4LIRA 1FTCA 1PILA 3AD7C 2IMWP 3HD1A 3K5MA 3FCVA 4CLYA 2C2KB 5EX0A 5GVQA 1OY8A 2KM8C 2RJZA 4NLGA 2H5EA 2QA1A 3SSRA 4B9LA 4LFAF 2XSFA 5F9LA 2JEIA 1T05A 2CQDA 3P3DA 2OKQA 1WG1A 1LKZA 2LCWA 1ZETA 2PD1A 2VU5A 3W2WB 3B8HA 2BA9A 3WC0A 1X0FA 2FC9A 2QO3A 5KOWA 2JEGA 1B4SA 2YH1A 5F8MA 2FY1A 3CCRS 1K0VA 3T5LA 1RE1B 3PG9A 2RMLA 2WB4A 3SCLE 2QLXA 1QDUB 2ALYB 1R6VA 1EARA 1FTRA 1X9WA 1UJ5A 2BRLA 3GFYA 4X4UA 2PT0A 4OI6A 2FHOB 4BHQA 2BJ8A 2MY8A 2ZC4A 5DGBA 3MM7B 3V2UC 2XMMA 3PCOB 2BE2B 4QR0A 3W61A 2KXFA 2IJNA 2LA6A 2AGOA 2DNMA 3C6TB 4QWCA 3JSMA 4C9DA 2DGSA 5A2QU 2JJ4D 3I9ZA 1KLMB 1UW9A 4DDFA 2F7VA 1UETA 2BJDA 3TEHB 3G87A 4DUYF 4DSFA 4OMFG 3H5SA 3L4BC 4YQWA 1ZAWA 2CG4A 5HBMB 3R6LB 1XMBA 2IA0A 1VK8A 1FDDA 2GO9A 4ZVHA 2R7WA 2HSEB 3D54A 3LGHA 4KKOA 3W5XA 3TW0A 2XZDB 2XLJA 3BGLA 1SJ3P 2RF2B 2UXDF 1YBTA 2W25A 2DEIA 1FKPB 5H1SV 4OQJA 2QX0A 5AXNA 4F67A 2QRRA 2EKNA 1UWBB 3V6DA 1X8DA 4IOAQ 4ZPVR 1CULB 3M1VA 2K7KA 2KYXA 4DR5J 2AJ2A 1WOPA 1ZS6A 3GILA 1ZH5A 3JAMY 4FS2A 4Q0BB 1S7HA 1RWXB 3VQTA 1G4CA 4I67A 1NHVA 2K3IA 3KK2B 5KFIA 2V0NA 1TKDA 3I82A 4EWTA 1O6XA 3MM5B 3UE2A 3QGPA 2WONA 4IH6A 1UFLA 1NJYA 1AA1B 2QMXA 2GVZB 4DL2A 1HMVB 3X1LB 3DXBA 5KFSA 1XR7A 1UEVA 4TYAA 4HKQA 4LF6J 4PKDB 1TQLA 1HHTP 1HNVA 3KHGA 3AJ1A 5H9EJ 4RNFA 1NZ8A 1YRTA 3BGRA 3GONA 4DSLA 1YBAA 1RAAB 2AU0A 1BQXA 2ZH2A 2POKA 1V9OA 2NLWA 3CC2S 3IG1B 1ZM4A 1RHJB 2DYAA 2R2TA 3RB0A 2FJEB 4UUWA 1FEEA 5FLXU 1RTZA 4G1QB 4ZOSA 1RWKB 2RKIB 4ZN3A 5C25B 4HH0A 4Y6IA 4BS2A 3VWSA 2R7XA 3E8OA 4X4QA 3A8IA 1JKHA 4GVBB 2DITA 4WXOA 2MKIA 1FKOB 1YVFA 3NCRA 1XMOF 4I1TA 4YB6A 3GV8B 1FDBA 5KG3A 1Q7LB 7FD1A 1RSCA 4UZCA 1OY6A 3D7SB 2GJIA 3M32A 2H51B 2OD4A 4J9VA 4I0WA 4TQRA 3U7JA 4P9SA 4PWDA 4J37A 2GQCA 1VQMS 5HROB 3HHLD 4Q2LA 1RT3B 2BJ3A 5I3UA 1GXUA 4J9NA 4JI6J 4S0MA 5U47A 2GGPA 3BSAA 2AGQA 2MQLA 4WZQA 3DRRA 2QA4G 1SJFA 2ZE2B 2IA6A 4OLOA 1FD8A 2DHSA 4I6AA 1TL3B 1F5AA 1S49A 5C24A 2NUUG 4DG1B 3VZHA 2XLIA 1BHNA 4LRAA 1NBEB 3RJMB 4EBCA 1VQ8S 3TAPA 3CCUS 3G9CA 3CO0P 4O3NA 1HQ2A 4CTAB 4HTIA 1RTIB 1S0MA 1HNIA 2J0WA 1XK8A 2C2MB 5GMEA 2V4JB 2AV5A 2VZ9A 5KFLA 4DL0C 4YY3J 4C11A 3DMJA 5IQ6A 4WE1B 1HQEA 3NXZA 2DPIA 1H6KX 1RKJA 2YWWA 4EU0A 5AXMA 1JXLA 1W7WA 4OZ5A 1NK8A 1B3TA 5D4LA 2C22A 2AJ4A 4EEYA 3MM8B 4F25A 2PEHA 2IBKA 3CVKA 4JI0J 4X64F 4K5RA 2WK4A 3EDQB 3EVWA 4WBFA 4I69A 2L9DA 2HVHA 4I7FA 5IWAF 3LANA 3LWLA 5ETTA 1NXIA 2ZDPA 5L1KA 1B7YB 2DY1A 4OI3A 3RBZA 2JVRA 1SQFA 4Q7AA 1SKSA 1NSQA 1MNEA 3KLIA 2HBRB 2HVZA 1I5OB 1KD1T 1Y3KA 4CH1A 1RBOB 2GS8A 2V2KA 1S0VA 1P27B 1U49A 1RT7A 1RA6A 3F56A 1TFYA 4DUTA 3HVTA 5LT5A 2QFJA 1U0SA 2WVBA 2ROGA 3J7YU 4ECUA 1LEOA 3DGPA 3CJ4A 3SDEB 4WXWA 1VJWA 1WNEA 2Z2YB 3NEKA 4OZ2A 4DR4F 4NLQA 1KTVA 3TX0A 3LP1B 3AXKA 1FE0A 3AHPA 3CJKB 2CXEA 3MM6B 1X5TA 1HD1A 4RPFA 5THWA 3J81j 4UT4A 1SJ1A 4X4RA 4PRFA 2G2ZA 4PEOA 2J8SA 2NR0A 1HNWJ 3LP0B 2J7KA 1QAYA 3DCAA 3M4XA 4GO7X 4OYAA 2B9YA 2HW3A 4MTPA 4RW4A 4JV5J 1F2GA 3IMQJ 4B3SF 2UVVA 2GVDA 1U25A 3G6VA 4ZP8A 3D0IE 2XQCA 2M8HA 1R27B 3HJFA 4UW2A 3QZ8A 5D8HB 4RL1A 3MWBA 1D1UA 4PQUB 4O4RA 2ADCA 2OHDA 1Z4UA 5IT0A 1X60A 1QAXA 3MUMP 1WC3A 1VQSA 4CM0A 3I0RB 4LUBA 2GO8A 2OTJS 1NDLA 1PCAA 3KG4A 1RT4A 2VDIA 1PYTA 1XERA 4XPCA 5DDPC 3M6XA 4OYBA 3AQOA 1HL6A 1PAUB 4OJ1A 2R8IA 2C42A 2BJEA 2HRTA 3R7SB 2DH8A 1B99A 2YTCA 3DLEA 4UF4A 2HLTA 5A76A 3Q22A 1UVJA 1NH7A 3G82A 4OIXA 2C2NA 3D68A 3B78A 1NKBA 2AGPA 1U2RA 4J90A 3GQCA 4O3OA 3RB3A 2VODA 3KK1A 3EVMA 3ETOA 5JJBA 3ZNUA 1O5JA 2JZ5A 1RAFB 1NPKA 3PACA 4F2SA 1JJHA 5ETQA 4OI1A 4DR7J 5KFTA 3PZPA 1X4FA 1N36F 4DV3J 4KB7A 2HVIA 3GYXB 4ICLA 3LA0A 1ZTTA 1JLFA 4CLUA 1UVMA 3T5HA 1WHVA 3BR8A 2HHPA 4WIIA 1WTBA 3G8TA 1YJRA 1VIXA 1RTDB 5GAGU 3QRRA 2RQCA 3N4WA 4X62J 3CCSS 1N34F 3PJXA 1JLQB 5ETVA 2ZKTA 5KFDA 3F73A 4LFBF 4RX6A 1EP4B 4CO0A 5J2MB 3EJMA 2IYIA 3CMQA 1FKAF 1F2HA 1G1XA 1XR5A 1U0HA 2GHWA 1NSKL 1S1TB 4LFCF 2QSFA 3I4HX 1BXNA 4FYWB 2DRAA 3BH7B 3EGWB 2R7QA 3M8WA 3LGMA 1XEZA 4NLYA 4R25A 1U1NA 4OZ0A 4H4KA 4FBTA 4P2SA 3CCWA 3KJVB 3DNCA 3CTRA 3I32A 3G96A 4L6V3 3UCZP 2HQIA 2EFVA 4UTGA 2FVPA 2YY3A 3KNGA 3M8PB 4DL4A 4B9TA 3CMAS 1RABB 2MQOA 1ITPA 3UVJA 2ZH8A 2J9CA 3MEGA 1E6YB 3Q0AA 2LDIA 2KVQE 4O44A 2KFYA 4R0EA 2IIHA 3T9NA 1RZMA 2E5LF 3US5A 3R8YA 1S9GA 4JBCA 2EVZA 2R2RA 1CJVA 1B0TA 3G6XA 2GNKA 2IC3A 4NRTA 3QIPB 2OMOA 3DLJA 1S97A 2KTQA 1RKIA 4M5DB 2XMUA 1KQKA 3DYAB 1EKSA 2B6AB 3BBFA 5HP1A 4RW6B 4I4BA 1TUGB 3AH6A 4F3QA 3S7RA 4A8MP 3L7UA 3IAS9 5A2QY 4DV6J 2LXUA 1ZM9A 1DTTB 2FDNA 5GADU 3TVYA 1S9EB 3D1HA 1VBYA 3TVZA 2HK3A 1NHKL 5L9XA 3JS9A 4MKYA 4L3NA 4I6YA 1QE1B 4G6VB 5HI7A 3C14B 2LU2A 4LR9A 2OUGA 4PCQA 1HNZF 3HHDA 2F8HA 2KXNB 4AL7A 3CDAA 1PKUA 3QWPA 3HHEA 4WFZA 2HQCA 3PYEA 4ANDA 4UOFA 3SBMA 4BLGA 4NOHA 3UN3A 3HHLB 4DR6J 3CGIA 1HBUB 1IKWB 2J0SD 4B3OB 1UFKA 2ZOGA 4HVZA 2WSCC 1QSYA 2ZWPA 1HYSA 2WHOA 3CW2C 1RHRB 3VAGA 3WHIA 2NQPA 5L9NA 1RT2B 2ZOMA 1NB2A 1YZ6A 3UR3C 5F8HA 3GFZA 4C48A 5HQMA 4NPOA 2CJBA 1U6ZA 4KV8B 2LLZA 4RW8A 4KFBB 1IKXB 4IOCQ 4DL7A 1S6QB 1UAWA 4IH5A 4JI5F 1CJUB 4F0HA 2C2OB 3BO4A 3BDEA 2PDAA 4KBIA 1U47A 2V6AA 2Z8QA 1MU2A 4DR3F 2XTJP 1VDHA 3W64A 3RGIA 4DS5A 3K8VA 2OSQA 1MMLA 3BYRA 3BKUA 4LFAJ 4M1KA 1MN9A 5LMUF 4FS1A 2FYXA 3BQ1A 2HQDA 1FRJA 2V8HA 3HHKA 3D67A 1YRUA 1JMTA 4RWXA 1K73T 1DARA 1D8ZA 1S0OA 1FK9B 3Q8YA 1W2BR 5FLXY 4RJVA 4H54A 2MHNA 2BANA 5JXSA 2GA7A 1IQZA 1SB6A 4CT9A 2F4FA 2RIJA 2VA3A 2ACYA 4DEZA 3EZ5A 1L3UA 1RAIB 3FK4A 5DG7A 4CZCA 4LRBA 3TJAA 4G65A 1N32F 2HHXA 1RWWB 5IZHA 2R2SA 3HD2A 2F8MA 4ED6A 1T3NA 2KRRA 1N5QA 3Q8UA 4RZRA 5D3GB 3JYTB 3KTQA 3BSNA 1M5SA 2RUSA 3M7VA 3U1NA 4C8KA 3LP2A 1Q86T 3TEGA 1JNZB 4DMZA 2OGUA 3DRPB 5HMWA 2Z4PA 4HDGA 3EPIA 4XAKA 1YGYA 1U8SA 4QYRA 1BQNA 3J7Z5 3MTKA 2UUBJ 2OMLA 4CT8A 1XR6A 2X1BA 3NGKA 2DY9A 3NCQA 2G2YA 2XCAA 3I9V9 2R9LA 1SI9A 1KTQA 2R8GA 2VL1A 4DUYJ 2O01C 3N0VA 2IVMA 3A3OB 3QO9A 3W9JA 4KH1B 4FF2A 3V4IB 3VGTA 2MKSA 2PI5A 2QFIA 3CJ5A 1BY9A 2DIUA 2FLLA 2VG5B 3SQOP 4LVNP 2OTLS 3HK2A 3HT0A 2FJXA 2GW8A 1X5OA 5I3QA 3TO8A 4DN0A 2HG4A 3ENAA 4C3KA 2UXDJ 5A8KA 3M2UA 1KFDA 3HCXA 1YJNS 3PIOQ 3B4DA 2W24A 5KT4A 1XC9A 2ZFHA 2QZ8A 2JX2A 2LQJA 1XNQF 2W01A 3WX8A 2EBEA 4A8WA 2YXLA 4MFBA 3UDEA 3E01A 5J2QB 4DPOA 3Q83A 1QLNA 2FPHX 5HATA 2UUCF 1RWMB 4DPTA 3HKZD 3AFGA 4QIFA 2HHSA 1K9MT 4K0KJ 2BV3A 4U7CA 3WX4A 2CPDA 3FBCA 3I0SA 2B4PA 4KPCA 2ZH1A 4KSEB 1XQIA 4LMZA 3JTPA 3MECA 1JJ2R 3HVWA 4G3IA 1VQNS 5J2PA 4YFUA 3IR6B 5A0YA 4BBYA 1CQMA 3DLKA 1SH3A 4NMXA 1SH2A 3OSNA 2HNDB 4QYZJ 4FN5A 2LQ8A 3T6JA 2HQGA 1HQUB 2HHHF 2RAQA 3GJTB 4OI2A 5E7OB 4C98A 1ZOTA 4NCGA 2HRYA 2LEPA 3W65A 2JEFA 3RAXA 1JQGA 3PJ9A 3DOLB 1AYEA 4WZMA 4ZDNA 4KTQA 2H1YA 3H5YA 2YX7A 1XMOJ 4DV2J 2NYHA 1SUQA 1X4HA 3RYLA 4HHHA 1ZM2A 2XGPA 4JYAF 4OFZA 2V94A 5I42A 4EBEA 2YQ0A 3HHLC 3MR6A 1WI8A 5D78A 3PYFA 3K5OA 2EFOA 2CQBA 3VAKA 2H65B 1SC1B 4OHXA 3FQKA 3MCMA 2M5YA 4F4AA 3L3CA 3LPYA 4WPAA 3UN2A 2OPSB 2XSJB 1LXJA 3OXFA 1WWHA 3HZEA 4W98A 4ZVGA 2WOMA 2GIRA 1KHVA 2O66A 3W1YC 4TQSA 5KFKA 2MKKA 1UVNA 2W1BA 4C3LA 2DGXA 3D3BJ 1TUWA 4DWIA 1WKJA 2AEMA 4YB7A 3VQSA 3KMQA 1WEYA 1DY3A 1TFWA 2HIYA 1NJZA 1MMDA 3BQ2A 2UVWA 3HP6A 4CRJA 2XGQA 1RP5A 1QSSA 4TNOA 3WIUA 1I1GA 2RHSB 4B3TF 4DQSA 3G71S 2ALZA 2VIHA 1TTHB 2UU9F 1UA0A 4ZLLA 3QBCA 1KC8T 3FZ2A 4F0KA 3AJ2A 4Y2MA 2V2ZA 4AQYJ 3LAKA 2ZBQA 2KZZA 1DLOA 5D6GA 4LR8A 1H73A 2GX8A 2UXCF 4ELUA 3WBZA 1B70B 3UD4P 3POTB 3QSYB 2BM1A 1K8AT 4I2PB 5IT9U 4WWSA 2DCLA 2MGZA 4RWWA 3I5AA 5K14A 3CDUA 4X64J 1XMQF 2IYGA 1TMMA 1Q0NA 1TKXB 1FRMA 2DNYA 4F26A 3RU0A 5F8NA 1HW9A 3ET6B 4MKAA 3KHRA 5E3AA 4LT6A 5IWAJ 2FC8A 1LWCA 4URSA 3R7BB 4ZVEA 1HI1A 2ASDA 1I51B 9ATCB 2OSRA 2KG0A 4WTYA 3ZO7A 4QPXA 1NKEA 4F4YA 3CWJA 2QL5B 3KUHA 4JI1F 4NLPA 3ENQA 3CCQS 2A6MA 4C0HA 4E2FB 3MD1A 4OYMA 4PR6A 2WBMA 1KN6A 4TY9A 2I0XA 1OSDA 2HNYB 3NOCA 2ASYA 4ZJLA 4BDPA 3A12A 2LU1A 1SL1A 2FHMA 3IR7B 5KFBA 2ZD1A 4CLZA 2E1MC 3FMBA 1R0BG 3R5DA 4DR4J 2FVRA 2W9CB 3SI8A 2MLZA 3RR7A 5A8WA 4B9UA 1VQPS 1PO6A 1JXVA 4IG3B 4Q43A 2R8KA 1AT1B 2J9DE 2IRXA 4NLVA 2J5AA 3TP2A 2J6SA 1HARA 3KDOA 3PKYA 3SFUA 2HWHA 2ZHBA 3ZFVA 4DXLA 3GCWP 3TR5A 3W8GA 2VG6A 4OX7A 3UDCA 3CIZA 4PXEA 1KP6A 5ETPA 3D6FB 3IM9A 1X31C 4ZPDA 2YVSA 3MTJA 2L08A 2Y1RI 3OUYA 2ZM6F 2VV5A 2HFSA 1VJQA 3FQLA 1LK5A 3TJ8A 3QYYA 5EUHA 3CJRA 4QW8A 4LR7A 2OD6A 1AXQA 4FKYA 4NZ0A 3UR0A 2KN4A 3M8SA 5BYQA 5J2NA 4DS4A 4ELTA 2E7WA 2VG7A 2V2VA 5KOXA 4K4TA 2JFDA 4WTOB 1NU4A 4HT7A 5C42A 3QFHA 3MPWA 5B0CA 3RRHA 1XN9A 2QG9B 3I55S 3IRXB 5KG6A 2VBWA 3FDSA 3MEEB 1KNZA 2GCFA 4NLOA 2R2UA 3C16B 3ITHB 3NNCA 4MAKA 3NBPB 5C2CA 4LQ3A 3EGVA 2J7UA 3F44A 2A6OA 1N36J 4OZ1A 3B82A 3FRYA 2EC0A 1RWNB 3ZZUA 3T9ZA 3SCKE 3KLVA 3KLEB 1NK0A 4LSLA 2MZRA 2RS8A 1LV5A 3G8SA 1S7IA 1Q4RA 1N34J 2CPZA 1A9NB 1HW8A 3BB5A 4LFBJ 4J9MA 2QLWA 2DGVA 2X3GA 2X1AA 2YNIB 2IY5B 3N6MA 5LM7E 4CP5A 3MAAA 1MW7A 2K1RA 1JX4A 4ANCA 1VISA 2P8IA 2Y8WA 4NYZA 3C46A 3CUNA 4NZ6A 2HRUA 1RHUB 4L76A 2MQNA 3OR1B 3HSGA 1NMEB 3SXLA 2DJWA 2IM3A 1IBLF 1Y5LB 2EW9A 1Y5IB 2AMCB 4M5JA 5HLFA 3ZTPA 2MSTA 2IAJA 1WJ9A 4H4OB 3RRGA 2D69A 3MR5A 4M5LA 1IXKA 2Q3PA 1RHKB 3NAIA 3DGVA 2Y1LB 3MURP 4DF4A 1NSAA 5B0FA 3AD9C 4IFVB 3BH6B 3UD5A 1MN7A 4FXWA 5IOLA 5DZ6A 1H2TZ 4I2QA 3NLCA 2C3MA 4TU8A 2P5VA 1TR0A 3Q8QB 2V8GA 1HHSA 1IQTA 4F7VA 3DRXA 4KY3A 1BWVA 4M5IA 4YDXA 1REVB 3FSYA 4WYLA 1IR1A 2EKYA 3I31A 3AAWB 4KHPJ 3NNAA 1W26A 3J81U 4RW9A 1KHWA 1F3FA 8ATCB 2OEJA 3BJYA 3I96A 4O3RA 1JLGA 3H2LA 1HI0P 1REGX 2OI2A 3B4MA 4USWA 2E5HA 3FJ2A 2B4OA 3UD3P 4ZPAA 2VQEF 1D9FA 2Q66A 1S48A 1N5TA 2JRSA 3AQPA 4N7TA 4P2XA 2IDLA 2HWTA 1VRTA 2XG8A 3VVTA 3HLUA 3ILIA 2PMZD 4EO8A 3PX4A 4ZHRB 2M0GB 5KG1A 4OLPA 1C0TA 2BVZA 1WEZA 3CT9A 5ETLA 5LJ5Y 2NXNA 4MIBA 2IVYA 3U27A 1EZZB 2F65A 4JI5J 1JLEB 2DR5A 4V19J 3OR2A 1Q1KA 2MJNA 3PW4A 4CH0S 4OHWA 2KZMA 5GMKa 3JQJA 1Y0HA 3GYNA 3EZUA 2OPPB 1GEHA 4PAAA 2LVWA 3V4MA 4ID5B 1MWYA 4LJMA 3W9IA 3UCGA 5JMNA 4ED7A 3R5JB 2COLA 1V3ZA 3MM9B 3KK3A 1PJ7A 1C1CB 3VTIA 3O8WA 2R7UA 3AA9A 5D4OA 1J5OA 1S79A 3CB4A 2JLFA 4DPXA 2FGCA 3IFEA 2R3VA 5KFPA 3G6YA 3TUJC 4QOTA 2YNGB 3TNVA 5CYQA 3MR2A 2EPIA 3W66A 4B9VA 5KFJA 3PDNA 3CJTA 3ENVA 3WC2A 1Y11A 3MMBB 4C8MA 4DV0J 3ILJA 3BQ0A 3CJSA 4HACB 4HR2A 4D3HA 1HR0F 5B0BA 3TUIC 3SV4A 4DSIA 2E1RA 1S6PB 1Y10A 3HFKA 1NO8A 2XI3A 4ES2A 3KLGB 2RRAA 3R27A 3MAQA 3FZBA 2GJ2A 2ATCB 3QJLA 5DDQC 5F0WA 2BXJA 1IBCB 3SYZA 2CQHA 1VQYA 4LBHA 2NXCA 4OYZA 2JL9A 5CHCB 1U2CA 4DOZA 2VD3A 5EGYA 1KDNA 2QL9B 3QGGA 1AROP 1VBKA 3R2DJ 4ECXA 2Q1LA 2W2MP 3CIMA 2HWIA 2BKPA 3OL7A 5H9EK 3M8RA 1T9VA 2RDDA 4FXVA 1Y3JA 2RQ4A 1F0XA 4O4GA 1EQ0A 3SV3A 1URNA 3QSIA 2XC9A 1H7WA 3DXSX 3W62A 1KRPA 1TP7A 3OXGA 1KVJA 5AE2A 2OFHX 2DXDA 3W63A 4ZVFA 3SFGA 4U67Q 2BBEA 4HHJA 1TU0B 2PE8A 4JI4F 1I3OB 2BUNA 3GJRB 3OFGA 2XY7A 4FVCA 1O8BA 3DOKA 1TAQA 1LW2A 2F9DA 1KOHA 3FFIA 4N56A 1HBOB 3N6NA 2RQKA 1RI7A 3ZZRA 3CC7S 4PXCA 1O51A 1ULRA 1VRUB 2C1EB 3QT8A 4C6AA 2RUGA 2OPRB 3I5BA 1LWEA 1S4EA 4N8OA 1GMWA 5IT9Y 2LDYA 2FJAB 3VALA 3B54A 4TY8B 2IJFA 4QR1A 3RW7A 3KFWX 4O23A 3TAQA 4CO3A 2JOQA 1BQMB 2R4FA 4BWJA 3UWTA 4CWBA 1T9TA 3BGUA 4IQXA 4LF7J 2QE5A 4IDKB 4XK8C 5CYMB 3K7RA 1VHFA 1FERA 1S1WB 3EVOA 3LGNA 5E41A 2CIMA 1ZTWA 3BM7A 2ZHOA 3DU5A 3DI6A 4WU3A 3W2VB 2LECA 1WOSA 4X66J 5KFNA 3AB4B 4ECVA 4RKUC 3MMAA 3KXDA 3THPA 2LA4A 2HHHJ 4KPYA 1VR6A 2VF3A 2YKNB 3O2IA 4ZVUB 2CJYB 4DLGA 4PUOA 3T19A 2GMHA 4TN2A 3GJSB 3AA8A 3N9UC 4L3KA 1DTQA 1KKHA 4UY85 1XTZA 1F6TA 1XNRF 5F3TA 4HDHA 4CLPA 3M2RB 4YHHJ 5DM6Q 5IV3A 4R0JA 3PY8A 4LF5J 4JYAJ 1UL3A 3IRWP 5DZ7A 3VR1A 1TVRA 2M3DA 2YKMA 3HSZA 3A8EA 2BQRA 3H2UB 4E98A 4MIWA 4P73A 1NHUA 3IWLA 1U7LA 2DGUA 1N0UA 2DR9A 3EWGA 5HO4A 3BSOA 2WSFC 1VHIA 4K50A 1AZSA 1CLFA 3C15B 3IR5B 2AX0A 1X4AA 3NGDA 3CDEA 2CFXA 2VUGA 3CE8A 4WFNQ 3W8PA 1WTFA 2NPIA 3OTOF 1TKZB 5M2PA 1FHTA 4IUFA 1TK5A 4UUXA 5L38A 1RT1B 5KT5A 1YJUA 4ZP6A 2OIHA 1IWGA 1T94A 4CI0B 1U1RA 3CO9A 1KEKA 5EWFA 2R7TA 1X4CA 2MEWA 3VGUA 1U1MA 1XJWB 3OL9A 4B3TJ 2CNOB 5KG0A 1SV5A 3FBBA 3IM8A 4NI2B 3TQEA 4ED1A 4AXIA 1TL1B 5L1IA 1JLAA 2FJDB 4NXNF 3MR7A 2L48A 4J9RA 2Y0BB 1R3NA 2HK2A 2MZTA 3LW5C 1SKUB 3TZWA 5F41A 4CYUB 1VCTA 1PJ6A 3P96A 3V81A 2UXCJ 4WJBA 2YNFA 4ILRA 4WK1A 2HQFA 2CZ9A 1FJCA 5K8PA 2QJ3A 3OHAA 1ELOA 2ZVIA 1RWVB 4PYAA 4DV5F 1NK4A 1Q81T 5A8RB 3J7YI 2BR0A 1FFWB 4D3GA 5AE1A 4CO1A 2AYMA 3FC9A 4USIA 3CXCR 4DQQA 4YN3B 1PSDA 5BR8J 5KG4A 1N8RT 4DU7A 1HPZA 1GH8A 1MROB 4LSNA 3DRSA 3BGOP 4DPWA 5B0EA 3GV5B 2YWEA 4Q2MA 4OZLA 2FVCA 3GV7B 4J7CA 2CPIA 3K0JA 1CEZA 1UTAA 4DN9A 4P71A 5IT4A 4MKBA 1T03A 3R97A 1VMBA 3PXGa 5KFOA 3IS9B 3OVBA 2XEXA 4ZMMA 2XMKA 1YJ9S 1CJTA 1WI6A 5HVHA 4DQPA 3DLGA 5BJRA 2YNHB 2PA3A 4J9KA 3VV2B 1NDKA 4OZNA 1RAGB 4NL5A 1RT6A 7FDRA 1YJVA 3KUEA 1T11A 4OYOA 2KHDA 3HT3A 2E7VA 3KLHB 5E5NA 5K20B 3ZNJ1 3T1HF 1HWUA 1DJ0A 1MWZA 4WP3A 3J7ZT 2J6UA 2DISA 2CG8A 3QLHA 3ENWA 2HBYB 3TZYA 4I56A 1HD0A 1AFJA 4KGMA 3KWMA 4JI2J 2W9BB 3TAMA 1T9UA 3CJ0A 2HFOA 3TWZA 4X84A 1FESA 3PYDA 1VQ7S 2ROEA 1R0CB 4QJVA 4RW7B 3WZ0A 3G6ES 5KFXA 4IFYB 2HS3A 3R1LA 1EETA 1KVIA 2HMIA 2OPQB 1C0UB 1UZDA 1VOMA 1JWWA 3OSPA 3SMZA 2OFGX 4C7QA 1JLBB 3M9OB 2DGOA 4CLSA 1F1BB 1ZBTA 5DGAA 2XI2A 1X9MA 4C8LA 4RNOA 1S10A 3OLAA 1JJCB 4DV4J 4LF4F 4G1IA 4X65F 3BBBA 1WSRA 1S1XA 5DS7A 1ICEB 1FJ7A 2QLJB 2A0FB 1HBMA 1QM9A 1GMVA 1NAQA 1RT5A 3RG6A 3J81Y 5G0RB 4EZ6A 3RBEA 4ILLA 1N33F 1X4GA 1S4FA 1HBNB 2EFNA 5FIIA 1WC1A 5KG2A 2C3OA 3J80U 1FNXH 2Y1IA 1KQSR 1TELA 6FD1A 3A13A 2ZH4A 1K44A 2YPYA 2MXYA 4HHUA 1F5CA 1VFJA 1FWKA 4RUBA 3IA0A 2VKRA 4JV1A 1IUJA 2HURA 3NGTA 1S77D 2XO6A 2BYCA 3SQGB 2DRDA 2XHWA 3QZ7A 3FBEA 3MR3A 1MMNA 5K8OA 2VASA 8AT1B 1RGVA 4XIUA 4GC6A 2WVEA 1U1QA 2G0IA 2G1DA 4FPRA 1IJFB 2NPFA 1Q16B 2ILZA 2O5DA 4ZLNA 3UO0A 3PRVA 1X4DA 2BRKA 3GIMA 4B3MF 4OX8A 1R0AA 5C2GA 2MLYA 4M5HA 1H3DA 2IDEA 1NH8A 4YS2A 2W8LA 4AL6A 2NCKL 3EM1A 4NYOA 2W2PP 4E0DA 2E9ZA 1N6QA 4ETZA 3MMCA 3IN5A 4KH0B 1LWFA 1IBMF 3QQCD 3M6WA 2DHAA 4HYKA 1SXLA 2PIIA 2AZ1A 1F9HA 1NDCA 4O0NA 3G4SS 3VCDA 4NLDA 2GHPA 1LW0A 1FFSB 3W5ZA 5EHHA 3MZIA 4WFYA 3TA0A 2YWHA 4YMEA 2ZNYA 3H7HB 3UDVA 1WORA 3W7BA 4E8UA 5ETRA 1S76D 4CLKA 2VKZG 3MXHP 5B0DA 3HKWA 1IBLJ 4JI8F 2I5JB 3T1YF 2A2CA 4HI1A 1YJ7A 3MEDB 5KFGA 4ECSA 5T14A 1CPZA 1DBDA 3M2VB 4DQIA 4Q5VA 1H7XA 5M2UA 1D0EA 2Q79A 3LOUA 1JLCA 4KQZA 5CD4H 3O44A 2RNEA 4OJGA 4NASA 4B9SA 3DOMA 1T9WA 2HFVA 2WBRA 3ZTRA 2M7SA 1RTJB 5EWGA 3IBCB 2NXJA 2MQQA 2MDAA 3UCUP 3ELHA 3DDKA 4P74A 4R5PB 4FVMA 5KFRA 1IKYA 2CQ0A 2GMJA 2HGNA 3NMRA 2Z2ZA 2RU3A 1HHQA 3ZTQA 4N5SA 4DUZF 4Q44A 4NA2A 1M1KT 3R5AA 3RBXA 3LH2S 3T3FA 5J1EA 4RNNA 1WOOA 5DETA 5DJBA 1ZM3A 3PRDA 2K06A 2HNZB 5C7PA 3H4DA 3KUGA 3MPYA 2JSXA 1N5YA 4FYXB 3QT5A 1B7FA 1RACB 2WSEC 1BE4A 2XCPA 4KO0A 1VQOS 4KGXB 4WKRA 4N47A 3IP0A 5FDLB 1FRIA 3C6UB 4XTTA 5IS2A 3NL0A 2CWXA 1G7CB 3O5TB 2BACA 2XHCA 3SCIE 4R8UB 3NAHA 1NJIT 3M9NB 2CPXA 5T7LB 1TV6A 1I6JA 3M8QA 2BKNA 3QRQA 3N5FA 4TVAB 2MLXA 3CEDA 2AWZA 2C3UA 2AHOB 1E6VB 4J9SA 1FEHA 3TZXA 4L73A 5EDWA 1APSA 3K58A 4LF8J 4UOGA 3GFHA 4MYUA 4LRCA 3CCLS 1RLDA 2C2EA 1WUUA 4BCAA 4USJC 3OQ2A 2BOAA 3R2CJ 2IRUA 2A2DA 1T05B 4LF6F 3Q89A 1OY9A 3T6BA 3MCNA 3KG1A 2JC1A 1LQ9A 2KT2A 1Q82T 4PQAA 2YH0A 2FVQA 1WDTA 2ZNZA 4K5SA 5AJ3F 3ILLA 2LMIA 3V5RA 3B6BA 3QMQA 1HR0J 3U1MA 2G0CA 1QAJA 2CQPA 4QWBA 3EGZA 5C5JA 3ZZPA 2VFVA 5G4DA 1NDPA 2P6SA 3CULA 2CZVC 1UEKA 1IN0A 1C1BA 4JOUA 3NWRA 4JI3F 5B0AA 2KL8A 4K2XA 2PSZA 3K59A 2WW8A 3PFOA 1CJKA 4QYZK 2DPJA 3W3SA 2IRYA 3D0GE 3JSMB 2VC1A
chains in the Genus database with same CATH topology
3L7OA 5DLGA 3CCQS 1NK9A 1T7PA 5LL6d 3MOJB 2YWFA 5DQHA 3KLFB 2D3OR 4C0HA 2Z2LA 3MD1A 4Y3CA 4PR6A 1OWXA 4I6WA 2WBMA 1KN6A 4TY9A 4N77A 1QTMA 4Y2KA 3BO3A 2MZQA 2I0XA 2MMYA 1OSDA 3S6EA 5HQ8A 3EPGA 4EFAC 2HNYB 1T3OA 2ASYA 2HNZA 2F1FA 2NS1B 3DOLA 3TA1A 1QVGR 4BDPA 2P9EA 1FJGF 2LU1A 1SL1A 2FHMA 1VQ4S 5F0UA 2K1RB 3IR7B 2MQPA 3OV7A 3CMES 1R7IA 2HFZA 5KFBA 3K57A 2BOPA 4DFPA 2DTJA 2ZD1A 2VPZB 2HHVA 2E1MC 3FMBA 2C28A 3R5DA 3VAMA 1D9AA 2FVRA 2W9CB 1IJEB 3KYLA 3SI8A 4OV1A 3RR7A 5A8WA 4B9UA 4M63A 2X1FA 2PO4A 3AY0A 1VQPS 1U1PA 4N8NA 4H4MA 3SEOA 1PO6A 4QZVB 4IG3B 4Q43A 5FDLA 5IM0A 4ECWA 5KFCA 2FGOA 2R8KA 3C6UA 5E3RA 1DZ5A 1TKTB 2VBXA 3N79A 2UXBF 2J9DE 4K4VA 2IRXA 4KKOB 2NXUA 2O67A 4TKTA 2W8KA 4ZP7A 4NLVA 2J5AA 2PGCA 3TP2A 2J6SA 4HT5A 1HARA 4ID8A 4OZJA 3PKYA 2IM1A 3SFUA 1ZAXA 2HWHA 3TQ1A 2ZHBA 5M2RA 2AQ4A 2HFNA 3ISZA 3ZFVA 4ETXA 4QR2A 2KHCA 2ERRA 2AYGA 3PIPQ 4KAIA 4R8UA 1SJ4P 3TR5A 1KONA 2OAUA 5DG8A 5LSOA 2Y1JA 1IR0A 5HLFB 2VG6A 3PEJA 4OX7A 3UDCA 3CIZA 4IG0A 3M30B 4PXEA 4FYDA 2OPSA 1S1UA 3UI3A 3V6DB 5T7LA 2IAJB 1D8YA 2XSJA 4YY3F 2AW0A 3I5CA 2ZZNA 2HGMA 4IRDA 2ZBCA 3M1VB 1RISA 2ZVSA 4A8KA 2KT5A 2EK6A 2RSQA 4DV0F 3HPOA 1JB0C 1IKVA 2KRBA 2Q43A 2Q6CA 4LIRA 2K2PA 1FTCA 4ZPDA 5L39A 2YVSA 3MTJA 1PILA 2L08A 3NS5A 2YX1A 2IMWP 1JK9B 2Y1RI 4Y28C 3OUYA 2V5HG 1V3RA 2B5JA 3K5MA 2ZM6F 5I4MA 3R5CA 1G6BA 2VV5A 2VPYB 4ZPCA 5BYRA 4KHRA 3FQLA 5EX0A 3I56S 1LK5A 5GVQA 4I2QB 2KM8C 2YKPA 2RJZA 4NLGA 4OI0A 4JI0F 2XO7A 3TRGA 2VFTA 4F4WA 2WONB 4YB5A 3QYYA 2H5EA 2QA1A 3DHXA 5EUHA 3SSRA 3NNHA 2CPEA 1S99A 3Q8RB 5KFWA 4B9LA 4LFAF 4QW8A 2NYIA 2DNGA 2XSFA 3BZQA 5KAKA 2OD6A 5F9LA 2JEIA 1AXQA 2YWKA 4RNHA 4WFBQ 3D2WA 5B7WA 2CQDA 1Q8IA 3P3DA 1UA1A 1T05A 3DRYA 2OKQA 4NZ0A 2KN4A 3G86A 3UR0A 4Z2XA 3M8SA 4G1PA 3JTNA 5BYQA 3MUTP 3PEHA 5J2NA 4DS4A 3TANA 4ELTA 1WG1A 1LKZA 2LCWA 2E7WA 2VG7A 3H98A 3LALA 4DFKA 1ZETA 2PD1A 3LWMA 5KOXA 3O6QA 3HM9A 2UZAA 1HNVB 2RVJA 3W2WB 2EG2A 4K4TA 4QWAA 2JFDA 2PA8D 3B8HA 2V9WA 4WCEQ 1NU4A 2BA9A 3WC0A 5LSRA 4HT7A 3GFXA 5C42A 1VK3A 1T95A 1X0FA 4ED0A 4RBUA 4UQTA 1N54B 4RW9B 2FC9A 3MPWA 3BGRB 3NCPA 2QO3A 1RTHA 2B4UA 2HAIA 5KOWA 2JEGA 5B0CA 3RRHA 2YH1A 1JLGB 4MIAA 1XN9A 1Y4ZB 5F8MA 1K1QA 3I55S 3IRXB 2FY1A 5KG6A 2VBWA 3FDSA 3MEEB 3CCRS 1YJTA 2UUAF 1KNZA 3POTA 2GCFA 5DRKA 4NLOA 2R2UA 1K0VA 4I2PA 2FUG9 2DHGA 2ZHAA 3ITHB 3NNCA 3T5LA 4ZP9A 4MAKA 4YR2A 3NBPB 1NJWA 2O3DA 3IGNA 2HHUA 2J9EA 4LQ3A 2J7UA 4KJIA 3F44A 4ZCMA 4OZ1A 2RMLA 3Q23A 1ZAVA 2WB4A 6FDRA 3ZZ0A 3SCLE 2QLXA 3L09A 4Y2AA 1S1VA 1B0VA 1JKHB 1TKXA 3B82A 3FRYA 3DLBA 2EC0A 4RBTA 3TYTA 1FTRA 2H9ZA 1X9WA 1UJ5A 2BRLA 3DM2A 3GFYA 2DH7A 4X4UA 2PT0A 2ADBA 1D9DA 2EFPA 4NLSA 2BDPA 3ZZUA 1VRTB 1A7GE 4OI6A 1R31A 3T9ZA 2FHOB 4BHQA 1NK5A 2MY8A 2Z0GA 2ZC4A 5DGBA 3SCKE 4DHVA 3KLVA 3QAUA 3MM7B 2JWNA 4HLBA 3V2UC 2VONA 3KLEB 2XMMA 2RD5C 1NK0A 2PN6A 4LSLA 2VOOA 2DHXA 2MZRA 2RS8A 1C0TB 3WDOA 4AXJA 2BE2B 4QR0A 2DR8A 3CF5Q 1LV5A 5FJ4A 3G8SA 1FD2A 3M32B 2KXFA 2IJNA 2DNKA 2LA6A 2AGOA 2DNMA 2X1GA 5E33A 1Q4RA 3H4BA 5KFUA 2CPZA 3C6TB 1AW0A 1QJHA 1H0HB 4DFMA 5CXTA 1A9NB 4QWCA 1HW8A 3JSMA 1S72S 4C9DA 2DGSA 2AF6A 4PXDA 4PWDB 3BB5A 1CG2A 3OR2B 2JJ4D 4J9MA 3KLFA 2QLWA 3I9ZA 2HS4A 2DGVA 2QA2A 1KLMB 5I3UB 2LEBA 3K5NA 4DDFA 2DVIA 4C4WA 2KKHA 3FNNA 2X3GA 2X1AA 2UVUA 2GGPB 2HNYA 2YNIB 3M6VA 4PG6A 3N6MA 1BWEA 2F7VA 1UETA 2BJDA 4X4OA 4DUYF 2B43A 3DRRB 4NLTA 4DSFA 1MW7A 2K1RA 4OMFG 4LF7F 3ISND 1JX4A 3R3TA 3CCZA 3H5SA 4ILMA 2UUTA 1DQ9A 3PJWA 3QGIA 4YQWA 1ZAWA 2CG4A 5HBMB 2W9CA 3J80Y 4NYZA 4JV0A 1XMBA 2IA0A 4JI7F 2KFZA 3MPVA 3BREA 3BDPA 1U6FA 3C46A 4NLXA 2JLEA 1VK8A 3MAHA 3NMAA 3KMSA 4JV2A 4DJBA 5C24B 1KSPA 1FDDA 4IG3A 2LQBA 3CUNA 3BEGB 4NMLA 3KK3B 1TKTA 2GO9A 3KG0A 4ZVHA 2R7WA 4NZ6A 2DNRA 3D54A 4DX8H 2HRUA 4KKOA 3UNGC 3H5UA 2MQNA 1K1SA 2L41A 3TW0A 1J5OB 4CIOA 3PW5A 3OR1B 3I87A 2XLJA 1X5SA 4BC9A 4X66F 3OPKA 2HIQA 3BGLA 4U9RA 3SXLA 3U02A 1RYRA 1SJ3P 2DJWA 2Y0SD 2RF2B 4OX9F 2UXDF 2BABA 2D9PA 2IM3A 1IBLF 2W25A 2ZDOA 1U1LA 1FKPB 1Y5LB 2C3PA 2EW9A 1Y5IB 2HS0A 3DN9A 5H1SV 5HLFA 4OQJA 3OFFA 5AXNA 4F67A 5CYQB 2QRRA 3M30A 1WHWA 2LQ9A 2MSTA 1HNIB 1UWBB 3V6DA 2IAJA 2G13A 1RK8A 1X8DA 4H4OB 4WU2A 4X4PA 1VQLS 3RRGA 4IOAQ 1PC5A 3ONQA 3MR5A 4ZPVR 1IXKA 2R7SA 2Q3PA 4C11B 3M1VA 4ZPWR 2K7KA 3NAIA 2KYXA 2M4MA 2YKQA 3DMJB 2CQ1A 3GILA 3MURP 4DF4A 3JAMY 1ZH5A 2D1CA 4GC7A 4FS2A 4Q0BB 1HQEB 1S7HA 2CVEA 2SXLA 2VPWB 3VQTA 5B0FA 1Q7YT 4I67A 4IFVB 2I9SA 1Y7PA 1NHVA 1SJQA 1X7VA 4FXWA 2K3IA 3KK2B 1U48A 3N5BA 1H2TZ 5KFIA 2V0NA 4HH1A 2CJ9A 1TKDA 3QJJA 2CKWA 3I82A 4I2QA 3NLCA 4YHHF 2RS2A 2C3MA 4EWTA 3UE2A 1JXEA 3MM5B 4TU8A 2P5VA 3QGPA 2WONA 4IH6A 2F4VF 1TR0A 4LF5F 3Q8QB 2V8GA 4DV3F 1HHSA 1IQTA 1UFLA 4KT0C 2FD2A 1NJYA 3DRXA 2I2YA 2QMXA 4DL2A 2CJAA