4WFBQ

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with bc-3205
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
89
structure length
89
Chain Sequence
b'EARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVASVNIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S rRNA
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
molecule tags Ribosome
total genus 11
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wfbQ00
3VAHA 2KFYA 2RRAA 3ZZZA 4WFBQ 2HVZA 3H2UB 1KOOA 2MB0B 1VQ6S 2KT5A 2XSFA 2M8DB 1PGZA 2DGWA 1Q81T 2XB2D 1DHMA 3BO3A 3UWTA 2MKIA 2LEBA 1VQ5S 2DHGA 1AUDA 3US5A 2LECA 3MOJB 4U67Q 3TYTA 3NS5A 2MSTA 3CMES 3D2WA 2LMIA 3P3DA 1YIJS 2YH0A 2DNNA 5GAEU 1WG5A 2AD9A 5GAHU 3P6YC 1YI2S 4QU7A 1R8PA 1OPIA 1VQKS 4C4WA 2KI2A 1JJ2R 3NNAA 4CH0S 4YOEA 1WI6A 4RU2A 1WHXA 2MY8A 3MUVP 2DITA 5LSOA 3SXLA 1FNXH 3CCJS 2DHAA 2RNEA 2MZ1A 3CC7S 1X4HA 5H1SV 2K3KA 1D9AA 3CUNA 1G2EA 2CQGA 3CD6S 1OO0B 5JVHQ 1WG4A 1UAWA 5IM0B 5CXTA 2MYFA 4TU9A 1X4DA 2DIUA 2MQPA 3CC2S 2RU3A 1SJQA 4TLQA 4WFAQ 3MXHP 3CCRS 3G96A 3P5TL 3NS6A 5LSLA 2DH9A 2CQHA 1U2FA 2XS5A 3MDFA 4A8XA 5HL7Q 1YJWS 3DLLQ 2FC9A 3I55S 5CYJA 3NMRA 2FPHX 1CVJA 2PE8A 3S6EA 2MZQA 2CPDA 2KVIA 1YWXA 2QEXS 3PIOQ 2JX2A 2NLWA 2CPEA 2J8AA 2OTJS 3U1LA 2DNYA 2MQOA 2L9WA 2AYGA 2MGZA 2RVJA 1U1QA 3G4SS 4PRFA 1SJRA 2MKKA 2A3JA 1HA1A 1KOHA 2X1BA 3ZZYA 4W92B 4F25A 1FXLA 1RKJA 2CPFA 1VC6A 4ZKAA 4LIRA 2DK2A 1U1KA 1F9FA 4PKDB 2RQCA 1VQ9S 2RS8A 1WELA 1URNA 1K8AT 2LQ5A 2LCWA 4PR6A 1OIAA 1YJNS 4QQBA 2I2YA 1U1RA 2VOOA 5LXYA 1U1OA 2MQLA 2CPJA 1VQ4S 2G1DA 2MQNA 2OTLS 2FHOB 4FXVA 3J7ZT 3S01A 1WI8A 1KQSR 5GVQA 1X4GA 5DM6Q 1A7GE 2U1AA 4C0OC 2EK1A 3BS9A 2KXNB 2DGSA 1WHWA 1UP1A 1SXLA 1Q7YT 2LA6A 1SJ4P 4BS2A 1FJ7A 2KU7A 1DBDA 2J0QD 5ITHA 2I38A 5FJ4A 2FY1A 1HD0A 1B7FA 2KM8C 2OIHA 2MKCA 4WFNQ 3BO2A 5D78A 1WHYA 2M8HA 1N54B 3FEYB 1M5VC 2D3OR 2MPUA 3VAJA 1QVFR 3EGNA 1U1NA 1FHTA 2CQCA 2MKJA 2CQ3A 2LA4A 3V4MA 2NZ4A 2EVZA 2CPZA 3G6ES 2LXUA 1X4FA 1WEYA 2CPXA 1ZZNA 2KRBA 5D77A 2BOPA 2E5GA 2DGVA 2FC8A 3FEXB 2JVRA 1R8HA 2D9PA 2E44A 1FO1A 3CCSS 3UD4P 1JJ4A 2CPHA 2CQDA 4CIOA 1HL6A 2KRRA 4M5DB 1KC8T 3LQVA 1VQLS 3JB9k 2HYIB 1VBYA 2KM8B 1QM9A 2D9OA 1ZH5A 3NNHA 5MLCV 4IOCQ 2Q79A 1L3KA 1X0FA 1DZ5A 2M88A 2ADCA 1W2BR 1FJCA 4CH1A 2RUGA 3VAMA 1VBXA 3MURP 4F02A 1NO8A 2G4BA 4WIIA 3CTRA 5GADU 3CMAS 2JVOA 4UY8T 3MUTP 3SDEA 2XNRA 3MUMP 2KN4A 2M4MA 1ZZFA 2DGUA 2JRSA 2M2BA 3N9UC 2KXFA 2KH9A 1H2UX 1N88A 3CCLS 1U1MA 3RW6A 3BO4A 2KHCA 2DNKA 3J7YU 1WF2A 2DNLA 2ZJRQ 3VAIA 3MI7X 2MSSA 3L3CA 3G9CA 2J76E 2HZCA 4WCEQ 1WTBA 2MMYA 3HHNB 2XS7A 1BY9A 2K8GA 2YKAA 2CQ2A 3VALA 3THTA 4QU6A 3CCMS 2B0GA 4F26A 5HO4A 5LJ5Y 3CXCR 2ZJQQ 3OW2R 1SJ3P 2RRBA 2DGQA 3CPWR 5GAGU 3VAFA 2KG0A 1WHVA 3CCVS 2L41A 3CCUS 1IQTA 2X1GA 3CCQS 1Q86T 1X4AA 1YJ9S 2DNZA 1M1KT 1U1LA 2MKHA 3DXBA 3CF5Q 4YUDA 2QFJA 2OSQA 3SMZA 3THPA 3S8SA 3R27A 2CQ0A 2U2FA 4QPTA 2F9DA 1A9NB 3ULHA 2F3JA 1VQNS 2MKSA 1Q82T 3TO8A 1X4EA 1M5PC 2BZ2A 2DH7A 1VQ8S 5EN1A 3EGZA 3PIPQ 4OZ0A 1U6FA 2UP1A 1KD1T 2LKZA 2CQBA 2N7CA 3IWNC 2ERRA 4TU8A 2N82B 2OJ3A 2CQPA 2X1FA 5BJRA 2DNOA 2RQ4A 2CPYA 1NU4A 2OSRA 3CC4S 4ERDA 3UD3P 1PO6A 5DDRC 2YWKA 4Y0FA 2LEAA 2MXYA 1U6BA 2YH1A 3U1MA 2ZJPQ 5DDPC 3HI9A 1K9MT 3IRWP 1P27B 1X5SA 2DNHA 2CJKA 3MD1A 2DH8A 3R1LA 1RK8A 1M5OC 2DHSA 1X5OA 2M70A 2AYMA 1VQ7S 4ED5A 2DO4A 1D8ZA 2DNPA 4CQ1A 2SXLA 3MD3A 2CQIA 1YTYA 2CQ4A 2MJUA 3UCGA 2HGMA 1WEZA 2VOPA 5IFMA 3NNCA 2MZTA 4WF9Q 1WEXA 2G0CA 1WF1A 2PEHA 2DNRA 2L08A 4C7QA 5IM0A 2DIVA 1QVGR 2DGTA 5LXRA 1XN9A 2ADBA 2LYVA 2GHPA 2N3OA 2RT3A 2E5JA 4TU7A 3G8SA 3Q2SC 4J5OA 2MZRA 3VAKA 1K73T 2F9JA 2QA4S 3H2VE 2MQMA 2WBRA 4IO9Q 1JJHA 1DRZA 3TP2A 5GMKa 4V19X 4LJMA 1UFWA 1H2TZ 4P6QA 3EX7B 3CULA 1O0PA 3SDEB 1VQOS 2E5HA 1S72S 2JWNA 1WF0A 2LXIA 5CA5A 2MQQA 2AYBA 1X4CA 3G71S 2E5IA 1X4BA 1YITS 3VF0B 4EGLA 2M7SA 1M5KC 2XNQA 2M9KA 3I56S 3G8TA 3K0JA 2O3DA 2DB1A 2YTCA 3S7RA 1OWXA 2MY7A 2DGXA 1VQPS 1NJIT 4LMZA 1VC5A 2CPIA 2DNMA 1M90T 4YB1P 2MJNA 3VAGA 2MGZB 3CCES 1X5TA 2HGLA 3LPYA 5IQQA 4IOAQ 1H6KX 1P1TA 2MHNA 5DDOC 3UCUP 1X5PA 1YHQS 4Z2XA 3Q2TC 2N3LA 2DISA 4Y00A 2MZSA 2DHXA 3P49B 3R1HA 1HD1A 2DO0A 5JVGQ 4WKRA 2DGOA 2KYXA 1VC0A 1SJFA 5DETA 1FT8A 2EK6A 3UCZP 3RW7A 2AYEA 2DNQA 1UW4A 1H2VZ 2M52A 2CQ1A 1WG1A 2VODA 1JMTA 2KXHA 1FJEB 2HGNA 5DM7Q 2M0GB 2DNGA 4W90B 4FXWA 1S79A 3UE2A 3BEGB 5LJ3Y 4OZ1A 1N52B 2VONA 2RS2A 4UQTA 5DDQC 4IUFA 2XS2A 3B4MA 1VBZA 2MZJA 3B4DA 2KG1A 1U1PA 1N8RT 1VQMS 1WWHA 2X1AA 2GO9A 2J0SD 2V94A
chains in the Genus database with same CATH superfamily
3ZZZA 4H4KC 3W1YC 3CD5A 1MLAA 5AE2A 1VQ5S 2DHGA 1GAOA 3FNNA 3MM8B 4FBTA 3V6KA 2YH0A 3NOCA 2JLFA 3P6YC 2OEKA 3WBZA 2KI2A 1MW7A 3L95X 2ZBPA 4LQ3A 1FNXH 3CCJS 1FRKA 1LXJA 4K59A 2ZBIA 1UEKA 4MFBB 4E8UA 3GONA 3HF5A 2J5AA 3VVTA 1H72C 1JXVA 2MQPA 2WTFA 2M3DA 3MXHP 1JNZB 1MG7A 3P5TL 4EMDA 1HNXF 2FZGB 1NM2A 3M2VB 5I3PA 1CVJA 2PE8A 2HVHA 1RHKB 4C8LA 1N32J 2GIQA 4DLEA 3MTJA 3GIJA 3DRPA 3PV8A 1SJRA 2V2VA 3L7UA 3HCXA 1KOHA 4CLKA 1AW0A 2H3EB 4IG3A 2RQCA 4ZPVR 2LCWA 2XQCA 2R9LA 2YNHB 4OX9F 4RLEA 3J7ZT 1TK5A 4DI6A 3EPIA 5KG2A 3FKBA 1QUPA 3BR8A 3D6FB 2KXNB 3M8YA 2FJDB 1J5OA 1EETB 5K5MA 2JJ4D 4Y6IA 3GV8B 3M2RA 3PACA 2WW8A 2X3GA 3VAJA 3FMWA 2P9GA 3J7A1 4LR9A 2BOAA 3TUJC 3MM7A 1VLOA 1QE1A 2DGVA 3CJ3A 2GV1A 1NAQA 5ETMA 5ETRA 2KM8B 5HLFB 4I69A 1AZSB 1CC8A 4E98A 3BSNA 5C42B 1TKDA 1KLMA 2AGPA 3NCPA 1NK5A 4Y2MA 2M2BA 3X3UA 3OJUA 3QLHA 3JTOA 1PC5A 3HT3A 2W2NP 4ZS6A 3ZTSA 3EZ5A 3W5ZA 1HNVA 2PA3A 3GFXA 4LSZB 4DZDA 4LUBA 2K8GA 2ZDPA 3RRKA 2CRLA 4QBUA 4RNMA 3DOLA 4DPUA 1Y7PA 2HIYA 4YY3J 2XMWA 5EWFA 2G1HA 2F4VJ 2R8HA 4TYAA 1F60B 4J90A 1C0TA 3DRYA 2CQ0A 2F8EX 2F3JA 2FJAB 2CDQA 4DV3J 2XG8A 1VQ8S 1N33J 2ERRA 5KFTA 2KJWA 2GMLA 2WOMA 4C8YA 4I6WA 2YPYA 3BV8A 1P9QC 4IG0A 4JUZA 3MECA 4NZ6A 2VG7A 4ECTA 3CD7A 1FDAA 4KYZA 5JJBA 3R8YA 3UN2A 1TL5A 4ANEA 1FJGF 3JSRA 3NGSA 2XZWA 1CSJA 4NYOA 2AYMA 2B4OA 2V8VA 1XR7A 1VS3A 5CQGA 3UDCA 3HSDA 2CQIA 2AX1A 1ZBTA 1WEZA 3IR5B 3ET6A 4UOGA 4ZJOA 1N5YA 2B9WA 4RWXA 3DLKB 1WF1A 3BDEA 4DR2J 2JHEA 1S6OA 1U47A 2E5LF 4NLUA 5A6WA 1BQXA 4EO8A 1HWJA 3AODA 4F4WA 1IKVA 1RWNB 4I67A 4KRWA 1Q4RA 1BQMB 4DOZA 1Q5VA 1DTQB 3UR0A 1LWFB 3OTOF 3QIPB 3G6YA 3GWCA 2VPXB 1MROA 5LM7E 3MPDA 2M9KA 2YTCA 2QIFA 4X4VA 4PG4A 4ITSA 4Z7CA 2DO0A 3M2UA 3FMBA 1WOOA 1GX5A 4Q8FA 2L9DA 1HBUB 4DV4J 3KFWX 2HKEA 1C1CA 2XI3A 4ZCIA 3RJMB 4UQTA 2ZE2B 4PEOA 2ZUGA 2OFHX 4BC9A 1AFIA 4LFAJ 2GO9A 5KFGA 1FE0A 4YFUA 2HVZA 1RWPB 5IZHA 2MB0B 3JQMA 2AJQA 5HI7A 3OUYA 4FXDA 3BQ0A 3MOJB 3J7AN 2C2ZB 3LP2A 1RAOA 1YI2S 2XTJP 3W64A 3OL7A 1OPIA 3OTDA 5CCMA 3MMCA 4RU2A 4AQYF 4KQZA 4M5MA 3QPIA 2Y1IA 5J2MB 2FVRA 4ECZA 1N34F 3CC7S 3CUNA 3W8GA 4NE9C 4RU9A 4JYAJ 1WG4A 2FVPA 1T9TA 3ZZRA 3FCHA 5IT0A 4R0JA 2GIRA 3RB0A 2PMZD 1N5SA 2G2YA 5LSLA 4DR4F 4A8YA 3G82A 3M8PA 4IH6A 3AD8C 1R0BG 1HLWA 4B9VA 1PBAA 5FDLB 2ZH4A 2XHCA 4KGMA 4CO0A 2QG9B 1T05B 1S10A 2Q3PA 3K58A 3IR7B 4WBFA 4RW9A 3KLHA 4PKDB 2ROEA 1WELA 4MJKA 3NGKA 1Z2LA 4QIEA 2LQ8A 1NJZA 3IR6B 4I2QB 2KJVA 4DHVA 3GCXP 4RUHA 2B51A 4X66F 2AKWB 2CYYA 3O8WA 1RBLA 3HULA 2CVIA 2IM1A 4DSJA 4X64F 5LL6d 3U02A 2C2DA 2BXJA 3V2UC 5H9EJ 1U1NA 2I9SA 5A8WA 4N5SA 2LA4A 2NZ4A 2FLOA 4DUYJ 3KMSA 4DS5A 4F36A 1RABB 4LRDA 3I0RA 2YKMA 3UD4P 2DYAA 1KC8T 1VQLS 4K0KF 1XERA 4H4KA 1RBOB 2R7QA 1SKSA 1NHUA 2RUGA 2OPRB 4G1QB 4ATNA 4RKUC 2JRSA 4OX7A 2KH9A 2BW2A 3OL8A 3KLGA 3LF0A 3CJ8A 4HT5A 2MSSA 1SUQB 4O44B 3KJQB 2RAQA 2V68A 2K1RA 4NYPA 5I42A 2ATLA 4AXJA 5HP1A 5GAGU 5ETVA 2Y1JA 1IQTA 3C19A 2LVWA 4OI3A 4A8WA 1YKWA 1R0AA 4ECYA 2VBZA 4Z37A 4RUAA 3VZHA 3G87A 2OELA 2PMHA 5KG0A 5HQ8A 5CD4H 4R8UA 2DH7A 2GQQA 4QR2A 1RT7B 1TL3B 3FBEA 4FDFA 1R8CA 2H4WB 2QSFA 4BLGA 4DL4A 3EGWB 2EC2A 1F5BA 4Y0FA 2ZC4A 2Z4PA 2BEFA 1E6YA 4ZVRB 4IDKA 3M8RA 2RRNA 1J2VA 2I1RA 2BQUA 2M70A 1I51B 2IM3A 4QWBA 3T1YJ 3PFEA 4LF9J 1VJQA 2X7IA 5CZVA 6FDRA 3OFGA 2ADBA 1RTIB 5KFKA 1KRPA 4ZPBA 3QO9B 1VQYA 3MOZA 1FNMA 4CZCA 3NXZA 2ZD1A 3H2VE 2WZ1A 1S1XA 2EI5A 4OV1A 5C24B 5KFJA 4ZP9A 2ZWPA 4O4GA 4E0DA 3DMJA 4ZPTR 1H74A 5K14A 3F73A 2M7SA 4O3SA 2XNQA 3TJ8A 1U2RA 3TJ9A 3ICLA 3IRXB 2LDYA 3MMAA 3FEZA 2DY9A 2NPIA 2DR7A 3VAGA 2MGZB 3BH7B 4MKAA 1X5PA 3NGDA 2KYXA 1HHQA 3NRBA 4ZCLA 5BYRA 4IO1A 2UXBF 2QSWA 1H2VZ 1MMNA 5L1LA 2V50A 3NS7B 5JMNA 4CTAA 4XAKA 2XYPB 5KFEA 3SCLE 5M2UA 3B4MA 4XPCA 4HHUA 4TXSA 1S49A 2V94A 1LW0A 2IY5B 4B9UA 3M30A 4KHPF 1VQ6S 4JV0A 1NB2A 2BJEA 2OMOA 3IBCB 4ZCMA 3SBMA 3MAAB 1T03A 3TYTA 2LMIA 1U0HA 1T9UA 1RDRA 2AD9A 1IM6A 3TVKA 1GX6A 2CJAA 3CJSA 1TL1B 3ZZ0A 3RAMA 1UVLA 1HNIA 3AHPA 3LGHA 2DHAA 2Y1LB 5H1SV 5D3GB 3D9BA 3OFFA 5E3RA 5L1JA 5JVHQ 3M9OB 4X62J 2B4PA 4FPIA 1XNQF 1CJTA 3DGVA 4WKYA 4XDCA 4QIGA 4FYVB 1HARA 4MTPA 2W2QP 2EFQA 3BREA 2FJVA 1YBAA 1ZPVA 3S6EA 5GAEI 3K2YA 2DNYA 1ZA1B 1BWVA 1UWAA 4ID8A 1HNWF 2CVEA 3CJKB 3BBCA 1NXIA 4HHJA 1EZZB 4PUOA 2CPFA 3SSQA 1RCOB 2VH7A 4KAIA 2LQ5A 1WC3A 1OIAA 4I7FA 2VOOA 3OTCA 4GO5X 3V5RA 1HNXJ 2G1DA 2VUGA 3HJVA 3AH6A 4KT0C 4LF5F 3W3SA 1VLYA 1KQSR 1S9EB 2UVRA 3L9ZA 5LMNF 2AV5A 4RW8A 3OSNA 5HVGA 1Q7YT 3I82A 5C25A 3N6MA 5FJ4A 2C2MB 4U7UK 4N41A 2BRKA 3HFVA 4A8SA 2HG4A 4TY8B 1VRUA 1VOMA 4DV6F 1XMQF 4OX9J 4NLQA 3IAS9 5CAAA 4MYUA 4PXEA 2FC8A 2BJ1A 1UVKA 1YVFA 2IVMA 3C16B 2OMLA 1HQUB 2XY5A 2CQDA 3DI6B 3CDAA 1B7YB 2CZVC 4B3OA 2HYIB 1VBYA 1X0FA 4EK2A 3TX0A 1BC6A 1NO8A 2R8JA 3QGGA 2HSEB 2AJ2A 2M4MA 1ZZFA 2HHVA 4H4MB 3GIIA 4ED3A 3GP9A 1VGYA 1BHNA 2NSCA 1RTHB 1E6VB 1FRMA 2CQ2A 5E33A 4LRFA 1QAIA 2QX0A 2BM1A 4IOBA 1RTZA 5LSRA 1SQGA 1FK9A 4C8ZA 1R8BA 4EBDA 3C2PA 3MZIA 2QFJA 3M6UA 2HZAA 2OSQA 3LWMA 3W5XA 1IBMJ 3JSMB 4HDGA 1M5SA 1QAJA 1X4EA 1KVKA 1C1BA 3PIPQ 2ACMA 3F56A 3IWNC 4A47A 1JLFA 2EFVA 3KTQA 1C0UB 1EQ0A 4PYDA 4NRTA 2Z56B 3MEKA 4JB8B 1V5IB 4YP3A 3HT0A 1SKUB 4WYLA 3GCWP 2V4RA 4ZPWR 4NXNF 2WCXA 2YKNB 3CDWA 1NPPA 3IG1B 3HD1A 3HK2A 1M5OC 1SI9A 2DNPA 5KFZA 4NZ0A 3KJNB 5D4PA 5IFMA 4USUA 4MFBA 2PEHA 2DY1A 4PZVA 4U96A 4A4JA 2UUAF 4CRJA 5LXRA 5ETOA 4ECWA 2LYVA 3FFIB 1GXTA 4BC7A 4F0MA 2ZHAA 3BBFA 3M2VA 5IT4A 2F9JA 1RACB 3FCWA 4U6PA 4PG6A 3Q22A 3WC0A 3SDEB 4CNYA 2JWNA 4DL2A 4NPOA 1TAUA 2LQ9A 1V3ZA 3G71S 4PYAA 4X4PA 1WC5A 3B8HA 2IJNA 3I32A 3KJVB 3K0JA 1RADB 4LFCF 1OSDA 1LWEB 5IS2A 2CPIA 2ZH2A 1FFGB 2ZBCA 4QYRA 2FZKB 3CCES 5ETKA 1YG0A 2EWHA 2BJ7A 1PC4A 5JVGQ 3SQGB 2QL5B 1FEEA 1Q53A 3KHLA 1FT8A 5B7WA 3D3CJ 1IWGA 1NK9A 1H73A 5K20B 3UE2A 1EJ7L 3KLIB 3W2VB 2WVFA 4QR1A 1S77D 2FHMA 3OVAA 3EUNA 4J9KA 4HTJA 4J9LA 3RR8A 2XEXA 3POTA 5HLFA 2AX0A 4NLOA 4GMKA 1AZSA 4A8MP 1YIJS 3MR5A 5C42A 2E7WA 2XMMA 3HP6A 4HKQA 2BX6A 2RF2B 2AGQA 3O2IA 1I3OB 4D3GA 2MZ1A 3EJMA 5DLFA 4WFXA 2UXDF 3CC2S 3V6HA 4TLQA 5L9NA 2AZ3A 4GKKF 3IXQA 3MPYA 5CYJA 1DAXA 3BR9A 4CLTA 2K7JA 2Y1RI 2MQOA 2L9WA 2RVJA 1S6PA 5KG1A 3HVRA 1CS4B 1YZ6A 2HQCA 5KFAA 2DK2A 2MLZA 1JLQB 2H54B 1AXQA 9RUBA 4J9VA 3LAKA 3PX6A 2CADA 4U8YA 2MQNA 1IBKF 4DR4J 1IJEB 3VQSA 3OLBA 1X4GA 1N36J 1F9HA 4IFYB 4ZVSB 4NA3A 3DCAA 2Q6CA 4F3QA 1U25A 1VRTB 1Z1ZA 1ZYQA 3PHTA 3N6LA 4DUTA 2CNLB 2PI4A 1WC6A 3TA1A 3TARA 3BGUA 1NH8A 4AD6A 4XK8C 2D3OR 2YWWA 3FQKA 3DM2B 2HHXA 3RBEA 1GT8A 2RDIA 3DLKA 3TW0A 1LK7A 3HZEA 4DV0F 2KRBA 1MMDA 3Q8QB 3PO5A 2J0XA 4PWUA 4NL5A 2AJ0A 3MEEB 2ZOMA 4X66J 3AT1B 1RT4B 1BQMA 4P52A 4EYIB 1DTQA 3W9IA 4ZIWA 3GSIA 3QIPA 4O23A 2XNRA 4LF7F 1WSRA 3BM7A 2JEGA 2DD8S 2B56A 3EZOA 5B0BA 4OX6A 4K5RA 2XS7A 4CLLA 4K0KJ 2WBMA 4ZVHA 3WIUA 2J7WA 3VAFA 2V2QA 4I6AA 2XSJB 4ICLB 3GFZA 1U1LA 3DXBA 2V8PA 2HEKA 1IR0A 2ZHBA 1HBUA 4BDPA 1XWLA 4PAAA 2WVEA 2VA2A 4OHWA 1RE1B 4ELVA 2ZE2A 1U6FA 4IH7A 1ULRA 4RO0A 1HHSA 5C7PA 2OJ3A 3DLGB 1NH7A 3HI9A 4K4YA 1X5SA 3TX8A 1RK8A 2CAJA 1NSQA 2RQKA 1RT1B 1S4FA 5J2MA 5K8OA 4DMZA 1TP7A 2W2OP 1JLCB 3FBFA 2G0CA 3GYXB 4ZITA 4DFPA 1R8AA 1OY8A 2WONB 3GG1A 1JK9B 1PJ6A 1ZAXA 3T5JA 2CIMA 2HIQA 4O3OA 5HJXA 3OTEA 3NMAA 3P45B 4FPRA 5J1PA 2ZVIA 5FDLA 3JTNA 1DTTB 5L38A 4KTQA 3EX7B 3LOUA 1U8SA 2HNDB 2H4YB 1T05A 1JLEB 2GVZB 3W62A 3H20A 1F9EB 5D6GA 4EGLA 4L74A 1Y10A 2VZ9A 4Y28C 3TVYA 3D1QA 3LPEA 4DL7A 2VD3A 4EBEA 2HVDA 4A48A 4I2QA 4F4ZA 3M9MB 3NAHA 1OQ6A 3D28A 4Y00A 2DTJA 1T11A 4OZLA 2HFVA 5F8IA 4ETXA 3GJSB 4DSIA 4RW4B 4QR0A 2W9CB 2YQ3A 1NK8A 4DCJB 4GVBB 1KDNA 2BJ9A 2FB0A 5KT6A 4K4WA 1N8RT 4KBIA 2J6SA 2IYIA 2BMBA 2MKIA 5BYSA 4DV7F 1C2PA 5IV3A 4J9SA 3FVYA 3A8IA 3LWLA 3D2WA 1NDKA 2L3MA 2HHHF 5CYQB 2AJ1A 2UXBJ 1FRJA 5IC4B 3KLEB 3FZBA 4G1QA 2IC3B 2BE7D 3PYDA 2HNYB 2JFKA 4RZRA 4YOEA 4IR1A 1GXUA 2MY8A 2HRUA 1XJWB 2AGOA 4DQIA 4H4OB 4M5LA 2GNKA 4GC7A 1YX2A 4P2MA 5A2QY 1SUQA 4O44A 4EO6A 3BF4A 3ZXWA 4KHPJ 2ZZMA 1Y11A 4OJGA 2JC0A 4OL8A 4IYQA 5F8NA 5HL7Q 3EVMA 2IM2A 2EFOA 3Q8SB 3ZFVA 3GB0A 4ZLJA 1RWVB 2CPDA 2PFFB 2JH3A 1MU2B 2OTJS 3ZTRA 3MM6B 2H5EA 1VK3A 3ZTOA 3N28A 5HBMB 3ZTPA 4LIRA 1RT7A 5E5NA 1TL3A 1XNQJ 2GJIA 2A0FB 5KFSA 4KO0B 4C6AA 2YVSA 3HVTB 3SFUA 3E2EA 3S01A 3GIMA 1WOSA 5J2PB 2L9NA 4A8KA 2CJQA 3DOKB 1CC7A 4BS2A 4G3IA 4ZHRB 4Q44A 2J0QD 2P6SA 2OO4A 4ETZA 2MKCA 1HNWJ 1ITPA 3OJSA 1ZM4A 3VR1A 1HW9A 4JBCA 3M8WA 2GIFA 3MEDB 3BN7A 2CPXA 1GXLA 1RTIA 3CCSS 4F2SA 5LMNJ 4DPWA 4M5DB 5AXLA 3JB9k 3DXSX 1ZH5A 4IOCQ 1SQEA 1PILA 5C24A 5DQGA 3VAMA 4F02A 4TKTA 5DO2A 5HQLA 3KNGA 8RUCA 2P5VA 1H7WA 4OFZA 3ZTQA 3ELHA 3MUMP 2EKNA 4CT9A 3QFHA 4WP8A 2QN6B 5FLXU 1H2UX 1M1GA 1XMQJ 4ZVQB 1Y9OA 1UZDA 3HKZD 1LEOA 3IWLA 1IKXB 4PWDB 1Y4ZB 3IRXA 4WCEQ 5KFHA 5KG5A 3PM9A 3A3PB 1MN9A 3CO9A 3H7HB 1T9WA 4FYXB 4DS4A 2VKRA 2BJ3A 1WHVA 2IMWP 1TKTA 2Q1LA 2Z8QA 4LBHA 4PCQA 4F4KA 1HBMA 3K89A 2VG6B 3IN5A 1PAUB 3UD5A 3M7VA 2XCAA 1RYSA 4OZ0A 2UP1A 4QPXA 3FC9A 4F04B 2JSXA 3L7PA 4RW7B 2R2RA 2BJ8A 2H5IB 5SZTA 2XGQA 5HMZA 3MAAA 2G0JA 5ETPA 2YH1A 4ZDNA 5D4NA 1C4CA 5HMXA 2DNHA 1U0SA 3MD1A 1RLCL 4X4SA 4RNOA 3R1LA 3LH2S 3AA9A 4QWEA 1RQ0A 1TL1A 3HKWA 5KFLA 4RUBA 3KNAA 1T9YA 2OPQB 4CQ1A 3K8VA 1NKBA 3W7BA 2IJFA 3UVJB 2VOPA 5D3GA 2QLWA 5RUBA 1SIWB 2PMWA 4PG5A 3PTWA 3GR1A 4DV5F 1SC6A 2VPYB 4P10A 6AT1B 2VJVA 4TU7A 2GGPB 1NDLA 3GR0A 2MZRA 3VAKA 4NXNJ 2OFGX 7AT1B 2FHKA 1JJHA 2H51B 1RWMB 2BKPA 2ROGA 1FRLA 1H2TZ 1VMBA 3CJKA 4MYTA 1M5KC 1G3OA 5BR8F 3QT5A 2UUAJ 4Y2KA 1QLNA 2IRUA 4CLFA 4C8OA 5F9LA 2DGXA 1VC5A 2J7KA 1T8EA 3KOAA 3QIDA 3UPFA 1S9EA 1RZMA 3WHIA 1KFDA 2VFVA 5IQQA 4DQPA 5DQIA 3EPGA 3K5NA 3SCKE 4CO4A 1B4SA 1CJVB 3FK4A 2XMKA 4OX8A 2A2CA 4X4OA 5DM7Q 2M0GB 4TY8A 2NYHA 1T94A 5LJ3Y 1B70B 4D3HA 3SQOP 4C48A 5HQMA 4LFCJ 1VI7A 3PW5A 1U1PA 4DL6A 4W4MA 2WSCC 2ZM6F 1TKXB 4B9MA 4CLSA 4JI0F 3C16A 2HFOA 5EX3A 4WFBQ 1HQUA 3RRHA 3DI6A 3M6WA 2IDLA 2M8DB 2PFDA 4OYIA 4M5HA 3NS5A 3N4WA 2EFGA 3P3DA 5GAEU 4B3TF 3W5YA 3BQ2A 1QD1A 1VQKS 1UJ4A 2V9WA 2ZBQA 5T14A 4H4MA 3IBWA 2P9CA 2IYGA 3CW2C 4CWBA 1RTHA 3CD6S 1E6VA 3AB2B 4I6YA 3KMQA 1X60A 2UUCF 1VIOA 5DQHA 2QZ8A 3GJQB 4DR3F 4GO7X 2HZVA 1KBRA 2VBYA 4ELTA 4DL3A 3H98A 4OYMA 4RJVA 3U27A 2HK3A 2JZ5A 1X0PA 4KR0B 5GAHI 1YWXA 4FF3A 2J8SA 3JSMA 3R5CA 4LSNB 2R2SA 2IIHA 4B9SA 2MKKA 3PEHA 1TFYA 5D4LA 5J1EA 3ZZYA 1RKJA 4LF4F 4WU2A 1FERA 2E1MC 2UXDJ 1C0UA 4P2FA 1PKUA 4DFJA 1JX4A 4ZPDA 1PYOB 4GKKJ 4QOTA 3HHLC 4L3KA 4R5PB 2CNOB 2EC0A 2V2KA 2YKNA 2LA6A 2IPOB 3IG1A 3A8JA 1RUSA 4OHZA 4KGVB 1UVIA 2VF3A 2ASDA 3FEYB 2IAJB 3DOMB 1FHTA 4J91A 1W25A 1UEVA 1QAXA 2CPZA 1IBKJ 4X4QA 3FFIA 3GV5B 3GTYX 4L76A 3PG9A 2HAFA 1NCLA 4C0HA 2ASLA 5ETLA 4CO2A 4FN5A 5AXKA 3SDEA 4K5SA 5B08A 4WK1A 1O6XA 5ETQA 3T5HA 1SB6A 5IT9Y 2F8HA 1WTFA 1T9XA 3IP0A 4DV0J 3KJVA 2XLIA 4RBUA 4EEYA 4JI5F 1LWEA 3ENQA 2OPSA 4P74A 2ACYA 3L7OA 3W63A 3CJQA 3G6XA 3AD9C 3HFKA 2VV5A 3KK2B 1M1HA 4F2RA 4HVZA 1Q86T 2EKYA 5I4MA 3WIVA 3SQGA 4KPCA 4O3PA 3SMZA 1HWUA 1N4LA 3CIMA 4DF4A 2IFXA 4OZ5A 4WU3A 2BYCA 2CZ9A 3KLIA 3W2VA 2EEYA 3EGZA 2VJUA 5IWAF 4ILRA 5ETSA 3GQCA 1Y5NB 1HMVB 1U02A 4U9RA 3AOBA 3JQKA 5AJ3F 3AB4B 5DDRC 1WD6A 2AMCB 1U6BA 1Y3KA 3NLCA 1S57A 2HLTA 4KH0B 4UOFA 5D0EA 1RT5B 5KOWA 2RF2A 3M6XA 4J7CA 2VG5B 3ZNUA 3J81j 1VRQC 3RBDA 5LOQA 2MZTA 2HFSA 1QVGR 1RTDB 1Q79A 2F40A 3TQEA 2MHEA 3MCMA 3Q2SC 4M63A 4JP8A 1BXNA 5D0GA 4YDDB 5KT5A 2Z2YB 4PQAA 2BQRA 1CULA 3CULA 2E5HA 4Z7YA 1X4CA 1CS4A 4U8VA 3VF0B 2YX1A 3N0VA 4X2BA 5KAKA 1JLQA 2KL8A 3OXLA 4QIWD 3SSSA 5KFDA 1UZHA 3OLAA 2V4JB 4J9NA 1G4CA 4GVLA 4IFYA 1TVRA 3UDEA 4ECUA 1H6KX 3UCUP 2JDJA 2NQPA 4LF6F 1VRTA 3DYAA 2ZHOA 3D54A 1SJFA 5F0WA 1X31C 5HMWA 3CCZA 1HYSA 1JMTA 3M6VA 3JS9A 3HVAA 2QTWA 3DM2A 5HVFA 3BEGB 1RTJB 4B9LA 1SKWA 1CBKA 2FGCA 1U49A 5HK4A 4WFYA 4JI2F 1WWHA 2RQMA 3MEEA 3H5SA 1JIHA 3AJ2A 1FTCA 2RU9A 4USKA 1J5EF 1HWLA 1RT4A 2V8DA 1I5OB 1SJ1A 3EGVA 2DNNA 2JL9A 2DRAA 2HRTA 4DF8A 3TRGA 1UFLA 3MM5B 3AAWB 1QSLA 2C3UA 4DDFA 3L09A 3MEGB 2BABA 2QA1A 1I6JA 3N5BA 1TK0A 3V81B 3VGTA 4KFBB 3R7NB 2IBOA 3QZ8A 3BGLA 1QAYA 1X4DA 2DIUA 4OYPA 3ETMA 2A2DA 4KY3A 1XMOF 3EDQB 4DV7J 1S0VA 4WIQA 1EHWA 1YLXA 2CQHA 5H9FJ 2XS5A 2XSJA 2HHHJ 4LQ9A 4QWCA 2FC9A 4RR5A 2PT0A 2APOA 2DEJA 3E8OA 4PQUA 2NZCA 4Q2MA 2ZNZA 5JXSA 2H65B 2J8AA 4UQGA 3K7RA 4J9RA 5J2QB 5FD1A 4NEYA 4P75A 3AY0A 1VC6A 1OYDA 2C2RA 2RS8A 1URNA 1TKZB 2PEBA 1HIYA 1YJNS 4RL1A 2QC3A 4MIBA 3DLGA 4F4XA 2B6AB 1SXLA 1JLBB 2KU7A 1FCAA 2KFZA 2I38A 1K44A 4Q2LA 2OGUA 2ZITA 1T02A 1RT1A 4NZ7A 3TQ1A 3SSRA 4DEZA 4TYBA 2CKWA 1JLCA 4Y34A 1RHRB 1RI7A 2W24A 4CDIA 1XMBA 1X4FA 2WONA 2VA3A 2JVRA 3IGNA 4OI2A 4FP9A 2HNZB 4KH1B 1H3DA 3VHQA 3EWGA 4Q5VA 1K1QA 2A6OA 3OVSA 3ILJA 1URRA 4IQXA 1TU0B 2ADCA 2E1AA 1G7CB 1DTTA 1U24A 1BUXA 4C0BA 2HNDA 2AEFA 1JLEA 1H38A 2RKIB 1N5VA 2KHCA 3LP0A 4LREA 2YY3A 3KG1A 3T19A 2C22A 2XMJA 3MR2A 3RU0A 3KG4A 3CCMS 1SJ3P 1YGYA 4CNZA 3RBXA 4A8FA 3K5OA 4RUCA 2J9EA 2X1GA 3CCQS 1NHKL 1WDDA 3C66A 4NRUA 2QLJB 1TUWA 2UUTA 2QL9B 1Q82T 4GVBA 1FVQA 5KFFA 1RHJB 4OQJA 1J27A 3J7YI 4PXDA 2E9TA 2HW3A 3D1HA 2GHWA 4LBPA 1T3NA 5HANA 3A3OB 5CZXA 3NWGA 3SFGA 5I3UB 1S6QB 4OMFG 1FTRA 4J9PA 2RHQB 2ZNYA 4LIWA 4WK3A 1EX8A 1GMUA 1K9MT 2ILZA 5CYQA 5DS7A 4F4AA 2GVDB 3BBBA 3IO1A 1IBLF 3KLEA 2O67A 3WC2A 3GE9A 2IC3A 3SIPB 2HNYA 1IKYB 2YQ0A 3LA0A 3TEGA 3IS9A 3MD3A 3LAMA 4H4OA 1RU2A 1KLNA 2F65A 2L08A 4C7QA 3GU0A 3TUPA 3EE3A 3ETOA 2GHPA 3QMQA 1CQMA 3HX9A 3I6PA 2BV3A 3F0NA 4ZP8A 3OFHA 4PWWA 3C8YA 1X9WA 2RSQA 1MU2A 2CFXA 1WF0A 3MM6A 2HBQB 3MAQA 1KKHA 1AT1B 5HBMA 3IGVA 1CJKB 1Z4UA 4DV5J 2CNKB 1OWXA 1WKKA 4KO0A 1REVB 3HVTA 3KWMA 5F0UA 4ED6A 1IBCB 4YB1P 1D0EA 3FZ2A 2RIJA 3DOKA 1TAQA 2GC8A 2MZSA 5HATA 2DGOA 4PPZA 4OLPA 5MAOA 1P8GA 3RW7A 4ZIVA 3NGRA 2CQ1A 1WG1A 3LGNA 4LSLB 2FLLA 1TR0A 5LMUF 5BR8J 2V9KA 4QYZJ 3MEDA 2VONA 4NLYA 1FKOB 2ZH6A 3EXYA 2XS2A 1VBZA 4CM0A 5HAOA 2LQBA 2X1AA 4ES3A 1FVSA 1KTVA 4ECRA 2QO3A 4DQRA 3EVWA 2RE1A 4M5DA 5KFMA 3HMJG 2RH3A 3BO3A 2GJFA 3ILLA 2VPWB 3R5BA 1WG5A 4HI1A 1WOPA 3F44A 2Y0SD 1RT2B 1KR4A 5KG3A 2VFUA 2FDNA 2O01C 4GRSA 1IKXA 4PWDA 2ZM6J 4NXMF 2KFNA 3QQCD 3V4IB 4JI0J 2O66A 4XO0A 3H25A 2E9RX 4WFAQ 1YDLA 1KLMB 2QLFB 4QJVA 3D68A 3DU5A 3QLHB 4YHHF 4N77A 3A4TA 2OD4A 3OPKA 4B3TJ 1REGX 3C14B 2MZQA 3QSIA 2E1CA 4NYZA 3R9LA 2IHR1 1D8YA 1RA6A 3FBCA 2WVCA 2PI5A 1U1QA 2VG6A 3KHHA 4PRFA 3D66A 1W7WA 3RUBL 3BDPA 3WZ0A 4Q43A 1SH3A 1RKIA 2ZH9A 4ZJQA 4C98A 4DR3J 2CJBA 3HPOA 1EQMA 4RW7A 3M1VB 5KT2A 4OYOA 1GK8A 4UUXA 3FSXA 2WHOA 4ZP6A 2R4FA 3D0HE 4MK9A 4X4NA 4F0HA 3H4BA 4NA2A 1TL4A 5J1NA 4DQQA 3PW2A 5CH7B 3SV4A 2OPQA 5E3CA 3UVJA 4LF4J 3D0GE 2CQ3A 3V4MA 1RP5A 2DT9A 4JI3F 2YKOA 4ZP7A 1L3UA 2FLPA 2GGPA 1N32F 2V0NA 1ZTTA 2H48B 4DX6A 1UMJA 1ROFA 3BPDA 2XMVA 2OPPB 5CYMB 2B9YA 4CH1A 1T9VA 2I6WA 4UY8T 3PR4A 4NLRA 1SL0A 4ED1A 2DGUA 2KKHA 3CDUA 4HL9A 3CCLS 1F0XA 1UPPA 2CJ9A 4LR8A 2B9XA 3DN9A 1KVJA 2YWEA 1WC0A 4C11A 3VALA 3N01A 1HR0F 3OR2B 3A12A 3NEKA 4DL5A 4O0NA 3OW2R 2RRBA 2IMOA 1UW9A 2ZH7A 3CCVS 3PCOB 2E7XA 1NZAA 1CJVA 4WJBA 1YSJA 4ZCKA 2AEJA 3DRSB 5KFOA 4XTTA 4OHXA 5D8HB 2V34A 2AJFE 1FXDA 3FCVA 1FF2A 3TO8A 2BE9B 2QV6A 1OSCA 3BSAA 2VC0A 4EZ6A 2ZH3A 4RW6A 1RXOB 1TKXA 3K5PA 1S76D 4EWTA 5E7OB 2H5JB 1S1UA 1YRTA 1SC3B 1S5ZA 3IRWP 2K2PA 3FGVA 2J9DE 5KFWA 3NKYA 4ILMA 1LFWA 3DDIA 3KDOA 2W7AA 2SXLA 1YTYA 3KUEA 2XI2A 5IWAJ 1EP4B 3QGHA 4ID5A 2CJXB 4KE5A 1WKLA 1ZAWA 1S9GB 1UWBB 2QJ3A 4FNIA 2VDIA 5AJ3J 4WP9A 1NUEA 2PIIA 4G6VB 4I64A 3JAMY 2QA4S 3M32B 2WBRA 2ASYA 2BR0A 1N5TA 4OYXA 5GMKa 2R8IA 1HWKA 3R5GA 2VDHA 4Y2CA 4EUVA 2DR6A 5CA5A 4LSNA 2BE2B 4M95A 4QW8A 4F0KA 2FJXA 3G82B 1KHWA 1YJVA 2W1BA 3S7RA 4B02A 2FD2A 4P7VA 5F3TA 3Q8VA 4ALZA 3TZWA 1JNRB 4CM2A 4K2JA 2RHSB 4R5PA 1QSYA 1P1TA 2MHNA 1F2GA 1N6QA 5LT5A 1PG5B 3HJFA 1VFJA 1JKHA 2J6TA 2DJWA 1HWIA 1PYSB 4HACB 1LOUA 2EW9A 4J9OA 2IAJA 3DOMA 1F5CA 1N0UA 1N52B 5DDQC 1Q78A 2IDEA 2ASJA 3I5BA 4O3QA 1KOOA 3PHEA 1GNKA 4MMOA 1PGZA 2J0WA 3UWTA 4YR2A 2JOQA 1NKEA 1O51A 3Q8UA 5GAHU 5F3ZA 4OI4A 1N48A 1ZM2A 3J81Y 3GPAA 2W4PA 3H2LA 2YNIB 2R42A 1NDCA 4JI2J 4ED2A 3MMBA 5SUHA 3JAMU 3R2CJ 2Z57B 4I4BA 3BSCA 1J5EJ 4KV8B 3A3NB 3DHXA 3HFZB 2QMXA 3KK2A 2IRYA 3CVKA 5DGAA 1RBAA 3PIOQ 2NREA 4YEAA 4LFAF 1HI8A 5I42B 4F50A 2NUUG 5HP1B 1HA1A 1FXLA 2D7SA 4DN0A 3FUYA 1U1KA 3LTOA 1XMOJ 1U1OA 2MLYA 1HMVA 3GJRB 1O5JA 3I31A 2LDIA 2Z2MA 4CT8A 2K7KA 5D0HA 2DGSA 1XIQA 4LF1A 5B09A 3GIKA 1IM4A 1RT5A 1NK4A 2VG5A 2KM8C 2EFNA 1RB0A 3CJRA 1AA1B 3K57A 1U09A 2OP5A 5KFCA 2FVQA 2ATCB 1HI1A 2JLGA 1HNZF 4G1PA 3UR3C 4RNFA 1RTDA 1JLGA 4IDKB 1T7PA 1JXEA 1FO1A 2KHDA 4BBYA 2CPHA 3A8EA 5KFNA 3CSKA 3PR5B 3H4DA 5HJYA 2Q79A 2UV8A 4R0EA 3FJ2A 2BW7A 5HN0A 1LNQA 2FYXA 3KLVA 1UETA 3Q83A 4CYUB 1D9DA 1NPRA 5ETTA 2NXEA 2ZD1B 1WF2A 5D4OA 2BJDA 4NI2B 3AJDA 2J76E 3A13A 5E0OA 4DZ6A 2C3YA 2PGCA 2E29A 3HHNB 1QUVA 2V4JA 3JYTB 2XLKA 2W2PP 3T9NA 2HFZA 2B0GA 4F26A 4OIXA 3RBZA 5C5JA 4DU8A 1DQ8A 2BM0A 3AJ1A 2XY7A 3BGOP 1Y5LB 3FDSA 3EMTA 2UV8G 4ECQA 4J9QA 3AFGA 4NMLA 3QRQA 2GJ2A 3QRPA 4DUYF 3D6TB 4DJBA 2U2FA 5GMDA 1UJ5A 3T1HF 5KFXA 4USIA 3UDLA 1RWKB 4ENOA 1NSPA 4Y2AA 1RTJA 2BDPA 4UZCA 4YR3A 2LEPA 2LKZA 4IR9A 2N82B 2CQPA 4I2PB 2XCPA 1NHVA 1NK0A 4WTYA 2DNOA 1KSPA 3CC4S 3M4XA 3Q8RB 3IBFB 5E3AA 4DR1F 4HHHA 1LKZA 4LT6A 2EG1A 3CJ4A 1D1UA 2CG8A 4USJC 5T7LA 4B17A 3K5LA 9ATCB 2DHSA 1X5OA 2OLWA 3M30B 3MM5A 1N0VC 2ZH1A 3NNCA 3MEGA 1T03B 3DU6A 3V81A 1RLDA 4KFBA 4CCHA 4NCGB 1X9MA 2E5JA 4OJ3A 4JOUA 1HNIB 1MWQA 1IBLJ 4V19X 2RDDA 2RD5C 2GA7A 5AE1A 4A46A 1R6YA 3LW5C 3SV3A 3MCNA 5J2QA 3CJ2A 4QIFA 4NLPA 3RYLA 2HQ3A 3I56S 3D3BJ 1YJUA 4NLGA 1AYEA 1TKZA 1S7HA 1G6BA 3EM1A 2HFUA 2FIUA 4DL0C 4UY85 2DNMA 4WXWA 1IWAA 4IOAQ 3EDRB 4UUWA 2IBKA 3HM9A 2B6AA 3T1YF 1P6TA 2O5DA 2YPZA 2HAIA 4CP5A 1TFWA 1OJ4A 7FD1A 4J9UE 1SC1B 1FJEB 1RT6B 5D0RA 1NEEA 4W90B 3CGIA 3CJTA 1S0MA 2WW4A 2KDOA 2HHWA 1PSDA 3TVZA 2HLUA 2G2OA 3D1OA 4MKYA 3KJFB 1KQKA 2HNZA 1MWYA 1LFPA 5IV4A 1DHMA 3H42A 5G4DA 4AL6A 3CMES 3OXGA 3MGJA 1KWMA 3DRRB 4OZNA 2KYZA 1R89A 2W9BB 1JJ2R 4UOCA 2ZZNA 2HBYB 3MUVP 3UQSA 2RKIA 3PVXA 4B3OB 3H5UA 4C97A 2RNEA 1S1WB 1UL3A 3HHEA 1D9AA 3R5DA 2Y8WA 2HQFA 4DSEA 5CXTA 5GMEA 4OLOA 3P4UB 3VWSA 2G9OA 3NG8A 3V6DB 2DH9A 1B0PA 4B3RF 5A0YB 4L6V3 1YJWS 3DLLQ 3NMRA 2OI2A 2ZZTA 3DGPA 2QEXS 2ROPA 2YQ1A 4JV5F 4NEZA 2D69A 4BWJA 3GZ7A 3G4SS 2X3DA 3PXGa 1ELOA 4NXMJ 3QZ7A 2X1BA 3TAQA 5KFRA 4ZKAA 3OSPA 1VQ9S 4N47A 5I3UA 2I0XA 1K8AT 4DUZF 1SKRA 1DQ9A 4IKAA 3MPUB 4YHHJ 1JB0C 5DM6Q 3QGPA 1SPBP 4A8QA 3VGUA 3TA2A 1X7VA 1UP1A 2W01A 2GVDA 4Q0BB 2CJYB 2CXEA 3B54A 1IKYA 3HHLD 3CIZA 4KGZB 1WHYA 3QAUA 2W7PA 2WAQD 1M5VC 2VC1A 3QAEA 3MM8A 4NA1A 3MR3A 3TA0A 3R5AA 3TZZA 1N56A 3ISND 1WEYA 2FVCA 1FWLA 2EFPA 2GZOA 1ZZNA 2BRLA 5D77A 2ZH5A 2QT7A 1Q16B 2A1BA 3TZXA 5HROB 5E41A 1L3KA 1DZ5A 3BQ1A 1W2BR 3M8QB 3MCOA 3QRRA 3TAMB 3MUTP 5F8HA 2V63A 3O1LA 5A76A 4JI3J 3OL9A 1FJGJ 3J7YU 5J2NB 4WTOB 1CJKA 2ZJRQ 3MI7X 2BVZA 3MPVA 3CDEA 5A8KB 1REVA 2MMYA 1BY9A 2YKAA 1BD6A 3A1YG 2Q43A 2IM0A 1GEHA 4X4UA 3OFEA 5LJ5Y 2R7SA 1V3RA 4ZVOB 1U7LA 1ACMB 1TUGB 2V6AA 3KG0A 1QSSA 2E5LJ 2AW0A 1V6HA 2MKHA 2YBVA 3CF5Q 2YNHA 3KHRA 1F6TA 3R27A 4KKOB 4QPTA 4LSLA 3GILA 4B9TA 1FD2A 1VBKA 2BZ2A 2QLBB 4O3NA 1FKOA 1EETA 3OTOJ 4BHQA 1HR0J 4G1IA 4EYHB 2Z58B 1JLAB 3NY0A 1F3VA 1GMWA 1K1SA 2X1FA 3ITHB 5AT1B 4UOHA 1FX4A 4IFVB 2FVSA 3T6BA 4C8KA 1APSA 3THVA 1GMVA 2X51A 1IXKA 3FBBA 3AQPA 3H40A 1VQ7S 1RT2A 4XPEA 2DO4A 1D8ZA 2E1RA 2MJUA 3UCGA 2PA8D 3CE8A 4V1Ak 3POTB 1JXLA 2R8GA 2DR5A 3KK1B 3MTKA 3V4IA 2QE5A 4RBTA 1B99A 1NBEB 5L39A 3BH6B 2ZOGA 5KFVA 1SH0A 2HHPA 1K0VA 4ZN1A 5DJBA 1IBMF 1K73T 4X4RA 3DNCA 1NZ8A 3CT9A 1WNEA 1VIXA 4IO9Q 3C14A 4ANDA 4KPYA 1UFWA 3Q24A 1FFWB 4NX9A 4U7UD 3SYZA 1OMSA 2W8LA 2K06A 3TR5A 1HBNB 3V6JA 2NR0A 2FZCB 2BUNA 2BQ3A 2DRDA 3NP5A 1B64A 2AHOB 2VBXA 4CLUA 2JNJA 1DLOB 3LGMA 2F5GA 1RAHB 1R43A 4AQYJ 4DX5A 3M1VA 4ES1A 4JI1F 3UNYA 1N34J 1S6PB 5EDWA 3DLHA 3GV7B 4FS1A 5B0GA 2E9ZA 3RGIA 5HSPA 2MLXA 5KFBA 2VICA 4N7TA 5F8JA 1RHUB 2V5HG 5DETA 2AYEA 1B3TA 3ZC4A 1EB0A 3HXMA 1FD8A 3CCTA 1UA1A 2ALYB 3R6LB 5B0AA 4DFKA 3Q0AA 3SCJE 1RA7A 4DSLA 3PY8A 1VDHA 1F5AA 3GJTB 3PRVA 2JC1A 1S48A 3IM9A 2OPPA 1AUDA 1WC1A 5CYMA 3ADAC 2PC6A 4URQU 3I4HX 2D3O1 1D3WA 4ILLA 3B78A 1Q5YA 4RBVA 5EWGA 2K3KA 4ES2A 4X64J 3IFEA 4I56A 3H8YA 1UAWA 4AFFA 1LWFA 3W8PA 3M9NB 4HYKA 3OR2A 2BBEA 3NS6A 4ED4A 1S9FA 4FF1A 1K47A 3JXOA 5KT7A 4KHMA 2FPHX 3TEHB 3DRSA 2KVIA 1FKPB 2YWFA 1UVJA 2FJBB 2P6TA 3N5FA 1WACA 3Q89A 4CLWA 2HURA 3HHDA 3ZZPA 3AOAA 3NL0A 1S1TB 3UN3A 3NWRA 4PR6A 1U1RA 1SL1A 4FXVA 3MM9B 1YJRA 4HDHA 2Y0BB 5F9NA 2U1AA 1PYTA 2EK1A 4AUKA 5B0FA 3CEDA 4USWA 1CLFA 4TY9A 3DDNA 1FJ7A 1UCNA 1PIEA 3W60A 3C6UB 2FY1A 3QWPA 4PABA 4URSA 1S0OA 2OIHA 3BO2A 1LW2B 5BXIA 2Z2ZA 1QVFR 2DCLA 1EP4A 3W9HA 2HHQA 4EZ9A 2LXUA 2P2CB 4XIUA 5L8RC 5DRKA 3C46A 2E5GA 4WFZA 1S9GA 1UWBA 1VYAA 2E44A 2D9PA 1JJ4A 2E7VA 2XM3A 3KK3B 2NXUA 1RCXB 3M32A 3HO1A 4MH8A 3K59A 3RRGA 3P96A 2FJEB 3QBCA 3Q23A 2KZZA 2BE2A 4P7TA 3OHAA 1HNZJ 1YK9A 1GTEA 1N36F 2DNLA 2PD1A 3G9CA 1WTBA 3KHGA 1I1GA 2ZBRA 1NSAA 4NCBA 2ZJQQ 2Z2LA 4IRCA 3CCUS 1TMJA 2DRBA 1VR6A 4K4TA 3THPA 1KHVA 2F9DA 4DPXA 3A8KA 4HACA 1ZETA 2UZAA 1WC4A 2ZKUA 1EAYC 3TANA 1U26A 5H9FK 3D67A 3L4BC 3E01B 2N7CA 1JJCB 2R7RA 5CCLA 2FQQB 4M5NA 3QJJA 4RWWA 3H5YA 3IC1A 3DLEB 5B0DA 1S1VB 3M05A 3U1MA 2ZJPQ 2B7CB 1RT3B 4ZVEA 3T1HJ 4A8OA 2NXNA 2DVIA 4NWBA 2YNIA 2BA9A 5A8RB 2D1CA 2PN6A 3C6TB 4I68A 3OVBA 2OPRA 2XWXA 4F4YA 3P8BB 4KV8A 1S7IA 3ENWA 1B0TA 4DR1J 2BANB 2D3ZA 3OR1B 1UKUA 2AIRB 4PXCA 2C2EA 1LQ9A 1H7XA 3R6GB 4JI6F 2E1PA 2W8KA 3BKFA 4WE1B 3IMQJ 4ED0A 1KP6A 1HW8A 1EIYB 1O0PA 4MIWA 4JI4F 1X4BA 3UW1A 3CO0P 2DB1A 2QRRA 3DHWC 2P9EA 8ATCB 2NSBA 2WSEC 4MAKA 5DDOC 4OYAA 2I5JB 3QT7A 4CI0B 2COLA 2YKQA 1R27B 2J9CA 2DNQA 1XQIA 5D15A 2HHTA 2LLZA 1H98A 2YWGA 4DR5F 3PJXA 1ZM3A 4FYWB 2KG1A 4LFBF 4DN9A 2WK4A 2J0SD 2LQJA 2KFYA 5IOLA 1SVDA 4P72A 3MFIA 2XB2D 3J7Z5 2DKOB 2DEIA 1F2HA 1UPMB 4PG8A 4WZQA 4P2XA 1U6ZA 4LF5J 2LP4A 3QO9A 4CYUA 4C4WA 1I94F 2DXEA 5DG8A 3CJ0A 1IN0A 4FZVA 4ECSA 3BJYA 1TL7B 2CQGA 2JEJA 2VASA 3AD7C 4NI2A 3R97A 2C3PA 2R2UA 2WB4A 4CO3A 2EBEA 1KNZA 3Q86A 5A2QU 3JYTA 4ER8A 4OHYA 3CCRS 1L5UA 4DQSA 4DV6J 3G86A 4UT4A 4A8XA 2VQEF 4OZ2A 3QJLA 4E2FB 4NLSA 4TNOA 1RWXB 1NDPA 2CPEA 3PW7A 4P9SA 3U7JA 2MGZA 3W66A 5F8GA 1IR2A 1RU1A 3I87A 1L3SA 3O3LA 3IA0A 1TKTB 1NKCA 4DLGA 1F9FA 1OS5A 3C3LA 4Q8EA 1HBMB 4I2PA 1IKWB 1Y3JA 3OT9A 4KC5A 1JQGA 4B3RJ 1TZ0A 4C2MA 2VFSA 1YRXA 4C0OC 4ZLPA 1HQEB 4H54A 3BPSP 1WHWA 4DPYA 1SJ4P 2NXJA 3PW4A 3G2XA 3JQJA 3R2DJ 1QJHA 3ZZTA 4RPFA 3GSDA 4JV5J 4NLWA 2M8HA 1N54B 4YDXA 3BGRB 3TNVA 1HBOB 2NYIA 4DUZJ 3G6ES 4PXBA 4NCGA 1FI4A 1PBUA 2MEWA 1Q1KA 1XK8A 4JI7F 5MLCV 2M88A 3UO0A 4QYZK 4F3MA 3JSYA 4OZJA 3DRXA 3C15B 4OV6A 2UVUA 3VAIA 3UDVA 2KZMA 1BQNB 2OUGA 1NPKA 2N4DA 1R6VA 2GMHA 4TN2A 2VQFF 1P9YA 2W25A 2ZC3A 3EVOA 4EFAC 1SBRA 3H59A 4QCLA 3BYPA 3K5MA 1N5QA 1RT6A 1DURA 4FF2A 3I0SB 2ZOFA 1CG2A 2FGOA 2V67A 2OSRA 5DDPC 1U4BA 4F7VA 3BB5A 1RAFB 3DRRA 2JEIA 1AB8A 1HFEL 2W9BA 4EBCA 2W4DA 1XTZA 3AA8A 1GH8A 4HLBA 1S1WA 5IC6B 3D7SB 3N6NA 1WEXA 3W61A 1W2IA 3AQOA 1S99A 3VQTA 2HMIB 3BKUA 2RT3A 3VGSA 3ZO7A 1HI0P 3V6DA 5A0YA 3O6QA 5EX0A 1UA0A 2MKYA 3QWUA 4ED7A 1AUSL 3DLJA 3T5LA 1YITS 2D41A 5ETNA 1FXRA 2O3DA 2GAHC 2MY7A 4X84A 4FS2A 1VQPS 1NJIT 4LMZA 1CPZA 3CB4A 4QIVA 3KDNA 1M90T 1X5TA 3LPYA 2POKA 1KTQA 3QATA 1YHQS 3Q2TC 5J1EB 3P49B 2DHXA 4Q0BA 4ZVPB 1SV5B 2NS1B 2R7VA 3PZPA 4AL5A 3PO4A 3CD0A 4WPAA 1T0TV 2HQDA 4NCAA 1H0HB 1RSCA 1NSKL 3W2WB 2UXCF 4B3MF 3ISNC 3KKFA 4JI1J 4HTIA 4ZVUB 4K4XA 2XSFA 5HROA 2LEBA 3SZ2A 2LECA 4U67Q 3M8QA 2V8HA 2BKOA 3OXFA 3QT8A 1JWWA 3TAMA 4QU7A 1R8PA 2EPIA 5LSOA 4L75A 2J7UA 3IM8A 5J2NA 1OO0B 1UTAA 3OQ2A 2A10A 5IM0B 2XYHB 1VHFA 5A8KA 4X65F 2RU3A 2AEMA 5BYQA 4MK7A 2HQIA 1U2FA 3MCSA 1VQSA 1FDDA 6FD1A 1KFSA 5L1KA 4KKOA 4F8RA 2JX2A 2NLWA 2OPSB 3U1LA 2XZTB 2AYGA 4K4VA 4OYWA 2CZ4A 4X4TA 5EHHA 2DBBA 2JLEA 2DHHA 2A6MA 3PRBA 4W92B 4F25A 3PYFA 4LF7J 1JLAA 2I2YA 5LXYA 2CPJA 2FHOB 2XZDB 3NBPB 3ITHA 1A6LA 1EARA 2OD6A 4IFVA 2J9DA 1A7GE 3M8ZA 4AYBD 4KHRA 1GMWD 3BS9A 3TWZA 2VPZB 1U48A 4MK8A 1LWCB 4WFNQ 1MNEA 5D78A 1CJUB 3HHKA 3JSBA 2GQ2A 4C3LA 4KGKA 5KOXA 4M5IA 3KK1A 3WDOA 3GIRA 2JEFA 3D5MA 1B0VA 2BOPA 4CLPA 1SCJB 2C2NA 3QJPA 1L3VA 1Y5IB 1FWPA 1S4EA 2C28A 2B3TB 2L48A 3KXDA 4TLRA 2G4BA 4WIIA 1OPZA 2B5JB 2JVOA 1L3TA 2UVWA 2NXCA 2KN4A 1HBNA 1D9FA 3ENVA 1N88A 2FUG9 2YKPA 3PFOA 3RW6A 3BO4A 3BYRA 2DNKA 5IT9U 3ZNJ1 1DLOA 1XBWA 2QMUB 3HSJA 3PX4A 1CULB 3MR6A 1RISA 3TUIC 3E3XA 5K8NA 1X8DA 1OY9A 3PYEA 4ZPCA 5KTQA 4OZ3A 1PJ7A 4DSKA 1FESA 5KT4A 1IJFB 2PDAA 5C2GA 4U95A 4V19J 5KT3A 2HVEA 3VCDA 5GADI 3HZGA 1FX2A 5DZ6A 2B8PA 2LU2A 3NCRA 2B9EA 2MKSA 2RB7A 4DCOB 1TVRB 1M5PC 3GYGA 4WZMA 1XEZA 2C1EB 1KD1T 5IXUA 4TU8A 4LF8F 3DYAB 3RB4A 3KLFB 2H9ZA 1NU4A 4ERDA 1HYSB 2OAUA 4B3SF 2Y8YA 1D09B 5KG4A 3DDKA 5KFPA 2QL7B 5DG7A 4DX7A 2MQ8A 2KT2A 4WF9Q 2VKZG 1SL2A 1G1XA 4HH1A 1RYRA 2DIVA 2DGTA 1XN9A 2QGFB 4YQWA 2DPIA 4J5OA 3MHYA 1R0CB 3D4JA 4M5JA 4C8NA 4DR7F 3B6BA 3OTBA 1Y0HA 3HD2A 3TP2A 3CMQA 4USTA 2KTQA 4MT1A 1W26A 1FKPA 3QFWA 1TK8A 1HPZB 1Q8KA 4RNHA 2YNGB 4TQRA 3GFHA 4ICLA 2IA0A 3G8TA 1YBTA 1QTMA 2UU9F 4PQUB 1S1TA 4YB5A 2UUBF 3MR7A 2R3VA 3AOCA 5M2PA 4DR6F 3D6MB 3GMGA 3MM9A 4LRCA 2HGLA 2YNFB 4JI6J 2KVQE 3GYNA 1TTHB 3PJ9A 4ZOSA 3UNGC 1CQNA 4USMA 1Q0NA 2FHJA 2F4FA 3C6UA 3Q8PB 4I1TA 4JI4J 1LW2A 2ALZA 1XNRF 2HGNA 2DNGA 5A6PA 1Y00A 4YMEA 1HQ2A 1YJTA 4N76A 2C42A 3VAHA 4C3KA 1SIZA 5ADZA 4S0MA 3KK3A 3D0IE 1VCTA 4M5KA 2ZDOA 2EXUA 2VHGA 2WB1D 1UVMA 2ZKTA 1R3NA 4ZPAA 4OYZA 4DR5J 1TV6B 3VGVA 2VFTA 3PDNA 4IRDA 5L9XA 3LALA 4LFBJ 3H90A 2XGPA 2XBPA 1ZS6A 2IA6A 1P1LA 1QY7A 2CWKA 1SJQA 5B0EA 5DZ7A 2GVZA 3G96A 3I5AA 5KG6A 1C4AA 4DWIA 4CLZA 3ILOA 3I55S 3LP0B 4LR7A 2FJWA 1XC9A 4ELUA 1ZM9A 4ZLLA 1I94J 3T5KA 5EGYA 2AQ4A 5E3PA 3E01A 3UFCX 3GLJA 5KG7A 2GAGC 4O4RA 1VQ4S 4RW4A 2B4UA 3H0PA 2W9CA 3DLEA 1WI8A 5F8MA 4HEA9 7FDRA 4DSFA 1AROP 1S1VA 2VQEJ 2FLNA 3TUZC 3LP1B 4J9MA 1KQGB 4QW9A 3K17A 1TELA 1RT3A 4YN3B 4HR2A 1KN6A 4FYDA 3OV7A 1EKSA 4DBQA 4OJHA 4ZLNA 2W4CA 1HD0A 2DCUB 1OY6A 2AWZA 3MPWA 4HT7A 2GHVC 5G0RB 2GCFA 3EGNA 4DG1B 2MKJA 1LXNA 1WORA 2R2TA 2EVZA 5A8RA 3HHLB 3C6TA 3VV2B 1GTHA 2FY8A 1NK7A 3EICA 3O44A 3I4PA 4CIOA 1HL6A 2KRRA 2BANA 3LQVA 3IS9B 3OR1A 3PW0A 2OHDA 2D9OA 3NNHA 2NCKL 2RUSA 1PAEX 3PX0A 4WE1A 4Q7AA 4U7CA 5EWEA 4M94A 2MTLA 3CTRA 3CMAS 3LUYA 1BE4A 4DV1F 1U45A 5FLXY 1F1BB 4HI2A 1RAJA 2CA9A 4I0WA 1NJXA 4CH7A 4JI8F 1ICEB 1NJWA 4GKJF 2HZCA 2YWHA 4JI7J 4DV2F 3JTPA 3CXCR 4DX8H 1Z2ZA 2KG0A 2I5JA 3TAPA 2GS8A 1M1KT 2DNZA 2ZWOA 1RHMB 4FF4A 3S8SA 1S6UA 3ULHA 4DU7A 3DRPB 3NAIA 2G0IA 5J2PA 2AT1B 4MKVA 5EN1A 2DXDA 3IWXA 4ZHRA 2V69A 4IG3B 2M5YA 4NLDA 3ZZUA 1T95A 2XMUA 5KFYA 2XYGB 1WKJA 2VQFJ 2RQ4A 1SH2A 3UD3P 2W2MP 2MXYA 2W9AA 2XO6A 4CO5A 1KVIA 3QNWB 4PPDA 1P27B 4Y65A 1J5OB 2RMLA 2PSZA 3AXKA 3TJAA 5L46A 4YB6A 3M2RB 2AJ4A 4OYBA 3HSZA 2IJRA 3G6VA 4ED5A 3I96A 1NMEB 1BLUA 3KUGA 1RAGB 2CDRB 2UVVA 1TL7A 2ZEJA 1EKRA 2GX8A 4B08A 2H1YA 2GMJA 3MM7B 1K0TA 1ZAVA 2QYGA 1QE1B 3MMJA 1UEUA 3QSYB 1SC4B 3NGTA 3EYZA 3HSGA 2N3OA 3PYGA 4EU0A 2FTRA 3OL6A 1NB7A 4N56A 3TZYA 4LJMA 4Y3CA 1IQZA 3WX8A 2LXIA 2DPJA 3NGUA 1AFJA 3W9JA 4ZA1A 3PNIA 2Z0GA 1HHTP 4Y2IA 4N8OA 5B0CA 1HNVB 2HWIA 3BGFA 1Q8IA 1IKWA 3DOLB 5L1IA 2MJNA 5AE3A 3DLBA 2V4QA 3H5XA 2R7OA 1HQEA 4Z2XA 2UUCJ 2N3LA 2DISA 4OHVA 3R1HA 2OEJA 5CD4A 4CLYA 4KB7A 1DY3A 2N4CA 1C0TB 2V8GA 5DG9A 2VODA 4DPOA 3BGRA 3HLUA 1OQ3A 3GG0A 2XULA 4KJIA 1V9OA 1S79A 4OZ1A 2HS4A 1HBOA 4IUFA 1DQAA 2IVYA 3B4DA 2V2ZA 1VQMS 2WOMB 4ECXA 2KT5A 4IG0B 3MECB 3RB3A 2VG7B 2XWYA 4LVNP 3CDBA 1NLKL 2A18A 2RDJA 4CO1A 2CNNB 1S12A 4FVCA 3E51A 3C15A 1FRIA 4L3NA 4P73A 2MDAA 3BZQA 3QT6A 1WSVA 1WI6A 2OEMA 1ZPWX 1WHXA 2DITA 2WVBA 3P5BP 1X4HA 3ET6B 1N5YB 3D6HB 2LU1A 2UXCJ 1G2EA 4K2XA 4B3MJ 1RWWB 1Q95G 5I3QA 1BGXT 1BQNA 3NOGA 4TU9A 1UJ6A 3GFYA 5HMYA 1IKVB 2F7VA 2HHUA 2R7XA 4OI6A 1CEZA 2VIHA 4W98A 2GQCA 4C11B 2C3MA 4FKXA 1RAIB 3OD2A 4NMXA 2A3JA 1ZTWA 2QLXA 1MROB 3I0SA 4G65A 2R7UA 4X65J 3T9ZA 1FA0A 5E3QA 3X1LB 2MQLA 2G2ZA 2OTLS 3TOQA 5GVQA 4DFMA 1YZ7A 2HQGA 3QYYA 4JI5J 3VZIA 4WYWA 1DBDA 1LWXA 3M2UB 3Q8YA 2Q6BA 4RW6B 3F41A 5KFIA 2YX7A 2R7TA 1MMLA 1S1UB 1C1CB 2QA4G 5IQ6A 3J80Y 4IRKA 4LVOP 3RR7A 2B4VA 3I9V9 1FDBA 1S97A 2HMIA 3FEXB 1R8HA 4JV2A 3VVUA 4USHA 1QM9A 3OUYB 4YY3F 4F3OA 1VBXA 4ID5B 2F4VF 3LP2B 3RG6A 8AT1B 3BKTA 2DR9A 4UW2A 3MMCB 4ZVTB 3N9UC 2F63A 3LO3A 3BN4A 4DV3F 1VJWA 4AL7A 3L3CA 2XLJA 2GW8A 4WXOA 1N33F 1RJJA 3THTA 3T41A 3WQPA 4UF4A 4QU6A 4MIAA 1TUVA 1O8BA 2YXLA 2L41A 3M8PB 3R7SB 3EXCX 1YJ9S 2DXFA 4YUDA 1KQFB 1IVZA 1SV5A 4YS2A 2HFNA 4ZVFA 4C9DA 2E66A 1BMQB 4LF2A 4ZK7M 4OJ1A 3ISZA 1MN7A 5CHCB 1VQNS 3EZUA 1V5VA 2CG4A 1N6QB 4RW9B 5AXNA 3KLHB 4J37A 3W2WA 3PRDA 4GC6A 3O5TB 4K4SA 2VBWA 4DR2F 2AZ1A 1JKHB 3T6JA 3HDSA 4P2SA 4LBIA 4ED8A 4NLXA 2YWKA 5GAGI 1A0OB 3W65A 4HH0A 2C2OB 2LFVA 2OH2A 1RHQB 3DC2A 1FFSB 1Q8BA 2DH8A 2ZVSA 1YQHA 2XHWA 1DARA 2B43A 3J80U 4NLVA 2RJZA 5DLGA 1FRXA 4LF6J 4NLTA 5A8WB 4IQMA 5K8PA 3RAXA 3G8QA 3CCWA 4LF8J 1XR6A 2DNRA 5IM0A 2B8QA 2Y3YA 4QZVB 4AT1B 3SCIE 5KFQA 2KT3A 3I0RB 3FRYA 2YKMB 4YB7A 3G8SA 4B3SJ 5CABA 2BKNA 2GO8A 1RWOB 2MQMA 4P71A 1YRUA 1XR5A 1RGVA 3MMBB 2R8KA 4K4UA 5U47A 3U1NA 2VFRA 2ZUAA 2E5IA 5THWA 1DJ0A 3KLGB 4FKYA 4DV4F 2ILYA 4FNHA 5DGBA 2VL1A 1WJ9A 2QYCA 3NBPA 3I9ZA 1LK5A 3OBIA 2K1RB 1S59A 2CUYA 4DR7J 4K8RA 1ZOTA 1HD1A 4WKRA 2HPUA 3MFHA 1R0AB 3UCZP 1LWCA 2I8EA 2M52A 4TQSA 4TVAB 1CJUA 4NOHA 3HVWA 1Q8LA 2KXHA 4FYYB 2AP6A 4XDDA 4FXWA 4R8UB 2UU9J 2KB2A 2RS2A 5EUHA 2MZJA 2UUBJ 4JYAF 4EI2A 1VK8A 2IVFB 4DR6J 2RRAA 2QA2A 3H2UB 3IAM9 2EBGA 1R7IA 4N8NA 2DGWA 1Q81T 3FSIA 4C3MA 4KSEB 3US5A 1PJ5A 1S0NA 2MSTA 3OHBA 1E6YB 2B5JA 3RB6A 2HRYA 1JLGB 2WRMA 3CNQP 1XNRJ 2HS0A 3CWJA 2GFFA 3NNAA 4CH0S 1KS2A 3SXLA 1FDNA 1MSWD 2JFDA 1X9SA 5H9EK 3J81U 1QDUB 1QTNB 4ZMMA 2MYFA 2D74B 1FEHA 3PKYA 4WWSA 2ZFHA 4BWMA 3WX4A 4M1KA 3NCQA 2HWTA 3MDFA 1RAAB 1S1XB 1V3SA 1NK6A 3R5JB 3MAHA 3R7BB 2AU0A 2WSFC 3RAQA 3PJWA 3KYLA 3MF5A 1MWZA 2ABYA 4O4GB 3KUHA 3RTVA 3DMJB 4M8LA 5K14B 1NRKA 4RX6A 1FNOA 3R3TA 4UZBA 2Z30B 1KONA 5T41A 2HK2A 3KLFA 4QQBA 2O1PA 5FIIA 1NJYA 4AXIA 1ZA2B 3PKMA 3MMAB 2HHSA 1Q7LB 1KEKA 1HKAA 3FSYA 3DKDA 5AXMA 4K7QA 5ITHA 3SI8A 2J6UA 4K50A 5HVHA 1B7FA 3CJ5A 2G13A 2EG2A 2MPUA 4CTAB 2CQCA 2LXFA 2HWHA 4KGXB 1PCAA 3B82A 2Y9HA 2C2KB 2CWXA 2B7BB 5T7LB 4ZVGA 1LW0B 2C3OA 5KFUA 1F3FA 3TI0A 2DR8A 1IR1A 1FJCA 2N7YA 4KIAA 3MURP 4L72B 2XY6A 4DXLA 1U0HB 5GADU 2VU5A 3DFEA 1T3OA 4M5GA 1FKAF 1HPZA 2KXFA 2YNGA 4AE5A 5F41A 1U1MA 3BSOA 1FRHA 4BCAA 4OI0A 2NUHA 4FBUA 3ILIA 1BWEA 1GQEA 3N79A 1FE4A 3K8WA 1CJTB 3UI3A 4ECVA 1RAEB 1U2CA 4K4ZA 5HO4A 4QWDA 4DCPB 1M5HA 2HVIA 2DGQA 2YNFA 3CPWR 4ZN3A 1NNDA 3T3FA 4C8MA 2F1FA 3RZAA 4OI1A 4B9NA 1UVNA 4LRBA 1X4AA 4LRAA 4DV1J 4MKBA 2D3UA 2XMAA 2AF6A 1A9NB 2VB6A 5F8LA 2FHJD 3FRZA 3UN5A 4DPTA 4JI8J 4GKJJ 2XC9A 4PUOB 1JLBA 1GFWB 2CQBA 4LF9F 5K8MA 4DV2J 3T1AA 4I7FB 5E2QA 5BJRA 1WDTA 2R7WA 2CPYA 1PO6A 2LEAA 1UFKA 1VISA 4RW8B 4JV1A 2CJKA 5C25B 3S1TA 2QFIA 3I5CA 1TV6A 5K9FA 4FVMA 2CQ4A 2HGMA 1VRUB 4L73A 2W7OA 1YBUA 4WP3A 3VTIA 4URGA 3ONQA 2YX4A 1M0SA 4R25A 5JUMA 2OKQA 5LMUJ 1R31A 3FQLA 2HBZB 1DRZA 4ZJLA 2ZH8A 3MWBA 2F8MA 5M2RA 4P6QA 4IH5A 2QMWA 1VQOS 2KO1A 1S72S 1VHIA 2IRXA 3ENAA 3QGIA 2MQQA 2BACA 2AYBA 1TMMA 2UUWA 3PEJA 5C2CA 3LANA 4F67A 3ZZOA 4PG7A 4UTGA 4O0IA 4RNNA 4O3RA 2NPFA 1RWUA 1IUJA 3DGPB 4ANCA 4QWAA 1OYEA 2XO7A 3LP1A 4USVA 1FK9B 4NASA 2PO4A 1WUUA 3SEOA 1FWKA 1S6QA 1SQFA 1VC0A 2XMTA 1U8WA 2EK6A 4YR0A 1UW4A 5G0RA 2K3IA 1DFDA 2P8IA 4DG1A 1LV5A 3M8SA 1C1BB 2HBRB 1YJ7A 3HHLA 1TQLA 2WVDA 2Q66A 2RILA 4Q45A 1JLFB 2HS3A 3AXMA 4X62F
chains in the Genus database with same CATH topology
2ASJA 4KBIA 3I5BA 4HTIA 4O3QA 3ZZZA 4H4KC 1KOOA 2J6SA 3PHEA 1GNKA 2IYIA 3CD5A 4MMOA 4K4XA 2XSFA 1PGZA 5HROA 5AE2A 2LEBA 2J0WA 3UWTA 2MKIA 1VQ5S 2DHGA 1GAOA 3FNNA 5BYSA 4YR2A 3SZ2A 4DV7F 2JOQA 1C2PA 1NKEA 4J9SA 3MM8B 2LECA 4U67Q 3FVYA 1O51A 3LWLA 4FBTA 3V6KA 3M8QA 3D2WA 2L3MA 2V8HA 2HHHF 5CYQB 2AJ1A 2YH0A 3OXFA 1FRJA 2JLFA 5GAHU 1JWWA 3TAMA 3P6YC 4QU7A 3WBZA 3KLEB 1R8PA 3FZBA 4G1QA 2IC3B 5F3ZA 2KI2A 2HNYB 1MW7A 2EPIA 2JFKA 4OI4A 3L95X 4RZRA 4YOEA 4IR1A 1GXUA 2MY8A 1N48A 2HRUA 5LSOA 4LQ3A 1ZM2A 1FNXH 3CCJS 3J81Y 1FRKA 2AGOA 1LXJA 2W4PA 4DQIA 4K59A 4H4OB 2ZBIA 3H2LA 2YNIB 2GNKA 4GC7A 4MFBB 2J7UA 4E8UA 5J2NA 1OO0B 4ED2A 3MMBA 3OQ2A 5A2QY 5SUHA 3HF5A 2A10A 1SUQA 2J5AA 4O44A 4EO6A 5IM0B 1VHFA 3BF4A 5A8KA 4I4BA 4X65F 2MQPA 2ZZMA 4ERDA 2RU3A 2M3DA 3BSCA 2WTFA 4KV8B 3MXHP 1JNZB 3P5TL 3DHXA 4OJGA 1HNXF 5BYQA 4MK7A 2JC0A 2HQIA 3M2VB 5I3PA 4OL8A 2QMXA 1U2FA 3KK2A 4IYQA 5F8NA 5HL7Q 2IM2A 3MCSA 2IRYA 2EFOA 1VQSA 3CVKA 3Q8SB 5DGAA 1CVJA 3ZFVA 2PE8A 1FDDA 3GB0A 6FD1A 2CPDA 2PFFB 2HVHA 2JH3A 4C8LA 2GIQA 1KFSA 4DLEA 3MTJA 5L1KA 4KKOA 3PIOQ 1MU2B 4F8RA 2JX2A 2NLWA 2OTJS 2OPSB 3GIJA 3U1LA 3MM6B 4YEAA 3DRPA 2H5EA 1HI8A 2NREA 4LFAF 3PV8A 1VK3A 2AYGA 4K4VA 5I42B 2CZ4A 4X4TA 1SJRA 5EHHA 2DBBA 2JLEA 4F50A 2NUUG 5HP1B 1HA1A 3PRBA 1KOHA 4W92B 4F25A 1FXLA 3N28A 5HBMB 2D7SA 4DN0A 4LIRA 1RT7A 1AW0A 5E5NA 1TL3A 4IG3A 1U1KA 2RQCA 2GJIA 4ZPVR 5KFSA 2LCWA 4KO0B 1JLAA 2YVSA 2I2YA 2R9LA 2YNHB 4OX9F 3HVTB 4RLEA 5LXYA 3SFUA 1U1OA 2CPJA 1HMVA 2FHOB 3NBPB 3E2EA 3ITHA 3J7ZT 1O5JA 3I31A 3S01A 1A6LA 1TK5A 3GIMA 2OD6A 2LDIA 4IFVA 2Z2MA 3EPIA 4CT8A 5J2PB 5KG2A 2J9DA 2L9NA 1A7GE 1QUPA 4A8KA 2K7KA 4AYBD 3BR8A 4KHRA 2CJQA 3BS9A 3DOKB 2KXNB 1CC7A 2DGSA 2VPZB 2FJDB 1J5OA 4BS2A 4G3IA 1EETB 1U48A 5K5MA 4ZHRB 2JJ4D 5B09A 4Q44A 3GIKA 2J0QD 1IM4A 1RT5A 2P6SA 1NK4A 4Y6IA 3GV8B 3M2RA 2OO4A 4MK8A 2VG5A 2KM8C 4ETZA 1LWCB 2MKCA 3PACA 4WFNQ 1MNEA 5D78A 2WW8A 2EFNA 3HHKA 2X3GA 3OJSA 1ZM4A 3VR1A 1HW9A 3JSBA 3VAJA 2GQ2A 3K57A 3FMWA 2P9GA 4JBCA 4C3LA 1U09A 2OP5A 3J7A1 5KFCA 2FVQA 3MEDB 1HI1A 2JLGA 1HNZF 3TUJC 3BN7A 4KGKA 5KOXA 4G1PA 3UR3C 3WDOA 3KK1A 2CPXA 3MM7A 1GXLA 4RNFA 1RTDA 2JEFA 1JLGA 3D5MA 1B0VA 2BOPA 1QE1A 2DGVA 4IDKB 3CJ3A 1T7PA 1JXEA 1RTIA 1FO1A 2KHDA 4BBYA 3QJPA 2GV1A 3CCSS 1L3VA 1NAQA 2CPHA 1Y5IB 4F2SA 3A8EA 4M5DB 5AXLA 5KFNA 3JB9k 3DXSX 2KM8B 3CSKA 2C28A 2B3TB 2L48A 3PR5B 5HLFB 3H4DA 1ZH5A 4TLRA 4IOCQ 1SQEA 2Q79A 1PILA 5C24A 2UV8A 4I69A 5DQGA 4R0EA 3FJ2A 3VAMA 1CC8A 5HN0A 4E98A 4F02A 2G4BA 4TKTA 4WIIA 1OPZA 2B5JB 2JVOA 3BSNA 3KLVA 5DO2A 1UETA 5C42B 3KNGA 1L3TA 2UVWA 2P5VA 1H7WA 1TKDA 4OFZA 1KLMA 2AGPA 3MUMP 2KN4A 3NCPA 1NK5A 1D9DA 1HBNA 4Y2MA 4CT9A 1D9FA 2M2BA 3ENVA 3X3UA 3OJUA 1H2UX 3QLHA 1N88A 2FUG9 2YKPA 3PFOA 3RW6A 3JTOA 1PC5A 3BO4A 3HT3A 1Y9OA 2ZD1B 3HKZD 2DNKA 3IWLA 1IKXB 1WF2A 4ZS6A 4PWDB 5D4OA 1DLOA 1XBWA 2BJDA 3EZ5A 1Y4ZB 3IRXA 2J76E 1HNVA 5KFHA 5E0OA 5KG5A 2PA3A 3GFXA 3PM9A 4WCEQ 3PX4A 4LUBA 2C3YA 1RISA 2E29A 2K8GA 1QUVA 2PGCA 2ZDPA 3CO9A 3MR6A 3HHNB 3RRKA 2CRLA 2V4JA 4QBUA 3JYTB 3TUIC 2XLKA 3E3XA 4RNMA 3DOLA 5K8NA 3T9NA 1X8DA 2HFZA 2B0GA 4F26A 4OIXA 1Y7PA 4ZPCA 5C5JA 1DQ8A 5KTQA 2BM0A 4DS4A 2XMWA 3AJ1A 2VKRA 4DSKA 5EWFA 1WHVA 2XY7A 1FESA 1Y5LB 5KT4A 3FDSA 1IJFB 2UV8G 2R8HA 1TKTA 2PDAA 4ECQA 2IMWP 4J9QA 4TYAA 4V19J 2Q1LA 5KT3A 3VCDA 1F60B 4NMLA 2Z8QA 4PCQA 4F4KA 2GJ2A 5GADI 1HBMA 4DUYF 4DJBA 1C0TA 3HZGA 3DRYA 2CQ0A 2F8EX 2U2FA 1UJ5A 2F3JA 2LU2A 3T1HF 2FJAB 5KFXA 3NCRA 2CDQA 2MKSA 4USIA 3UDLA 2VG6B 3IN5A 2RB7A 4Y2AA 2XG8A 1TVRB 1M5PC 1RTJA 2XCAA 1VQ8S 2BDPA 4WZMA 4YR3A 1RYSA 1XEZA 2LEPA 4OZ0A 2UP1A 1KD1T 4QPXA 5IXUA 2LKZA 4IR9A 2ERRA 4TU8A 5KFTA 4LF8F 2KJWA 3DYAB 2JSXA 2N82B 3RB4A 2GMLA 3L7PA 3KLFB 2CQPA 2WOMA 2H9ZA 4RW7B 2R2RA 4I2PB 2XCPA 4C8YA 1NHVA 1NK0A 4WTYA 4I6WA 2DNOA 1P9QC 4IG0A 4JUZA 5SZTA 2XGQA 1NU4A 3MECA 3M4XA 3Q8RB 4NZ6A 1KSPA 3CC4S 5E3AA 2OAUA 2VG7A 1HYSB 4ECTA 5HMZA 3CD7A 4DR1F 1FDAA 2YH1A 5JJBA 4B3SF 1LKZA 4ZDNA 4LT6A 5D4NA 2EG1A 3CJ4A 1TL5A 1C4CA 1D1UA 5KG4A 1FJGF 5HMXA 2DNHA 3JSRA 3MD1A 4USJC 5T7LA 4RNOA 4X4SA 3LH2S 3AA9A 2XZWA 4B17A 3K5LA 3R1LA 2DHSA 1CSJA 4QWEA 1X5OA 1RQ0A 4NYOA 1TL1A 3DDKA 3HKWA 2AYMA 2B4OA 5KFLA 5KFPA 3KNAA 2OLWA 2V8VA 3M30B 5DG7A 3MM5A 1XR7A 1VS3A 2OPQB 5CQGA 3K8VA 3UDCA 4CQ1A 1N0VC 1NKBA 2ZH1A 2CQIA 2AX1A 3W7BA 1ZBTA 1WEZA 2IJFA 3IR5B 2VOPA 3NNCA 2KT2A 5D3GA 1N5YA 2B9WA 3MEGA 4RWXA 1T03B 4WF9Q 2VKZG 3DLKB 3DU6A 1WF1A 2QLWA 3BDEA 1SL2A 3V81A 4HH1A 1G1XA 4KFBA 1SIWB 1RYRA 2DIVA 2JHEA 2DGTA 4CCHA 4NCGB 1S6OA 4PG5A 1XN9A 3GR1A 4DV5F 1SC6A 1U47A 1X9MA 4YQWA 2E5LF 2VPYB 4NLUA 5A6WA 1BQXA 4EO8A 2DPIA 1HWJA 2E5JA 4TU7A 2GGPB 1IKVA 4OJ3A 4F4WA 4JOUA 3GR0A 3MHYA 4J5OA 4I67A 2MZRA 3VAKA 4KRWA 1HNIB