4WFBQ

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with bc-3205
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
89
structure length
89
Chain Sequence
EARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVASVNIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S rRNA
total genus 11
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wfbQ00
1HD1A 2Q79A 1WG1A 2EK1A 4FXVA 3S8SA 2DH7A 3P6YC 2RNEA 5IQQA 3SMZA 3MURP 2CQ0A 2KM8B 4ERDA 2CQGA 3CMAS 2M0GB 3CCES 2CPHA 2N3OA 2EK6A 2RVJA 3H2VE 4C7QA 3VAGA 2OTJS 4Z2XA 1U1LA 2E5JA 3FEXB 1X5OA 2RRBA 3S7RA 2MKHA 2F9JA 2LECA 2RS2A 1BY9A 3P3DA 2LQ5A 4UY8T 2CQCA 1UP1A 4QU7A 3CCMS 2KXFA 5CXTA 3OW2R 1N54B 1KC8T 3ZZYA 3D2WA 1HA1A 4CH0S 2B0GA 2KG1A 1U6BA 3CULA 2N82B 2D3OR 3G9CA 3NS5A 2CQ2A 4LIRA 2DNPA 3CCSS 1WHVA 3MUVP 3G4SS 5LXRA 5GAGU 4YOEA 2HGLA 1X4AA 3NMRA 2ZJQQ 2CPXA 2BOPA 1WELA 3G96A 2DH9A 1JMTA 4TU9A 5JVGQ 1X4GA 1SJRA 3UCGA 4IUFA 2AYMA 1L3KA 2F3JA 2DIVA 3Q2TC 3CC4S 2KN4A 1YTYA 2YH1A 3CCJS 1VQPS 1FHTA 4CH1A 3G6ES 1WI6A 3MUTP 3HHNB 2CPDA 4Y0FA 3CC2S 3J7ZT 1JJ4A 3CCRS 3BO4A 1YI2S 1WHYA 1VQ7S 1FJCA 1X4FA 3J7YU 2MZTA 2KG0A 3HI9A 4WFBQ 3PIOQ 3R1HA 2XSFA 5LSOA 2SXLA 2KYXA 2G0CA 2KRRA 2X1BA 1DBDA 1X4EA 1H2UX 2E5IA 2YWKA 4F02A 3BO3A 2CPZA 4F26A 1M1KT 1QVGR 1M90T 1VC0A 1NJIT 1X5PA 1A9NB 2RT3A 1XN9A 3LQVA 3UE2A 3VAHA 1WF0A 2L41A 1M5VC 1VC6A 2DHSA 5DDPC 1QM9A 3ULHA 1SJ4P 2XS7A 2M88A 3UD3P 2LEBA 1WI8A 1OIAA 3P5TL 1UFWA 2U2FA 1FXLA 1PO6A 4C4WA 2LA6A 2X1FA 1VQMS 2CQ4A 2LYVA 2XS2A 1WWHA 2DHXA 2RQ4A 2CQDA 4Y00A 3VF0B 3VAJA 2RQCA 1WHXA 3U1MA 2LEAA 2M70A 2AYGA 2LCWA 4ED5A 2CPYA 2RRAA 1UW4A 1B7FA 2FHOB 3THTA 3B4MA 2CPFA 3RW7A 4BS2A 3VAIA 5IFMA 3FEYB 5DM7Q 2DB1A 2DGOA 3V4MA 1F9FA 2GHPA 5IM0B 4W92B 4WFAQ 4ZKAA 2DNZA 1URNA 2KVIA 5LJ5Y 2MGZA 2M9KA 4UQTA 2CQ3A 2MQMA 1VQ4S 1CVJA 1K9MT 2MKSA 2FC8A 2M52A 5FJ4A 1WHWA 2U1AA 3MI7X 3G8SA 4IOAQ 2HVZA 2XB2D 3UWTA 1WEYA 3CCLS 1YITS 3VAKA 5HO4A 1VBYA 3UCZP 1Q86T 2MQOA 1U6FA 1N88A 2QA4S 1KQSR 4M5DB 2DITA 2DO0A 1X0FA 2CQIA 2ZJRQ 5D77A 1DHMA 4J5OA 1FO1A 2MMYA 1IQTA 2M7SA 2OJ3A 2K8GA 3NNHA 1U1PA 4PRFA 4WF9Q 1R8PA 2DNNA 2ADBA 2MZQA 4A8XA 1KD1T 5BJRA 1KOOA 2I38A 3NS6A 1PGZA 4OZ0A 2MZJA 2L08A 1SXLA 3B4DA 1DZ5A 4TU8A 1HD0A 2DGTA 2MY8A 2AYEA 5LJ3Y 2DGQA 4C0OC 4QU6A 2MYFA 1YWXA 1X5SA 2J0QD 5LSLA 2HYIB 2LXIA 2DGUA 3U1LA 1SJQA 2X1GA 2KM8C 3CF5Q 1K8AT 3IWNC 1D9AA 1N52B 1YJNS 2E5HA 3TO8A 4TU7A 1VBZA 2M2BA 2V94A 2F9DA 1VQKS 2CJKA 3TP2A 2J8AA 2MKCA 1OWXA 2OTLS 1YJWS 1FJEB 2E44A 5DM6Q 1YJ9S 1VQOS 1U1OA 2N7CA 2D9OA 3LPYA 2FC9A 1JJHA 1RK8A 2HGMA 5GMKa 3R27A 2MJUA 1WEZA 1NU4A 5CYJA 1U1MA 1WEXA 2DHAA 2HZCA 1WG5A 4LMZA 2KU7A 2DISA 5GAHU 4V19X 1FT8A 5JVHQ 2XNRA 1Q7YT 1JJ2R 3DLLQ 3N9UC 2KFYA 5DETA 1WG4A 4IOCQ 2LMIA 5CA5A 2JX2A 2PEHA 2LA4A 3CCQS 1NO8A 3MDFA 2MXYA 3TYTA 3NNCA 2QFJA 3NNAA 1SJFA 1FJ7A 2MKKA 1P27B 2OSQA 2DNKA 2MZ1A 4WIIA 2MQQA 3MD3A 1U1KA 2MSSA 3RW6A 2XS5A 2VONA 4WKRA 2KXNB 3UD4P 2BZ2A 2JVRA 2JRSA 4CQ1A 2MZSA 1M5OC 3CUNA 2KRBA 2DNMA 1HL6A 3SDEA 2FY1A 1ZZFA 4U67Q 1A7GE 2KHCA 5H1SV 2KXHA 5EN1A 1U1NA 4YB1P 1VBXA 1AUDA 5DDRC 3Q2SC 2DNOA 2XNQA 3S01A 2NLWA 1ZH5A 4WCEQ 2YH0A 1R8HA 2MQLA 1X4BA 2MSTA 1VQ8S 4EGLA 3BEGB 1X4DA 2CPEA 3MOJB 1FNXH 4TLQA 2MY7A 2DK2A 1X5TA 2J0SD 3ZZZA 2M4MA 1K73T 2AYBA 3VAMA 3R1LA 2DIUA 1S72S 2CPIA 3CCVS 2G4BA 1YIJS 2CQPA 5GVQA 5DDQC 1Q82T 2A3JA 1VQNS 3K0JA 1OO0B 1S79A 3IRWP 3G8TA 1U1RA 2HGNA 2CPJA 5D78A 2MKJA 5DDOC 1X4CA 3MXHP 4PR6A 2I2YA 3VALA 2MKIA 2DGVA 3EGZA 3S6EA 2VOPA 1KOHA 4WFNQ 2X1AA 1ZZNA 4LJMA 4RU2A 2J76E 2G1DA 1VQ5S 3THPA 4CIOA 4IO9Q 1M5PC 2DH8A 3CMES 5GADU 1G2EA 2JVOA 2NZ4A 5ITHA 1VC5A 1DRZA 3H2UB 2KI2A 3US5A 2DGWA 4FXWA 2RUGA 4YUDA 1VQLS 3CTRA 1OPIA 4OZ1A 2MHNA 1M5KC 2FPHX 1SJ3P 3CPWR 2MPUA 3DXBA 1YHQS 1UAWA 3SDEB 5IM0A 2UP1A 2D9PA 5MLCV 2K3KA 5GAEU 2MGZB 3MUMP 1P1TA 2DNGA 2PE8A 1W2BR 3I55S 2MJNA 1Q81T 2ZJPQ 2KH9A 3VAFA 2DNHA 1X4HA 2WBRA 1U1QA 2YKAA 1WTBA 2L9WA 2ADCA 1N8RT 3PIPQ 2QEXS 4F25A 3CD6S 2DNRA 3UCUP 2LKZA 4P6QA 3I56S 3SXLA 2RU3A 4QPTA 1H2VZ 2GO9A 3EX7B 2VOOA 3EGNA 2O3DA 5LXYA 2DNYA 2DGXA 2MB0B 2JWNA 2M8DB 3CXCR 2ERRA 2MQPA 2E5GA 1WF2A 3BS9A 4QQBA 2OSRA 2MQNA 3MD1A 3CC7S 1O0PA 1U2FA 3G71S 2DO4A 1WF1A 1VQ6S 1D8ZA 2KT5A 2EVZA 1QVFR 2LXUA 2CQ1A 2M8HA 2RS8A 4W90B 2YTCA 2MZRA 1RKJA 3BO2A 4PKDB 2N3LA 1H2TZ 2CQHA 2DGSA 2VODA 3P49B 3JB9k 2OIHA 1H6KX 5HL7Q 2DHGA 1VQ9S 3CCUS 2AD9A 3L3CA 2DNLA 2DNQA 2CQBA
chains in the Genus database with same CATH superfamily
1GMVA 1LW2A 4R0EA 3OTOF 1XMOF 3VGUA 3PEHA 4BDPA 4YB5A 2HVIA 2EK1A 3CNQP 3QGPA 3HPOA 1KR4A 3IGNA 4ED1A 1KTQA 3FCVA 4BC9A 5C42B 2K3IA 3TI0A 4DJBA 3MURP 4ECUA 2EXUA 4WXWA 1REGX 1JLBB 3DRXA 1HWLA 2D3ZA 1JLBA 1ZM2A 5I42A 2CQGA 3CMAS 3AXMA 3SFGA 2M0GB 3QMQA 2GAHC 3MECB 4KPCA 4MYUA 2R7TA 5KFUA 2Q6CA 3VAGA 1S7HA 4LRAA 4C7QA 1T7PA 1S0VA 4NA3A 4Z2XA 1Z4UA 2E5JA 1S6PB 4H4MB 1U1LA 2CXEA 1M1GA 2MKHA 3KTQA 4J7CA 2F9JA 2FY8A 3HX9A 2LECA 4H4OA 3K8WA 4J9NA 4NLYA 1FDAA 1WSVA 2IMOA 1QDUB 1ZPWX 3CCMS 3GFYA 3OHAA 1IKYA 3HDSA 1WC1A 2Z57B 1SL1A 1N54B 3QIPA 5LSRA 3ZZYA 4EYIB 2H48B 2B7BB 5A8KA 2Z56B 4CH0S 4B3MJ 4GKJJ 4B9NA 2YY3A 2B0GA 4OYAA 1NB2A 5I3UA 1FXDA 4KGZB 5IV4A 3DU6A 1I1GA 2C2NA 2Y1IA 2P5VA 3UN5A 4LSNA 3CULA 2GVDA 3OTOJ 1NSPA 2P9CA 2A1BA 3AA8A 4AYBD 2UUAJ 1UVKA 4KH1B 1RADB 2CQ2A 3ETOA 5KFAA 3W5ZA 1YJRA 3DLEA 3FJ2A 5D0RA 2DNPA 4KKOA 2K1RB 4ANCA 1WHVA 3UI3A 5F9LA 2ZWOA 5GAGU 1RHMB 4CLSA 1U0SA 2CDQA 2CJBA 2ALZA 1IBMJ 2ZJQQ 3GFZA 2MDAA 4RO0A 1OPZA 3EVWA 5JVGQ 2HHUA 3ITHA 4A8SA 1X4GA 4G1PA 1KQKA 4UZBA 1RTIA 4NI2A 1JXEA 4OX8A 1FRMA 3TX8A 1RTIB 1IKVB 1S6QA 3UCGA 4DR3J 2R8JA 1IKVA 2AYMA 4L3KA 2RF2B 2DR9A 1F9EB 4FNIA 4WFYA 3D1OA 3QLHB 3J7A1 1H72C 4CRJA 1J5EJ 1ZA1B 1NK9A 4FYWB 4YHHJ 3MFIA 1RE1B 5LT5A 1JNZB 1HWIA 4CLPA 1G6BA 3NOCA 3H7HB 1FTRA 4MAKA 1TKTB 1BQNB 2HBZB 4MYTA 5IWAJ 2HQFA 4ZIVA 2L48A 1EAYC 1WI6A 2AJ2A 2IHR1 1UZDA 2ZUAA 1PBAA 4CTAA 3M32A 4WIQA 2NXJA 2R2RA 2IFXA 1RHKB 4DDFA 2DPJA 3T5LA 4ALZA 4DCJB 3KK3A 3T3FA 3HHNB 1RQ0A 1FTCA 1J27A 2LQ9A 3RRHA 1J5OA 1GX5A 3M8ZA 3VR1A 4QBUA 3CCRS 4IYQA 5B0EA 2OPSB 2LQJA 1RWMB 5E3RA 5CD4H 2OPSA 4OX6A 1VQ7S 3D3CJ 5A8KB 3HHDA 3J7YU 1F5CA 3HI9A 4QIGA 4E2FB 1GNKA 2B9EA 4FPRA 4WP8A 2CWKA 3WHIA 3H0PA 3ZNUA 5LSOA 4XDDA 2FZCB 5ETOA 1CJUB 4GO7X 4DQSA 2Y1LB 3LAMA 5F8NA 2BRLA 2BQ3A 3RRGA 3KDNA 5HVFA 1JX4A 3DM2B 2P6TA 5AE3A 4AUKA 1P9QC 2PDAA 1F3FA 1S6PA 2BEFA 4H4MA 4DU7A 4DX7A 5DQIA 2XS5A 1GMUA 2F7VA 2Z8QA 1FNOA 3IR5B 2QO3A 4M63A 3GQCA 2O01C 4DV1J 1A9NB 4YB7A 2XMTA 3UE2A 5DGBA 3VAHA 2ATCB 1WF0A 3DLGB 3PJ9A 1WTFA 1NDKA 1UJ6A 4X4TA 4KHPF 4IUFA 4LFBF 4U6PA 1BD6A 2O66A 1T0TV 2I1RA 4PG4A 4DEZA 5GAGI 3AJ2A 2ZH5A 3IM8A 4EBCA 2BJ1A 3HSZA 3GV5B 3R9LA 1L3SA 1Y0HA 3CIMA 3OR1B 4LRDA 4ZK7M 2HPUA 2W8LA 3SIPB 1TFYA 3M6VA 3R7SB 1RAFB 2HIQA 5KFBA 1FFSB 4NEYA 3ENQA 3W9JA 1XMOJ 2QE5A 3UN2A 1TL4A 2CKWA 2J0WA 3VTIA 1T95A 2QL9B 4XIUA 2YKQA 3D5MA 4K2XA 1NSKL 5HMWA 3CJ2A 2MTLA 5KT7A 1B3TA 1Q7LB 1Q5VA 1SUQB 2CQ4A 2LYVA 3I6PA 1SUQA 3ZC4A 3VF0B 2DHXA 4U8YA 2CQDA 4USVA 3N5FA 2XHCA 5JJBA 4O4GA 1T03B 1PG5B 3IR7B 1S0MA 1RWPB 1Q8BA 5B08A 1VK3A 1HHTP 5IQ6A 2F5GA 2LEAA 1U48A 2UXCF 2M70A 5AXMA 2AYGA 2V9WA 5IS2A 3P96A 3CGIA 3HJVA 4DCPB 3LP0A 1B7FA 2FHOB 4DL4A 2HLUA 4KR0B 4YMEA 3KYLA 2Z4PA 4A48A 2CPFA 3D7SB 2Y9HA 2CG4A 2W4PA 3AJ1A 4DV5F 4RBUA 5IFMA 1SH0A 3K8VA 4OI3A 3CIZA 3FK4A 5DLGA 4OHVA 1BMQB 3DM2A 4KYZA 2AP6A 1F9FA 1JJCB 2F8EX 4MIBA 5IM0B 4WJBA 4W92B 3NY0A 2KO1A 4O44B 4ZKAA 8RUCA 2DNZA 5CYMA 5FLXU 4URSA 3EPGA 2R7QA 1LWFA 4AD6A 2KVIA 5LJ5Y 1EB0A 1FDDA 2C3YA 3DDIA 2RAQA 3DN9A 2CQ3A 4MFBB 5L9XA 3VGSA 1HMVB 4MFBA 4Q45A 3F0NA 5MAOA 1VQ4S 2C2EA 4DSLA 3A4TA 2R2SA 3P45B 2MKSA 2A6OA 2UUAF 2Q3PA 3FCHA 3Q86A 4E0DA 3HVWA 1TL5A 5HBMB 1D9DA 3AAWB 1WC4A 2A0FB 3AD8C 4G1QA 2JOQA 2BE7D 1WC6A 1F3VA 1KQFB 1DQ8A 3UWTA 5D0GA 3BGUA 3IG1A 1YBAA 4K4XA 3A8KA 3BREA 2WAQD 3KMSA 3VZHA 4PXBA 3IP0A 3WBZA 3UCZP 3AB2B 2K1RA 3HT3A 2HRUA 1U02A 3VV2B 2ZZNA 1JNRB 3F41A 4O23A 1N88A 3FVYA 2QA4S 4JV5J 4M5DB 1NM2A 4UF4A 4YDXA 1FI4A 2PFFB 1RWUA 1F5BA 3CDWA 3DHWC 4L74A 4EZ6A 4DUTA 2MMYA 2Y0SD 5SZTA 2M7SA 3KMQA 1C0TA 3QJLA 2OJ3A 1T94A 1U0HB 3J81U 1N6QA 3K5PA 1TKZB 1T05B 1D0EA 4FBUA 4TXSA 4WF9Q 4RNNA 3E2EA 4R8UB 3ISZA 4K8RA 3JS9A 4DR5F 2XMAA 2IYGA 3LOUA 1AROP 4DV4F 1QLNA 1HBOB 3BSNA 3OXLA 1PC4A 1WJ9A 4KPYA 1KVJA 5K9FA 3LGMA 5H9FK 3UFCX 1KOOA 2CVIA 2Z2ZA 1H7XA 2YKOA 1PGZA 2CVEA 2F8HA 3NWGA 2DY1A 2QV6A 3FUYA 1PCAA 4NZ7A 5RUBA 5I3UB 4CT8A 3TA2A 2QSFA 4P9SA 5CHCB 1SXLA 3B4DA 1UL3A 1NAQA 1OS5A 2KB2A 3G82A 3SCJE 1HD0A 4ZCLA 4DPYA 5LJ3Y 4ZVFA 4DX6A 4QWDA 3L9ZA 4KBIA 5FIIA 1TV6A 3W3SA 2FDNA 2R8HA 3GPAA 1NJZA 5LSLA 2HYIB 3O44A 3H4BA 4DSIA 1KP6A 3DOLB 3U1LA 3I96A 3ZZUA 2JZ5A 4UOHA 1IN0A 2VBXA 5T14A 2FGOA 3QO9B 1D9AA 2ZH6A 4DQQA 1N52B 5DGAA 1YJNS 3NGUA 2RQMA 3ONQA 4NLDA 4LF5J 2E5HA 3TO8A 2EC2A 3PDNA 1HARA 3MWBA 1VIOA 3V6JA 5KG2A 3MR6A 1ZS6A 4HEA9 2ZZTA 2V94A 4DUZF 1H38A 2PMHA 1VQKS 2CJKA 1SIWB 2J8AA 3AOAA 4Q2LA 3GG0A 4NWBA 4WE1A 3V5RA 3OVAA 4KHMA 2UUBJ 2HQ3A 2N4DA 1U1OA 2OFGX 2VG5B 4TY9A 4C0BA 2N7CA 2D9OA 3LPYA 1J5OB 2FC9A 3UVJA 4FF4A 1JJHA 1HKAA 1RK8A 1KBRA 5GMKa 2HLTA 4NEZA 4AE5A 4U96A 1EETB 1TTHB 3OFGA 3KUGA 3MMCA 4F7VA 1WEXA 2DHAA 4G1QB 2HEKA 3PKMA 4QR0A 2IVMA 2N7YA 1R0AA 4XPEA 4CH7A 3O2IA 1KVIA 1VGYA 4CWBA 4IDKA 3TAMA 1T9WA 3L09A 1HYSA 1Q7YT 2V8VA 1JJ2R 1DTQB 4B9LA 5B09A 4P10A 3F56A 1EZZB 6FDRA 2ZH4A 2KFYA 2X1FA 5DETA 2EW9A 3OPKA 2VFRA 1WG4A 3BR9A 5CCMA 3KJVA 1RHUB 2WOMB 2H1YA 1AZSA 3NS7B 1LV5A 1RWOB 4RUBA 2CJYB 1SH2A 1YJ7A 1VCTA 2V4JB 4A4JA 2WBMA 1UA1A 1FD2A 3EDRB 4ZJLA 2XULA 3GJQB 4C48A 4LF5F 3LWMA 5D4NA 1WDTA 1FJGF 1C0TB 2MXYA 4L75A 4I2QB 4DV0F 2DRBA 1N32J 3NNCA 2QFJA 4GC7A 1HWKA 2HHQA 3MMBA 4DS5A 3A3NB 1S9EB 2WVDA 4ZPAA 4N41A 3TUPA 1P27B 4ATNA 4X4VA 4HACB 2RDJA 1UVMA 4Y65A 9RUBA 2JFDA 2G0IA 2HFVA 5D4OA 4KV8B 2PI5A 5HROA 2HHTA 2JLGA 3EMTA 4FP9A 4ZPVR 4KJIA 1M5OC 1OYEA 3CUNA 3C2PA 4HHHA 1HL6A 2V34A 3SDEA 3MPYA 2RUSA 5DLFA 2POKA 4NL5A 3N6NA 2KJVA 3B6BA 2VA2A 1T03A 1RT4B 1WOPA 3GJRB 1VQSA 2KHCA 1HWUA 1Y7PA 2KXHA 1Y3JA 4UY85 3SCLE 2HWIA 2F4VJ 4WZMA 2HVEA 4DR1F 3C6UA 2DNOA 5FD1A 3MTJA 3CJ4A 3EZOA 2DT9A 2H4YB 3TANA 3W2WB 2EG1A 3M6XA 2L9DA 3I0SA 4MJKA 1U4BA 2NLWA 4R25A 3AQOA 4IQXA 1ZH5A 4FYXB 4FXDA 2QLFB 1LFPA 3J80Y 4Y2AA 1VFJA 4EGLA 3MECA 4A8FA 2ZM6F 4FF1A 4XK8C 1KFDA 3TZXA 3D0HE 4TLQA 3KNAA 1RSCA 3JQMA 5HAOA 2DK2A 4CLUA 3WQPA 2DCUB 3D54A 3EUNA 1YRXA 2C2OB 1TAQA 2K7KA 3KJQB 2V4JA 3CJKB 1S1XA 1HBUA 3C66A 3GZ7A 2OD6A 4QWCA 2G4BA 1YIJS 2CQPA 1NBEB 1YLXA 3MPWA 5DS7A 3QSIA 5GVQA 1KRPA 3NRBA 2ZFHA 4LR8A 4IH7A 1XNQF 4RW6B 4D3GA 4TN2A 1XMBA 3W8PA 3OV7A 2YX1A 2UVUA 4M94A 2ZEJA 2JLFA 2CPJA 3S1TA 5D78A 1ZAXA 3ELHA 3MXHP 1AXQA 1SCJB 2VC0A 1R0AB 1WC5A 1VLYA 4P2XA 3W62A 3LA0A 2ROPA 4ED0A 5HQ8A 4I2PB 2WSFC 1S49A 4DR1J 1ZOTA 1HYSB 5KFTA 4MH8A 1JKHB 2KJWA 3DRPA 4B3MF 4DQIA 2KT2A 4QR1A 3LO3A 3AT1B 3Q0AA 2VJUA 4HR2A 5EX0A 2CNLB 3R5GA 3BGFA 3THPA 2JH3A 2ZD1B 1KNZA 2DH8A 1XQIA 3GYGA 5KG4A 4JI6J 1HBMB 2EI5A 1G2EA 4ZVOB 3BV8A 3C15B 2JVOA 2NZ4A 4FN5A 2YQ3A 1DRZA 3KUHA 3MMBB 2FD2A 3HO1A 2NYIA 4I1TA 4OJ3A 1N6QB 4ILMA 2DXEA 1V3ZA 3DLKB 4X64F 4FXWA 3Q8UA 1KHVA 1UTAA 3D3BJ 3TAPA 3CTRA 1RAIB 2HQDA 4C8LA 2HHVA 1RBLA 2QA1A 3TZZA 1SKUB 1PJ7A 1DY3A 2EFQA 2FPHX 4HI2A 4FYDA 5HROB 4IH6A 3EXCX 1YHQS 5EGYA 4NE9C 2W4CA 1CG2A 3SDEB 1KN6A 1Y10A 3SQGA 1HNZF 2W4DA 4A8OA 3LTOA 2V67A 4I69A 1GAOA 2K3KA 3I4HX 4OYBA 3RBZA 3SSQA 3C6TB 3RAQA 2DNGA 4JYAF 1E6YB 1ZTTA 3QNWB 9ATCB 2V50A 5EWGA 3Q8PB 1ITPA 2BQUA 1CS4B 3CE8A 3JSRA 1H74A 1Q81T 1SQGA 2V8DA 1EETA 3BB5A 1W7WA 3L7UA 2VBZA 3LH2S 4NLVA 1JLGA 4P7TA 4YB6A 4Z7CA 4ZCMA 5DG9A 3QJJA 3BGOP 4ES3A 1IBLJ 1QAIA 3PYDA 4G6VB 2L9WA 5KFZA 1CJUA 3CSKA 3DFEA 5KFHA 1X7VA 2ADCA 1HWJA 2FLLA 1MMNA 1LEOA 4NZ0A 4QOTA 4A46A 3QO9A 3BQ1A 3I56S 4P6QA 4B9MA 4Q44A 3RGIA 4DLGA 2DVIA 4Q43A 1H2VZ 4USHA 2F63A 2QLBB 2ZHOA 4ZVRB 5J2PA 4LQ9A 4OI4A 2ROEA 1NPPA 3V2UC 4NLOA 3HHLC 5IC6B 4FS1A 5I3PA 3VGTA 4DR4F 2GGPB 1DQ9A 2R8GA 2IJFA 3T9ZA 1SH3A 1U25A 3DI6B 1CJKA 2HVDA 4QQBA 3M9OB 2AT1B 2HNZB 2MQNA 1H73A 3OTCA 4AQYJ 3K5NA 3ZFVA 1RT3B 1Y3KA 2EG2A 2HAFA 4OJHA 4C11A 1U2FA 4CI0B 4CLZA 1HNZJ 3MFHA 1WF1A 2BX6A 2D3UA 2B3TB 3I31A 2M8HA 3FEZA 5J2NA 2YTCA 4XO0A 5AJ3F 1RYSA 2FJXA 1RT1A 3RR8A 2E66A 1GX6A 2MZRA 3KG1A 2J5AA 3QFHA 5E3QA 3OXFA 1RKJA 1HLWA 1X9MA 4HH1A 1OY8A 3OQ2A 1H2TZ 2IMWP 1MWQA 4IR9A 1F1BB 2C1EB 3JB9k 2XQCA 4A8QA 3C8YA 2CA9A 1VBKA 3JXOA 1DQAA 3TRGA 3KLEA 1VQ9S 3CCUS 3U7JA 2J6UA 4PWDB 3I5BA 3QPIA 3NBPA 2OEMA 1KEKA 2DNLA 3ZZOA 2CQBA 3T1YF 1QAYA 1HD1A 4A8YA 4DXLA 4OI0A 2Q79A 1VRTA 4I56A 3T6JA 3MM6B 3C15A 2AGPA 3S8SA 4MKYA 5F41A 2OLWA 1H98A 4GC6A 4ZA1A 1N48A 2EKYA 2XMVA 1SL0A 4DR4J 5IQQA 4F0KA 2NXUA 1JWWA 3GJSB 4B9SA 2D74B 1LQ9A 1P9YA 4QPXA 2KM8B 4ERDA 4QYRA 4AQYF 2VPXB 2BJ3A 3BKTA 4KV8A 4QR2A 4DR7J 2UXCJ 2CPHA 2ZC3A 2JHEA 2DJWA 1CULA 3HFVA 3UR3C 5L46A 3KLGB 2RVJA 4WU2A 2QLWA 2ZH7A 1N5YA 2OTJS 4W4MA 3KNGA 1X5OA 2HK3A 2IDLA 3OD2A 2XY5A 3S7RA 3DMJA 2RS2A 4USTA 1BY9A 2ZDOA 3P3DA 5AE1A 1R6YA 1FDBA 4F0MA 2LQ5A 3X1LB 4DUYF 1GT8A 3A8IA 2CQCA 1UP1A 4L76A 3BH7B 1N5SA 4K4WA 2HRTA 3CDAA 3HCXA 1S0OA 2KXFA 4GKKF 4YFUA 4OI1A 2MQ8A 3OW2R 4TYBA 3HJFA 3KK2B 2QX0A 3D0GE 3A12A 1KLMA 2KYZA 1YKWA 2YKNB 2OPPA 2N82B 3B82A 1XJWB 3BDPA 3M8WA 2CDRB 5HSPA 2D3OR 4DMZA 4Q0BB 3RB4A 2AF6A 1LXJA 3ICLA 4QIVA 1NKCA 2QMWA 3DYAA 4ZVEA 3CCSS 4LFCJ 3SI8A 2CG8A 4DU8A 2EPIA 2OFHX 2BE2A 2ZBRA 1JK9B 1PSDA 2H54B 4Y28C 1X4AA 3NBPB 2CJXB 4ZJOA 5CYQA 4EO6A 2BOPA 3QRPA 3WX4A 1S59A 1LWEB 2GW8A 2XMKA 3MF5A 3U1NA 2DH9A 2HBYB 1L3VA 5THWA 2VPYB 1RT3A 2W7OA 2FVQA 4RU9A 1SJRA 1IR2A 2FHJA 2HWHA 1I3OB 2BBEA 1RTDB 2BJ8A 2CNOB 2FHKA 1FRHA 2ZBIA 4NRTA 3J81Y 1IKWB 3VWSA 4P52A 3OL6A 3OR2B 4M5LA 2H9ZA 5LM7E 3U27A 1FRKA 1RP5A 4W98A 2GC8A 2Q6BA 4J9VA 1NJYA 4HYKA 4PG5A 4XPCA 4NMLA 4F4ZA 5BYRA 3ZZRA 1VQPS 4EI2A 1RJJA 5CZXA 4NLXA 1FHTA 3K89A 4GKJF 3Q8QB 4B3RF 1FWPA 2LFVA 2RQKA 4ZHRA 4EBDA 3GFHA 3QFWA 3T1HJ 4P74A 4DV4J 5KOXA 2HSEB 2MLZA 3IRXB 2UUCF 2FJDB 4QIEA 4ECQA 4DV3F 3HXMA 5B7WA 5I4MA 1YI2S 3G87A 2CUYA 1YRUA 4NXNJ 3MEKA 1X4FA 2B56A 3E8OA 2MZTA 4OHYA 4C8MA 2D69A 5HMXA 4WFBQ 2CZ4A 3R1HA 2XSFA 1IBMF 2SXLA 1RU2A 2DHHA 2OKQA 2RE1A 3HF5A 2BDPA 3GILA 3KK1B 3FBEA 3M8SA 2HWTA 2XLKA 5CH7B 3QWPA 3H20A 1HNVA 3QT7A 1UEVA 2HFNA 2RDDA 2WW8A 3DOKB 3UDCA 2E5IA 2FZKB 2C2ZB 4F02A 1F9HA 2CPZA 2DD8S 4F26A 5F8IA 1UA0A 3V6DB 1VC0A 4URGA 1H7WA 5J2QB 1TUWA 1FEEA 1X5PA 1VQYA 3DMJB 3CJKA 2C22A 2RT3A 5JMNA 4IRDA 4O3RA 4URQU 2NR0A 1LWEA 3R3TA 4FYYB 3V6HA 2L41A 4MMOA 3GB0A 4RR5A 4TVAB 3PR4A 2F4VF 1RDRA 3KLIB 2EFNA 3BM7A 3BPDA 1C0UA 5B0AA 1D1UA 2OAUA 1VC6A 2JDJA 4O3QA 2XC9A 1HR0J 4ZLLA 1XTZA 5DDPC 4YR2A 2WONA 4DSFA 3ULHA 4GRSA 4PYDA 2R7WA 2XGQA 2FJBB 4ITSA 3OHBA 2P2CB 1YZ6A 2W2QP 2OI2A 3QAUA 4LR7A 2W7PA 1OIAA 1OSCA 2LEPA 2FVRA 2E1AA 3MEGB 4LF2A 2U2FA 2VBYA 2DR5A 2UXDF 3KLVA 1SC1B 4KB7A 3CCZA 4JI3J 4RPFA 3PHEA 3TR5A 1LWCA 3TW0A 3ZZPA 3UR0A 4QCLA 5K14B 2LU1A 4DFMA 1X9SA 1WWHA 1T3OA 4KC5A 1FE0A 1JQGA 1VLOA 3D68A 4HVZA 1NLKL 4WK1A 1RTZA 2A18A 2RQCA 2XZWA 2AJ0A 3PNIA 2KFZA 1O51A 3KLFA 3IGVA 2LCWA 3CD5A 1JXVA 1XR6A 3CWJA 3D4JA 1IJFB 4HACA 5D15A 1V9OA 3QRQA 4EMDA 1HNIB 2VG6B 2XLIA 4KFBA 1ZAVA 3R5JB 4M5HA 3W1YC 2GS8A 3NL0A 3QBCA 2OO4A 4J9SA 2KVQE 5DM7Q 2DB1A 3MAHA 3PJWA 2CNNB 3QAEA 3SQGB 3FSIA 3DRSB 4WFAQ 4PPDA 1U49A 5HI7A 5J1EA 4JUZA 1MMDA 2QGFB 3D67A 2HNDB 3HP6A 2COLA 2W9BB 2HNDA 3H8YA 3MTKA 1S1WA 2LDYA 1JLQA 1KWMA 1X8DA 2M9KA 4UQTA 4X4RA 2MGZA 3NCPA 4H4OB 4NLRA 4TYAA 2V8GA 1NPKA 3O1LA 3W64A 4KH0B 4KO0A 2B6AB 4F4XA 3BBCA 1K9MT 3J7AN 2FC8A 2E5LF 4WZQA 4QZVB 2J6TA 3RB0A 1RT2A 2B9WA 1WOSA 2GIRA 4IOAQ 1VHFA 1UVNA 2J7UA 1Y11A 3BN4A 4U9RA 5E3PA 5SUHA 1M5HA 3CVKA 3FRZA 4TNOA 3KK1A 4PXEA 3CCLS 2V2VA 3EZ5A 5IT4A 2VFTA 1RWVB 3SEOA 2GVDB 2AGQA 3J80U 1Q8LA 1VBYA 3GFXA 1S1UB 1IXKA 2KHDA 4CNZA 1IKXB 4DBQA 1U6FA 3MGJA 1SIZA 2C3UA 4P2FA 3RTVA 1LWXA 2DITA 2DO0A 5D77A 3M1VA 1S9GA 3D28A 5CABA 2EFGA 3FFIB 1WDDA 3M2VB 4PG7A 1ZAWA 5E3CA 4ER8A 4UUWA 4KSEB 4ZPBA 3EPIA 1Z1ZA 1IR0A 4PRFA 2F1FA 4YQWA 2CZVC 1IKWA 3OFFA 5IT0A 4YR0A 1R8PA 4BHQA 2WVFA 2HMIB 5KFMA 3ZTOA 4RWWA 3T1HF 4NX9A 4OX9J 4RBVA 3ZTSA 2XCPA 3UD5A 3CB4A 3ADAC 2EBGA 3J7Z5 3HD1A 1KD1T 4R0JA 2NXCA 2RHQB 3MEEA 1ZETA 1RYRA 1FRIA 1RTHA 1DLOA 2V8PA 1TL7A 2ZVIA 1KONA 3NS6A 4K4YA 4C8OA 4PUOB 1DURA 2WVBA 4ZHRB 1YK9A 4UZCA 5KT3A 2ZNZA 3KFWX 3O6QA 1MNEA 1GXUA 3VQSA 2ZDPA 2ZD1A 4X4SA 4Z37A 3R6LB 3MR7A 4I7FA 2G2ZA 2XTJP 2FHMA 2MY8A 4C9DA 2IAJA 4C0OC 1HQEA 2MYFA 4KTQA 4IG0B 1TL1B 3M2RB 3JSMB 2QZ8A 4PXCA 3QSYB 2XMJA 2J0QD 2NUUG 1Y5IB 2YX7A 3Q83A 2VASA 3I32A 4ZVHA 5B0CA 2HS0A 4JOUA 4DS4A 5DQGA 4ZLNA 1TL3A 1FK9B 1Q16B 5K8MA 5KOWA 4DPXA 1CQNA 1REVB 4I4BA 4M5GA 3BKUA 4F4WA 1RT5A 3FQKA 5HQMA 1MU2A 2ZKTA 2LDIA 1EKRA 4C2MA 5J1EB 1NCLA 1V5VA 2F9DA 2IVYA 3VHQA 3FSYA 1YQHA 1S1TA 1YJWS 1F60B 1E6YA 3EDQB 5KFQA 5DM6Q 2XM3A 2GO8A 5ETVA 2OP5A 4RL1A 2JC0A 3TUJC 3IC1A 2EFVA 4QYZJ 2HGMA 3RRKA 2MJUA 1IQZA 2GQCA 1WEZA 2RKIA 4JI3F 2PMWA 4OZ3A 3SQOP 2G2OA 2YWGA 5CYJA 5J2MA 1U1MA 1S6OA 1WG5A 2QFIA 2DISA 3MMAB 4OHXA 2C2KB 3DHXA 1SL2A 4ZMMA 2OPQB 1TVRB 2XWYA 3HFKA 1NPRA 4I68A 1BGXT 3P5BP 5JVHQ 1ZM9A 3KG0A 4OIXA 1GMWD 1O5JA 2E7XA 1FKOB 2PC6A 3PHTA 3TEHB 1S97A 1M5SA 1UWAA 2CJAA 2Y1RI 2XGPA 3GWCA 5K14A 2B4OA 2A10A 4DV2J 2DCLA 2PN6A 5T7LB 2R42A 4GVBB 4DI6A 3TUZC 2J0XA 3K5MA 5CA5A 1S9GB 2RHSB 1PAEX 3G8QA 3MOJB 2LA4A 2ZBQA 1CQMA 1OY9A 2IPOB 3M8QB 4IG0A 1HIYA 3MDFA 3LWLA 1FNMA 3MM8B 3JSMA 4B9VA 1NNDA 2W9CA 1A0OB 1RACB 5A2QU 4JI0J 1S1VA 4DUZJ 3IFEA 3H90A 5LOQA 1WKLA 3MM5B 2XHWA 2OSQA 2DNKA 2VG6A 2GV1A 2MEWA 2MZ1A 3HFZB 2FIUA 3T9NA 4ELUA 1KQGB 3WZ0A 1U7LA 1VK8A 1RTHB 1PJ5A 3UD4P 3EM1A 1E6VB 1U26A 3C16A 5C2GA 4LFBJ 3Q8VA 4CQ1A 1QTNB 3M30A 2KRBA 2JJ4D 4ZCIA 2HHPA 3BYPA 1C4CA 1QJHA 2ABYA 4WYWA 4DN0A 2YXLA 1SKSA 4N76A 1ZZFA 1T11A 1S4EA 3SZ2A 4NA1A 3DC2A 2IRYA 3G6VA 1A7GE 4LVOP 2D41A 3L7OA 1U1NA 1W26A 5DDRC 3JAMU 1N5QA 2LLZA 2IJNA 2BVZA 2XNQA 3QIDA 1FERA 2ZOMA 3QQCD 2AIRB 3HM9A 4LBHA 4NCBA 4MIAA 3MR2A 4H4KC 4L3NA 2ZUGA 5M2PA 1NZ8A 4CT9A 4ED8A 4AFFA 2YH0A 1R8HA 2MQLA 3GSIA 4KFBB 1X4BA 1U6ZA 3BEGB 3DRYA 5C2CA 1X4DA 2AZ3A 4N5SA 4BBYA 2CPEA 3VQTA 3HHEA 4NYPA 1ICEB 4OV6A 5G4DA 2MY7A 1FNXH 2XEXA 5E33A 1P8GA 1X5TA 4JI4F 3FCWA 1K1QA 3D6HB 5KFKA 2W1BA 5L38A 1CLFA 2WZ1A 3T6BA 4ZLJA 4KE5A 4PWUA 4DWIA 3MPDA 2AYBA 2CRLA 4HH0A 1PYTA 2OMOA 2NCKL 1JLQB 3A8EA 3CCVS 3BSAA 1NXIA 3NGKA 1NK4A 4CO5A 2D7SA 2Q43A 2B6AA 4NI2B 3HKZD 3W7BA 3W8GA 1FVQA 1RABB 4DX8H 4C3LA 4ETZA 3I0RA 2L9NA 5HVHA 5K8NA 4DZ6A 3TA1A 1TP7A 5KT2A 2YWHA 1OO0B 3G8TA 1RU1A 2HGNA 1TK5A 2HMIA 3O3LA 1NDLA 1X4CA 2QRRA 2RILA 1N5TA 3PRDA 4PR6A 5HQLA 3NAHA 3VALA 3TVYA 4WKYA 3SV3A 4NYZA 2DPIA 4N8NA 4LIWA 3OLBA 4HDHA 1T3NA 1R8CA 2KZMA 1AW0A 5DO2A 4WFNQ 2ZVSA 4TQRA 3FC9A 1AFJA 4C3MA 4G65A 4LJMA 3GU0A 2BA9A 2J76E 2AJFE 3SYZA 1UCNA 3KDOA 4X66J 2G1DA 4I7FB 5HLFA 1VQ5S 4LF7J 2MLXA 1ZPVA 3G82B 5F3ZA 1M5PC 3HVTB 1LW0A 2QA4G 1S4FA 5ETTA 2GVZA 3B78A 1VC5A 2MHEA 2YQ0A 3IAS9 5A0YA 3ILLA 3LALA 5C24A 5KFNA 5KG3A 4JV5F 2C3OA 2DGWA 2RUGA 4YUDA 1L3UA 4FKXA 1XMQJ 1TL3B 1CPZA 1RHQB 2GX8A 2HHWA 1FRJA 2GNKA 1QD1A 4ID5B 3T5KA 4ANDA 3G6XA 3KHGA 1SJ3P 4PCQA 2H4WB 3LP2B 3PEJA 2VF3A 3CPWR 1UAWA 2O5DA 4Q5VA 2YNHB 2ZHBA 1ACMB 1Y4ZB 3O8WA 3M30B 5MLCV 1IBKJ 4DSJA 3UO0A 3P8BB 3M8RA 4N47A 1S1WB 1XEZA 3ILOA 4LF1A 2MGZB 2VG7B 3MAAB 3MUMP 3GMGA 4BWMA 1F2GA 2HFUA 1T9XA 3HHLB 4LF4J 3I5AA 4DF4A 3I55S 2MJNA 3BBBA 2QYCA 4P2MA 2ZJPQ 3C46A 2KH9A 1HI0P 2YNGA 1JIHA 4QU7A 5C42A 2YKAA 3I4PA 4X65J 4RW9A 1WSRA 1HBNA 5G0RB 4X66F 4LF7F 2HRYA 2KL8A 1RWKB 3Q8YA 3DU5A 3Q8RB 4F25A 4OL8A 2UU9J 2G2YA 3KLHB 3EGWB 2RU3A 2FGCA 4IDKB 4QPTA 3TAMB 3TJ9A 3V81A 1SV5A 2DRAA 3EE3A 4CCHA 1FKPB 3AFGA 1I94F 1FKPA 3TX0A 1TQLA 1U8SA 3UNGC 4X4QA 4XAKA 2VQEF 1S5ZA 2Z2LA 3HVTA 4RJVA 1UW9A 1C1BA 2DEJA 4IFYB 4ETXA 1MROA 1NSAA 2HZAA 2XYPB 1LOUA 4K0KF 3DXSX 4UQGA 1YBTA 2HS3A 2NPIA 2DO4A 3MM5A 1NH7A 4C8YA 2IJRA 4USUA 4F3QA 1D8ZA 4DV6J 2XMUA 4W90B 2WB4A 2DY9A 4ZVPB 4YY3F 5AXNA 4OZ5A 3TJAA 1TFWA 1MG7A 1Q1KA 1Q78A 3BBFA 3GV8B 3LP2A 5H9FJ 4AL7A 1WUUA 1BQNA 2DGSA 2CQHA 4PUOA 4OI6A 3BQ0A 2W8KA 2QLJB 4USIA 1RAGB 2OIHA 1EARA 2XZDB 3IO1A 1CBKA 5HL7Q 2DHGA 4OLPA 5F8LA 3UNYA 3NGDA 2XCAA 4DV7J 2AD9A 4QYZK 1FWLA 2V8HA 3VVTA 4GO5X 2HVHA 1T9VA 3TARA 4O4GB 4IR1A 2DNQA 5GAHI 1DTTA 2WSEC 3RBDA 1V3RA 3MM9B 2OPRA 3ITHB 1IM4A 2B5JB 2RJZA 2QLXA 3RBEA 4CO1A 5D4PA 1N5VA 3ZNJ1 5C24B 2RNEA 3DGPA 1B0VA 3T1AA 3W2WA 1WACA 2G0JA 5K8PA 4J9QA 4A8WA 4ED6A 4DR6F 3SCKE 2VHGA 4ZPTR 3PV8A 4LR9A 2E9RX 1NK6A 2QT7A 3LW5C 2GQ2A 2OEKA 4PWWA 2N3OA 2ASYA 1M0SA 3WC2A 2EK6A 3FRYA 3JTOA 3H2VE 3D6MB 4OYMA 4ZPWR 4F67A 3H25A 1G4CA 5IZHA 4O3SA 4RW8B 3FEXB 3V4IB 1TMMA 4BCAA 3N6MA 2H5JB 4O3OA 1RA6A 4CLFA 2WK4A 1R89A 3AODA 2FLPA 4K7QA 1F5AA 4LSZB 2BQRA 3PO5A 3D1QA 4UY8T 1BE4A 3UQSA 1YG0A 2CAJA 3FMBA 5I3QA 1G7CB 4DPOA 4EO8A 3BO4A 4DSKA 1WKJA 3ISNC 4JI1F 2V6AA 1KC8T 1N4LA 2R3VA 5J2MB 3V6KA 4WK3A 2YNIB 1HBNB 1NRKA 2AV5A 5FDLB 3GCXP 3W9IA 1FEHA 2IYIA 1FRLA 1TR0A 2FVPA 1U6BA 3HVAA 2O67A 4J9PA 3A3OB 3THVA 2GJIA 1C1CA 4PAAA 1ULRA 1S48A 3G9CA 4K5RA 5ETRA 2HK2A 1NMEB 1RCXB 4WTYA 4RW7B 4KKOB 4A8MP 4X62F 2V9KA 2VQFF 3DLEB 2BV3A 4ED7A 5KFWA 2ZE2B 1XNRF 3HK2A 2B4UA 3D6FB 1IBKF 2ZKUA 2CPXA 3Q8SB 4K2JA 3RAMA 3NMRA 2IRXA 4L73A 5E0OA 2HQIA 4YDDB 5HJYA 4C8ZA 3IXQA 1JMTA 4EUVA 3GIMA 3LGNA 1SQEA 2GJ2A 2XO7A 1VR6A 2OUGA 2VUGA 3MPVA 4J90A 3FBBA 1PYSB 4NLQA 2ZH1A 4WYLA 4DSEA 2ZOFA 3MZIA 3NEKA 3M9MB 2R8IA 2BKPA 1B4SA 3ET6B 1TKZA 4FZVA 2KDOA 5EWFA 3OJUA 2DIVA 3HSGA 4TKTA 5F0WA 4WPAA 3HKWA 3LPEA 3Q2TC 3OSPA 1MLAA 4ZCKA 5CZVA 1CEZA 2KN4A 4CLKA 1UETA 4ZOSA 2KFNA 4JI1J 3DNCA 4KT0C 3OJSA 2AJ4A 4KIAA 5A8WA 2XI3A 1RAJA 1JLFA 4CH1A 5KFOA 4ECYA 1PBUA 3NGTA 4WE1B 3BGRB 3MCNA 4X65F 3N01A 2FLNA 1WNEA 4UOFA 3CJTA 4IO1A 3CC2S 3J7ZT 1JJ4A 2XI2A 3K5LA 1Y5NB 4HKQA 4K4ZA 5BYQA 4LF6F 5B0FA 1FJCA 2B5JA 3QT5A 4EZ9A 2KG0A 4OZNA 3BPSP 1JLAB 4R5PA 4LF8F 3TAQA 2J9DA 4OX7A 1IBCB 3KHRA 5L39A 1VRQC 4NYOA 1REVA 2KRRA 2X1BA 3GLJA 4F3OA 1DBDA 3V81B 2NZCA 1DTQA 1X4EA 5F9NA 1YSJA 1LK5A 3JYTA 4B3TF 1H2UX 2DTJA 3PO4A 1G3OA 1QVGR 1RT7B 2VKRA 4DG1A 4O44A 2FJVA 1TELA 3KJFB 5EHHA 3PW0A 4GVLA 2QMXA 1SC6A 1XN9A 2B9YA 3CD7A 3MM7A 3M8PB 3QGHA 3SFUA 1QAJA 3HSDA 1J2VA 1VOMA 1OQ3A 2XYGB 3HHKA 2JEGA 1FDNA 4M1KA 5HANA 3R2CJ 3HHLA 1HW8A 1FFWB 2EEYA 4FDFA 2E1CA 2UZAA 3M4XA 2DHSA 1T9TA 2X51A 3GONA 1R8BA 2VFUA 2YNIA 4J91A 2VL1A 4ZPDA 4ZN1A 5L1IA 4NLGA 4Y6IA 2M88A 1FX2A 3KUEA 2ZBCA 4LSNB 3UD3P 2LEBA 1WI8A 1JB0C 2NREA 4M95A 1O8BA 4CZCA 3IG1B 3X3UA 1R8AA 3CJQA 3P5TL 4IG3A 4Y34A 3W2VA 4IG3B 2BJ9A 4NXNF 1FXLA 4C4WA 3L95X 2LA6A 3NCQA 1NEEA 1VISA 3VGVA 4U7UD 1VQMS 2HFSA 3M6WA 3PKYA 4GVBA 4HI1A 4NXMF 2JLEA 4Z7YA 3VAJA 2ZM6J 3U1MA 1PILA 4F3MA 1KDNA 1MWZA 4KY3A 1TV6B 4PG8A 3CJ0A 2L3MA 4LT6A 2O1PA 4ZP6A 4DPWA 4ED5A 2JSXA 2CPYA 2RRAA 3HHLD 3DOLA 4DOZA 5KFPA 3THTA 3QGIA 3PW7A 1S57A 3DRRB 5CCLA 1NDCA 3EVMA 1YBUA 4OZ2A 3C14A 5KT6A 1U8WA 1MW7A 4P75A 3A3PB 3UN3A 3FEYB 2UUBF 1RTJA 4C6AA 4F0HA 1SQFA 1YDLA 3IBWA 3KWMA 4I6WA 3V4MA 7FDRA 5DQHA 1B70B 2LXFA 2YNHA 5CD4A 3J81j 3AB4B 3D6TB 1D09B 4X2BA 1RISA 1RT7A 4X4PA 4UOCA 1JLFB 3FKBA 3BKFA 3PG9A 4DFKA 1I6JA 1C2PA 2OD4A 4RLEA 4ZP7A 2HW3A 2JNJA 2VG7A 3BJYA 2XBPA 3DLGA 4I0WA 2C2DA 2UUWA 2GFFA 3IM9A 3LF0A 3ZTQA 5KAKA 4DL6A 3EICA 3POTB 4Y2MA 4FBTA 1Y00A 3NG8A 4B3SJ 1HFEL 3B8HA 3NAIA 4V1Ak 4R5PB 1W25A 2ILZA 3GYNA 1WHWA 1T9UA 2U1AA 3MI7X 5ETKA 3JAMY 2GMHA 3G8SA 2OHDA 1JLAA 2J9DE 4FVCA 2HNYA 4NLPA 4FS2A 3R7NB 2HKEA 3UPFA 1WEYA 4EK2A 2ILYA 3W5XA 4DQPA 3GCWP 4NMXA 5D3GB 3OVSA 4RNHA 2E9TA 2OMLA 4UW2A 5E2QA 3T1YJ 3Q89A 1UJ5A 3AD7C 2IC3A 1JKHA 3PFOA 1PC5A 3TZWA 4A8KA 4O3PA 1Q86T 2AQ4A 4MK8A 3GJTB 4MTPA 4X64J 4CO3A 3CJ8A 4CM2A 5C7PA 1KQSR 1GK8A 3WIVA 2ZJRQ 4ED4A 3RAXA 1C1BB 4IFYA 4J5OA 4Q2MA 1FO1A 4RNFA 3NLCA 2FJWA 4JI8J 5LMNJ 3VVUA 5KFJA 2WVCA 2QL5B 1WOOA 2K8GA 3C19A 1U1PA 3NNHA 1H3DA 2VH7A 4JI4J 4U7UK 3ET6A 4AXIA 1R43A 2AX1A 2RF2A 2NQPA 3BF4A 1T05A 3AOCA 1OY6A 3BR8A 5B0GA 4O0IA 2YNFB 2MZQA 4A8XA 3QYYA 3J7YI 4CM0A 2IM1A 7AT1B 1N34J 1F2HA 3IWLA 1KLNA 3LAKA 3TZYA 4LF9J 4ZP8A 4OZ0A 2L08A 2LQ8A 4B08A 2XYHB 3KOAA 2ZE2A 2CFXA 5KG5A 1EQ0A 4LREA 4TU8A 2EFPA 3A1YG 3EVOA 4MK9A 2GHVC 3SBMA 2DGQA 2A2CA 2KT3A 4WP3A 4QU6A 4ANEA 4JI7F 4RX6A 5ETMA 2RSQA 4LUBA 2C2MB 2K2PA 2N4CA 5EDWA 1T02A 3DGPB 3W66A 1S76D 2DGUA 3LP0B 5HMZA 3F73A 2Q1LA 1S7IA 2KM8C 3CF5Q 1U2RA 2XG8A 3GV7B 3HT0A 3IWNC 2F65A 2I5JA 2YWFA 2QC3A 1MWYA 2VPZB 3JTPA 3HMJG 3EWGA 3HVRA 3R5AA 5M2RA 2HQGA 1AT1B 3OT9A 4TU7A 3CMQA 1XNQJ 3VZIA 5HMYA 2AEFA 2M2BA 1X0PA 5CYMB 1VBZA 1NJXA 2GQQA 4ENOA 1LWFB 2UXBJ 3K17A 4X4NA 4K4UA 4CO4A 2VC1A 2MKCA 3AD9C 3AH6A 4N7TA 1S1XB 1FJEB 2BYCA 3R8YA 2J9EA 1PKUA 5F8HA 2AKWB 3H2LA 4RUAA 5IV3A 1S0NA 2YPYA 2ZH9A 3KLIA 5LMUJ 3C6UB 2AGOA 1PYOB 1UZHA 1G1XA 2YX4A 3B54A 3PYFA 2DRDA 4WFZA 2WONB 2HZCA 3PVXA 4LMZA 1KLMB 5KFEA 4HTIA 2KU7A 3IS9B 2HHHF 5GAHU 3FGVA 4DFPA 2IIHA 4V19X 4M8LA 2V5HG 3KLHA 1FT8A 5KT4A 2ASLA 5D3GA 3DOMA 4JI6F 2PGCA 3MEGA 2BJ7A 4USJC 1HNXJ 4F8RA 1WC0A 4PYAA 3SSRA 3VCDA 1C4AA 4IOCQ 3M8YA 4B9UA 2BJEA 2LMIA 1AZSB 3P4UB 4M5DA 3FBCA 2JX2A 2E1MC 3W61A 2UU9F 1HBUB 2RU9A 2CJ9A 4LSLA 1HBMA 1KS2A 3HZGA 1KKHA 2GMLA 4P72A 2ZOGA 4RW4B 5KG6A 1S6UA 4HDGA 4JI5F 2ALYB 1CC7A 1RKIA 2GCFA 2PT0A 3NXZA 3TYTA 1RA7A 4I2QA 4LBIA 1RTDA 1TAUA 1FJ7A 1IUJA 3PW2A 4V19J 2CYYA 5D4LA 4C97A 1PAUB 1TKXA 5KG0A 2G13A 2VA3A 2IM0A 2YNFA 1HBOA 1XR7A 1U1KA 2IBOA 3IBFB 5DJBA 2MSSA 3RW6A 1RT1B 1NHUA 2PEBA 3LGHA 4HLBA 5KFCA 3EGVA 2VICA 2RRNA 2BZ2A 1TKTA 1VQLS 2V4RA 1HQUB 2JRSA 1BUXA 1RGVA 3QATA 4DL2A 2DNMA 2FY1A 2K06A 4B3SF 3KLEB 2DXFA 2C3MA 4USKA 2R2UA 1YJTA 1WORA 2XSJA 4UT4A 1IBLF 1D9FA 2NXEA 3R2DJ 2X3DA 2XSJB 4U67Q 4ECSA 3GIKA 1Q8KA 1QUVA 3HULA 3POTA 2DYAA 2J8SA 4ES1A 4J9RA 5EN1A 2V0NA 5L1LA 3W65A 4L72B 2FZGB 1VBXA 1AUDA 2H3EB 1XK8A 2VPWB 3Q2SC 4U7CA 3KK2A 1RBOB 1SVDA 2BUNA 3PW4A 4LFCF 3W63A 3DDNA 2LU2A 4AL6A 3PZPA 1XNRJ 2IDEA 2P6SA 3ZZ0A 3NP5A 4WCEQ 2J9CA 3BN7A 1VQ8S 2MSTA 3OL7A 3IN5A 5IOLA 3ENWA 1SB6A 1RTJB 2IC3B 4JI8F 5KFRA 4RW8A 3U02A 1LK7A 2WOMA 2GGPA 2PFDA 3Q22A 1NK7A 3ZZZA 4TY8B 2FVCA 2HS4A 5DRKA 5J2QA 3MM7B 1RZMA 1FA0A 3G86A 4NLWA 3R1LA 1J5EF 2DIUA 6AT1B 2CPIA 2WSCC 5E7OB 4DV5J 4IKAA 1CJTB 1RWXB 2IVFB 1CJTA 2Z58B 1IKYB 3KKFA 1RLDA 4ZDNA 1Q82T 1N34F 2BW7A 5BR8F 4RW6A 2JEIA 3MMCB 1FXRA 1RWNB 1S79A 4DZDA 3IRWP 2UUTA 1X31C 3CW2C 3CJ3A 3D0IE 4R8UA 4ZVGA 2MKJA 2AJ1A 2B4PA 4K4TA 3N6LA 3IS9A 1FE4A 2P9GA 1W2IA 2I2YA 2MKIA 5K20B 5E3AA 1R0BG 3EXYA 1TKDA 4K50A 3LUYA 4USMA 4RW7A 2DR8A 1QSLA 2I6WA 4PXDA 1XR5A 1CSJA 1DJ0A 3KHHA 1ZTWA 4C98A 5IT9U 2DR6A 3HSJA 4OYIA 1ZZNA 2R2TA 3IA0A 3RZAA 2ZZMA 3TJ8A 1GFWB 3K59A 4MKVA 2APOA 4LSLB 3MOZA 4CIOA 1RBAA 4J37A 2NXNA 3Q23A 2Y8WA 3CMES 3CO0P 1AYEA 1VRTB 1QAXA 3H40A 1NUEA 5HJXA 2MKYA 3KLFB 2H5IB 5ITHA 3RG6A 2QN6B 5B0BA 2VQFJ 2HQCA 2KI2A 1Q4RA 3ZZTA 3ISND 4IRKA 4DV1F 1NH8A 2OELA 4QJVA 3QLHA 2UXBF 2I5JB 2QA2A 3QWUA 4P2SA 5E5NA 3OR2A 2NPFA 4FNHA 3M9NB 1RAOA 1JLCA 1OPIA 2QL7B 4EBEA 2OEJA 1M5KC 1FK9A 4KAIA 1BQXA 1CULB 3KLGA 4ED2A 1Z2LA 3ILJA 4DV0J 2NSCA 5BR8J 1R0CB 4XTTA 4FF2A 3WDOA 1Z2ZA 3TVKA 3C6TA 3KK3B 1SPBP 4WFXA 5GAEU 3L4BC 2E7VA 4OJ1A 1KTVA 2VG5A 3FSXA 4NCGB 4NLSA 4J9UE 1C0UB 2PA8D 4NCGA 4OHZA 2F40A 2IA0A 4C0HA 3K58A 4J9KA 1W2BR 1VS3A 5HBMA 5D6GA 1JLGB 1UEKA 1WKKA 3OFHA 2I9SA 2R7OA 3VAFA 1U1QA 2EWHA 1FESA 3GTYX 3OTEA 3PX6A 3GG1A 3RJMB 4CO2A 1N8RT 3OL9A 3TQEA 1XC9A 5C25B 2QEXS 3GE9A 5B0DA 1S77D 4ID8A 2DNRA 4Y2KA 3UCUP 1FWKA 1TMJA 1T9YA 1GXLA 1UPPA 1XIQA 3DOMB 3SXLA 1QUPA 3JYTB 2R8KA 1HNVB 4JI5J 4KGXB 5JXSA 2F4FA 2VOOA 3EGNA 2O3DA 5LXYA 4DR3F 2DNYA 2DGXA 2MB0B 4RWXA 4AT1B 3CXCR 4HTJA 4RUHA 3QJPA 2RMLA 2ZH8A 3O5TB 1NJWA 3MEDA 2OSRA 3FNNA 3GP9A 2Z2YB 4J9LA 2EKNA 1EIYB 1CJVA 5A6WA 3OUYB 5A2QY 4JBCA 4HL9A 3E51A 1RT6B 2QJ3A 5IWAF 1S9EA 1R3NA 3M2UB 1S1VB 1TKXB 1CC8A 2CWXA 2KT5A 3M2UA 2EVZA 3OR1A 2R7RA 2D1CA 1Q53A 1QVFR 4M5NA 2LXUA 2CQ1A 2RS8A 1Y5LB 2V2ZA 2YKNA 2YQ1A 4NZ6A 4X4OA 5GMEA 2YVSA 3G2XA 4CDIA 3BO2A 3N28A 5A8RB 1U2CA 1NHKL 4OMFG 4MT1A 1YVFA 1DLOB 1QY7A 2XO6A 2ASJA 1IWAA 1H6KX 1DFDA 2V4QA 2H65B 3KJVB 5ETSA 1YJUA 2BW2A 1NKEA 4WP9A 2ZH3A 3IAM9 3ZTPA 4ZS6A 1CS4A 1UWBA 3TUIC 1WG1A 4FXVA 4DPUA 1RB0A 1XWLA 2XY6A 1N36J 2DH7A 4CLTA 2GZOA 3P6YC 2BABA 3SMZA 3MPUB 1OYDA 2CQ0A 5K5MA 2HG4A 5AXKA 2VQEJ 4DV2F 4DL7A 4JV1A 1MN7A 1HNIA 1ZM3A 1RI7A 2B4VA 2BJDA 1VJWA 3OFEA 3CCES 4ES2A 3MCSA 4K0KJ 1RT5B 4NASA 2HHSA 1TUVA 1IKXA 1R27B 5KTQA 2XLJA 5BXIA 4LFAJ 2R9LA 3RB6A 1JXLA 3RUBL 1LFWA 1QE1B 2RRBA 2VV5A 4DV6F 1B64A 3NGSA 3T41A 4O0NA 3AA9A 2E7WA 1IVZA 4K59A 4ZJQA 4F50A 2HBQB 3RR7A 3GYXB 1CJVB 1EKSA 3R5CA 1D8YA 2H5EA 1UEUA 1XBWA 2AJQA 3UDVA 3GSDA 3N5BA 1D3WA 3QT8A 1IWGA 2ZBPA 3IR6B 5CXTA 1YRTA 2W2MP 5KT5A 3D2WA 1HA1A 4MKBA 3AQPA 3NWRA 5H9EK 1N56A 2HAIA 2KG1A 2IY5B 4JYAJ 3LP1A 5LL6d 4F2SA 3CJ5A 1R31A 4UUXA 1V3SA 5CQGA 4B3OA 3R5DA 4HHUA 3NS5A 4DF8A 2X7IA 3DCAA 4N56A 4LIRA 1HW9A 1XERA 3DYAB 4IH5A 2BE9B 5KFGA 3MUVP 3G4SS 2E1RA 4I64A 4PQAA 2VDIA 5LXRA 4YOEA 2Z0GA 3T5JA 1FKAF 2HGLA 1TZ0A 5IXUA 4E98A 3DI6A 2VZ9A 1WELA 3NOGA 3UDLA 2VU5A 3G96A 4KQZA 4RW4A 4K4VA 1U09A 2HURA 3EZUA 3M8QA 4TU9A 1RT6A 4BLGA 4MK7A 3OUYA 3GIJA 4EWTA 4LFAF 1LNQA 3IBCB 1I94J 4EU0A 3K2YA 1F0XA 1L3KA 4A47A 2F3JA 2X3GA 5KG7A 5KFDA 3PR5B 4ZLPA 4IRCA 1ZYQA 4XDCA 3CC4S 3JQJA 2NSBA 3K57A 5L1KA 4FKYA 1YTYA 4U8VA 2YH1A 3CCJS 1HQUA 3A8JA 3OBIA 1BHNA 2ZH2A 1N5YB 2P9EA 5A8RA 4CLLA 3G6ES 3DRSA 2XWXA 5KG1A 2DXDA 3W60A 3MUTP 3NCRA 4Y2CA 4ELTA 3IRXA 2PI4A 3M05A 2CPDA 2UV8G 4D3HA 4Y0FA 2RB7A 5D0EA 2WHOA 3H98A 3PACA 5KFFA 3SCIE 3KJNB 2FQQB 4LF9F 2RD5C 2VBWA 2YPZA 1FF2A 4KO0B 4JI2F 1M1HA 1WHYA 4PZVA 3MM6A 3GIIA 1RCOB 2I0XA 2JC1A 2RKIB 4K5SA 1Q0NA 1RT2B 4ELVA 2LVWA 3PIOQ 3I0SB 1K0TA 3TEGA 1R6VA 5M2UA 5C25A 4FVMA 2KYXA 4ECZA 2G0CA 4CYUB 5A6PA 3E01A 1SI9A 2J6SA 3E01B 2BKOA 2W2PP 5J2PB 3EYZA 1FX4A 3D9BA 1SV5B 2YWKA 2KZZA 1AB8A 3BO3A 1UKUA 1M1KT 2BE2B 1M90T 5T7LA 4TY8A 4ICLA 4B9TA 1NJIT 4C8KA 4YP3A 2AZ1A 3BQ2A 3ENVA 3LQVA 5CYQB 1AFIA 2BM0A 2V2KA 4OX9F 1URRA 3GR0A 2W24A 3M1VB 4OYPA 4QW8A 4YEAA 3SSSA 1M5VC 3UVJB 3H5YA 2C2RA 3QRRA 3F44A 3AJDA 1N0UA 3FZ2A 1X60A 2WCXA 1QM9A 1Q95G 2LP4A 5L8RC 1SJ4P 4EEYA 3MCMA 5J2NB 2OPPB 2XS7A 1L3TA 1RAAB 3LP1B 2R7XA 1KSPA 1N0VC 4DUYJ 2VJVA 1RHJB 2P8IA 4JI0F 4I2PA 4IQMA 4JP8A 2VFSA 1UFWA 4JI2J 2NUHA 4LF6J 4O3NA 2VKZG 4X84A 1HHSA 3PX0A 1PO6A 4LRFA 3G6YA 1BWEA 4I6YA 3BYRA 5C5JA 2XS2A 8ATCB 4PPZA 4Y00A 1GTHA 2RQ4A 2HZVA 3PJXA 1PJ6A 2AEJA 3R5BA 2ROGA 1HNWJ 2QMUB 1WHXA 2AMCB 2BKNA 3GIRA 3FFIA 2IAJB 5JUMA 1P1LA 1MSWD 3JQKA 4WWSA 2EBEA 3UW1A 1BC6A 2IRUA 4C11B 1UW4A 2WTFA 3PW5A 2C42A 2YWEA 3B4MA 4YS2A 1QTMA 2HFOA 2A2DA 2B7CB 3A13A 2DEIA 1KHWA 3RW7A 4BS2A 3VAIA 2FB0A 2Z30B 3AY0A 3NKYA 1GMWA 2ZHAA 1N33J 1RUSA 2DGOA 2XZTB 1OJ4A 3MEEB 2GHPA 3QZ7A 3N0VA 3ENAA 4EFAC 1KFSA 3V6DA 5EWEA 3CCWA 4NOHA 2M3DA 1URNA 3I82A 2ASDA 1MMLA 1CVJA 3OLAA 4NXMJ 3H5SA 2MQMA 1GQEA 4FYVB 3MR3A 5KFYA 3DLJA 4ECRA 2M52A 1DAXA 5FJ4A 1TL1A 2OGUA 3FMWA 1KVKA 1GXTA 3W9HA 3RBXA 2YNGB 2HVZA 3IWXA 3N4WA 2XB2D 4K4SA 2BXJA 4ILLA 4PQUA 4MKAA 3H59A 4DL3A 4RW9B 2B51A 5G0RA 5KFVA 5KFSA 2R7SA 4ECVA 2FVSA 4KGKA 5IC4B 3Q24A 1YITS 3D1HA 3VAKA 4ZITA 1H0HB 1C1CB 5HO4A 3CDUA 2ZNYA 2PA3A 5KFLA 1FJGJ 2MQOA 4ICLB 4OZJA 4ZN3A 3OL8A 2EFOA 4ZVSB 4ED3A 4ILRA 2XY7A 2PD1A 3DGVA 4YN3B 1CJKB 4WU3A 2YBVA 2CQIA 3MEDB 5DZ7A 4CLYA 2Y1JA 1DHMA 1X0FA 4DR6J 2HNZA 2QIFA 4RKUC 4CLWA 2VIHA 1IQTA 4YHHF 4DR7F 2W9CB 4B3TJ 1K0VA 1VIXA 4F4KA 1TK8A 3BGLA 3AXKA 3ZXWA 4RUCA 3N79A 3TVZA 2ZWPA 1S6QB 1F6TA 3LANA 4WXOA 2CIMA 2DNNA 2HBRB 3K5OA 3R6GB 5AE2A 4OV1A 2ADBA 2ZITA 4IFVA 4JV2A 4P7VA 1APSA 2R7UA 4UOGA 4ZIWA 4LF4F 5BJRA 1BLUA 4N8OA 3BH6B 1TVRA 4DN9A 4M5IA 4Q0BA 2I38A 4B02A 1E6VA 3C16B 3DRPB 4M5KA 5GMDA 4GKKJ 3KHLA 1TL7B 2YKPA 1SC3B 2MZJA 4CTAB 1OSDA 2MLYA 1DZ5A 2UXDJ 5IT9Y 3M32B 3MAAA 1WC3A 1VHIA 2VDHA 1NK0A 2DGTA 1ROFA 2IM2A 3H5UA 1P6TA 2AYEA 4DR2J 1UWBB 6FD1A 2GJFA 1YWXA 2GHWA 1NB7A 1HI8A 3MM8A 5CAAA 1S99A 1X5SA 5HVGA 3W5YA 2LXIA 3DLKA 5F3TA 4LBPA 1SJQA 2BMBA 2X1GA 3T5HA 4HHJA 3FBFA 1K8AT 1MN9A 1ZBTA 4DX5A 4CNYA 1JLCB 1LKZA 1BQMB 2CNKB 4KHPJ 4OZLA 2AEMA 2NYHA 3CDEA 3M7VA 3FDSA 1PIEA 4LVNP 3AOBA 4NLTA 4OYWA 1L5UA 4DQRA 4I67A 3K7RA 3C3LA 2JEJA 1BWVA 3RU0A 1QE1A 2G1HA 3CO9A 4YR3A 5DZ6A 3DLBA 3V4IA 3TP2A 5J1NA 4YY3J 1OWXA 1Y9OA 2NS1B 4NA2A 5AT1B 1S1TB 5K8OA 1VI7A 3TQ1A 2OTLS 3H5XA 2FJEB 2E44A 2UV8A 1YJ9S 1A6LA 2CZ9A 1VQOS 2Y3YA 4C8NA 2CADA 2GMJA 5L9NA 4I6AA 5T41A 3R27A 1SKRA 4KGMA 1IR1A 2BANA 2PSZA 2R4FA 1NU4A 4ZVUB 3PCOB 4OLOA 4TLRA 2B43A 1RXOB 4IFVB 4DV7F 2R7VA 1GEHA 4RNOA 4PQUB 4LRCA 1IM6A 4DR2F 1VJQA 4HT7A 4B3OB 4KGVB 5HATA 5HP1B 2AW0A 1HNWF 2FTRA 4DPTA 2E5LJ 1EHWA 2J7KA 4QIWD 2QG9B 3HLUA 3I9V9 1SC4B 4C3KA 4CP5A 4DFJA 3DLLQ 1QSYA 4E8UA 2IM3A 1IJEB 3N9UC 4JV0A 1SKWA 5F8JA 2D3O1 2EC0A 1NHVA 2W2NP 5GADI 5EUHA 4J9MA 4F36A 2PEHA 3UDEA 1XMQF 3DLHA 3PM9A 1TUGB 1YZ7A 4KRWA 1U24A 3AHPA 2V63A 3ZTRA 3CCQS 4TQSA 2FUG9 1NO8A 3M2VA 1N33F 2RH3A 2V2QA 5A76A 5ETNA 5A0YB 2CJQA 2FLOA 2DR7A 3NNAA 3TWZA 1SJFA 2MKKA 1I5OB 4DHVA 2B8PA 3DRRA 1EX8A 3MHYA 2HHXA 4RBTA 4WIIA 2MQQA 1RAEB 3MD3A 2UVWA 2XNRA 2GIFA 4OJGA 2FHJD 2PMZD 3RYLA 4H4KA 1Q8IA 2WB1D 2DKOB 4F04B 5ETLA 2KXNB 5LMNF 2VONA 4WKRA 1BXNA 2BOAA 2JVRA 1UPMB 1MU2B 5AXLA 5H9EJ 2AU0A 2MZSA 4NRUA 4PABA 1HI1A 1Q5YA 5FLXY 5L1JA 1HR0F 2Q66A 5F8GA 1TK0A 4PWDA 3PFEA 1SJ1A 2WRMA 3T19A 1EJ7L 3WX8A 2UVVA 4L6V3 4OQJA 5H1SV 1YGYA 1LW0B 1B0TA 3OTBA 5ADZA 4YB1P 4X62J 3M2RA 1EP4A 5DG8A 2C3PA 2KKHA 2PO4A 2YKMA 3S01A 2JFKA 1HHQA 1R7IA 4H54A 2FJAB 4OI2A 3BDEA 2W01A 4DL5A 1NKBA 4X4UA 1FFGB 1S10A 5U47A 5E41A 5I42B 4LF8J 2Z2MA 3JSYA 4Y2IA 1S1UA 1N36F 2RIJA 1ZA2B 3MMJA 2BR0A 2Y0BB 4CO0A 1YX2A 2J0SD 3PYEA 1K73T 2M4MA 4AL5A 4DG1B 2W7AA 3HZEA 3CDBA 2J7WA 3VAMA 2IBKA 1V5IB 3R7BB 2BACA 2W9BA 4DR5J 1S72S 5AJ3J 1MROB 3I9ZA 4WBFA 2A6MA 7FD1A 4RZRA 2XMMA 5DDQC 4LRBA 1UVJA 1B99A 2A3JA 1FCAA 4F4YA 1AUSL 3DDKA 1VDHA 4P71A 4B3RJ 1U0HA 4U95A 3I0RB 2KTQA 1VQNS 3QIPB 1QSSA 2BANB 1U1RA 3NGRA 1Q79A 3DKDA 4DCOB 5DDOC 2UUCJ 4P73A 4UTGA 5HP1A 3GR1A 3MMAA 5KFXA 2DGVA 4PG6A 4OFZA 3PXGa 2AWZA 1T8EA 4DV3J 3S6EA 1GTEA 1K44A 1KOHA 1FKOA 2W25A 3EGZA 4ZVTB 3NMAA 3W2VB 3WC0A 5LMUF 2GA7A 2UVRA 1I51B 1WD6A 2X1AA 4ECTA 4ECXA 4BWJA 4ZPCA 2C28A 1U47A 1K1SA 2K7JA 4Q8EA 4RU2A 1OQ6A 3E3XA 4HT5A 4NCAA 4DL0C 3TNVA 2GIQA 2Y8YA 1VRUB 3TA0A 4IO9Q 5HLFB 1GH8A 4LQ3A 2BRKA 2VD3A 5D0HA 5GAEI 2VB6A 1LXNA 3CJSA 5GADU 1NK5A 3PX4A 1DTTB 2OPRB 4AXJA 2V69A 1HNXF 3MM9A 4M5MA 1EP4B 3L7PA 4NLUA 4ZP9A 3H2UB 3ILIA 3MR5A 2YKMB 2OH2A 4O4RA 1NZAA 3QZ8A 1HPZB 2YWWA 1RAHB 3US5A 1HPZA 2G9OA 4Q7AA 2HIYA 4Y3CA 3MAQA 3PRBA 1BQMA 3KG4A 2MHNA 1B0PA 4NPOA 4OZ1A 4USWA 1RHRB 5KFIA 2W9AA 4ID5A 2W2OP 3PYGA 4OYZA 1YJVA 5F0UA 1NK8A 2MPUA 4RNMA 3DXBA 1S12A 3PTWA 2ZC4A 5HN0A 5IM0A 5F8MA 3IMQJ 2UP1A 1UVIA 2D9PA 3JSBA 3OXGA 1VMBA 1B7YB 4IOBA 4F4AA 5J1PA 3H42A 1SBRA 3M8PA 3BGRA 2I8EA 4QWAA 1P1TA 4ECWA 1JLEA 4B17A 1NSQA 3CJRA 2PE8A 3FQLA 1JLEB 2E1PA 4QIFA 3EJMA 4J9OA 2JEFA 2HFZA 1UFKA 1LW2B 3D66A 4G3IA 2PIIA 1UVLA 3BZQA 4G1IA 4QWEA 2V68A 2F8MA 5D8HB 2DNHA 1X4HA 2WBRA 3QGGA 4N77A 3RB3A 2ACMA 5HK4A 3CT9A 2AHOB 4QWBA 2LQBA 1WTBA 2IA6A 2HNYB 3TOQA 3PIPQ 4DLEA 3CCTA 4CYUA 4F2RA 1UMJA 3CD6S 3K0JA 1HQ2A 2OPQA 1TU0B 2LKZA 1X9WA 4FF3A 3PRVA 3ZO7A 2VOPA 3DOKA 3KXDA 4OYOA 1UJ4A 3BSCA 2GO9A 4JI7J 1ZM4A 4MIWA 2BM1A 3EX7B 2AX0A 2WW4A 4Q8FA 1N32F 1S9FA 2JWNA 2M8DB 3I5CA 2ERRA 1VRUA 2MQPA 2E5GA 4WTOB 1VYAA 1WF2A 1EQMA 2VFVA 3BS9A 3CEDA 2GAGC 2QYGA 5ETPA 1FVSA 4EYHB 1U45A 3PY8A 2GVZB 3OVBA 3MD1A 3CC7S 1NDPA 3M6UA 1V6HA 3H4DA 1O0PA 2WVEA 1FRXA 2M5YA 3I87A 5BYSA 2DBBA 3HD2A 2ATLA 4M5JA 3G71S 1VQ6S 4ZVQB 2JL9A 3MCOA 4FPIA 1RLCL 3C14B 4GMKA 3BSOA 2B8QA 2QSWA 1FD8A 5FDLA 3WIUA 4S0MA 3JTNA 1O6XA 2QTWA 1UFLA 1RWWB 3FZBA 4BC7A 5ETQA 4PKDB 2N3LA 5A8WB 2VODA 2E9ZA 5EX3A 3P49B 1K47A 2B9XA 2H51B 4KHRA 4PEOA 2FYXA 5DG7A 1LWCB 1AA1B 1ELOA 3ETMA 3QT6A 4OHWA 2XMWA 2E29A 1OMSA 3CD0A 2RDIA 3OTDA 3R97A 8AT1B 1DARA 2ACYA 4OYXA 4QW9A 2HHHJ 3L3CA 1HMVA 4JB8B 1RT4A 3OSNA 3SV4A 1HQEB
chains in the Genus database with same CATH topology
1LW2A 4R0EA 3OTOF 1XMOF 4BDPA 3PEHA 4YB5A 2EK1A 3QGPA 3HPOA 1KR4A 3IGNA 4ED1A 1KTQA 4BC9A 3TI0A 5C42B 2K3IA 4DJBA 3MURP 4ECUA 4WXWA 1JLBB 3DRXA 1HWLA 2D3ZA 1JLBA 1ZM2A 5I42A 2CQGA 3CMAS 3SFGA 2M0GB 3QMQA 3MECB 4MYUA 2R7TA 5KFUA 2Q6CA 3VAGA 1S7HA 4C7QA 1T7PA 1S0VA 4NA3A 4Z2XA 1Z4UA 2E5JA 1S6PB 4H4MB 1U1LA 2MKHA 2F9JA 2LECA 3HX9A 4H4OA 3K8WA 4J9NA 4NLYA 1FDAA 2IMOA 1ZPWX 3CCMS 3GFYA 3OHAA 1IKYA 3HDSA 1SL1A 1N54B 3QIPA 5LSRA 3ZZYA 4EYIB 1IBKF 2B7BB 5A8KA 4CH0S 4B9NA 2YY3A 2B0GA 4NXMF 1FXDA 3H5XA 3DU6A 1I1GA 2Y1IA 3CULA 2P5VA 4LSNA 2P9CA 2A1BA 3AA8A 4AYBD 1UVKA 2CQ2A 3ETOA 5KFAA 1YJRA 3DLEA 3FJ2A 2DNPA 4KKOA 2K1RB 1WHVA 3UI3A 5F9LA 5GAGU 2CDQA 2CJBA 2ALZA 2ZJQQ 3GFZA 2MDAA 1OPZA 5JVGQ 2HHUA 3ITHA 4A8SA 1X4GA 4G1PA 1KQKA 1RTIA 4OX8A 1JXEA 1FRMA 3TX8A 1RTIB 1IKVB 1S6QA 3UCGA 2R8JA 1IKVA 2AYMA 2RF2B 2DR9A 4FNIA 4WFYA 3D1OA 3QLHB 3J7A1 1NK9A 3MFIA 5LT5A 1JNZB 1HWIA 3RTVA 1G6BA 4MAKA 4MYTA 1FTRA 1TKTB 1BQNB 2L48A 2IHR1 1WI6A 4CTAA 2R2RA 3M32A 2IFXA 4DDFA 2DPJA 3T5LA 4ALZA 3HHNB 3KK3A 3T3FA 1RQ0A 1FTCA 2LQ9A 3RRHA 1J5OA 1GX5A 4QBUA 3VR1A 3CCRS 4IYQA 5B0EA 2OPSB 2LQJA 5E3RA 5CD4H 2OPSA 4OX6A 1VQ7S 5A8KB 3HHDA 3J7YU 1F5CA 3HI9A 4QIGA 1GNKA 4FPRA 5LSOA 4XDDA 4DQSA 4GO7X 3LAMA 5F8NA 2BRLA 2BQ3A 3RRGA 1JX4A 3DM2B 2P6TA 5AE3A 4AUKA 1P9QC 2PDAA 1S6PA 4H4MA 5DQIA 2F7VA 3IR5B 2Z8QA 1FNOA 4M63A 2QO3A 3GQCA 2O01C 1A9NB 4YB7A 2XMTA 3UE2A 5DGBA 3VAHA 1WF0A 3DLGB 4X4TA 1WTFA 4KHPF 1UJ6A 4LFBF 4U6PA 1BD6A 2O66A 2I1RA 4PG4A 4DEZA 5GAGI 3AJ2A 2ZH5A 4EBCA 3GV5B 1L3SA 1Y0HA 3CIMA 3OR1B 4ZK7M 2HPUA 2W8LA 1TFYA 3M6VA 2HIQA 5KFBA 3ENQA 2QE5A 1TL4A 2CKWA 2J0WA 3VTIA 1T95A 5I3UA 4XIUA 2YKQA 3D5MA 4K2XA 5HMWA 3CJ2A 2X1FA 5KT7A 1Q7LB 1SUQB 2CQ4A 2LYVA 3I6PA 1SUQA 3ZC4A 3VF0B 2DHXA 5JJBA 2CQDA 1T03B 3N5FA 1F2GA 4O4GA 1S0MA 3IR7B 1Q8BA 5B08A 1VK3A 1HHTP 5IQ6A 2LEAA 1U48A 2UXCF 2M70A 5AXMA 2AYGA 5IS2A 3P96A 3CGIA 3LP0A 1B7FA 2FHOB 4DL4A 2HLUA 4KR0B 4YMEA 3KYLA 2Z4PA 4A48A 2CPFA 2CG4A 2W4PA 3AJ1A 4DV5F 4RBUA 5IFMA 1SH0A 3K8VA 4OI3A 3CIZA 5DLGA 4OHVA 3DM2A 2AP6A 1F9FA 2F8EX 4MIBA 5IM0B 4WJBA 4W92B 2KO1A 4O44B 4ZKAA 2DNZA 5CYMA 4URSA 3EPGA 2R7QA 1LWFA 2KVIA 5LJ5Y 1FDDA 2C3YA 3DN9A 6FDRA 5L9XA 4MFBB 2CQ3A 4A8MP 1VQ4S 1CVJA 1HMVB 4MFBA 4Q45A 5MAOA 4DSLA 4C8ZA 2C2EA 2R2SA 2UUAF 2MKSA 2Q3PA 3FCHA 4E0DA 3HVWA 1TL5A 5HBMB 1D9DA 3AAWB 4G1QA 2JOQA 1KQFB 1DQ8A 3UWTA 3BGUA 3IG1A 1YBAA 4K4XA 3BREA 3KMSA 2WAQD 3VZHA 4PXBA 3WBZA 3UCZP 3AB2B 2K1RA 3HT3A 2HRUA 1JNRB 3F41A 4O23A 1N88A 3FVYA 2QA4S 4M5DB 4YDXA 2PFFB 1RWUA 1F5BA 3CDWA 3DHWC 4EZ6A 2MMYA 2Y0SD 5SZTA 2M7SA 3KMQA 1C0TA 3QJLA 2OJ3A 1T94A 1N6QA 3K5PA 1TKZB 1T05B 1D0EA 4FBUA 4TXSA 4WF9Q 4RNNA 3E2EA 4R8UB 3ISZA 4DR5F 2IYGA 3LOUA 1AROP 4DV4F 1QLNA 1HBOB 3BSNA 3OXLA 1PC4A 4KPYA 5K9FA 3LGMA 3UFCX 1KOOA 2CVIA 1H7XA 2YKOA 1PGZA 2CVEA 2F8HA 3NWGA 2QV6A 4NZ7A 5I3UB 4CT8A 3TA2A 2QSFA 5CHCB 1SXLA 3B4DA 1UL3A 1NAQA 1OS5A 2KB2A 3SCJE 1HD0A 4ZCLA 5LJ3Y 4ZVFA 4QWDA 4KBIA 5FIIA 1TV6A 3W3SA 2FDNA 2R8HA 1NJZA 5LSLA 2HYIB 3O44A 3H4BA 4DSIA 3DOLB 3U1LA 3I96A 3ZZUA 2JZ5A 5T14A 1IN0A 2VBXA 2FGOA 3QO9B 1D9AA 2ZH6A 4DQQA 1N52B 5DGAA 1YJNS 3ONQA 2RQMA 4NLDA 2E5HA 3TO8A 3PDNA 1HARA 3MWBA 1VIOA 3V6JA 5KG2A 3MR6A 4HEA9 2V94A 4DUZF 1H38A 2PMHA 1VQKS 2CJKA 1SIWB 2J8AA 4Q2LA 3GG0A 4NWBA 4WE1A 3V5RA 3OVAA 4KHMA 2HQ3A 2N4DA 1U1OA 2OFGX 2VG5B 4TY9A 4C0BA 2N7CA 2D9OA 3LPYA 1J5OB 2FC9A 4FF4A 1JJHA 1RK8A 5GMKa 2HLTA 4AE5A 1EETB 3OFGA 3MMCA 1WEXA 2DHAA 4G1QB 3PKMA 4QR0A 2IVMA 2N7YA 1R0AA 4XPEA 4CH7A 3O2IA 1KVIA 1VGYA 4IDKA 3TAMA 3L09A 1HYSA 1Q7YT 2V8VA 1JJ2R 1DTQB 4B9LA 5B09A 3F56A 2ZH4A 2KFYA 5DETA 2EW9A 3OPKA 2VFRA 1WG4A 3BR9A 5CCMA 3KJVA 2WOMB 3KTQA 1LV5A 1SH2A 2V4JB 4A4JA 2WBMA 1UA1A 1FD2A 2XULA 4LF5F 3LWMA 5D4NA 1FJGF 1C0TB 2MXYA 4I2QB 4DV0F 2DRBA 3NNCA 2HHQA 2QFJA 4GC7A 1HWKA 3MMBA 4DS5A 4ZPAA 1S9EB 4N41A 1P27B 4ATNA 4X4VA 2RDJA 4Y65A 2JFDA 5D4OA 4KV8B 2PI5A 5HROA 2HHTA 2JLGA 4FP9A 4ZPVR 4KJIA 1M5OC 3CUNA 3C2PA 1HL6A 3SDEA 3MPYA 5DLFA 2POKA 4NL5A 3N6NA 2KJVA 2VA2A 1T03A 1RT4B 1VQSA 2KHCA 1HWUA 1Y7PA 2KXHA 1Y3JA 4UY85 3SCLE 2HWIA 4WZMA 4DR1F 3C6UA 2DNOA 5FD1A 3MTJA 3CJ4A 3TANA 2DT9A 3W2WB 2EG1A 3M6XA 2L9DA 3I0SA 4MJKA 1U4BA 2NLWA 4R25A 3AQOA 4IQXA 1ZH5A 4FXDA 1LFPA 3J80Y 4Y2AA 1VFJA 4EGLA 3MECA 4A8FA 2ZM6F 4FF1A 4XK8C 1KFDA 3D0HE 4TLQA 3KNAA 2DK2A 2DCUB 3D54A 3EUNA 1YRXA 2K7KA 1TAQA 2V4JA 3CJKB 1S1XA 1HBUA 3C66A 3GZ7A 2OD6A 4QWCA 2G4BA 1YIJS 2CQPA 5DS7A 3MPWA 5GVQA 1KRPA 3NRBA 2ZFHA 4IH7A 1XNQF 4RW6B 4D3GA 4TN2A 1XMBA 3OV7A 2YX1A 2UVUA 4M94A 2JLFA 2CPJA 3S1TA 5D78A 1ZAXA 3MXHP 1AXQA 2VC0A 1R0AB 1VLYA 2ROPA 4ED0A 5HQ8A 4I2PB 2WSFC 1S49A 1ZOTA 1HYSB 5KFTA 4MH8A 1JKHB 2KJWA 3DRPA 4B3MF 4DQIA 2KT2A 4QR1A 3LO3A 3Q0AA 5EX0A