4WFBQ

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with bc-3205
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
89
structure length
89
Chain Sequence
EARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVASVNIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
molecule keywords 23S rRNA
molecule tags Ribosome
total genus 11
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wfbQ00
1B7FA 3NS5A 1D9AA 2HGMA 3EGNA 3CUNA 2JX2A 2CQ2A 3G9CA 2MSTA 2DNPA 1WI8A 2CQ0A 1VQ8S 1AUDA 1WEYA 3L3CA 2FHOB 2DNNA 2LA6A 3CCMS 2FC9A 1H2TZ 2CQ3A 2DHSA 3NMRA 2RUGA 2LMIA 2U1AA 1YIJS 1X4BA 5DDQC 1HA1A 4Z2XA 3RW7A 4FXVA 2MKJA 1U1RA 1WTBA 1UFWA 2CPHA 1X5TA 2DISA 2DNOA 2CPFA 2K8GA 1VC6A 3VAFA 2LXUA 1VQMS 3CCUS 2XNQA 1FXLA 3CCVS 2L41A 2MZTA 4PR6A 3PIOQ 4C4WA 5DM7Q 2QFJA 2F3JA 2RVJA 2BOPA 4FXWA 3S7RA 2PE8A 1KOHA 3EX7B 4CH0S 2OTLS 2DGVA 3VAKA 2CPDA 4QPTA 5DM6Q 4RU2A 2QA4S 2DNGA 1X5SA 2MPUA 1M5OC 4F26A 1WEXA 4WFBQ 2KI2A 2EK1A 3IWNC 1OPIA 2X1BA 2GHPA 4V19X 1WWHA 3H2VE 2RS8A 3JB9k 2DGWA 3NS6A 1Q82T 2K3KA 3OW2R 2RS2A 2J0QD 2EVZA 1OIAA 1U6FA 2RRAA 3DXBA 3EGZA 1P1TA 2MZ1A 1A7GE 3U1MA 5LJ3Y 2D9PA 1DHMA 2LA4A 4WFNQ 2KM8C 1FO1A 2M8HA 1DBDA 2RQ4A 3U1LA 5LSOA 2EK6A 3SDEB 3CPWR 1X4FA 2KH9A 2I2YA 3TP2A 2AYMA 2KYXA 1ZZFA 1FNXH 2O3DA 3BO4A 1VQ6S 1VQNS 3DLLQ 2ADBA 3LPYA 3G4SS 1JMTA 1N54B 1XN9A 4F25A 4W90B 3VAGA 2I38A 1KC8T 1SJ3P 3UCGA 2LYVA 1S72S 2MZSA 4EGLA 1D8ZA 2F9JA 3RW6A 1WF2A 1WG5A 2E5HA 4PKDB 2CQCA 1U1KA 5LJ5Y 2MZJA 4ED5A 3MURP 2CPXA 2VODA 2DGUA 2MQOA 1WEZA 4YOEA 4Y0FA 2DIUA 2FPHX 2MZQA 2ADCA 1R8PA 1G2EA 2NZ4A 4CQ1A 1SJFA 4WKRA 5GAEU 2DGQA 2N3OA 1VQLS 2X1GA 1VQ7S 2U2FA 1NU4A 2DGSA 4OZ1A 4LIRA 1R8HA 2M8DB 1SXLA 5CXTA 1VC0A 4QQBA 2JVOA 1M90T 2G4BA 2XS7A 2CQPA 4ERDA 2JWNA 2KFYA 1X5OA 5IM0B 4CH1A 2DH8A 3R1HA 2CQ4A 2L9WA 5GVQA 1QVFR 2ZJQQ 5LXRA 1NJIT 2JRSA 2MKIA 2OTJS 4IOAQ 5LXYA 4P6QA 2KXHA 2KHCA 4U67Q 1WHWA 2MXYA 3BO3A 5GAGU 2CPEA 3MI7X 2SXLA 3K0JA 2KRBA 1YWXA 1X4CA 2G1DA 2RU3A 3V4MA 2PEHA 2DNRA 1YJNS 3CMES 3CC4S 3MXHP 2DGXA 1YI2S 3US5A 2KVIA 3HHNB 1JJ2R 5MLCV 1FHTA 1YHQS 4WF9Q 1UAWA 2DH7A 2ZJPQ 3CCQS 2YKAA 4TU9A 3MD1A 2KG0A 5GADU 2M52A 1FT8A 1BY9A 2J76E 1YTYA 4C7QA 2FC8A 1M5VC 2J0SD 1YITS 2RNEA 3IRWP 1VBYA 2MQPA 3S01A 2KXFA 2CPYA 2MJUA 3PIPQ 1FJCA 2YTCA 1UW4A 1CVJA 2B0GA 2M88A 2E44A 3CC2S 3UCZP 1W2BR 1SJQA 1O0PA 4BS2A 2MKHA 1M5PC 2MSSA 1Q81T 4YUDA 4C0OC 2ERRA 2D3OR 1IQTA 4F02A 1A9NB 2HYIB 2MKSA 2DO0A 4WCEQ 2DIVA 2N7CA 2LKZA 2RT3A 4LMZA 2HGNA 2KN4A 2E5JA 2DNLA 3BS9A 2AYBA 2M0GB 3P49B 3SDEA 5D77A 1K73T 5DDPC 3S6EA 2MKCA 1WHVA 1WF1A 1Q86T 2HVZA 3BO2A 3NNCA 2DB1A 2YH0A 1HD0A 5CYJA 1X4DA 5ITHA 1X5PA 2AYGA 3HI9A 5IQQA 4A8XA 3MDFA 4YB1P 2MQNA 3D2WA 1FJ7A 2CPIA 2OJ3A 1U1QA 1KOOA 1H2UX 3MUTP 2VOOA 2YH1A 1H2VZ 1M1KT 1X4GA 3CCSS 5LSLA 1JJ4A 4M5DB 2LEBA 3P6YC 2DNZA 1X4EA 3NNHA 2NLWA 5HO4A 3THPA 1HD1A 5JVGQ 3I56S 2LEAA 3THTA 2XB2D 2KT5A 3G6ES 3LQVA 1P27B 3G96A 1X4HA 4WIIA 2F9DA 2MHNA 3Q2SC 2M7SA 4LJMA 2E5IA 4ZKAA 5GAHU 3VF0B 2VOPA 1ZZNA 5JVHQ 1H6KX 4IUFA 1FJEB 2DGTA 4IO9Q 3NNAA 1F9FA 3CXCR 2LECA 5IM0A 4IOCQ 2J8AA 1U1LA 3P5TL 3ZZZA 5H1SV 2MY7A 1PO6A 2XSFA 5GMKa 3CMAS 1WF0A 1RKJA 2CQGA 1X4AA 2V94A 3ULHA 3ZZYA 1QVGR 1N88A 3MD3A 2MMYA 3CCLS 1N8RT 2DNHA 4QU7A 3H2UB 1UP1A 3Q2TC 3UD3P 2L08A 2DNKA 2DNYA 1WHYA 2DITA 3CC7S 1S79A 3VAMA 2MQLA 1YJWS 4OZ0A 2DHAA 3SMZA 2MKKA 2MJNA 2HGLA 2MB0B 1VQOS 2OSRA 2A3JA 5IFMA 2N3LA 2MZRA 3S8SA 2XS5A 2CQIA 2CQBA 5DETA 3G8SA 3P3DA 2LXIA 2OIHA 3CCES 2XNRA 3R27A 3MOJB 2DHGA 1X0FA 2KG1A 2Q79A 1KD1T 4J5OA 1N52B 1PGZA 1SJ4P 1WG1A 3I55S 1OO0B 2AYEA 2RQCA 1WHXA 2DGOA 2CPZA 2DNMA 3BEGB 2OSQA 3UE2A 1ZH5A 2DK2A 3VAJA 2AD9A 3FEXB 5CA5A 2G0CA 2CQ1A 5BJRA 2ZJRQ 3MUMP 2DH9A 2LQ5A 4UY8T 4W92B 2KU7A 1RK8A 2CPJA 5EN1A 1VBXA 1Q7YT 2HZCA 1WELA 2MGZB 2MGZA 1VQ5S 2MY8A 3CCRS 2JVRA 3G71S 2DNQA 3CTRA 3SXLA 1U1NA 2KM8B 2M4MA 1HL6A 3MUVP 1L3KA 3B4DA 2BZ2A 3CD6S 3CCJS 2CQHA 3J7ZT 5HL7Q 3VALA 2M70A 4QU6A 2N82B 1SJRA 3TYTA 1VC5A 2DO4A 2DHXA 2XS2A 1OWXA 1YJ9S 1QM9A 1VBZA 3CF5Q 3UD4P 1U1MA 4PRFA 2FY1A 5FJ4A 1U6BA 1VQKS 2VONA 1U1PA 2UP1A 3VAIA 5DDRC 1WI6A 2KRRA 3N9UC 2CJKA 2YWKA 2X1AA 2D9OA 1KQSR 2MQMA 3J7YU 4CIOA 2LCWA 1U1OA 1VQ9S 1NO8A 4TU8A 3UCUP 2MYFA 4Y00A 2QEXS 1DZ5A 1VQPS 3VAHA 1URNA 2M2BA 5DDOC 2E5GA 3B4MA 1DRZA 2CQDA 2GO9A 4TU7A 1VQ4S 1WG4A 3R1LA 3CULA 1U2FA 4TLQA 2KXNB 3UWTA 2X1FA 3FEYB 2MQQA 1JJHA 2RRBA 1K8AT 4WFAQ 1M5KC 1K9MT 3G8TA 2WBRA 4UQTA 3TO8A 2M9KA 5D78A
chains in the Genus database with same CATH superfamily
4ED3A 1RAEB 3N6LA 3UNYA 1L3VA 3G9CA 2AJQA 5KG3A 2PD1A 4OYXA 1FI4A 2F5GA 2LA6A 2DXEA 2FC9A 2POKA 1S0VA 1LNQA 2RUGA 1EETA 1IKXA 1HA1A 1IR2A 4FXVA 5DJBA 1U25A 1FWPA 5HK4A 1C0UA 2ZUGA 5KOWA 2QFJA 2F3JA 4C3KA 4PWDB 3V2UC 1ZM3A 2FTRA 2QA4S 1VCTA 4ZITA 1KRPA 1FRMA 3BH6B 3FC9A 4FF1A 3H2VE 3I32A 3QRQA 3GONA 4OV1A 2LA4A 4F8RA 3HT0A 4DG1A 4BLGA 4KQZA 4OZLA 4X65F 1ZZFA 1D9FA 3FQKA 1R7IA 1HNXF 3QO9A 1HWKA 3BGUA 4NEZA 2DT9A 2LYVA 3PKMA 4J9UE 1D8ZA 5DLGA 2X7IA 4FDFA 2JZ5A 1RBAA 2DGUA 2H4WB 2JFKA 1WEZA 4PG7A 3NP5A 3LP2A 3GIKA 4H54A 4IYQA 5GAEU 4CO0A 4DS5A 4B9MA 1K0TA 4RNNA 3RB3A 3LP1A 5J1EB 2QG9B 2YPYA 2W2MP 2L48A 1QAJA 2ZM6J 1U6ZA 4C8OA 2CQPA 4FNHA 2ZKTA 1X5OA 1OQ3A 1RWVB 2CQ4A 2RKIB 4GO5X 2ZJQQ 3IP0A 1UVKA 1GMVA 1RT2A 4A4JA 4U67Q 2ALYB 3EWGA 5L39A 2RSQA 5GAGU 3M2VB 4NYOA 5HLFB 2IAJA 2QYGA 3K5LA 4U7CA 3US5A 3WIVA 2NSBA 4G1QB 3D1OA 2WZ1A 2UUBJ 2MKYA 4PPDA 1RAIB 4J9LA 2M52A 5FLXU 1FT8A 2VQEF 4HT7A 5CD4A 2E29A 2RNEA 1CC7A 2QN6B 1SJQA 3VTIA 1OPZA 4K4SA 3T5HA 2ROGA 1NDKA 3AT1B 2P9EA 1QE1B 2AYBA 4C48A 5D77A 2WCXA 3KG4A 1Y10A 2YH0A 3GFHA 3HI9A 3L4BC 2R7OA 4JV5J 4CLPA 2VOOA 1KOOA 1F5BA 1N36F 3MTJA 4J9NA 4RWXA 1T11A 2P6TA 1JJ4A 4MIAA 4NLYA 5L1IA 2NLWA 3R5JB 2UV8G 4K4TA 1HQEA 4BCAA 2R8HA 4J9SA 5D4OA 3KJVB 3LQVA 4KYZA 2W7PA 3NAIA 1KHVA 5T14A 3MEGA 2VH7A 1FFWB 4JBCA 3GYNA 4DUYJ 4FF3A 2MY7A 4NMXA 4Y2AA 4A8FA 3ZZYA 3FMBA 1IQZA 2J7KA 3MAQA 2HQFA 2GQCA 4EU0A 5FD1A 1F5CA 2NXEA 1QSLA 5M2PA 2V8HA 1R0AB 2BOAA 2OIHA 3AHPA 1RABB 4X4PA 1SJ4P 4YR2A 3DNCA 2BRKA 2DNMA 1R0CB 1RK8A 1A0OB 4E0DA 1U8WA 4C98A 3JS9A 2FLOA 1HHTP 5KT3A 3JSMA 2PFDA 3MEKA 4YHHF 2VBXA 1TK5A 3TVKA 2BE9B 1NNDA 2QT7A 5T41A 2GGPB 2E9TA 1RAAB 3DMJB 4WP3A 1QM9A 1MNEA 3OQ2A 1U1MA 2GO8A 4IH5A 1VQKS 2UP1A 4YDXA 3VAIA 5D15A 1TL7B 1FRHA 2X1AA 2E9ZA 3R5DA 4Z37A 1CJKB 3EGVA 5MAOA 3KMSA 2B9EA 2FUG9 1S1WB 1AUSL 4U8YA 4DV2J 2IYGA 6FDRA 5A2QU 5AXNA 3GZ7A 2M2BA 2QMUB 5ADZA 1JLEB 2CQDA 2GHVC 3CIMA 3TZXA 4WFAQ 3PNIA 1Q8LA 3O8WA 2M9KA 1XMBA 3GIRA 2OH2A 1NDPA 4OFZA 4O4RA 4NASA 4NLOA 2NZCA 3M8PB 5C42A 2IM1A 3K59A 4DFJA 4CTAB 2VHGA 3PACA 1UPPA 4Z2XA 2BM0A 2W7AA 4YQWA 1J5OA 2BXJA 5K14B 3SI8A 1XR6A 4C4WA 4WU2A 3HD1A 3RTVA 4USVA 2XLIA 1YZ6A 3QFHA 3GCWP 2A0FB 5B0AA 5HATA 3K5NA 1TL1B 4CLUA 3M8RA 5JUMA 3MCNA 3PX4A 3PJXA 3FSIA 4C0BA 1NLKL 3CDUA 3KMQA 3F41A 5EX0A 1FD2A 3DXBA 3N6MA 2BKPA 1Q53A 3U1MA 4QR0A 2CWKA 1XC9A 2JDJA 4LR9A 5BYRA 2J6TA 3MMAA 2HPUA 2R7SA 3VGSA 3R6LB 5LSRA 1S72S 4K2JA 2VPZB 3WIUA 4LQ3A 1OQ6A 1Y3JA 5G0RA 2IJRA 4R25A 3N01A 3ET6A 1R8PA 3CJ4A 1SJFA 1BWEA 2QSWA 4KHPF 2B5JA 2DGSA 1LWXA 3CSKA 4CLZA 1SXLA 4DJBA 4F7VA 4DV0J 2IRUA 4CH1A 2PFFB 4CCHA 1NPPA 2QFIA 2Q66A 3M7VA 1NJIT 1N6QB 1IUJA 4KTQA 5THWA 3AOAA 5ETVA 4EZ9A 1XNRJ 3BO3A 2WVCA 1D0EA 5B0GA 1X4CA 2G1DA 3V4MA 1H74A 1QDUB 4C97A 3KLEB 4ZA1A 3BR8A 4PWDA 3KG1A 4B3MJ 2JL9A 4UUXA 4J9PA 1T9XA 4LF8F 4JOUA 1OSCA 1T03A 2NSCA 2NXJA 3J80U 5KT4A 2V9WA 1YQHA 4OI6A 1SCJB 4TXSA 2IPOB 2D3OR 1IM6A 3WZ0A 3BS9A 1Y5IB 4CNZA 2Q6BA 4OV6A 3PHEA 3DLKB 2OMOA 2VG5B 3N0VA 4NL5A 3EGWB 2VJUA 1DLOB 1X0PA 1TTHB 2AYGA 1JX4A 3D6HB 4DI6A 4XPEA 3ZZRA 1PJ7A 1U1QA 3MUTP 2YH1A 2VV5A 3PYDA 4USWA 2EC0A 2IYIA 1X4EA 1FD8A 4ETXA 2NUUG 2V2VA 3OTBA 1B99A 1HD1A 2XMJA 2X3DA 3NWRA 4WIIA 1QD1A 2ZH4A 1OY6A 5J1EA 4X84A 2BACA 2IRYA 3FMWA 2DGTA 3H5UA 1KVKA 3OVBA 3RRKA 2XSFA 5KG6A 1RKJA 3FKBA 1VBKA 2DNYA 1G6BA 3M2VA 1RB0A 2MQLA 3VZHA 1Q79A 4F4XA 2ZBCA 1ZETA 2V68A 1KVJA 1J27A 1FKAF 1LWFB 1TKDA 1BQNA 3ZC4A 2CQIA 4G1QA 3ZTSA 1FX4A 4F3QA 2KG1A 4KH1B 1KD1T 3HSJA 2FGCA 4X4TA 1RWXB 3MMJA 2XI3A 1WC6A 3VAJA 2P5VA 2B7BB 4DQPA 2KTQA 5BJRA 1OY8A 2KJWA 5GAHI 2X3GA 3H0PA 4Q7AA 3V81B 1R6YA 2JVRA 3CTRA 3MAHA 2M4MA 4DCOB 2FVQA 1QE1A 4ZVRB 5A8KB 4RZRA 1F1BB 2M70A 2QRRA 2FJAB 2VC0A 1KVIA 1QLNA 1VLOA 5KFRA 4F0HA 5LOQA 7AT1B 4DFMA 1VIXA 4ALZA 1XERA 4M5NA 1VRQC 4HACA 1V3SA 4OYZA 3VV2B 1VIOA 4GMKA 1JB0C 3EJMA 1NSPA 2HG4A 5ETLA 3KJVA 1BQMA 3PW4A 4DV6J 5HP1B 2KXNB 1S99A 2AJ0A 4TVAB 2BRLA 1NAQA 1B7FA 3RB0A 3WQPA 3RGIA 2WK4A 3EGNA 1EKRA 3GYGA 2XM3A 1SC1B 3QT8A 2Y1JA 1U7LA 1SC6A 1AUDA 2FHOB 2DNNA 2CAJA 2Y0SD 4ZVEA 3N28A 2XLKA 3N6NA 2HQDA 2FY8A 3DDIA 3KJQB 1TKXB 1RWNB 3FBBA 1R0AA 4OYWA 4DR5J 2CPFA 2LXUA 4UOHA 2ALZA 3UDVA 1S1VB 5DM6Q 3D28A 1UEVA 4GKJJ 4DSEA 3D54A 3N5FA 4O4GB 4DS4A 3Q8SB 3HD2A 2R7UA 2VASA 2Z0GA 1U24A 5E3PA 2OD4A 2KFNA 1SC4B 1YJVA 2GGPA 3DMJA 4YR3A 5KG1A 2H5JB 1W26A 3Q23A 2WRMA 3DC2A 2HNDB 3M4XA 3H5SA 1S9FA 1TL7A 2JEJA 3ILIA 2XC9A 4F25A 1CJKA 3DOLB 1R27B 5AXKA 1RHRB 2AZ3A 2XZDB 2X51A 1S1WA 4JI8F 4DDFA 1GTEA 5KFXA 4M1KA 1K1SA 5C2CA 2I8EA 3SV4A 1JLEA 2NYHA 2MQOA 2FB0A 2KKHA 3OUYA 3ONQA 3K7RA 2ACMA 2JOQA 3BSNA 1R0BG 1V9OA 1VJWA 3L7UA 3FJ2A 1R8HA 1B64A 2B9XA 5ETPA 2CNLB 3QGHA 3M8PA 1RTHB 1TZ0A 4USJC 4CTAA 4OZNA 5AE1A 3WC0A 2V63A 2NPIA 4TNOA 1RWKB 5JMNA 2SXLA 5K14A 1CS4B 3QSIA 2V6AA 3D3CJ 1YI2S 3KYLA 3NS7B 3BKTA 2O5DA 1JLCB 2ZJPQ 2IM0A 1OMSA 2NPFA 2J7WA 4DZ6A 2LXFA 2OPQB 5B0FA 1TL1A 3H5XA 3FDSA 4X64J 5AJ3F 3NLCA 2YQ1A 3EZOA 1FFGB 1UW4A 1S6QB 2O66A 4X62F 2RQMA 3CDAA 3DHWC 1MU2B 2HGNA 2R7XA 4UOCA 4GC7A 3S6EA 4NLXA 1RTDB 4O3RA 1YSJA 3P96A 3HFKA 2VQEJ 1X5PA 2BM1A 3D0HE 2NXNA 3IM8A 2IBOA 2RJZA 2ZHBA 4NI2B 5F9NA 1UWAA 3T5LA 2CXEA 2QYCA 3FGVA 1RUSA 2XB2D 1HBNB 4ZVQB 4HTJA 4QOTA 1UETA 3OD2A 4ILRA 5H1SV 2AWZA 1FTCA 1ZM9A 4WFYA 1S0NA 1RE1B 1N36J 2C3MA 1N6QA 4PAAA 2D7SA 4C8MA 3W5XA 4WTYA 3MM5B 4QU7A 4BWJA 1UKUA 4CI0B 3HJVA 3CJ2A 2DEIA 3PO5A 3A12A 2EKNA 2MKKA 2MB0B 2ZVSA 2OSRA 1YBUA 3KLEA 3T1AA 2XS5A 2CQBA 3FSYA 3M6WA 3MMCB 5BR8F 4ECSA 3O5TB 4LF4F 2CNOB 3I55S 1EQMA 2AW0A 4RBUA 5D0HA 4WFXA 3UN3A 3B78A 3MUMP 4YY3J 2FDNA 4ZJLA 4I1TA 3G87A 3C6UB 2UVUA 1MROB 1IWGA 1EZZB 4P7TA 2MQ8A 3MMBB 4JYAF 2XLJA 3Q89A 3ZTRA 1GX6A 3DLKA 4ZN3A 3RR7A 2GJFA 2VG5A 3GP9A 1DLOA 2RILA 7FDRA 5A8RB 4PYAA 2KVQE 4P9SA 2VC1A 1SB6A 2GW8A 1H7XA 3NXZA 2NCKL 4B9VA 2GCFA 4QWEA 4DR1J 3BGLA 2C3OA 1JXEA 1AZSB 3IN5A 3L95X 3C19A 3M1VB 2YNGB 2I9SA 3IGNA 2BANB 4RNHA 2DXFA 2VKRA 2PI5A 2X1FA 2RRBA 1M5KC 1K9MT 3LGNA 3I4PA 4OZJA 5DG9A 3MCOA 4OHXA 3NS5A 2H48B 3W9HA 4IR9A 2K1RB 4JI1J 2E1RA 3KK3B 4KJIA 2YPZA 4KGVB 3PYFA 4DR7J 2CJXB 4FKYA 2OGUA 2EW9A 1CG2A 2Q3PA 1LWFA 1U1RA 5ETRA 1PYSB 2UUTA 4FF4A 1BD6A 4WJBA 2DRDA 1FESA 3CCUS 4DF8A 2OD6A 1UJ4A 3SSSA 1HMVB 1KLNA 3SEOA 1X5SA 4X4UA 4PXBA 3RAMA 3V81A 4V1Ak 2QMXA 4NLPA 1YX2A 4FPIA 1OPIA 4DL7A 3OXFA 4MK9A 5A8KA 4OHVA 1E6VB 3EVMA 2FLNA 3EGZA 2JEIA 3UR3C 3QT6A 1KKHA 2RQ4A 2HQCA 4OYIA 3LWMA 2K2PA 2AF6A 2V2QA 3MM7B 4W90B 3UCGA 3VGTA 1LW0B 4MT1A 5LJ5Y 1BUXA 4ED7A 5HP1A 4JI6J 4Y0FA 5A6PA 2ZBQA 1Q5YA 1HW8A 4ZK7M 2FYXA 1NPKA 2O01C 5CXTA 2G13A 5KFOA 4O3NA 2AQ4A 4AQYJ 2R7QA 3ZNJ1 2CVIA 3LF0A 2XO7A 1R43A 4IRCA 4JI3F 1UWBB 5KFGA 4DL5A 4LFAJ 5LXYA 4DV5J 3IA0A 1TKXA 2IRXA 2Z2LA 2CRLA 4DSKA 4LVNP 1PKUA 3SQOP 5H9EK 4DPOA 4TQSA 3CC4S 3MXHP 2J0XA 2D41A 3KK2B 1P1LA 1S4EA 1SIZA 1YBTA 3DI6B 4H4OB 3DGPB 1H3DA 4IFVB 1NJWA 2HRYA 1S1VA 3HO1A 2KG0A 4Q44A 2XZTB 4CM0A 2FC8A 2WVEA 1TQLA 5BYSA 3N5BA 2E7XA 4O4GA 5KFBA 3W60A 3KDOA 2YTCA 2LVWA 1IQTA 5KFQA 1T94A 3GFYA 4CYUB 2LU2A 5K20B 2B9YA 2HNDA 1TAUA 3CJSA 4P2MA 1XEZA 5IQQA 2HZAA 3DOLA 5HANA 3ZTQA 2VB6A 1H2VZ 5IC4B 3UN5A 3MFHA 3RAQA 4RPFA 3P6YC 1MW7A 1C1BB 3NNHA 1LXNA 3PX0A 3AQPA 2XMVA 2Z2YB 4JB8B 3KJFB 1NJXA 3DRXA 2HW3A 3LUYA 2M7SA 5GAHU 2ZNYA 3LALA 2LECA 2WONA 4LF2A 4B3OB 4QCLA 2GQQA 2D1CA 4XDDA 5IT0A 3EXCX 1RTHA 4HTIA 2ZBPA 1FJGJ 1PBUA 3ZZUA 3TUPA 3ULHA 1H7WA 4QW9A 1QVGR 4DX6A 4Q0BB 1N48A 3PKYA 4K0KJ 3RAXA 3Q2TC 3I5CA 5K8PA 1S1XB 3OVAA 1YJWS 1CS4A 2DJWA 2EPIA 1TL3B 2J8SA 2NXCA 2V2ZA 4A8QA 3RRGA 1ULRA 2RAQA 3OPKA 2CFXA 2XNRA 3R27A 5F0UA 4DQSA 2OPQA 2PA3A 3QAUA 2CUYA 3MR6A 1ZH5A 2FLPA 3GMGA 2HWTA 1S6QA 2ZVIA 3EXYA 1HNIB 2EBGA 2XHWA 1MU2A 4JI5F 3PR4A 8AT1B 1U2RA 3CD6S 5HL7Q 2F4FA 5HBMB 3MR5A 1RTDA 3DN9A 2HBZB 1GQEA 4FKXA 1S1TB 1IBKF 4PQUB 1VBZA 1RT7B 2FY1A 3QAEA 1U1PA 2IVFB 3HHKA 3N9UC 4NI2A 2YWKA 3LOUA 2VFTA 5HVHA 5D4LA 3FQLA 4UQGA 1HYSB 1GNKA 2ZD1B 1VQPS 1NK7A 2I6WA 2YWHA 2GVZB 1HBNA 4OQJA 2H1YA 1TK0A 1KQGB 1NDCA 1DRZA 4WK1A 3IBCB 1U2FA 1KQKA 2CJQA 2EBEA 1REVB 1WSVA 2VDHA 1IR1A 3Q8QB 3TEHB 3CUNA 2AHOB 4WYWA 3MM5A 4FYXB 1TMMA 3PTWA 1RGVA 3BR9A 2J5AA 1FKOB 3MMCA 3H7HB 1WC1A 3C16B 1C4AA 2XI2A 4ZMMA 3M8QB 1NJZA 3S7RA 3EX7B 4CH0S 2OTLS 2W2NP 1YRUA 2VFUA 4ZIWA 2NYIA 4AXIA 3HT3A 4RUAA 3CGIA 1MROA 3HULA 5BXIA 1Y3KA 4MK8A 3MMBA 1N34F 4KV8B 4PCQA 5A8RA 7FD1A 5LJ3Y 1DHMA 5LSOA 2BE7D 2UXBF 2C2MB 1UPMB 4PWUA 5DLFA 5SUHA 1O51A 3QYYA 2K7KA 1AZSA 1U02A 4A47A 3M1VA 2YNGA 5KG5A 2K3IA 2Y8YA 1B0PA 4CDIA 2BANA 3DCAA 3FZBA 3LTOA 2W9AA 1CEZA 3R2DJ 4IQXA 3GFXA 1TUVA 2GIQA 1NU4A 4PZVA 4M63A 2WVBA 4B3TJ 3ILLA 5KFVA 3JQKA 3SQGB 5M2UA 4WP9A 2KFYA 3IG1B 2K1RA 3KK3A 3R1HA 3UFCX 4BBYA 3TVZA 3K89A 3NG8A 1VK3A 2HHHF 4G3IA 4GO7X 2KHCA 2XSJA 5ETQA 4QW8A 1JQGA 3IGVA 4ED0A 4DX7A 2FD2A 3G6YA 2G0JA 3IRXB 3ZNUA 3T6BA 4ECUA 1VK8A 2IMWP 5EUHA 1RISA 1YLXA 2IBKA 3DLEB 4B08A 2EFGA 1HMVA 1BMQB 3I6PA 2DTJA 4WZQA 3OL7A 4FF2A 4AXJA 4OYOA 5KFMA 1FJCA 1SL2A 4LF5F 1RWPB 3D67A 4B3RJ 1E6VA 2HFUA 2DO0A 5ETMA 2UUAJ 3MR7A 2GFFA 4X4VA 5IWAF 4LF9F 2GMJA 3MM7A 2MQNA 1OY9A 1GMWA 3BSCA 1FJ7A 2QJ3A 3QPIA 3QT5A 1JXVA 1LQ9A 4ATNA 1QUVA 1LW0A 1R8AA 3CCSS 3DLBA 4M5DB 2WTFA 3VGUA 4IRDA 3CVKA 2F4VJ 3W5ZA 4ENOA 3MOZA 3E8OA 4YMEA 3AJDA 2GNKA 5HROB 2YKOA 2YX7A 1FE4A 2G0IA 2DKOB 3NWGA 4U96A 1SV5B 2A6OA 4LJMA 3TAQA 4IO9Q 4ANCA 4DSFA 1Q8IA 3CD7A 1TR0A 3KLGB 5KFIA 5GMKa 3HHLB 4O0NA 1UWBA 3QIDA 1FX2A 1NB2A 3M05A 4O3SA 2WVFA 2XGQA 3W9IA 4R5PB 4ZVOB 5B0EA 4Q2LA 2ZEJA 5K9FA 5G4DA 4ELUA 5L38A 2JLGA 5C25B 1VQOS 2XYPB 3KK2A 3DI6A 4H4OA 2Y1RI 3DGPA 2IVYA 4IFVA 5B0CA 1IKWB 5KFDA 1J5EF 2I5JB 3NL0A 4DR3F 2AX0A 4O3PA 2LFVA 3HZGA 2LQ5A 1UJ5A 1NCLA 3I0RB 2Z56B 1KS2A 3KK1B 4AFFA 1AFIA 3ZFVA 1KBRA 4CYUA 1J2VA 1UW9A 4ILLA 1XNQJ 2C2RA 3HSGA 4QYZK 2HHSA 4NRTA 2R7WA 1KFDA 2N82B 1T3NA 2VJVA 1S77D 1X8DA 4WK3A 3GG1A 4OYAA 3U27A 5DDRC 1WI6A 3ZTOA 3W9JA 1PG5B 1KQSR 3MPUB 3SSQA 4CIOA 2WOMB 3L7OA 1C1BA 5F3TA 4DSIA 2Q6CA 5J1PA 4DPWA 1REGX 2EFPA 3OFGA 2Z2ZA 4TU7A 1RBLA 4TLQA 1SI9A 4B3OA 4RWWA 2F1FA 3Q22A 1HNWF 3NGRA 3OSNA 5HJXA 1XMQJ 1D9AA 1KP6A 2RRNA 4Q0BA 4HDHA 3PY8A 4OX8A 4LBPA 4ED1A 3CCMS 1S1XA 1H2TZ 2QLXA 2B6AB 2CZ4A 1RHQB 3QT7A 1TL3A 1C2PA 4QIVA 3Q8RB 1XMOF 4TN2A 4LRDA 2DISA 2OHDA 4B3SF 3W61A 1FRXA 2BOPA 4PYDA 2KL8A 5KFTA 4CLTA 1YG0A 2QSFA 2E1AA 4L6V3 2CKWA 2MLZA 2ZZTA 2GS8A 2MPUA 1HNIA 4GVLA 1JJCB 3AD8C 2FJDB 3T19A 4LSNA 2H5IB 3IAM9 2CVEA 2OI2A 2E5LJ 2A2DA 2XMWA 4HT5A 1Q82T 5HBMA 4TQRA 3HVAA 3Q24A 1P1TA 4OX6A 1I51B 1RAGB 1S1TA 3PG9A 4PQUA 4ED4A 1VFJA 2B4UA 1RT7A 4LF6F 2EK6A 2KH9A 3W2WB 1RP5A 1MWYA 3DLLQ 3G4SS 2I38A 4OL8A 1VDHA 3CJRA 2RB7A 1VQSA 2ZD1A 2E5HA 4IOBA 2GVZA 1FNMA 1M5SA 2CPXA 3BGRA 5KFWA 3TWZA 5IZHA 4YOEA 4EO6A 4UZCA 4QWCA 4NXNJ 4DUZJ 4WKRA 2X1GA 1VQ7S 1T3OA 1REVA 2AX1A 1C0TB 4K5RA 2XS7A 2J6UA 4J9MA 2ZZMA 4X2BA 1K1QA 3G82B 4XPCA 2HWIA 4WZMA 5F0WA 1FE0A 3OHBA 4L3NA 2H9ZA 1URRA 1IKYB 1FKOA 2E66A 1YJ7A 3QZ7A 1YWXA 4DV3F 1CQMA 1YJNS 2FHKA 2ZBIA 2AV5A 2D3ZA 3C16A 4UOFA 2MTLA 2DGXA 4HEA9 1BXNA 2Z8QA 1JJ2R 4LSLB 2VPWB 3DLJA 3BJYA 1XBWA 3UR0A 3M8YA 2G1HA 3PEJA 3HM9A 1AW0A 9ATCB 4JI3J 4ZLPA 5DGBA 1IBLF 1HKAA 2F63A 2MQPA 2KXFA 2CPYA 2HNYB 3MPWA 3A8JA 4KV8A 1CVJA 4O3OA 2BW2A 3EE3A 2DR6A 3TAMB 2N7CA 4TY8B 5L1LA 3G6XA 4DL6A 4N5SA 3IWXA 3CO0P 3P49B 1Z1ZA 2R7RA 1WHVA 1Q86T 3OR1B 4KT0C 4J37A 1E6YB 2Z2MA 3KLHB 4G1PA 4MKBA 2VICA 4GVBB 1OYDA 1M1KT 2UU9F 5F41A 2YWFA 2OKQA 1NMEB 3WX8A 3VQTA 3NGSA 2PIIA 5GADI 3O6QA 4YR0A 3RZAA 2B3TB 4ZKAA 1JXLA 5JVHQ 3SQGA 3NNAA 3IG1A 2ZOFA 3R2CJ 1T9TA 4DFPA 3ZZZA 2QLWA 4F4YA 3CMAS 4CLWA 2CQGA 4F0MA 4M95A 2MMYA 2FHJA 3JSBA 1CBKA 3CDEA 1LW2B 2R4FA 4Q45A 4ZVPB 1WD6A 1QAIA 3IRXA 2HVDA 3C14A 2HRUA 3T5JA 4AL5A 2XGPA 2AIRB 4DSLA 3DLEA 2JJ4D 5CD4H 1RHMB 3UW1A 3BEGB 4ED8A 3UD5A 2DK2A 3ICLA 3G8QA 2CQ1A 1IXKA 2CYYA 2DH9A 2ASDA 4DL0C 2KU7A 4C6AA 3RG6A 1WELA 3CT9A 5J2QB 2MGZA 2B8PA 3QSYB 1HI0P 1L3KA 1D8YA 1WNEA 1ZPVA 1HFEL 4OJ1A 2B4PA 3V6JA 4K2XA 1U0HB 2R7TA 3DXSX 1NK9A 2HS4A 4M5DA 1U4BA 5E7OB 3VQSA 4Y00A 2HQIA 1YVFA 5HROA 3W8PA 2QTWA 3BREA 3W8GA 1RA6A 1NK0A 1SV5A 3T1YJ 2GO9A 1VQ4S 1VMBA 4I2PB 2EKYA 1UVMA 1IBKJ 5E0OA 4RW8B 4MJKA 3KLGA 4WFZA 1A6LA 1YDLA 2WBRA 1Y4ZB 3HHLA 5CCLA 1S7IA 2EG1A 1XIQA 2CQ2A 4R5PA 4EUVA 5C24B 2H65B 3EYZA 3R5BA 3RBZA 2ACYA 2VPYB 4J91A 4EK2A 3R8YA 2VFVA 2ILYA 4F2SA 2FJBB 4N56A 2R2RA 5HI7A 2K8GA 1VC6A 2XNQA 1IKWA 4ZP8A 4DR6J 1DTQB 2I5JA 3WC2A 3VR1A 4EFAC 1TUWA 1HNZF 2CPDA 1AYEA 1NKEA 3VCDA 2XWXA 1B3TA 1NK8A 1AA1B 3KK1A 4WFBQ 4RW4B 2BVZA 2EK1A 4MYUA 5C5JA 2PMHA 2DD8S 2C42A 5K8MA 4FBTA 2UVVA 4F2RA 4KKOB 3F56A 3HVRA 1U47A 2FGOA 2JNJA 2W7OA 1A7GE 4RKUC 3UDLA 2I2YA 1TV6B 1WKKA 3BO4A 2WOMA 4ZLJA 4DFKA 4A8KA 2HSEB 4EGLA 3RW6A 3CDBA 4C8NA 2HK2A 1Y11A 2LP4A 4C8YA 4ZPCA 4F4AA 1VQLS 3AD7C 4KRWA 3HMJG 4I7FB 1IBMJ 3OL8A 4UOGA 4ECTA 1X9SA 3R7SB 2RDJA 3ZZPA 1CJUB 2IM3A 3HVWA 2B6AA 4CO3A 2ASYA 2P9GA 4HR2A 3MI7X 3MCSA 4I2QB 3K5PA 4G6VB 3HPOA 1CJTB 5KG0A 1RWMB 5F8LA 2VQFF 1UAWA 4JI0F 3LPEA 4WPAA 3MD1A 4F4ZA 4ZPTR 4P73A 1RJJA 3KHRA 3A8EA 4IRKA 2RE1A 3LAMA 1M5VC 2VG7B 1HHQA 4CRJA 2HBRB 4ECZA 3UDCA 2MKCA 1D9DA 1Y7PA 3W2WA 2IC3B 3TA1A 4QIEA 1FVQA 3QBCA 1ZM4A 3D2WA 2CPIA 2V5HG 2ZWOA 5J1NA 2YKMA 4LQ9A 5D4NA 3UI3A 1X4GA 4X4SA 2ZH6A 1ITPA 4CT9A 1MSWD 1GMWD 4FS2A 1SQEA 3FCWA 5FIIA 4DV7F 3VVUA 2KT5A 1C0TA 4N8OA 2MHNA 2DBBA 5GMEA 1IVZA 1VRUB 2OO4A 2Y3YA 5KT5A 1ZZNA 4M5MA 4ZP7A 5H9FK 2YWGA 4ES2A 3POTB 1PILA 3R97A 3SFUA 2V94A 3T41A 1N88A 2AJ2A 2LLZA 1Q1KA 4C8ZA 1IKYA 4ETZA 1MG7A 4LSLA 4R0EA 2N3LA 3JSYA 3P3DA 2D74B 2EI5A 1X0FA 4U7UK 1DAXA 1WHXA 1RSCA 2HNYA 2N7YA 2B8QA 3LA0A 2CADA 1I94J 3TAMA 1SL0A 4TY8A 4KO0A 4K50A 1I3OB 4MKVA 3DLHA 2CG8A 5I3QA 3AXKA 2EFOA 3VALA 2BKOA 3OR1A 3EVOA 2J6SA 1IWAA 3JTOA 1J5EJ 1E6YA 1L3UA 3D1HA 1YJ9S 3KLHA 3CB4A 2DYAA 1B0TA 1TU0B 1RT6B 1VRTA 4GVBA 1NKCA 2HBYB 2D9OA 2BMBA 2BW7A 4DN9A 4FXDA 1N33J 2DHHA 4JV2A 1V3RA 2E5GA 4N41A 3FZ2A 1VJQA 4DR2F 2ROPA 3GJSB 3UWTA 3QRPA 2MQQA 2C2OB 3I9V9 2J9DA 1VLYA 4I68A 1RT4B 4K5SA 3NGDA 1KN6A 1EQ0A 2H51B 4L73A 1LW2A 2JEFA 2UXCF 2HHTA 3RU0A 1F6TA 3DOKB 3BPDA 2MKJA 1WTBA 3J7YI 2DNOA 3CJ3A 2FZKB 4XAKA 2QL9B 4ZN1A 4UTGA 4P71A 3V6DB 5FLXY 2JH3A 1FTRA 2YWEA 2HS3A 5HN0A 2L9DA 2H5EA 3DDKA 4DF4A 5D3GB 1XQIA 1JLQB 5J2QA 4F26A 2X1BA 2I1RA 4LFCF 2GZOA 3TW0A 1Q8BA 2R2TA 1XMOJ 1NSQA 2EVZA 2L3MA 3HFZB 3ITHB 2BE2B 2NR0A 2MZ1A 5LMNJ 3OFHA 2KM8C 4H4KC 2EFQA 1U0HA 2HIQA 2GAGC 4OYPA 3SZ2A 1KSPA 4ED6A 2F9JA 2KDOA 3H40A 4DR4F 4ZVHA 1Q7LB 2YQ3A 4ED5A 4U95A 2FVRA 3MM8B 4ZPDA 2FJEB 4G65A 4RW8A 1GXUA 2PN6A 4IR1A 5KTQA 1VQYA 2JWNA 1LFPA 5C24A 1LEOA 1CLFA 4EYIB 2VZ9A 3JTPA 4F36A 2MKIA 3DRYA 3LP0B 3W65A 2F40A 4Q43A 4RNMA 3EVWA 3D6FB 1VYAA 3M30A 4HH1A 3C46A 3LWLA 2KRBA 2RU3A 3CMES 1U09A 2HFZA 1DTQA 3RYLA 4WF9Q 2QV6A 1SKUB 3UQSA 3K8WA 3HCXA 1YJRA 2IVMA 1CJVB 5HJYA 5GADU 3DRRB 2FZGB 4U9RA 3DHXA 4RW4A 3RJMB 3UVJB 3UCZP 4RUCA 2V4QA 4NYZA 1HR0J 2QL7B 1RZMA 2GX8A 4L74A 3ZXWA 1ZAVA 4KKOA 2HYIB 1D09B 1S0OA 2LQ9A 2VU5A 1SL1A 3CJ5A 4Z7CA 1HARA 2ZM6F 2Y9HA 1TV6A 1X4DA 5ITHA 4YFUA 1PJ5A 3FCVA 3M9OB 4YB1P 3TJAA 4A8XA 4LF1A 4NCGB 4L3KA 1IBLJ 5I3PA 3U02A 3TJ9A 1Q5VA 5A2QY 3LAKA 4J9KA 3THPA 2CA9A 3C15B 4ZVFA 4YB6A 3PX6A 1QAYA 4QJVA 4K4XA 1VOMA 2UUCJ 4JUZA 1X4HA 3Q2SC 5D8HB 2HHQA 4I7FA 3R5CA 2QLFB 1F9FA 3ISND 2UUBF 1U1LA 1SH0A 4OJGA 1CJUA 3EMTA 2UXDJ 4NPOA 2QLJB 3JXOA 1BE4A 2A10A 1NUEA 3CCLS 4EBCA 1FCAA 5KFNA 4H4MB 4CZCA 4ZPWR 4I2QA 3OLBA 2FHJD 2DHAA 4CLFA 2HGLA 1CJTA 3JTNA 3DU6A 2MZRA 1HBOB 4W98A 3BH7B 1Y9OA 1XK8A 3UPFA 2LXIA 2DHGA 5EDWA 3PW0A 2Q79A 4X66J 1PGZA 5GAEI 1HNVB 2W25A 2AYEA 3NEKA 3EUNA 2VG7A 3U7JA 2YNIB 2RMLA 2B4VA 4EWTA 4CH7A 5E3QA 1U1NA 3HXMA 2BJ7A 5K8NA 5F8MA 3J81j 3QIPB 1RADB 3CCJS 4QU6A 2IC3A 1AT1B 3W5YA 2VG6B 4P7VA 3W1YC 3KUGA 3AD9C 3D0GE 2VONA 4ZVSB 2DR7A 4QR1A 5CABA 4PXCA 3NGUA 4AL6A 1FWKA 3HDSA 3RRHA 1NK4A 3HFVA 1RBOB 1RTZA 3BBBA 1JKHB 2ZH3A 3FFIB 4FN5A 5B0BA 3K58A 3JAMU 1VRUA 3MPYA 1MN7A 3BF4A 4U7UD 5E33A 3POTA 3G8TA 2WBMA 1TKTB 1ZPWX 1NRKA 1ZA2B 4RX6A 3HHLD 2CZVC 4OYBA 1BWVA 1EETB 3PXGa 1EKSA 4C3MA 3PVXA 2QZ8A 5CYQB 4JI2F 3AODA 2L41A 1PAEX 4AD6A 4PR6A 2BYCA 3C6TB 2IHR1 3NGTA 3A4TA 3GYXB 5B0DA 2AEJA 3MR3A 3J80Y 5KOXA 4RU2A 3L9ZA 4B9SA 1TP7A 2DRAA 1FDAA 1FRJA 4KB7A 1WEXA 2W4PA 4ZVTB 4DV2F 2XBPA 2HAFA 1TUGB 2RS8A 1LFWA 2XCAA 3EPIA 3OW2R 4OJ3A 2ZKUA 1UVNA 4LRBA 4HHUA 2BUNA 3KFWX 2DVIA 1F2HA 5LMUF 1RT6A 3KOAA 4UF4A 1JMTA 1FFSB 1N54B 3H4BA 2G2OA 3J81U 4ZS6A 3FNNA 3ETMA 4WE1B 2DIUA 2NZ4A 4YEAA 1V5VA 3OTDA 4Y6IA 1SPBP 4DU7A 1IN0A 3A8IA 1MN9A 1H72C 4QQBA 2JVOA 4NLDA 1RT4A 1W2IA 5IT4A 4DV1J 2CJBA 4J7CA 2OUGA 5HMZA 2RKIA 1AFJA 3T5KA 5F8HA 2L9NA 2R3VA 4EO8A 4F4KA 1L3SA 1RT2B 3QGGA 2C3YA 3DOKA 5K8OA 2HNZB 4OI0A 2B56A 5HLFA 1WDDA 2YQ0A 2WB4A 3FUYA 3V6DA 1R3NA 1YHQS 5D6GA 3F0NA 3H42A 1P8GA 2UVWA 2K7JA 1APSA 5D3GA 2IA0A 4ZVGA 5A0YB 4MKYA 1JLQA 4JV1A 4U6PA 1VBYA 4OX9J 1HPZB 3MF5A 4QWAA 3OJSA 2Q43A 2E44A 1VGYA 2ZFHA 4K4ZA 2MKHA 1LKZA 4A8WA 2MKSA 2YXLA 1N5QA 4LBHA 1L3TA 1RT3B 1M1HA 1WF1A 1JIHA 4DV0F 3ILOA 3VGVA 2YX1A 5EHHA 4QYRA 5F8NA 2WVDA 2FQQB 1LK5A 1NSAA 1NJYA 9RUBA 1XNRF 2BJ9A 3MM8A 3EDRB 3KTQA 1P27B 3G96A 2FJWA 4KPCA 2PC6A 3H5YA 1CC8A 2VOPA 1S9EB 1OJ4A 1AROP 4PUOB 3R9LA 3CW2C 3W63A 1S49A 1WF0A 1WTFA 2YKQA 1AB8A 2JC1A 3LP0A 3MD3A 3EZ5A 1UCNA 3DOMB 2DITA 3AY0A 1S79A 3OXGA 4OZ0A 2ZNZA 2FLLA 3S8SA 3G8SA 2M5YA 4KC5A 2DR9A 1CJVA 3AJ1A 1TVRB 2AJ4A 4DL4A 1NK5A 1WG1A 1S7HA 1OO0B 2PMWA 4UZBA 2DGOA 2CPZA 2AD9A 2JEGA 2ZJRQ 1ACMB 2NUHA 1X60A 4L76A 3DRPB 1P9QC 3M2UB 3PM9A 1WDTA 4UUWA 1XWLA 3DDNA 2ZH2A 1NXIA 1VS3A 4NCGA 4J9VA 1HI1A 3SCJE 3UD4P 4W4MA 3GJRB 4EMDA 2ZITA 2MQMA 2XMTA 5E3AA 3J7YU 1RT1B 1NO8A 4N7TA 4XTTA 4C0HA 4IG3B 4C8LA 3C15A 3VAHA 5IQ6A 4YB5A 2E1CA 2W2PP 1DTTB 3V4IB 4JI4F 3B4MA 4HYKA 2HMIB 2V34A 1F0XA 1ZA1B 2JLFA 2A1BA 2ZH9A 3KHLA 4QIGA 3NBPB 4KGXB 4O0IA 4A48A 4YN3B 4X65J 2VIHA 2HGMA 2JX2A 1HNXJ 2AEMA 2MSTA 4BHQA 3JYTB 4H4MA 3L3CA 1T05B 3TQEA 1EIYB 3OT9A 3RW7A 1HBOA 1J5OB 3DRSB 1X5TA 2M3DA 4I6YA 1T9WA 2XG8A 1DFDA 2GMLA 4K4VA 4U8VA 5I3UB 3EZUA 2R8JA 4DWIA 3OL6A 3SSRA 2OPPB 2YNIA 1HWLA 1ZM2A 2KI2A 4PG5A 1Q16B 2H54B 4K8RA 2GHPA 2W8KA 1WWHA 3AXMA 4OLOA 4A8YA 3NS6A 3QIPA 3HSDA 3MAAB 2RS2A 4DV6F 4OI2A 4LR7A 4NCBA 2VG6A 3BN4A 1L5UA 2IJNA 1WUUA 3SDEB 4GKKF 3VWSA 3PJWA 3O1LA 3X3UA 2LQBA 1FNXH 2ADBA 3MGJA 5KFLA 1GK8A 5EX3A 1SJ3P 2COLA 1VISA 3D6TB 2ZUAA 1YZ7A 1P6TA 5CZXA 4RR5A 2Z58B 1JKHA 2NQPA 2CQCA 5E5NA 3FFIA 2HAIA 3M6VA 2AGQA 5KFYA 4CO2A 3TZZA 3GB0A 4DR5F 3VVTA 4NOHA 2ZHOA 2HFNA 3OFEA 3Q0AA 1GXLA 3B54A 4A8MP 2Z4PA 1TKTA 3EPGA 3T9ZA 3ELHA 3SYZA 1HI8A 3GQCA 2ZOGA 3QNWB 4DR4J 4GKJF 3PZPA 2OELA 2V8GA 3CIZA 3BDEA 3PR5B 2PT0A 4DU8A 4PXDA 2HVHA 3HKWA 3HVTB 5CYQA 3LH2S 4C9DA 2RQKA 1S6OA 4EZ6A 4DN0A 1SQGA 4I69A 1FHTA 1GTHA 2AJFE 4DX8H 3C6TA 1DQ9A 3BGOP 1JK9B 5KFHA 1RA7A 4NCAA 2EC2A 2ZH1A 1T03B 4C7QA 4F50A 2AP6A 4KSEB 4IKAA 4ECYA 1F5AA 3GCXP 4Y2CA 3TUZC 3GR1A 5C7PA 1FDDA 4BS2A 1G4CA 4P75A 4IH6A 1UZDA 4DQRA 2W4DA 1CPZA 3CNQP 4DPXA 1TMJA 1FDBA 3N4WA 4F67A 3EM1A 4Y3CA 2VA2A 4ZLNA 1EX8A 1HD0A 5CYJA 3QGIA 2VDIA 2AJ1A 2DXDA 4XO0A 1NDLA 5FDLB 3KNAA 1BGXT 3H4DA 4NA1A 3IR5B 4WE1A 1KNZA 5KG7A 2CWXA 5HO4A 4EBDA 1YK9A 2V0NA 4YHHJ 1FF2A 2A6MA 2F9DA 4Y28C 1FVSA 3JQMA 1TAQA 4YB7A 3Q8YA 1U48A 2UUWA 1NHVA 3MTKA 2VA3A 2ZC4A 1S5ZA 4QR2A 4X64F 1N0VC 3MM6B 4NEYA 2HNZA 2E1PA 1WC0A 2WSFC 2KO1A 1FEHA 1I6JA 4K4YA 1VHIA 4Y2KA 1XR5A 1RXOB 1M1GA 1V5IB 1BQNB 5U47A 1U0SA 3M2RB 3PHTA 3BSOA 3PYGA 4GC6A 2E7WA 3S1TA 4DOZA 2QL5B 4IG0B 5A0YA 1HW9A 3IR6B 2RQCA 3PYEA 1HPZA 4DCPB 2CPJA 5CH7B 4DBQA 1QAXA 5KG4A 3O44A 3SCKE 3BSAA 3ZZTA 1FRIA 1RT3A 3H2LA 2XO6A 2AZ1A 1F2GA 4PXEA 1JLBB 2HHUA 3B8HA 2HLUA 2IMOA 4MTPA 2MLYA 4HACB 3K5MA 4AUKA 4TU8A 5A76A 1D1UA 3GV8B 5EWEA 1BQMB 4USHA 1S9EA 1S1UB 4PUOA 4WWSA 1T8EA 2DY9A 3K5OA 4UT4A 1PC5A 2GIFA 3TO8A 4X4QA 1N32F 5T7LB 4IQMA 4O23A 3ENVA 3QJJA 2VPXB 5L9XA 4ED2A 2CQ0A 3DOMA 1WC5A 4YY3F 3OBIA 2XY7A 5KFCA 5F8IA 3M6UA 3RR8A 1YIJS 1SKSA 2MLXA 5DDQC 1G7CB 4HLBA 3FVYA 4RLEA 2F8HA 3PO4A 4DHVA 2Y8WA 4KHPJ 3CCVS 4Q8EA 4FYYB 1TVRA 3RUBL 2ZOMA 1PIEA 4A8SA 2FVPA 2BJEA 4R8UB 3AB2B 2DNGA 1UJ6A 4DR1F 4PEOA 1M5OC 3I9ZA 3KLFB 3PFEA 4V19X 3DRPA 4P2SA 3M2UA 3NCQA 4JI2J 2BJ1A 2K3KA 1OIAA 1U6FA 2LQJA 5IS2A 2D69A 2GAHC 2WHOA 5EWGA 1JWWA 1NPRA 2M8HA 5D0EA 3U1LA 4P72A 3J7A1 4LF8J 2AYMA 1VQ6S 1RYSA 3AH6A 4JI1F 4QBUA 3VAGA 1RT1A 1FKPB 4GRSA 2MZSA 1ICEB 5B7WA 4JI7F 4FYVB 1SKWA 4IG3A 3RB4A 4DR7F 3A3PB 4M5GA 1DTTA 3V4IA 3MCMA 3OUYB 3FCHA 2CDQA 2HMIA 3HSZA 3WX4A 4C3LA 3TJ8A 4OZ1A 2V2KA 2PDAA 5LMUJ 3NBPA 2M8DB 3TX0A 1VC0A 2L9WA 5GVQA 4NZ0A 3JYTA 4NLVA 3OTEA 1T05A 3TVYA 1OSDA 3IAS9 2QA4G 4X4OA 5AXMA 1JLFB 4HH0A 3DRSA 2I0XA 3KKFA 2C2KB 3MECB 2RD5C 4AL7A 1RU2A 2OP5A 1PBAA 2KVIA 3NGKA 3BYRA 1IM4A 5I3UA 2DPJA 1JLCA 2PGCA 3TNVA 1YKWA 2XMMA 5JXSA 2NREA 4F4WA 2OPPA 4CLSA 3RBXA 2KT3A 4CO1A 1S6PB 4X4NA 2C2EA 3S01A 1RU1A 1O0PA 3MAAA 4JI6F 1TFWA 5F8JA 4URGA 5HVFA 4F02A 2LKZA 1EP4B 2DNLA 3SDEA 3DGVA 3BO2A 2J0WA 3GIMA 1PYOB 3BKUA 4AQYF 4OX7A 4O44B 4LFBF 4LFAF 1FWLA 2YKPA 1QUPA 3W2VB 4DV5F 3AA8A 4NA3A 5SZTA 2R7VA 1HHSA 3RBEA 2EEYA 1HBMB 1YGYA 4HDGA 3HHEA 2RHQB 3OTOF 4EBEA 2CNNB 3VF0B 2HFOA 1FJEB 2QX0A 3PCOB 3PRDA 4IOCQ 3GILA 4TLRA 1NZ8A 3GSIA 5K5MA 4BC9A 4HHJA 4ANDA 1X4AA 1PYTA 1UP1A 3DLGB 3PFOA 4WP8A 3VHQA 4K59A 3M8ZA 3HVTA 4B02A 3GWCA 2IIHA 2C2ZB 2ZH7A 1C1CB 2RH3A 2C2NA 1SJ1A 2HVIA 2APOA 1RWWB 1T9UA 4HI1A 3DU5A 2B4OA 3KDNA 1KEKA 4ELVA 4UY8T 1Q95G 2ABYA 3OL9A 3C6UA 3G71S 3FBCA 3D66A 3HF5A 4IDKB 4FP9A 4DL2A 3CCTA 3J7ZT 4URQU 3QATA 4FYWB 2Q1LA 2XEXA 4NZ7A 2W4CA 4ZJOA 1OWXA 3WHIA 5F9LA 1R31A 1FJGF 2ATLA 5CCMA 2R8GA 5FDLA 3AB4B 1FERA 4WXWA 2LCWA 2VUGA 4ECWA 4K0KF 4N77A 2DY1A 3PRVA 5HQ8A 1X31C 1PC4A 4PG4A 3IWLA 3T1HF 1JNZB 1NSKL 4LIWA 2KZMA 2VFRA 3IR7B 5E41A 1SKRA 4NWBA 1JJHA 2AT1B 1GXTA 4ITSA 5ETKA 3MM6A 4P10A 1VQ8S 4JI8J 4BWMA 4JI4J 1RCOB 2F7VA 4Q2MA 3NMRA 4B9UA 3TX8A 2U1AA 5CYMB 2Y0BB 4AT1B 3M2RA 4LT6A 2HLTA 4C11B 1VI7A 1B7YB 3AOBA 2WSCC 4OHZA 2A18A 4OYMA 4IG0A 2N4CA 4FXWA 1JLGB 2ILZA 3Q83A 4DL3A 3P8BB 2GMHA 4CT8A 3CWJA 5EGYA 4IO1A 3I82A 4RU9A 5F3ZA 3I5AA 1Q78A 4OI3A 3LGHA 3JB9k 5L1JA 3ILJA 4ZPVR 4Y2MA 2J0QD 2RRAA 1JLBA 3BBCA 2D9PA 3PJ9A 3AJ2A 5J2NB 4LR8A 4J9QA 2GIRA 4IFYB 1RWOB 1BC6A 3M9NB 1UTAA 1UZHA 4KR0B 5AJ3J 1WG5A 1Z2ZA 2OFGX 1U1KA 4DSJA 3MURP 1KTQA 4X62J 1FA0A 3R5GA 3PW2A 2ADCA 1F3VA 3ETOA 1S1UA 4F04B 3I4HX 2XWYA 1Z4UA 4ZHRB 2XHCA 4LIRA 4GKKJ 2QGFB 2PMZD 5T7LA 3PEHA 5M2RA 1B4SA 1N0UA 4E98A 1UVIA 5IM0B 3TQ1A 4RO0A 1KHWA 1ROFA 2JRSA 2OTJS 1RTIB 1WHWA 3MPDA 4E8UA 1KLMB 1R8BA 4ZOSA 3BQ2A 1YRXA 4AYBD 4ZCKA 1NEEA 3RB6A 4R8UA 1WJ9A 1GMUA 2XY6A 4YS2A 2R2UA 4M8LA 3IRWP 3KLFA 2BJ3A 1LXJA 4ZIVA 2M88A 1M5PC 2G2ZA 2GVDB 3BYPA 5ETOA 2GJ2A 2RU9A 5KFJA 1EB0A 3T6JA 1NK6A 4B3TF 4A8OA 5BR8J 3KWMA 3OV7A 3MEEB 4LF4J 2PEBA 3MDFA 1FKPA 1RQ0A 3BQ0A 3KNGA 3V6KA 4I0WA 3MWBA 2YNFB 2Z57B 3EDQB 3LO3A 2LEBA 3C3LA 2DNZA 2KYZA 4HKQA 3H98A 1WACA 1HQUB 4JYAJ 2C3PA 3P5BP 2E5IA 1GEHA 1S97A 3MM9B 2LDYA 3VZIA 2WONB 2GC8A 4USIA 1N5YB 3C8YA 3TUIC 2HKEA 1BHNA 4LF7F 2DRBA 4LBIA 5LT5A 1JLFA 1F3FA 1QTNB 4B3RF 3NAHA 3UNGC 3MECA 2LDIA 3G6VA 3W3SA 2UUAF 4DMZA 5ETSA 3LGMA 5DETA 1C4CA 1N5VA 4I6WA 5KFUA 2YNHB 2QA1A 2BBEA 1ZTWA 4J5OA 1N52B 1CQNA 1RDRA 1EJ7L 4J90A 3CJ8A 1S6PA 4ID5B 2OSQA 2JLEA 5CA5A 4W92B 5H9EJ 3NKYA 1VBXA 4CNYA 2F4VF 1B0VA 4RW6B 3TA2A 3EICA 2RDIA 1EP4A 3DM2B 2IDEA 3B4DA 2ATCB 1X9WA 2CQHA 3PRBA 3R3TA 2CJAA 5DO2A 2HHXA 2DO4A 2DHXA 1UFKA 3N79A 4O44A 4G1IA 1U49A 1PJ6A 1T9YA 4KHRA 4X4RA 2CJKA 1K0VA 5AXLA 2W01A 3W2VA 1XTZA 4DUTA 2MYFA 4MAKA 2WAQD 1HYSA 3IBWA 1O8BA 2HFVA 5KFFA 4J9OA 1RAFB 1GAOA 2KZZA 1HBMA 2YWWA 3TA0A 1QSSA 3CULA 5J2MB 2HQGA 1X9MA 5KFKA 1GFWB 1FRLA 2IFXA 5D78A 2OEMA 2G2YA 4RBVA 2AGOA 4OMFG 3KLVA 2DNPA 5KT6A 3DLGA 4OIXA 4DXLA 5KFPA 2JHEA 3OFFA 4I6AA 2OEKA 2UVRA 3PV8A 1C1CA 3CEDA 1XNQF 3QLHB 3SV3A 4N8NA 3D68A 3VAFA 1BLUA 1N32J 2MZTA 3KJNB 5DM7Q 3M8QA 4QWDA 3SCIE 4EI2A 1ZAWA 2DGVA 5DQGA 1MMDA 4QPTA 3IC1A 4F3OA 2IM2A 3ADAC 3BPSP 4USMA 4ECXA 1KR4A 4NLTA 2NS1B 3E01B 1MLAA 3BB5A 4IDKA 3IWNC 1T95A 2EWHA 1DY3A 3UO0A 3I87A 2GA7A 5A6WA 3QWUA 2XCPA 4OHYA 1SIWB 2Y1IA 1DBDA 1M0SA 1QY7A 3WBZA 2KYXA 1XMQF 1VQNS 1XJWB 4PG8A 4QPXA 5CAAA 3AA9A 1XN9A 2MDAA 2F8MA 2BABA 3MZIA 3P45B 3CD5A 4DPTA 1WF2A 3BZQA 4CM2A 1IJEB 1T7PA 4PKDB 3GR0A 4NE9C 2VODA 4I56A 4QWBA 2MZQA 1G2EA 2B43A 1DQAA 2IY5B 1WOSA 4P74A 5DG8A 2IJFA 3FRYA 1S57A 2VBYA 2R8IA 1PSDA 2LU1A 3I5BA 4DQQA 4JI7J 3AOCA 5I42B 2KFZA 4MFBB 1RWUA 2XSJB 2EFNA 4NRUA 4YDDB 5CYMA 4OI4A 2E5LF 3G2XA 3OXLA 1Y5NB 4C11A 1H73A 3BV8A 1X7VA 1JLGA 3OR2B 2OLWA 3GPAA 4ES3A 2C2DA 2VL1A 5C2GA 3IS9B 3A3NB 3IXQA 3AAWB 2YVSA 2MJUA 4NLGA 2PSZA 6FD1A 2ROEA 4NLQA 3DFEA 4MIWA 4HL9A 4NXNF 2DIVA 4DUZF 3FK4A 2E5JA 5J2NA 2M0GB 4RW7B 5DG7A 5DDPC 3HKZD 2RIJA 4IFYA 3M9MB 3NNCA 2HVZA 4ELTA 3SBMA 1WOOA 3W64A 3HP6A 4R0JA 1RAOA 3MR2A 1UL3A 2OJ3A 2V50A 2MHEA 4OZ2A 5E3RA 2ZE2B 4P2FA 1H38A 1LWEB 5KFEA 1RT5B 4LUBA 3I56S 2FJXA 4ZHRA 2B9WA 1TFYA 1I5OB 4JI5J 4KFBB 4MIBA 2BEFA 4DV4F 1F9HA 1CSJA 1FRKA 4IUFA 3L7PA 2W1BA 2FHMA 4RUBA 5IM0A 2J8AA 5J2PB 3R7NB 4LFBJ 4NXMF 3OVSA 3BGFA 1D3WA 1RTIA 1N8RT 3H2UB 1JNRB 1ZOTA 4USKA 1KLMA 2QLBB 3VAMA 3SMZA 2MJNA 1KFSA 3OTOJ 5C25A 2KHDA 5JJBA 2A3JA 3M6XA 5IFMA 1DQ8A 3CCES 3CJKB 1S12A 2QE5A 1S0MA 2XY5A 4ANEA 3CO9A 1NH7A 1O5JA 4ICLB 3D3BJ 3I0RA 1GT8A 2GVDA 3ZO7A 3Q86A 1RKIA 4F3MA 1JLAB 1IKVB 1HL6A 5DQIA 4Z7YA 1U45A 1UVJA 3FSXA 2O1PA 1TELA 1SJRA 1VC5A 1T9VA 1NHUA 4KGZB 2P8IA 3MEEA 4TKTA 4ZLLA 1GH8A 4FZVA 2XULA 3OSPA 2YNFA 1EAYC 1BQXA 2HK3A 4LVOP 1DZ5A 1HQUA 2F8EX 1H0HB 1N34J 5KAKA 3KUEA 5DDOC 5AE3A 2W8LA 1S10A 4KAIA 1HQ2A 3MM9A 4ZCLA 4AE5A 2VF3A 1FEEA 4PWWA 2UXBJ 3GV7B 2QA2A 1N5YA 2V8PA 5L8RC 2HIYA 1MWQA 4LRCA 5KT2A 1YRTA 1O6XA 1WEYA 2CQ3A 5RUBA 3T1HJ 2DHSA 5ETNA 4B9TA 5L1KA 2LMIA 2IDLA 2JC0A 3K2YA 2BQ3A 2CPHA 3UN2A 3RBDA 3TI0A 2YNHA 1VQMS 5HQLA 3W66A 1FXLA 4WYLA 1U2CA 5DGAA 1G1XA 4N47A 4ID5A 1UVLA 3B82A 4PABA 1MWZA 2BDPA 1NZAA 1IR0A 4LSNB 4RW6A 2HHHJ 2PO4A 3NRBA 2XTJP 5DZ7A 3DM2A 1RCXB 1Q4RA 3TR5A 4CLKA 3T1YF 4WXOA 4N76A 4DLGA 3HK2A 4O3QA 1EARA 2V9KA 3TP2A 2C28A 3LPYA 2OPSB 2FZCB 4KBIA 1Y00A 2HFSA 4QYZJ 3BGRB 4LF5J 2MZJA 2UV8A 2D3UA 2KB2A 2J7UA 4CQ1A 5J2MA 1B70B 2N3OA 4NMLA 2U2FA 4BDPA 4ECQA 2AKWB 5HQMA 4DR6F 5IWAJ 1SH3A 4J9RA 4ERDA 4LF9J 4EEYA 8ATCB 2DH8A 5DRKA 1F60B 2WSEC 1WORA 3BKFA 3G82A 1U8SA 4DPUA 2W9CB 2MXYA 2V8VA 2CPEA 3M32B 1SH2A 3QLHA 5DS7A 4I67A 4WIQA 2YY3A 2PEHA 1V6HA 2YKNB 3C2PA 1P9YA 5DQHA 3CCZA 3GFZA 4WKYA 2DH7A 1T0TV 3CCQS 3ZZ0A 2YKAA 4TU9A 2A2CA 1BY9A 2ZZNA 4OZ5A 2NXUA 3E01A 3OHAA 4RL1A 2PI4A 3CC2S 3PW5A 3M8SA 1W2BR 2MSSA 3H25A 1Q81T 4C0OC 1QSYA 3TZYA 4WCEQ 2GQ2A 3GIJA 2ASJA 1IBMF 1M5HA 1RTJB 5A8WB 4DR3J 1H2UX 1IJFB 3QJPA 2AMCB 3I96A 2LQ8A 3P4UB 5CHCB 5LSLA 2P9CA 4ZCIA 1UMJA 3UDEA 1S6UA 3LANA 2CDRB 4XK8C 4RNOA 3Q8VA 4DZDA 3G6ES 2XZWA 1XR7A 4DCJB 2HHWA 4XIUA 1UA0A 3KHHA 1WC3A 4Q5VA 1WKLA 3P5TL 5I42A 4ZP6A 3ISNC 4MFBA 3GU0A 4ES1A 2OMLA 4NLUA 1HBUB 5I4MA 3KLIB 2DNHA 4KY3A 3GSDA 3UD3P 2L08A 3LW5C 1WHYA 4URSA 3CJTA 2ZWPA 3SIPB 2RHSB 3C14B 2ZH5A 5ETTA 4FBUA 4RUHA 4KE5A 3OR2A 2KT2A 2AGPA 2XMUA 3IMQJ 1HNWJ 1RI7A 5IV4A 2PA8D 3IS9A 4LF7J 1N5SA 5B08A 3I0SB 2LEPA 5EN1A 2MGZB 2ASLA 1VQ5S 3U1NA 1IBCB 4DPYA 4CWBA 3MEDB 2KM8B 1WSRA 2QMWA 4ZP9A 1UEKA 1TL4A 2BZ2A 4RW7A 5D0GA 4B3SJ 3DYAB 1RLCL 4C8KA 3F73A 1LWCB 5D4PA 3PW7A 1TKZB 2ZE2A 2RDDA 3SFGA 3IO1A 1LWEA 2E7VA 4KIAA 4NZ6A 3ENWA 1Q8KA 3IFEA 4WU3A 1RT5A 2RF2B 2QEXS 3K17A 2C3UA 3KHGA 2FJVA 2KJVA 3BBFA 1V3ZA 2BKNA 4KFBA 3NCRA 1WG4A 3R1LA 4I2PA 4E2FB 4PPZA 4I64A 4ECVA 5J2PA 1RACB 1HIYA 4OLPA 4C2MA 6AT1B 2C1EB 4LF6J 2EXUA 4L75A 2R42A 3HZEA 1HWIA 5IXUA 4Y65A 2XYGB 2HRTA 1I94F 3HHLC 5IV3A 1X4BA 4OI1A 1FK9B 2E1MC 2CG4A 1FDNA 2AU0A 3T9NA 3A8KA 3CJKA 2DEJA 3PIOQ 2WW8A 3R7BB 1KOHA 1S4FA 1SC3B 4ICLA 4ZJQA 5HMWA 2V4JB 2OPRB 1UA1A 3AFGA 1JLAA 1IKVA 4M5LA 1N33F 1ZBTA 2H4YB 2VBZA 4DV3J 4V19J 2HURA 4KH0B 2BQRA 4FVCA 1QJHA 3KUHA 3OTCA 4ID8A 3QQCD 4D3HA 1FO1A 3I31A 1W25A 3CPWR 4NLWA 1X4FA 3BQ1A 3TAPA 1S9GB 1RYRA 2O67A 5CZVA 1UEUA 2FVCA 4FVMA 4UY85 4Y2IA 4M5IA 2V69A 2OEJA 2FPHX 3G86A 4MYTA 2RUSA 2HHVA 2HVEA 3J7Z5 2G9OA 3MPVA 2BV3A 1RHUB 2YBVA 2XMAA 1ZTTA 3D1QA 3H8YA 5L46A 2BJ8A 3IBFB 2W9BB 2BJDA 1G3OA 2R2SA 1NBEB 2GV1A 2UU9J 3BN7A 1CULB 2KXHA 3D5MA 3OLAA 3W7BA 3K0JA 4K4WA 4RW9B 1NH8A 3HHNB 3QMQA 5KG2A 3W62A 5LMNF 3C66A 2VFSA 2Z30B 2HS0A 3TEGA 2B51A 4HI2A 2HHPA 3A1YG 2J76E 4BC7A 1ZAXA 4JV5F 2J0SD 1YITS 1KQFB 3CE8A 2V4RA 2BX6A 1W7WA 3GE9A 3CJ0A 1SUQB 3ENQA 4YUDA 2ERRA 2Y1LB 2VKZG 1MMNA 4DLEA 4P2XA 2KN4A 3KG0A 1NKBA 3B6BA 4ZDNA 5BYQA 2ZBRA 4UW2A 5GAGI 4DEZA 2OPSA 2YKMB 4PG6A 4DUYF 1KDNA 5IC6B 5HMXA 3Q8PB 4QIWD 2DPIA 5JVGQ 3JAMY 2LEAA 4Q8FA 2QIFA 2P2CB 5LL6d 2HEKA 1GX5A 1RAHB 4QIFA 4KGMA 3H90A 1ELOA 1WC4A 1H6KX 4RJVA 5D0RA 3CXCR 1OYEA 3GG0A 1PO6A 1N5TA 4I4BA 4TYAA 4CLYA 4FPRA 4ER8A 3CCWA 2W9CA 1NHKL 2C22A 2BQUA 4PQAA 2HZVA 4HVZA 5AT1B 2DNKA 3M32A 1HR0F 3ISZA 5KFSA 4A46A 4DX5A 3ENAA 4DV4J 2YKNA 4ECRA 4NA2A 2FVSA 1IKXB 3MFIA 3CMQA 4FS1A 2DCUB 3JQJA 2EFVA 4JP8A 4CO4A 3THVA 4NXMJ 1C0UB 2ZHAA 4K4UA 5E2QA 1Q0NA 1PCAA 4JV0A 2ZDOA 3UE2A 4LSZB 3FEXB 1LOUA 1S48A 1Q7YT 1YJUA 5L9NA 3E2EA 1ZS6A 2VBWA 3CCRS 5HAOA 2DNQA 4KO0B 3SXLA 1RHJB 5DZ6A 1SQFA 2N4DA 3MUVP 2UUCF 1YBAA 3QFWA 4QZVB 2XMKA 3TYTA 1RTJA 4ZPAA 5A8WA 3QRRA 1R89A 4B17A 4D3GA 4PRFA 1VRTB 4DG1B 2UXDF 1HNZJ 2KRRA 3J81Y 1YJTA 2XQCA 3AQOA 3QO9B 1U1OA 1VQ9S 2OAUA 3CDWA 5HSPA 1URNA 4NLRA 1FNOA 2W2OP 3LP2B 4B9LA 3HLUA 3KXDA 3CJQA 5EWFA 1ZYQA 2BR0A 4ILMA 3FEYB 1PAUB 1K8AT 4NLSA 3F44A 3LP1B 3R5AA 3QWPA 4X66F 1HBUA 1S59A 2W24A 2HWHA 3KLIA 4Y34A 1WI8A 3E3XA 4OHWA 4ZPBA 4TY9A 5LM7E 3GIIA 3GJQB 3GJTB 3PDNA 5H9FJ 3L09A 4FNIA 2ZDPA 1UFWA 2BA9A 2IAJB 4RBTA 3H20A 1KWMA 3NY0A 5KT7A 5KFAA 2RVJA 1T02A 3FEZA 2PE8A 3NCPA 4S0MA 3I0SA 3VAKA 3BDPA 3JSRA 3MEDA 4H4KA 3QGPA 3GLJA 3HHDA 2J9CA 1N4LA 4LRAA 1RAJA 2DGWA 2B7CB 2OFHX 5AE2A 3DYAA 3D0IE 3NOGA 4LREA 3Q8UA 1FXDA 5KFZA 3TUJC 2VQFJ 3ITHA 4USTA 2BE2A 2QC3A 4WFNQ 1LWCA 3T3FA 4JI0J 1TKZA 2E9RX 2O3DA 2XYHB 3IM9A 2EG2A 1KC8T 4CP5A 4DQIA 1AXQA 2RF2A 2DCLA 5IOLA 3ZZOA 4TYBA 1H98A 1R6VA 3H59A 2R9LA 3D4JA 3NMAA 1HQEB 2DGQA 4MH8A 4NX9A 2QO3A 2JSXA 3DKDA 1F9EB 2ZH8A 1M90T 2G4BA 3MEGB 4USUA 3FRZA 4B3MF 3X1LB 1DARA 1QVFR 3HX9A 2GJIA 5LXRA 4MKAA 3QJLA 2MEWA 4IOAQ 4P6QA 4M5JA 2V67A 3TZWA 3M30B 1FK9A 4DV7J 2F65A 4MMOA 2DNRA 1LK7A 2HBQB 4RNFA 1UFLA 3A3OB 4B9NA 5MLCV 1HLWA 2AEFA 1Y0HA 2H3EB 1SVDA 2V4JA 1YTYA 3DRRA 2OPRA 1R8CA 1SBRA 3V6HA 4WTOB 3TRGA 3PIPQ 1TL5A 2B0GA 3UVJA 3FBFA 3J7AN 3K8VA 3JSMB 1A9NB 2RT3A 4LMZA 1VHFA 3QZ8A 1K73T 1DURA 3A13A 4WBFA 1HWJA 2DB1A 4OJHA 2UZAA 1S9GA 4DV1F 1TK8A 4XDCA 4IH7A 4OZ3A 4M94A 3E51A 2D3O1 1RLDA 1K44A 3SCLE 2R8KA 2ZC3A 3THTA 1VR6A 1RHKB 4FYDA 3OJUA 4EYHB 5E3CA 5B09A 1KONA 3D7SB 2HQ3A 2WB1D 5HMYA 2CJYB 3TOQA 4KPYA 3M8WA 2W9BA 1FXRA 2DR8A 3WDOA 1CULA 4OX9F 4KGKA 2FIUA 5C42B 4M5KA 1NB7A 3CC7S 4RW9A 3D9BA 2DR5A 1WKJA 1QTMA 3D6MB 4YP3A 4ZVUB 4KHMA 4DR2J 2W2QP 1Z2LA 4NYPA 3MOJB 1WOPA 1Y5LB 1OS5A 1NM2A 2YX4A 2JFDA 1HNVA 3K57A 1U26A 4L72B 2G0CA 3R6GB 1K47A 2UXCJ 1SUQA 3ZTPA 2HZCA 3BM7A 1S76D 2MY8A 3TARA 1DJ0A 2CNKB 3CD0A 2K06A 4CLLA 1LV5A 1KTVA 1EHWA 4F0KA 3GTYX 5CQGA 3O3LA 5IT9Y 3FBEA 3HJFA 2XS2A 2WW4A 5GMDA 4P52A 3CF5Q 3V5RA 5IT9U 2J9DE 5FJ4A 2J9EA 2P6SA 1U6BA 2IA6A 1I1GA 3MMAB 4M5HA 4LRFA 4MK7A 5HVGA 3O2IA 2CIMA 3UCUP 8RUCA 1MMLA 4K7QA 5G0RB 4ZCMA 2GHWA 4LFCJ 2V8DA 2VD3A 3NOCA 3TANA 1HWUA 3ET6B 4HHHA 2CZ9A 2CJ9A 1N56A 2B5JB 5F8GA 3GV5B 4CO5A 4UQTA 3MHYA
chains in the Genus database with same CATH topology
4ED3A 3N6LA 4RBVA 3Q8QB 1L3VA 2AGOA 3CUNA 3G9CA 4RX6A 4OMFG 2AJQA 4WYWA 3KLVA 3MM5A 5KG3A 2DNPA 2PD1A 3DLGA 4OIXA 5KT6A 5KFPA 2JHEA 3HHLD 2CZVC 3OFFA 2LA6A 4I6AA 2FC9A 2POKA 1S0VA 2UVRA 1EETB 1RGVA 2RUGA 3PXGa 3PV8A 1EETA 1IKXA 1C1CA 1HA1A 3BR9A 4FXVA 4C3MA 2J5AA 3CEDA 3PVXA 1XNQF 2QZ8A 1FKOB 3QLHB 5CYQB 5DJBA 3SV3A 1U25A 3MMCA 4JI2F 4N8NA 3VAFA 1BLUA 1C4AA 1C0UA 2XI2A 2ZUGA 4ZMMA 2L41A 2MZTA 4PR6A 5KOWA 2BYCA 3M8QB 5DM7Q 2QFJA 3M8QA 2F3JA 3C6TB 2IHR1 3GYXB 5B0DA 4QWDA 1NJZA 4C3KA 4PWDB 3SCIE 3V2UC 1ZM3A 3S7RA 1ZAWA 3MR3A 4CH0S 3EX7B 2DGVA 2OTLS 5DQGA 1YRUA 3J80Y 5KOXA 1MMDA 2VFUA 2FTRA 4QPTA 4RU2A 2QA4S 3IC1A 2NYIA 4AXIA 4F3OA 1KRPA 1FRMA 4B9SA 2IM2A 3HT3A 1TP7A 2DRAA 4ECXA 4RUAA 1FDAA 1FRJA 1KR4A 2NS1B 3CGIA 3E01B 4KB7A 4NLTA 1WEXA 1MROA 3BB5A 2W4PA 4FF1A 1Y3KA 4MK8A 4IDKA 3IWNC 3MMBA 4DV2F 1N34F 1T95A 2XBPA 2EWHA 3H2VE 4KV8B 2RS8A 3I32A 4PCQA 1LFWA 2XCAA 3EPIA 3OW2R 4OJ3A 4OV1A 2ZKUA 3C46A 1UVNA 3I87A 2GA7A 5A6WA 5A8RA 7FD1A 5LJ3Y 2BUNA 1DHMA 2LA4A 3KFWX 3QWUA 2XCPA 4OHYA 4F8RA 1SIWB 2DVIA 2Y1IA 1DBDA 5LSOA 2UXBF 5LMUF 4PWUA 4DG1A 1M0SA 1QY7A 1RT6A 4KQZA 5DLFA 4OZLA 3WBZA 3KOAA 2KYXA 4X65F 1XMQF 1ZZFA 5SUHA 1VQNS 1O51A 1D9FA 4PG8A 4QPXA 3FQKA 1JMTA 3QYYA 1R7IA 3AA9A 1HNXF 1N54B 1XN9A 3QO9A 1HWKA 3H4BA 2K7KA 3BGUA 2DT9A 2LYVA 3PKMA 2MDAA 2F8MA 2BABA 3MZIA 1D8ZA 3CD5A 1WF2A 3BZQA 5DLGA 1IJEB 1T7PA 4PKDB 4A47A 4ZS6A 3M1VA 2YNGA 5KG5A 2K3IA 3GR0A 3FNNA 2JZ5A 1B0PA 2VODA 4WE1B 2DGUA 4I56A 4QWBA 2JFKA 1WEZA 2BANA 3DCAA 3FZBA 2DIUA 4PG7A 3NP5A 2MZQA 3LP2A 2W9AA 1CEZA 1G2EA 2NZ4A 4YEAA 3GIKA 4IQXA 3GFXA 2B43A 4H54A 4IYQA 5GAEU 4CO0A 1TUVA 4DS5A 4B9MA 2GIQA 3OTDA 4Y6IA 1DQAA 1K0TA 4RNNA 1NU4A 3RB3A 1IN0A 3LP1A 5J1EB 4M63A 2L48A 5KFVA 4QQBA 2JVOA 5DG8A 1QAJA 1U6ZA 2IJFA 3FRYA 2CQPA 4NLDA 3SQGB 2VBYA 1RT4A 4FNHA 5M2UA 1W2IA 1PSDA 2LU1A 2ZKTA 3I5BA 5IT4A 2KFYA 1X5OA 3IG1B 2K1RA 1OQ3A 3KK3A 4DQQA 2CJBA 2CQ4A 3R1HA 2RKIB 4GO5X 5I42B 2KFZA 4MFBB 3UFCX 4BBYA 5HMZA 2RKIA 2ZJQQ 1AFJA 3T5KA 5F8HA 2L9NA 3TVZA 4EO8A 4F4KA 1L3SA 3NG8A 1RT2B 3QGGA 2C3YA 1RWUA 1UVKA 2EFNA 1VK3A 2XSJB 3DOKA 2HHHF 1RT2A 4NRUA 4A4JA 4GO7X 2KHCA 2XSJA 4YDDB 4U67Q 4G3IA 4QW8A 5CYMA 4OI4A 2E5LF 5K8OA 2HNZB 3IGVA 2B56A 4OI0A 3OXLA 4ED0A 5L39A 2RSQA 5GAGU 1Y5NB 3M2VB 4NYOA 5HLFB 2IAJA 5HLFA 2FD2A 3G6YA 4C11A 3IRXB 3K5LA 4U7CA 3US5A 1X7VA 3T6BA 4ECUA 1VK8A 2WB4A 2IMWP 5EUHA 3V6DA 1RISA 1R3NA 1YHQS 2NSBA 5D6GA 2IBKA 4G1QB 3DLEB 1JLGA 3D1OA 1P8GA 3OR2B 4B08A 2UVWA 2EFGA 2OLWA 1HMVA 2K7JA 4PPDA 3I6PA 4J9LA 4ES3A 2M52A 1FT8A 2VQEF 2C2DA 2DTJA 5D3GA 4HT7A 2IA0A 2VL1A 1APSA 4ZVGA 4WZQA 3IS9B 5A0YB 4MKYA 3OL7A 1JLQA 3IXQA 4JV1A 2E29A 4U6PA 4FF2A 2RNEA 1VBYA 1CC7A 4AXJA 3AAWB 1HPZB 2YVSA 2MJUA 3MF5A 4QWAA 3OJSA 5KFMA 4NLGA 2Q43A 1FJCA 1SL2A 4LF5F 2PSZA 6FD1A 2E44A 1VGYA 1SJQA 2ROEA 2ZFHA 2MKHA 3VTIA 1LKZA 1E6VA 3DFEA 1OPZA 4MIWA 4NLQA 4K4ZA 4HL9A 4A8WA 4NXNF 2MKSA 2DO0A 4K4SA 2DIVA 3T5HA 4DUZF 2ROGA 2R8IA 1N5QA 2P9EA 1QE1B 2E5JA 5J2NA 2AYBA 2M0GB 4RW7B 5DG7A 5D77A 1L3TA 1RT3B 5DDPC 2WCXA 3HKZD 2GFFA 2RIJA 4IFYA 1WF1A 3M9MB 3KG4A 2HVZA 4ELTA 5IWAF 3NNCA 4X4VA 1JIHA 4DV0F 2YH0A 3GFHA 3HP6A 4LF9F 4R0JA 2GMJA 3HI9A 3MR2A 3MM7A 2YX1A 2MQNA 5EHHA 2R7OA 1UL3A 4QYRA 3BSCA 1FJ7A 2OJ3A 2VOOA 1KOOA 5F8NA 3QPIA 1F5BA 2MHEA 1N36F 1LQ9A 3MTJA 5E3RA 1QUVA 1LK5A 2ZE2B 4ATNA 1LW0A 1R8AA 4RWXA 4J9NA 3CCSS 2P6TA 1JJ4A 4M5DB 1H38A 1LWEB 2WTFA 3DLBA 4MIAA 4IRDA 3CVKA 4NLYA 5KFEA 1NJYA 1RT5B 1XNRF 3MOZA 3E8OA 5L1IA 2NLWA 4YMEA 4LUBA 3MM8A 2UV8G 2GNKA 5HROB 2YKOA 3I56S 4K4TA 1HQEA 2YX7A 4BCAA 2R8HA 2FJXA 4ZHRA 1FE4A 5D4OA 2B9WA 4J9SA 3KJVB 1TFYA 3LQVA 3KTQA 1P27B 4KFBB 4MIBA 3G96A 2FJWA 3NWGA 4DV4F 1SV5B 2W7PA 4LJMA 3TAQA 2PC6A 1CSJA 3H5YA 1CC8A 3NAIA 1FRKA 2VOPA 1KHVA 5T14A 1S9EB 2VH7A 3MEGA 4IUFA 1AROP 3L7PA 4PUOB 4IO9Q 2FHMA 4JBCA 1Q8IA 4DSFA 5IM0A 2J8AA 3CD7A 3GYNA 5J2PB 4FF3A 1TR0A 2MY7A 3KLGB 4NXMF 1S49A 5KFIA 1WF0A 4Y2AA 5GMKa 1WTFA 3HHLB 2YKQA 1YJNS 4A8FA 3OVSA 2JC1A 1UWBA 3QIDA 3ZZYA 3LP0A 3M05A 3MD3A 4O3SA 3BGFA 3FMBA 1IQZA 1D3WA 1RTIA 2XGQA 3EZ5A 1N8RT 2J7KA 4R5PB 3MAQA 2GQCA 5B0EA 3H2UB 4Q2LA 4EU0A 1JNRB 1ZOTA 2DITA 5K9FA 5FD1A 1KLMA 3AY0A 5G4DA 4ELUA 1S79A 3VAMA 5L38A 1F5CA 2JLGA 3OXGA 4OZ0A 3SMZA 2MJNA 5C25B 1KFSA 1VQOS 1QSLA 5C25A 2KHDA 5JJBA 2A3JA 2ZNZA 3M6XA 5IFMA 5M2PA 2V8HA 3KK2A 2FLLA 1R0AB 1DQ8A 3S8SA 3DI6A 4H4OA 2Y1RI 3DGPA 3G8SA 2M5YA 2IVYA 4IFVA 4KC5A 3CCES 2OIHA 5B0CA 3AHPA 2DR9A 1IKWB 3AJ1A 3CJKB 1TVRB 4X4PA 2AJ4A 5KFDA 4DL4A 1NK5A 1SJ4P 2QE5A 1WG1A 4YR2A 1S0MA 2I5JB 3DNCA 1S7HA 1J5EF 3NL0A 4DR3F 1OO0B 2XY5A 2AX0A 2BRKA 2DGOA 4O3PA 2CPZA 2DNMA 2AD9A 2JEGA 3CO9A 2ZJRQ 1NH7A 1O5JA 2NUHA 2LQ5A 1UJ5A 3HZGA 4ICLB 1RK8A 4E0DA 4C98A 3I0RB 1KS2A