4WFEA

Human traak k+ channel in a k+ bound conductive conformation
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
259
structure length
253
Chain Sequence
b'RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 97
structure length 253
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4wfeA00
3E83A 4G27B 3K03A 2EIMC 4MTFA 4WFFA 1R3IC 3TETA 1XL4A 3AG4C 4PDLA 4XDJA 4GX2A 3SYOA 2DYSC 2WLJA 4H37A 2A0LA 2A79B 3KG2A 1J95A 2AHYA 3FB8C 4MS2A 5J9PC 4J9YB 4MW3A 4PA9A 4CBCA 4PA7A 4WFHA 1QLEC 3E86A 4MVSA 1R3LC 4BW5A 3K0DA 1OCRC 2Y69C 3TCUA 4XDKA 5B1AC 3F7YC 1K4DC 4HYOA 3K06A 4UUJC 4RUFA 3VOUA 2H8PC 2HFEC 3LDCA 4P30A 3RW0A 2DWDC 4MVMA 3K04A 2X6CA 2NLJC 3E8GA 3ABMC 2K1EA 4X88A 2HJFC 3LUTB 1ZWIC 3AG3C 4MVQA 1KKDA 3SYCA 1M57C 3LNMB 2AHZA 4MTOA 4PA4A 3SPIA 4WFGA 5CBHA 3F5WC 4GX0A 4LBEC 3JYCA 1V55C 4PDMA 4LP8A 4PA6A 5BZBA 2WLMA 2IH3C 1P7BA 3AG1C 1M56C 3SYAA 3T1CA 4MVUA 3R65A 1R3JC 4JTDB 3STZC 3SYPA 2WLIA 3GB7C 3E8HA 2ATKC 4OXSA 4P9PA 1OCZC 2A9HA 2X6AA 1BL8A 3FB5C 4PA3A 2Q69A 2WLLB 1R3KC 4RAIA 4DXWA 3K0GA 2HVJC 3OR7C 4P2ZA 3SPJA 4MSWC 3ZJZA 3OUFA 5EBMC 4ZBMA 5KUMA 3SPHA 4QNHB 2HG5C 5EK0A 4MTGA 3PJSK 4MVOA 5EC1C 3T4DA 3BEHA 3AG2C 3RBZA 3LDDA 1V54C 4MW8A 2DWEC 2QTOA 3OUSA 3T4ZA 1LNQA 4WFEA 3F7VC 5KUKA 4JTAB 5EBWC 2BOBC 3E8FA 4I9WA 2EIJC 2YEVA 1OCCC 4QE9A 3RVZA 2ITDC 4KFMA 4F4LA 3SJQC 4R7CA 4PDVA 2Q67A 3ABLC 3UM7A 5CBGA 3OR6C 3ZRSA 2WLIB 3EFFK 3IGAC 2W0FC 3STLC 2QKSA 3WG7C 1S5HC 4JTCB 4X89A 1ORQC 2ZD9A 3X2QC 5B1BC 2WLNA 3FB7C 3UKMA 4J9ZB 3HPLC 1OCOC 1JVMA 3ABKC 2EINC 2JK5C 2KB1A 2EIKC 4GX5A 4G28B 2IH1C 4MVZA 4MVRA 2BOCC 3ASNC 3IFXA 2OCCC 2EILC 3K08A 5E1AC 5B3SC 3E89A 4P9OA 2DYRC 2R9RB 4RO2A 3OGCC 5CBFA 4XDLA 3RVYA 3LDEA 3ASOC 4H33A 2X6BA 2HVKC 4HZ3A 4R50A 2WLHA 4GX1A 4RUEA 5EC2C 3FB6C 3SPGA 2ZXWC 4EKWA 5IY5C 4R8CA 2P7TC 3SYQA 1G4YB 4R6ZA 3E8BA 4QE7A 2WLLA 4PDRA 3SPCA 4LCUC 2ITCC 1XL6A 1K4CC 2WLKA 4TWKA 4X8AA 3T2MA 2Q68A 2Q6AA 5EBLC
chains in the Genus database with same CATH superfamily
2EBOA 4G27B 2EIMC 3WG7B 2DE0X 2WPDG 2VWKA 4PDLA 5JJEB 3BAAA 1H8HG 2BTQA 1N36O 1K9MW 3CEIA 1NJIW 4L8JA 4JI5B 4O2BB 3ZHVA 4JI0B 3CCRV 3RYCB 4HYOA 1MSDA 1D5AA 4P30A 1CPYA 3SJCC 4JI3O 4X88A 1YHQV 4JYCA 1RPOA 5BMVA 2VQFB 3JYCA 3RYFA 4QPKA 3ZRXA 4GCZA 1XEQA 1KECA 1VEWA 1M56C 3JALB 4OGQB 4NXMB 1HW7A 1BQZA 3D3QA 2DYSB 3JATB 1SZXA 1OV9A 1G1XB 1RSOB 3CRRA 3SPJA 1TA8A 3CCQV 1K33A 2FB5A 2JGDB 3T4DA 1SQQH 4MW8A 4DUYO 3D8CA 1SA0B 1FXKB 4I0XA 4F4LA 5LHGA 3K58A 5BR8B 2YIAA 2P6JA 4N21A 4DR1O 1GTOA 4Z1MG 3ZRWA 5LOVA 4LF9B 4DV7O 1RM1C 4LF8O 1JVMA 4K35A 1FJGB 1NR7A 1I94O 4DR7B 2MW2B 4U7OA 4JI2O 2OCCC 1Q8IA 4DRXB 3ASOC 1Z2GA 1L1FA 4JI7O 4PDRA 1PL0A 1W0KG 1K4CC 3RWRD 1HR0B 1DK1A 4GUNA 5JQGA 4JASA 5LA6A 1KBHA 4CS3A 3B40A 4WFFA 2R70A 3UCSC 5LYJA 4H44B 1XL4A 1N0NA 5IWAO 1GKFA 2DOSA 5KA5A 2GV9A 1Q6UA 4H37A 2ZIOA 3CCJV 2CTWA 5J9PC 4JI6O 1H2SB 1GH6A 1NVPB 3TCUA 1YZBA 3ZN0A 4YJ2B 3IAYA 2QWRB 2ZDIC 3OMIB 4LFCB 3VOUA 1IURA 2FYUH 4LF4B 1Y4MA 2NLJC 5H9CA 4X1IA 2W6IG 2KSDA 2Q7EA 4LFBB 4U3JB 5EIBC 3CCVV 4FLZA 2Q7GA 2Y0IA 1HNWO 5LMNO 3JARA 5JJJB 4OX9B 5KX5B 3BA9A 3JSNA 5IJ0A 4LFAB 3ZJZA 2OCHA 1VF6C 1BCCH 3BPZA 2QE7G 3TJTA 1XNQB 1AJNA 2A3QA 2QTOA 3ABMB 3OUSA 1NS1A 3I56V 2HP8A 3CD6V 2KG7A 2Y4UA 3EHBB 3WB2A 4GLXA 3A2FA 5FPRA 2UXNA 1VQPV 4Q6GA 4LC1A 5H6RA 1IBLB 5DN6G 3CC2V 1GN3A 2WLNA 2QGNA 4FFBB 1VARA 2EIKC 4LNUA 3VQWA 5AG2A 2ZNJA 3ASNC 1M93A 3JCUZ 4HZ3A 4TUYA 4EKWA 5J2UA 4DV4B 3L74H 1JCHA 1NVPD 1R6TA 2DN9A 2UXCB 1GM9A 3IC7A 3K03A 2IJHA 3HKBA 1IBKO 4JI4O 4EFEA 1MABG 5CA1B 3N27A 3CMAV 3CC4V 3D36A 1YSCA 1L8DA 3KG2A 5CB4A 3AK2A 4DV1B 4J9YB 4MVSA 1Y76B 3JD0A 4NYKA 3FKSG 4LF5O 4TQDA 2HFEC 3M7MX 4DV2B 4Q20A 2YS8A 4MVQA 1OHHG 4E2LA 5CBHA 4TV9A 4JYBA 3DC5A 2PUSA 2UUAO 4ZI7B 2IM9A 4KP4A 3OFNG 1R3JC 4AQYB 1PNMA 3BA8A 3GB7C 3QO5A 4OXSA 1OCZC 5FPOA 3K59A 4JI8O 3FB5C 1RFYA 2F1MA 4MTGA 3PJSK 4MVOA 1AJPA 4FLTA 3OTOO 2Q9LA 4DR5B 5LXTA 3CRQA 3AG3B 4JTAB 1SESA 3G4SV 4UB6Z 3C3SA 1DTOA 5LMUB 1Q81W 2RMKB 3CSXA 1GN4A 1IZ3A 2KQXA 2L35A 5CA0A 3UT5B 4U7NA 4LF6O 1IX9A 5B1BC 4UVBA 3DXRB 3ABKC 1A32A 1X59A 2F95B 1VQOV 5IYZB 3W7TA 3M8AA 4WFBV 2A7WA 5JJNB 2XOKG 4DV3O 2RN9A 3ZS8C 1VQNV 2VQEB 1GN6A 2WA4A 1I0HA 1N32B 4NVPA 2Q68A 1TAEA 2AGAA 4YHHO 1R73A 4PI0A 4B3SB 4GKJB 3ABLB 2QR4A 1N4CA 2D2CB 5GONB 5LGNA 3E22B 4O4LB 3B2EE 2A0LA 3JD2A 4FM2A 2V7QG 4O2AA 5FNVB 1N36B 1SQGA 1YJ9V 2YIDA 2FL4A 2ZDIA 2PZSA 2AHZA 5JH7B 2Q8VA 1JFFA 1QU7A 1V55C 4PDMA 3ZX6A 3QF7A 3ZN1A 4JI3B 3JD3A 5L3GA 1XOUA 4UB8Z 2A9HA 4GT1A 4X20B 4JZGA 4FVMA 1MA1A 1PPJH 3BFRA 2N74A 1N0JA 4QNHB 5K1XA 1H2GA 1JPXA 3MD0A 3UO3A 1VF6A 3T1HO 1W59A 4PV1B 1EFRG 4HNAA 2YEVA 1LUWA 3LNNA 3SJQC 3JD1A 3H1LH 3RYIA 4QGPA 3A0HZ 5H6QA 3EFFK 1FYJA 3FX7A 4GKKO 3G6EV 1PM9A 4DUYB 4J80A 1COWG 1YF2A 1EN6A 4TV8B 4MVZA 1N34O 3TK1A 1B04A 1BMFG 3THOA 1WP7A 4DR1B 3D3IA 3ZIAG 2JS3A 2PTMA 1K5SA 3FFQA 4DV7B 3FB6C 4LF8B 3FAVB 5KLVH 3RN4A 1I94B 4X1YA 5BXZA 4AHCA 4RWUA 2QTSA 4DW0A 2IU3A 4JI7B 3UO2A 5L3CA 5CN0A 3K9SA 2EINB 1FXHA 1VF7A 3CWBH 4JAVA 3E86A 1OCRC 1AR1B 2O57A 5EYPA 3K06A 3SDLA 1Q90D 2QWQB 1J5EO 1DLBA 2DQ3A 2F23A 4JI6B 5KHHA 1KMIZ 2OWOA 3JD4A 2ADPA 4PA6A 1F51A 2BTQB 5E79Z 2XAHA 3T1CA 3ZRVA 1SZTA 3AG4B 3J80N 1YDXA 2JDIG 1M90W 2PF4E 2X6AA 1TUEB 4DXWA 4WBNB 1HNWB 2V1DA 5LMNB 2CK3G 1JMKC 1XREA 5LGTA 2QA4V 1Y66A 2E76B 3BVOA 4X65O 3LSUA 3RYFB 1S5JA 5KUKA 3IC9A 2ITDC 4NTXA 3HKEB 2YICA 1M4UA 3AG1B 1BZKA 3APOA 1WA8B 2JVDA 2QWPB 3W7UA 3X2QC 1GO3F 2IBZH 3K5OA 4NR1A 3UKMA 2HLDG 1DGSA 2UUBO 5DEDA 4NTWA 3BY6A 4F6RB 2ZE6A 2ZE7A 3TXSA 1HWYA 2ZR3A 4AILC 2ZKOA 5E1AC 5B3SC 1PP9H 2R9RB 1VQKV 3LDEA 3CMEV 3OM3B 4IYHA 3E8BA 3CP1A 1DF4A 4O4JA 4QIWF 5JWPA 5L3FA 2XAJA 5BY1A 3ZRWB 1WPXA 2UU9B 3P30A 2EZOA 1S76D 1W0JG 1P4RA 4PA7A 3SR2C 2CH7A 2QWOB 1IBKB 4JI4B 1QNMA 1S5LZ 5KMGA 4W4LA 4FIPC 4JYAO 4RUFA 2E74B 3RW0A 2UXDO 4GYCB 1VQ7V 1L0LH 3E8GA 2HJFC 4QJFB 4ZKIA 3D36C 1BS3A 1M57C 1GM8A 4I55A 4CH6A 4LF5B 4O4HB 4DK0A 1HNZO 1I5YA 1KP3A 5BZBA 2IH3C 1L0NH 3ABUA 1M9NA 3R65A 2OT5A 1SF9A 4X66O 3K5LA 2QDOA 3G6BA 4P9PA 3N2GA 4ZOLB 4X9QA 3P3NA 4BIUA 2CAZC 3H1JH 5IJ9B 2UUAB 5D5QA 2WLLB 2LFSA 1EN4A 2XUMA 4DR2O 3B77A 1WB7A 3AG2C 3RBZA 3LDDA 1V54C 3OMAB 2IJJA 4JI8B 4I9WA 2A06H 2GUZA 1F4MA 3UM7A 3QNEA 3JCZA 3OTOB 4PI2A 1S5HC 2PYJA 4KUMA 4MT8A 3W7XA 2ODMA 4NTYA 1MZFA 2IW5A 2CE4A 1Q6HA 2IH1C 4YY3B 3RFRA 5B1NA 3CPWU 3A8TA 1YIJV 5EZYB 3WU2Z 4LF6B 3VQYA 1F4NA 4IL6Z 1THZA 4R8CA 1SQFA 1GM7A 1ZL8B 5IT9N 4X1KA 3SPCA 4LCUC 4DV3B 3EXAA 3L70H 1EBOA 1R3IC 3ZMVA 2BSKA 4IHJB 2CTQA 4ABMA 4CC5A 1EM1A 3ABTA 4LNUB 4XDJA 3RYHA 4EB6B 3H01A 4PA9A 4WFHA 4YHHB 1QLEC 3MHSC 3K0DA 3JSLA 2L6LA 2RCVA 3SJAC 1K7DA 1X4TA 4CS2A 3LNMB 3CX5F 1FXVA 4NB5A 1P7BA 3S3XA 1K34A 5CB4B 2CDYA 2HHHO 2CGNA 2FKXA 2WLIA 2F93B 4DV5O 2GTAA 1Y74A 1VF5B 5EBMC 2HG5C 5EK0A 4JI1O 4B3MO 5EC1C 1AR5A 4DUZO 3T4ZA 1YEWA 2Q0OC 3F7VC 2BOBC 1OCCC 2BTOA 3IJ4A 3RYCA 1WP8A 1UPGA 1I7FA 5CBGA 1H2NA 1OZ0A 2RQ6A 1M56B 4DV6O 2ZD9A 3T1HB 2B1GA 1YJNV 3KCYA 2UXBB 2BOCC 2JS5A 3SGIA 4GKKB 3ML0A 5C8YA 1FFXA 1H38A 4H13B 4RUEA 2ZXWC 5IY5C 4YIOA 3JATA 1XMQO 4FFKA 5K1PA 1NU1H 1XBLA 1N34B 2E75B 4TWKA 2JGDA 1PD3A 4FJCC 3HB3B 3L71H 1SA0A 1FXKA 4MS2A 5HFMA 3U10A 2R9IA 2Q4PA 3J7AU 1WLEA 2VRZA 2QWNB 1BGYH 4O4IA 4DV0B 3ASOB 3ZHTA 3LDCA 2X6CA 2EZPA 2GSMB 1KKDA 5CA3A 1IXMA 4ZHQB 1TVKB 4DRXA 2ZIMA 1J5EB 3OD4A 5LP6C 3AG7A 3R66A 1FKAO 1IXBA 5IYCO 4UCUA 2PI4A 5H2FZ 1VQLV 4PA3A 2P4VA 3K0GA 5KHJA 4O2AB 5KHKA 4DK1A 1QHTA 4ZBMA 4X64O 4UVAA 1TUBA 2P06A 4NKGB 1VIBA 4QPJA 2D3OW 4I9QA 2DWEC 2IJKA 2EJRA 2OTJV 1MNGA 5LHHA 4QE9A 1Q82W 1NTKH 4HBNA 4MTXA 4D7SA 1B3QA 3ZRSA 4Z2WA 4X62O 4X65B 4U3JA 4DR4B 4PJ0Z 1P7GA 4DR6O 1YJWV 4MVRA 3DTUB 4B08A 1WNSA 2OYQA 4LH7A 4IIJB 5KX5A 5EC2C 4FZ0A 2C2AA 2YEVB 2P7TC 2UUBB 1S77D 3RYIB 2QM8A 2ITCC 4NXMO 4LR3A 1VQ8V 1JJOA 3WFVA 1XMOB 1B06A 4BAYA 2XASA 2X0LA 1N33O 3DGEA 4UXNA 2CTPA 4CBCA 2IU0A 1EZJA 4I4TB 3ASNB 1T5EA 1CXZB 1U97A 1AI7A 1BHAA 3E2EA 1KKCA 3ZHRA 1I5XA 4MVMA 2XAQA 4FFBA 2ADQB 2LW1A 3F5WC 3HKDA 4JYAB 1NTMH 3Q4HB 3JASA 2UXDB 2HJDA 4MVUA 4TT3G 5EIBD 4FZ1A 3BABA 4FM1A 1HNZB 3H1KH 3OR7C 1VQ9V 5CA1A 5KUMA 3K5MA 4X66B 4WCEV 3QG5A 3VQXA 4XBFA 1SQXH 2HR3A 3K57A 1AJQA 3C3TA 4WFEA 1BSMA 3ZBHA 1Y76A 3VQVA 2FTKA 4G2KA 3CCSV 4DR2B 5KAIZ 1WAZA 5ITZB 2JJ1G 2GDSA 3P32A 1AILA 2CGOA 2W0FC 4HAMA 4J9ZB 1OCOC 1NH2B 1OCZB 1BQ0A 2YSUB 2EILC 2DYRC 1URFA 3K3WA 3JAWB 3ZMSA 1G4YB 4R6ZA 1YTFB 1SKVA 1CEZA 1V9PA 2YIBD 2WLKA 3APQA 2AZ0A 1XI1A 1K3EA 4KHPO 3OEHG 4L87A 1KUQA 1KC8W 3ZMZA 5FL7G 5B1BB 4I50B 2A79B 2OIEA 1J95A 3ABKB 2X7RB 3WB0A 1R3LC 4J7JA 2Y69C 5B1AC 3UT5A 2Q0AA 3F7YC 2ZM6O 4O4JB 2DWDC 2EIJB 3DXRA 4JI2B 4D7TA 5CMUA 3EVKA 3LUTB 3M99B 1ZWIC 2RJZA 5IYZA 4C7UA 3SPIA 1FPOA 2JIZG 3JAKB 4UV8A 3KCXA 1XNRO 3I55V 2R72A 5J2TA 2WLMA 1ZAUA 3SYAA 1Q7YW 4B3TO 4JF3A 3N2KB 4J11A 3STZC 3HKCB 2QKCA 2DW4A 1WJZA 5KMGB 1BL8A 5LP6A 5IWAB 2LGWA 3O65A 5GONA 1PKXA 1UJWB 1F23A 2HHHB 4J42A 2ZT9B 3E22A 2WA3A 4NXNO 4O4LA 1PNKA 3UQ8A 1VMGA 1KB9F 1NH2D 4K0KO 4F6EA 4DV5B 2XAFA 3I5DA 1NT2B 3RVZA 1JJ2U 1V55B 3DSQA 2M6YA 1H8EG 4B3MB 3N2GB 2QKSA 4I7ZB 3WG7C 4DUZB 1ORQC 5TISZ 4YJ3A 1YTFD 2P5OA 1JQ0A 5JH7A 2UUCO 1WB8A 2LW7A 4DO2A 2V4DA 4RQEA 4BIZA 2WWWA 3GWKC 4J10A 2QKAA 5BMVB 3E89A 4DV6B 4LF7O 2QEXV 3RVYA 2GUZB 2FMLA 3SYQA 4K8ZA 4K3AA 4X20A 1IBMO 2NR5A 2Z5UA 1FAFA 1GN2A 2F43G 4K8XA 2PYLA 2ZE8A 2RDCA 4IGGA 1XMQB 1AI4A 2DYSC 3CXCU 2AHYA 4JAUA 1K92A 1Z5WA 4I0XB 3B8MA 2PY5A 2H3OA 5JVDA 1HNXO 2H8PC 3U0ZA 1FD9A 4BW9A 1RPRA 4JGSA 1M1KW 4TV8A 3RT3C 1M5IA 4DR3O 5LOVB 3B8NA 4BIOA 1FXKC 4WFGA 1XDCA 1XHZA 2W6JG 1O9GA 1FFTB 3K79A 3JAMN 3FAVA 5L3EA 4JTDB 4WFAV 2ATKC 4LWSA 2IJIA 2E5LO 2N04A 3LSSA 3P3PA 3OUFA 3H9VA 5JQGB 3CRMA 5DM6V 5LA6B 1N32O 1NTZH 2BE3A 3O9OA 5LYJB 1D2DA 3W7WA 2H94A 3L9DA 4X64B 3CS5A 1GMGA 4KL1A 4PDVA 2WLIB 1LUVA 1DF5A 3QVNA 4JTCB 3OAAG 1Q86W 2XHBA 2Y4TA 4RQFA 1Y74B 5B66Z 5B5EZ 1Y67A 4X1IB 3ETGA 1VP7A 3IFXA 3K08A 2LQTA 4OPAA 1K5QA 4X62B 4XDLA 1K73W 1KD1W 3WB1A 4R50A 2X6BA 4UFZA 4B3RO 2AW9A 2P90A 3JARB 1I08A 3OGIB 1NZ6A 4DR6B 4JV5O 4WBNA 1W2BU 2Z0AA 5KA6A 5IJ0B 1O9HA 3MAQA 3CYOA 1XHXA 1JR9A 2GBOA 1H2MA 3X2QB 4IT5A 2LGQA 3ICXA 1SERA 3AK1A 5C8YB 1ZTEA 3HKEA 1FFXB 1LR1A 2KG7B 3L75H 5B3SB 1WA8A 1N33B 4AI8A 3B09A 2QJ1A 2YUAA 5IYDO 3ABMC 2Z3YA 3ETEA 4F6RA 2AXTZ 3CJHA 4MTOA 4LP8A 4W4KA 5LHIA 1U96A 5B1OA 2ZINA 1AI6A 2EX3A 1S0VA 4TUYB 1Z5VA 3E8HA 5J2UB 3AK3A 1E1RG 4O4IB 2MK3A 1BHBA 1CP9A 2HVJC 1QQCA 4UV9A 3G80A 3HKBB 3E35A 1QLNA 1VQMV 1LNQA 1IVSA 4FLWA 1M57B 3W7SA 2EIMB 3E8FA 1NR1A 4KFMA 3OW2U 4FM0A 4R7CA 3CCEV 4B7KA 2JEXA 3KZIZ 4CH3A 3K9AA 2F4VO 2LO1A 4J41A 2LP7A 3MHHC 2QM4A 1QBZA 1IDSA 1TUBB 4O4HA 3CCMV 2Q7HA 5GTHZ 3CXHF 4TV9B 1HDJA 4P9OA 1S3JA 2Q73A 1NI8A 3ETDA 5CBFA 4O2BA 4H33A 4GX1A 3CHXA 2HKOA 3J81N 1GAXA 3AG2B 2DQ0A 1V54B 2XNDG 4ZOLA 2ZE5A 5IJ9A 2WLLA 1GRJA 3E83A 1JX9A 1P84F 5LGUA 3LSQA 1Q5OA 2WSSG 3SYOA 4J7ZA 4KXRA 3JALA 4IYIA 5LXTB 4MW3A 4FPPA 3QTCA 2E3CA 1PL4A 4KHPB 4JYYA 1SS3A 2WAMA 1RSOA 4J7KA 3K04A 3ZHQA 5CA0B 2B9ZA 3AG3C 3AEIA 4UCSA 1YI2V 2ARHA 5JCOC 1AVMA 4LBEC 1SQPH 2HEPA 5EZYA 3TGUH 2ZM6B 4FMTA 1RM1B 2W0XA 2VS0A 3CCLV 1ZL8A 2OCCB 3PN1A 1E1QG 1Y6XA 1XNRB 1Q43A 5LBQA 1QLEB 1BT8A 1R3KC 4PELA 4RAIA 1K8AW 4UVCA 1FS0G 1QCEA 4B3TB 4IHJA 3RGBA 4WF9V 4EFBA 4EB6A 4D6TH 3HKDB 2YXHA 5LL6Y 3JASB 4UCTA 2CUGA 5EBWC 2UU9O 3T1YO 3H1IH 1H2KA 2RNBA 3NR7A 3C90A 1SQBH 3ABLC 4NXNB 4YXWG 1PNLA 5D5PA 1K97A 4UCRA 1N8RW 4X89A 4K0KB 3BHPA 2F66C 3OE7G 3OMNB 3HPLC 4I5SA 2JK5C 5IE9A 2QSAA 4CH5A 4EEQA 4A5UB 1JFFB 2Y48A 4YIPA 4BWAA 3HR0A 2WLHA 2UUCB 1G6UA 4YJ2A 2OIGA 4QE7A 3ZMTA 3STLC 1XL6A 1OCCB 1NBMG 4LF7B 1NQTA 1GK9A 4JI5O 1EN5A 4JI0O 4UCOA 4H0LB 2JEUA 4TQFA 3TETA 1AP6A 4GX2A 1IBMB 2ILMA 2YDEA 3L73H 4OPHA 3CCUV 2YI9A 4HNAB 3H1HH 2VQFO 3U11A 4CC6A 1AROP 5DECA 2ZXWB 5IY5B 2K1EA 1R6KA 2YXYA 3SJBC 4LH6A 1AR4A 1KP2A 5F2VO 2YI8A 3ZCCA 5L3BA 1HNXB 3GWOA 4BR6A 1P49A 2G38A 2EIKB 3OTFA 4YY3O 4DR3B 3MDSA 1E79G 1XILA 3G71V 3DC6A 4DW1A 2BCCH 2JRIA 1F7YA 4X1YB 2PGGA 4UCVA 4CS4A 5BR8O 2B5UA 2PI5A 1QVGU 5IDJA 1S72V 2E5LB 1AI5A 5C93A 4LF9O 1AB3A 5J2TB 2EIJC 1FJGO 1OJHA 1Q6IA 5A2QN 1NKDA 4ICGA 3CC7V 4DR7O 1MSWD 2NN4A 5EYPB 4FLYA 5LP6B 3CB2A 4JZ2A 4ZHQA 1TVKA 1WN7A 5FLXN 2EINC 2P22C 1HR0O 1D5NA 1WPBA 1YXBA 1QR8A 2NNUA 3ZHUA 5IYBO 1XQ8A 1SETA 3FYEB 1XUQA 4N23A 2Q6AA 1VQ5V 4YJ3B 1VQ4V 1ZUQA 4B3RB 4MTFA 3FYIB 4FK5C 1ROPA 3AG4C 2UXXA 3BRCA 4CZZA 4LFCO 4ZI7A 2WLJA 2YXLA 4JV5B 1JOYA 4LF4O 2Y0PA 4GZRB 4LFBO 1US6A 4E4EA 1KYOF 1R1BA 2XTAA 2EULA 2GHYA 4OX9O 4JAAA 5HFLA 4PA4A 5GW7A 2R9AA 2EJ7A 2CTRA 4IIJA 5H5NA 4LFAO 5JCOA 4FLUA 3AG1C 3OT7A 1MZEA 4B7EA 1B6QA 2M7WA 1YCIA 4PHZA 2UXBO 3K5NA 2N05A 1XNQO 2ZQMA 5JVDB 5A9GA 1SQVH 1KQSU 4P2ZA 4MSWC 1ZLZA 2YC0A 1IBLO 2LFRA 1R6NA 2YIBA 1TGOA 4I4TA 2ZCEA 1SRYA 3A0RA 2CH7B 3ZEDA 4LWSB 2P67A 3FB7C 4PD4F 4DV4O 3BCCH 3Q4HA 2ZR2A 4DV0O 5L3DA 1RP3B 2UXCO 4I55B 3KKYA 2KKWA 2XAGA 4RO2A 3OGCC 2XT9A 3SPGA 2F4VB 2JJ2G 5KHGA 1QR9A 3QO7A 4JI1B 2LJ2A 4X8AA 4ZIBA 1HP8A 5FNVA 4DV1O 3B4SA 3SYPA 4FLXA 3ZHSA 1H2LA 3G67A 1YVWA 4DV2O 1VQ6V 3QO8A 1OCOB 2DMXA 2P4KA 3FB8C 3L72H 1JA8A 1MMMA 4Z1VA 5ITZA 2GTSA 1ENVA 3CRAA 4BW5A 2OTLV 2EILB 4XDKA 2QM7A 1K4DC 3GVMA 2DYRB 4UUJC 3FD9A 3A0BZ 5GTIZ 3OEEG 3F5TA 4FLVA 4AQYO 1ZX3A 2B1IA 3ETQA 3SYCA 4GX0A 1SC5B 2VWJA 2Q5ZA 1BE3H 3S3WA 2AZ2A 4DR4O 3JAWA 4TOIA 2DJVA 1AP5A 1MG1A 2JGUA 4DR5O 1EZVH 2Q69A 4X1KB 2Y69B 3SPHA 5B1AB 3ZMUA 5LMUO 1Q3EA 4U3FH 3BEHA 3CJHB 4I50A 1UFIA 2ETNA 1ZSPA 2ZNIA 2BSKB 4CH4A 3RYHB 1MOFA 1XMOO 4TSFG 2K9PA 3CRCA 2Q67A 3CE2A 3OR6C 3IGAC 4DYLA 1G8MA 1YITV 5KHIA 2VQEO 1OCRB 3T1YB 3JAKA 4JPRA 2KB1A 1QVFU 4GX5A 4G28B 5KAFZ 3N2KA 4B3SO 1PV0A 4GKJO 2HVKC 3HKCA 3VBBA 3TXQA 3NXSA 3T2MA 4ASUG 1KU9A 5EBLC
chains in the Genus database with same CATH topology
3E83A 2EBOA 1VQ8V 4G27B 1JX9A 3WFVA 2EIMC 5LGUA 3LSQA 4BAYA 2XASA 3WG7B 2X0LA 2IU3A 2WPDG 2WSSG 4PDLA 3DGEA 3SYOA 4UXNA 1H8HG 5L3CA 1K9MW 5CN0A 2EINB 4MW3A 4CBCA 1FXHA 1NJIW 2IU0A 1EZJA 4FPPA 4JAVA 3E86A 3ASNB 3CCRV 1OCRC 1AI7A 1AR1B 4HYOA 3K06A 1BHAA 3E2EA 2WAMA 4P30A 1CPYA 1I5XA 4MVMA 3K04A 1DLBA 2XAQA 2DQ3A 4X88A 3AG3C 1YHQV 3AEIA 1YI2V 4JYCA 1RPOA 3F5WC 4LBEC 3JD4A 3JYCA 4FMTA 4QPKA 4PA6A 3ZRXA 4GCZA 1F51A 1RM1B 1KECA 1M56C 2XAHA 3T1CA 4MVUA 3ZRVA 1SZTA 3CCLV 3AG4B 2JDIG 2DYSB 4TT3G 2OCCB 1M90W 1E1QG 2X6AA 5LBQA 1QLEB 1TUEB 1R3KC 4PELA 4RAIA 4DXWA 4UVCA 3OR7C 3SPJA 1K8AW 1VQ9V 2V1DA 1FS0G 1QCEA 5KUMA 4WF9V 3CCQV 1K33A 4WCEV 2CK3G 3T4DA 4XBFA 5LGTA 2HR3A 2QA4V 1Y66A 4MW8A 1AJQA 4WFEA 5KUKA 5EBWC 1FXKB 2FTKA 4G2KA 2ITDC 3CCSV 4F4LA 3ABLC 2JJ1G 4YXWG 1PNLA 3P32A 5LHGA 3AG1B 2W0FC 1K97A 2P6JA 1N8RW 4HAMA 4N21A 4X89A 3W7UA 3X2QC 1GTOA 1GO3F 4Z1MG 3ZRWA 3OE7G 3UKMA 3OMNB 4J9ZB 2HLDG 1OCOC 3HPLC 1JVMA 1RM1C 1NH2B 1NR7A 4I5SA 1OCZB 2JK5C 3BY6A 1HWYA 2ZR3A 4U7OA 2YSUB 2OCCC 2EILC 5E1AC 5B3SC 2Y48A 2DYRC 2R9RB 3K3WA 1VQKV 3LDEA 3ASOC 2WLHA 1L1FA 3ZMSA 3CMEV 3OM3B 1G4YB 4R6ZA 1YTFB 3E8BA 1CEZA 3CP1A 4QE7A 3ZMTA 4PDRA 1DF4A 4QIWF 3STLC 1PL0A 1W0KG 1K4CC 1XL6A 2WLKA 1OCCB 1NBMG 4JASA 5L3FA 1NQTA 1GK9A 2XAJA 3ZRWB 1K3EA 4WFFA 1WPXA 2JEUA 3P30A 3OEHG 4L87A 3TETA 1KC8W 1XL4A 3ZMZA 1GKFA 2EZOA 5KA5A 5FL7G 4GX2A 5B1BB 1S76D 4H37A 2A79B 3CCJV 1J95A 3ABKB 5J9PC 1W0JG 2X7RB 1P4RA 3CCUV 4PA7A 1NVPB 1R3LC 2Y69C 3TCUA 5B1AC 3F7YC 3ZN0A 4FIPC 4RUFA 2ZDIC 3OMIB 3VOUA 1AROP 3RW0A 1VQ7V 2DWDC 2EIJB 2ZXWB 1Y4MA 5IY5B 2NLJC 3E8GA 5CMUA 2K1EA 5H9CA 2HJFC 1R6KA 1ZWIC 2W6IG 3LUTB 3M99B 4QJFB 4ZKIA 1M57C 1GM8A 1KP2A 3SPIA 2JIZG 3ZCCA 3CCVV 4UV8A 5L3BA 1I5YA 1KP3A 3GWOA 3I55V 5BZBA 2WLMA 2IH3C 3ABUA 3SYAA 1Q7YW 1M9NA 4JF3A 3R65A 2OT5A 2EIKB 3STZC 1E79G 4P9PA 3G71V 2DW4A 1BL8A 4BIUA 2WLLB 2LFSA 3ZJZA 1PKXA 1UJWB 1F23A 3B77A 2QE7G 2B5UA 1PNKA 2PI5A 3AG2C 3RBZA 1AJNA 1V54C 3LDDA 2QTOA 3OMAB 3ABMB 3OUSA 5IDJA 2IJJA 1NH2D 1S72V 1QVGU 1AI5A 3I56V 5C93A 3CD6V 2XAFA 4I9WA 2EIJC 3EHBB 3RVZA 1F4MA 1NKDA 3CC7V 1JJ2U 1V55B 2UXNA 1VQPV 1H8EG 4LC1A 3UM7A 1MSWD 5H6RA 3QNEA 3JCZA 5DN6G 2QKSA 3WG7C 1S5HC 3CC2V 1ORQC 4KUMA 4MT8A 2WLNA 1YTFD 1JQ0A 3W7XA 2EINC 4DO2A 2EIKC 2IW5A 2IH1C 4RQEA 4BIZA 3ASNC 5B1NA 3CPWU 2WWWA 1YIJV 1QR8A 3E89A 2NNUA 5IYBO 2QEXV 3RVYA 4HZ3A 4EKWA 1F4NA 1SETA 3FYEB 1THZA 4R8CA 3SYQA 1JCHA 1GM7A 3SPCA 4LCUC 4N23A 1NVPD 2Z5UA 2Q6AA 1VQ5V 1GM9A 3IC7A 3K03A 2IJHA 2F43G 1VQ4V 4MTFA 3FYIB 1MABG 1EBOA 1R3IC 3ZMVA 4FK5C 1ROPA 3AG4C 3ABTA 1AI4A 2UXXA 4XDJA 3D36A 4CZZA 3CMAV 3CC4V 1YSCA 2DYSC 2WLJA 3CXCU 1JOYA 3KG2A 2AHYA 3H01A 4J9YB 4JAUA 4PA9A 1K92A 4WFHA 1QLEC 3MHSC 4MVSA 3K0DA 3JD0A 3B8MA 3FKSG 2H8PC 2HFEC 4Q20A 1RPRA 2GHYA 4JGSA 1M1KW 1K7DA 4MVQA 1OHHG 3LNMB 3B8NA 1FXKC 5HFLA 4PA4A 5GW7A 4WFGA 4E2LA 5CBHA 1FXVA 4JYBA 2W6JG 1FFTB 1P7BA 1K34A 3AG1C 3K79A 4KP4A 3OFNG 5L3EA 1R3JC 1B6QA 2M7WA 4JTDB 1PNMA 2WLIA 3GB7C 3QO5A 2ATKC 2ZQMA 4OXSA 4WFAV 2IJIA 1OCZC 3FB5C 1KQSU 4P2ZA 4MSWC 3LSSA 3OUFA 5EBMC 2HG5C 5EK0A 5DM6V 4MTGA 3PJSK 4MVOA 5EC1C 1AJPA 2LFRA 1R6NA 3T4ZA 3AG3B 3F7VC 4JTAB 3W7WA 2H94A 2BOBC 1SESA 3G4SV 1OCCC 1DTOA 1SRYA 3A0RA 1Q81W 1GMGA 4PDVA 5CBGA 1OZ0A 2WLIB 1DF5A 1M56B 4U7NA 2P67A 4JTCB 2ZD9A 5B1BC 3FB7C 3OAAG 4UVBA 1Q86W 2B1GA 1YJNV 4RQFA 3ABKC 1VQOV 3W7TA 2ZR2A 3ETGA 2BOCC 5L3DA 4WFBV 3IFXA 2XOKG 3K08A 3ML0A 1K5QA 2XAGA 4RO2A 1H38A 3OGCC 4XDLA 1K73W 1KD1W 4R50A 2X6BA 1VQNV 4RUEA 3SPGA 2P90A 2ZXWC 5IY5C 2JJ2G 1QR9A 3QO7A 4X8AA 4TWKA 1W2BU 2Q68A 3SYPA 5KA6A 1R73A 4FJCC 1PD3A 3ABLB 3HB3B 3CYOA 5LGNA 3X2QB 1VQ6V 1FXKA 3QO8A 1OCOB 2A0LA 3JD2A 1SERA 4MS2A 3FB8C 5HFMA 2R9IA 1WLEA 1ENVA 4BW5A 2OTLV 2EILB 4XDKA 2V7QG 5B3SB 2QM7A 1K4DC 2DYRB 4UUJC 3ASOB 3LDCA 3OEEG 2X6CA 5IYDO 2EZPA 2GSMB 3ABMC 2Z3YA 3ETEA 1YJ9V 2B1IA 1KKDA 2ZDIA 3SYCA 5CA3A 1IXMA 2AHZA 4MTOA 4GX0A 1V55C 4PDMA 4LP8A 5LHIA 5B1OA 3ZN1A 1AI6A 1MG1A 1S0VA 3JD3A 5IYCO 2PI4A 3E8HA 5L3GA 1VQLV 2A9HA 4PA3A 1E1RG 4GT1A 2Q69A 2MK3A 1BHBA 1CP9A 3K0GA 2HVJC 2Y69B 4UV9A 3SPHA 4ZBMA 5B1AB 4UVAA 3ZMUA 4QNHB 1H2GA 1JPXA 3MD0A 3BEHA 4QPJA 3E35A 1QLNA 2D3OW 2DWEC 2IJKA 1VQMV 2EJRA 2OTJV 1LNQA 1M57B 3W7SA 1EFRG 1MOFA 2EIMB 3E8FA 5LHHA 4QE9A 2YEVA 4TSFG 1NR1A 1Q82W 4KFMA 3OW2U 3SJQC 3JD1A 4R7CA 4MTXA 2Q67A 3CCEV 3OR6C 5H6QA 3ZRSA 3EFFK 3IGAC 2JEXA 1G8MA 3G6EV 1YITV 1COWG 3K9AA 1OCRB 2LP7A 3MHHC 4JPRA 1QBZA 2KB1A 1QVFU 4GX5A 1YJWV 4G28B 4MVZA 3CCMV 4MVRA 3DTUB 3TK1A 1BMFG 4P9OA 1S3JA 3ETDA 3D3IA 5CBFA 4H33A 3ZIAG 2HVKC 5EC2C 4GX1A 1K5SA 2HKOA 3VBBA 3FB6C 2C2AA 2YEVB 2DQ0A 3AG2B 2P7TC 1V54B 2XNDG 1S77D 2WLLA 2QM8A 3NXSA 2ITCC 3T2MA 4ASUG 5EBLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E83 A;  4G27 B;  3K03 A;  2EIM C;  4MTF A;  4WFF A;  1R3I C;  3TET A;  1XL4 A;  3AG4 C;  4PDL A;  4XDJ A;  4GX2 A;  3SYO A;  2DYS C;  2WLJ A;  4H37 A;  2A0L A;  2A79 B;  3KG2 A;  1J95 A;  2AHY A;  3FB8 C;  4MS2 A;  5J9P C;  4J9Y B;  4MW3 A;  4PA9 A;  4CBC A;  4PA7 A;  4WFH A;  1QLE C;  3E86 A;  4MVS A;  1R3L C;  4BW5 A;  3K0D A;  1OCR C;  2Y69 C;  3TCU A;  4XDK A;  5B1A C;  3F7Y C;  1K4D C;  4HYO A;  3K06 A;  4UUJ C;  4RUF A;  3VOU A;  2H8P C;  2HFE C;  3LDC A;  4P30 A;  3RW0 A;  2DWD C;  4MVM A;  3K04 A;  2X6C A;  2NLJ C;  3E8G A;  3ABM C;  2K1E A;  4X88 A;  2HJF C;  3LUT B;  1ZWI C;  3AG3 C;  4MVQ A;  1KKD A;  3SYC A;  1M57 C;  3LNM B;  2AHZ A;  4MTO A;  4PA4 A;  3SPI A;  4WFG A;  5CBH A;  3F5W C;  4GX0 A;  4LBE C;  3JYC A;  1V55 C;  4PDM A;  4LP8 A;  4PA6 A;  5BZB A;  2WLM A;  2IH3 C;  1P7B A;  3AG1 C;  1M56 C;  3SYA A;  3T1C A;  4MVU A;  3R65 A;  1R3J C;  4JTD B;  3STZ C;  3SYP A;  2WLI A;  3GB7 C;  3E8H A;  2ATK C;  4OXS A;  4P9P A;  1OCZ C;  2A9H A;  2X6A A;  1BL8 A;  3FB5 C;  4PA3 A;  2Q69 A;  2WLL B;  1R3K C;  4RAI A;  4DXW A;  3K0G A;  2HVJ C;  3OR7 C;  4P2Z A;  3SPJ A;  4MSW C;  3ZJZ A;  3OUF A;  5EBM C;  4ZBM A;  5KUM A;  3SPH A;  4QNH B;  2HG5 C;  5EK0 A;  4MTG A;  3PJS K;  4MVO A;  5EC1 C;  3T4D A;  3BEH A;  3AG2 C;  3RBZ A;  3LDD A;  1V54 C;  4MW8 A;  2DWE C;  2QTO A;  3OUS A;  3T4Z A;  1LNQ A;  4WFE A;  3F7V C;  5KUK A;  4JTA B;  5EBW C;  2BOB C;  3E8F A;  4I9W A;  2EIJ C;  2YEV A;  1OCC C;  4QE9 A;  3RVZ A;  2ITD C;  4KFM A;  4F4L A;  3SJQ C;  4R7C A;  4PDV A;  2Q67 A;  3ABL C;  3UM7 A;  5CBG A;  3OR6 C;  3ZRS A;  2WLI B;  3EFF K;  3IGA C;  2W0F C;  3STL C;  2QKS A;  3WG7 C;  1S5H C;  4JTC B;  4X89 A;  1ORQ C;  2ZD9 A;  3X2Q C;  5B1B C;  2WLN A;  3FB7 C;  3UKM A;  4J9Z B;  3HPL C;  1OCO C;  1JVM A;  3ABK C;  2EIN C;  2JK5 C;  2KB1 A;  2EIK C;  4GX5 A;  4G28 B;  2IH1 C;  4MVZ A;  4MVR A;  2BOC C;  3ASN C;  3IFX A;  2OCC C;  2EIL C;  3K08 A;  5E1A C;  5B3S C;  3E89 A;  4P9O A;  2DYR C;  2R9R B;  4RO2 A;  3OGC C;  5CBF A;  4XDL A;  3RVY A;  3LDE A;  3ASO C;  4H33 A;  2X6B A;  2HVK C;  4HZ3 A;  4R50 A;  2WLH A;  4GX1 A;  4RUE A;  5EC2 C;  3FB6 C;  3SPG A;  2ZXW C;  4EKW A;  5IY5 C;  4R8C A;  2P7T C;  3SYQ A;  1G4Y B;  4R6Z A;  3E8B A;  4QE7 A;  2WLL A;  4PDR A;  3SPC A;  4LCU C;  2ITC C;  1XL6 A;  1K4C C;  2WLK A;  4TWK A;  4X8A A;  3T2M A;  2Q68 A;  2Q6A A;  5EBL C; 
#chains in the Genus database with same CATH topology
 2EBO A;  4G27 B;  2EIM C;  3WG7 B;  2DE0 X;  2WPD G;  2VWK A;  4PDL A;  5JJE B;  3BAA A;  1H8H G;  2BTQ A;  1N36 O;  1K9M W;  3CEI A;  1NJI W;  4L8J A;  4JI5 B;  4O2B B;  3ZHV A;  4JI0 B;  3CCR V;  3RYC B;  4HYO A;  1MSD A;  1D5A A;  4P30 A;  1CPY A;  3SJC C;  4JI3 O;  4X88 A;  1YHQ V;  4JYC A;  1RPO A;  5BMV A;  2VQF B;  3JYC A;  3RYF A;  4QPK A;  3ZRX A;  4GCZ A;  1XEQ A;  1KEC A;  1VEW A;  1M56 C;  3JAL B;  4OGQ B;  4NXM B;  1HW7 A;  1BQZ A;  3D3Q A;  2DYS B;  3JAT B;  1SZX A;  1OV9 A;  1G1X B;  1RSO B;  3CRR A;  3SPJ A;  1TA8 A;  3CCQ V;  1K33 A;  2FB5 A;  2JGD B;  3T4D A;  1SQQ H;  4MW8 A;  4DUY O;  3D8C A;  1SA0 B;  1FXK B;  4I0X A;  4F4L A;  5LHG A;  3K58 A;  5BR8 B;  2YIA A;  2P6J A;  4N21 A;  4DR1 O;  1GTO A;  4Z1M G;  3ZRW A;  5LOV A;  4LF9 B;  4DV7 O;  1RM1 C;  4LF8 O;  1JVM A;  4K35 A;  1FJG B;  1NR7 A;  1I94 O;  4DR7 B;  2MW2 B;  4U7O A;  4JI2 O;  2OCC C;  1Q8I A;  4DRX B;  3ASO C;  1Z2G A;  1L1F A;  4JI7 O;  4PDR A;  1PL0 A;  1W0K G;  1K4C C;  3RWR D;  1HR0 B;  1DK1 A;  4GUN A;  5JQG A;  4JAS A;  5LA6 A;  1KBH A;  4CS3 A;  3B40 A;  4WFF A;  2R70 A;  3UCS C;  5LYJ A;  4H44 B;  1XL4 A;  1N0N A;  5IWA O;  1GKF A;  2DOS A;  5KA5 A;  2GV9 A;  1Q6U A;  4H37 A;  2ZIO A;  3CCJ V;  2CTW A;  5J9P C;  4JI6 O;  1H2S B;  1GH6 A;  1NVP B;  3TCU A;  1YZB A;  3ZN0 A;  4YJ2 B;  3IAY A;  2QWR B;  2ZDI C;  3OMI B;  4LFC B;  3VOU A;  1IUR A;  2FYU H;  4LF4 B;  1Y4M A;  2NLJ C;  5H9C A;  4X1I A;  2W6I G;  2KSD A;  2Q7E A;  4LFB B;  4U3J B;  5EIB C;  3CCV V;  4FLZ A;  2Q7G A;  2Y0I A;  1HNW O;  5LMN O;  3JAR A;  5JJJ B;  4OX9 B;  5KX5 B;  3BA9 A;  3JSN A;  5IJ0 A;  4LFA B;  3ZJZ A;  2OCH A;  1VF6 C;  1BCC H;  3BPZ A;  2QE7 G;  3TJT A;  1XNQ B;  1AJN A;  2A3Q A;  2QTO A;  3ABM B;  3OUS A;  1NS1 A;  3I56 V;  2HP8 A;  3CD6 V;  2KG7 A;  2Y4U A;  3EHB B;  3WB2 A;  4GLX A;  3A2F A;  5FPR A;  2UXN A;  1VQP V;  4Q6G A;  4LC1 A;  5H6R A;  1IBL B;  5DN6 G;  3CC2 V;  1GN3 A;  2WLN A;  2QGN A;  4FFB B;  1VAR A;  2EIK C;  4LNU A;  3VQW A;  5AG2 A;  2ZNJ A;  3ASN C;  1M93 A;  3JCU Z;  4HZ3 A;  4TUY A;  4EKW A;  5J2U A;  4DV4 B;  3L74 H;  1JCH A;  1NVP D;  1R6T A;  2DN9 A;  2UXC B;  1GM9 A;  3IC7 A;  3K03 A;  2IJH A;  3HKB A;  1IBK O;  4JI4 O;  4EFE A;  1MAB G;  5CA1 B;  3N27 A;  3CMA V;  3CC4 V;  3D36 A;  1YSC A;  1L8D A;  3KG2 A;  5CB4 A;  3AK2 A;  4DV1 B;  4J9Y B;  4MVS A;  1Y76 B;  3JD0 A;  4NYK A;  3FKS G;  4LF5 O;  4TQD A;  2HFE C;  3M7M X;  4DV2 B;  4Q20 A;  2YS8 A;  4MVQ A;  1OHH G;  4E2L A;  5CBH A;  4TV9 A;  4JYB A;  3DC5 A;  2PUS A;  2UUA O;  4ZI7 B;  2IM9 A;  4KP4 A;  3OFN G;  1R3J C;  4AQY B;  1PNM A;  3BA8 A;  3GB7 C;  3QO5 A;  4OXS A;  1OCZ C;  5FPO A;  3K59 A;  4JI8 O;  3FB5 C;  1RFY A;  2F1M A;  4MTG A;  3PJS K;  4MVO A;  1AJP A;  4FLT A;  3OTO O;  2Q9L A;  4DR5 B;  5LXT A;  3CRQ A;  3AG3 B;  4JTA B;  1SES A;  3G4S V;  4UB6 Z;  3C3S A;  1DTO A;  5LMU B;  1Q81 W;  2RMK B;  3CSX A;  1GN4 A;  1IZ3 A;  2KQX A;  2L35 A;  5CA0 A;  3UT5 B;  4U7N A;  4LF6 O;  1IX9 A;  5B1B C;  4UVB A;  3DXR B;  3ABK C;  1A32 A;  1X59 A;  2F95 B;  1VQO V;  5IYZ B;  3W7T A;  3M8A A;  4WFB V;  2A7W A;  5JJN B;  2XOK G;  4DV3 O;  2RN9 A;  3ZS8 C;  1VQN V;  2VQE B;  1GN6 A;  2WA4 A;  1I0H A;  1N32 B;  4NVP A;  2Q68 A;  1TAE A;  2AGA A;  4YHH O;  1R73 A;  4PI0 A;  4B3S B;  4GKJ B;  3ABL B;  2QR4 A;  1N4C A;  2D2C B;  5GON B;  5LGN A;  3E22 B;  4O4L B;  3B2E E;  2A0L A;  3JD2 A;  4FM2 A;  2V7Q G;  4O2A A;  5FNV B;  1N36 B;  1SQG A;  1YJ9 V;  2YID A;  2FL4 A;  2ZDI A;  2PZS A;  2AHZ A;  5JH7 B;  2Q8V A;  1JFF A;  1QU7 A;  1V55 C;  4PDM A;  3ZX6 A;  3QF7 A;  3ZN1 A;  4JI3 B;  3JD3 A;  5L3G A;  1XOU A;  4UB8 Z;  2A9H A;  4GT1 A;  4X20 B;  4JZG A;  4FVM A;  1MA1 A;  1PPJ H;  3BFR A;  2N74 A;  1N0J A;  4QNH B;  5K1X A;  1H2G A;  1JPX A;  3MD0 A;  3UO3 A;  1VF6 A;  3T1H O;  1W59 A;  4PV1 B;  1EFR G;  4HNA A;  2YEV A;  1LUW A;  3LNN A;  3SJQ C;  3JD1 A;  3H1L H;  3RYI A;  4QGP A;  3A0H Z;  5H6Q A;  3EFF K;  1FYJ A;  3FX7 A;  4GKK O;  3G6E V;  1PM9 A;  4DUY B;  4J80 A;  1COW G;  1YF2 A;  1EN6 A;  4TV8 B;  4MVZ A;  1N34 O;  3TK1 A;  1B04 A;  1BMF G;  3THO A;  1WP7 A;  4DR1 B;  3D3I A;  3ZIA G;  2JS3 A;  2PTM A;  1K5S A;  3FFQ A;  4DV7 B;  3FB6 C;  4LF8 B;  3FAV B;  5KLV H;  3RN4 A;  1I94 B;  4X1Y A;  5BXZ A;  4AHC A;  4RWU A;  2QTS A;  4DW0 A;  2IU3 A;  4JI7 B;  3UO2 A;  5L3C A;  5CN0 A;  3K9S A;  2EIN B;  1FXH A;  1VF7 A;  3CWB H;  4JAV A;  3E86 A;  1OCR C;  1AR1 B;  2O57 A;  5EYP A;  3K06 A;  3SDL A;  1Q90 D;  2QWQ B;  1J5E O;  1DLB A;  2DQ3 A;  2F23 A;  4JI6 B;  5KHH A;  1KMI Z;  2OWO A;  3JD4 A;  2ADP A;  4PA6 A;  1F51 A;  2BTQ B;  5E79 Z;  2XAH A;  3T1C A;  3ZRV A;  1SZT A;  3AG4 B;  3J80 N;  1YDX A;  2JDI G;  1M90 W;  2PF4 E;  2X6A A;  1TUE B;  4DXW A;  4WBN B;  1HNW B;  2V1D A;  5LMN B;  2CK3 G;  1JMK C;  1XRE A;  5LGT A;  2QA4 V;  1Y66 A;  2E76 B;  3BVO A;  4X65 O;  3LSU A;  3RYF B;  1S5J A;  5KUK A;  3IC9 A;  2ITD C;  4NTX A;  3HKE B;  2YIC A;  1M4U A;  3AG1 B;  1BZK A;  3APO A;  1WA8 B;  2JVD A;  2QWP B;  3W7U A;  3X2Q C;  1GO3 F;  2IBZ H;  3K5O A;  4NR1 A;  3UKM A;  2HLD G;  1DGS A;  2UUB O;  5DED A;  4NTW A;  3BY6 A;  4F6R B;  2ZE6 A;  2ZE7 A;  3TXS A;  1HWY A;  2ZR3 A;  4AIL C;  2ZKO A;  5E1A C;  5B3S C;  1PP9 H;  2R9R B;  1VQK V;  3LDE A;  3CME V;  3OM3 B;  4IYH A;  3E8B A;  3CP1 A;  1DF4 A;  4O4J A;  4QIW F;  5JWP A;  5L3F A;  2XAJ A;  5BY1 A;  3ZRW B;  1WPX A;  2UU9 B;  3P30 A;  2EZO A;  1S76 D;  1W0J G;  1P4R A;  4PA7 A;  3SR2 C;  2CH7 A;  2QWO B;  1IBK B;  4JI4 B;  1QNM A;  1S5L Z;  5KMG A;  4W4L A;  4FIP C;  4JYA O;  4RUF A;  2E74 B;  3RW0 A;  2UXD O;  4GYC B;  1VQ7 V;  1L0L H;  3E8G A;  2HJF C;  4QJF B;  4ZKI A;  3D36 C;  1BS3 A;  1M57 C;  1GM8 A;  4I55 A;  4CH6 A;  4LF5 B;  4O4H B;  4DK0 A;  1HNZ O;  1I5Y A;  1KP3 A;  5BZB A;  2IH3 C;  1L0N H;  3ABU A;  1M9N A;  3R65 A;  2OT5 A;  1SF9 A;  4X66 O;  3K5L A;  2QDO A;  3G6B A;  4P9P A;  3N2G A;  4ZOL B;  4X9Q A;  3P3N A;  4BIU A;  2CAZ C;  3H1J H;  5IJ9 B;  2UUA B;  5D5Q A;  2WLL B;  2LFS A;  1EN4 A;  2XUM A;  4DR2 O;  3B77 A;  1WB7 A;  3AG2 C;  3RBZ A;  3LDD A;  1V54 C;  3OMA B;  2IJJ A;  4JI8 B;  4I9W A;  2A06 H;  2GUZ A;  1F4M A;  3UM7 A;  3QNE A;  3JCZ A;  3OTO B;  4PI2 A;  1S5H C;  2PYJ A;  4KUM A;  4MT8 A;  3W7X A;  2ODM A;  4NTY A;  1MZF A;  2IW5 A;  2CE4 A;  1Q6H A;  2IH1 C;  4YY3 B;  3RFR A;  5B1N A;  3CPW U;  3A8T A;  1YIJ V;  5EZY B;  3WU2 Z;  4LF6 B;  3VQY A;  1F4N A;  4IL6 Z;  1THZ A;  4R8C A;  1SQF A;  1GM7 A;  1ZL8 B;  5IT9 N;  4X1K A;  3SPC A;  4LCU C;  4DV3 B;  3EXA A;  3L70 H;  1EBO A;  1R3I C;  3ZMV A;  2BSK A;  4IHJ B;  2CTQ A;  4ABM A;  4CC5 A;  1EM1 A;  3ABT A;  4LNU B;  4XDJ A;  3RYH A;  4EB6 B;  3H01 A;  4PA9 A;  4WFH A;  4YHH B;  1QLE C;  3MHS C;  3K0D A;  3JSL A;  2L6L A;  2RCV A;  3SJA C;  1K7D A;  1X4T A;  4CS2 A;  3LNM B;  3CX5 F;  1FXV A;  4NB5 A;  1P7B A;  3S3X A;  1K34 A;  5CB4 B;  2CDY A;  2HHH O;  2CGN A;  2FKX A;  2WLI A;  2F93 B;  4DV5 O;  2GTA A;  1Y74 A;  1VF5 B;  5EBM C;  2HG5 C;  5EK0 A;  4JI1 O;  4B3M O;  5EC1 C;  1AR5 A;  4DUZ O;  3T4Z A;  1YEW A;  2Q0O C;  3F7V C;  2BOB C;  1OCC C;  2BTO A;  3IJ4 A;  3RYC A;  1WP8 A;  1UPG A;  1I7F A;  5CBG A;  1H2N A;  1OZ0 A;  2RQ6 A;  1M56 B;  4DV6 O;  2ZD9 A;  3T1H B;  2B1G A;  1YJN V;  3KCY A;  2UXB B;  2BOC C;  2JS5 A;  3SGI A;  4GKK B;  3ML0 A;  5C8Y A;  1FFX A;  1H38 A;  4H13 B;  4RUE A;  2ZXW C;  5IY5 C;  4YIO A;  3JAT A;  1XMQ O;  4FFK A;  5K1P A;  1NU1 H;  1XBL A;  1N34 B;  2E75 B;  4TWK A;  2JGD A;  1PD3 A;  4FJC C;  3HB3 B;  3L71 H;  1SA0 A;  1FXK A;  4MS2 A;  5HFM A;  3U10 A;  2R9I A;  2Q4P A;  3J7A U;  1WLE A;  2VRZ A;  2QWN B;  1BGY H;  4O4I A;  4DV0 B;  3ASO B;  3ZHT A;  3LDC A;  2X6C A;  2EZP A;  2GSM B;  1KKD A;  5CA3 A;  1IXM A;  4ZHQ B;  1TVK B;  4DRX A;  2ZIM A;  1J5E B;  3OD4 A;  5LP6 C;  3AG7 A;  3R66 A;  1FKA O;  1IXB A;  5IYC O;  4UCU A;  2PI4 A;  5H2F Z;  1VQL V;  4PA3 A;  2P4V A;  3K0G A;  5KHJ A;  4O2A B;  5KHK A;  4DK1 A;  1QHT A;  4ZBM A;  4X64 O;  4UVA A;  1TUB A;  2P06 A;  4NKG B;  1VIB A;  4QPJ A;  2D3O W;  4I9Q A;  2DWE C;  2IJK A;  2EJR A;  2OTJ V;  1MNG A;  5LHH A;  4QE9 A;  1Q82 W;  1NTK H;  4HBN A;  4MTX A;  4D7S A;  1B3Q A;  3ZRS A;  4Z2W A;  4X62 O;  4X65 B;  4U3J A;  4DR4 B;  4PJ0 Z;  1P7G A;  4DR6 O;  1YJW V;  4MVR A;  3DTU B;  4B08 A;  1WNS A;  2OYQ A;  4LH7 A;  4IIJ B;  5KX5 A;  5EC2 C;  4FZ0 A;  2C2A A;  2YEV B;  2P7T C;  2UUB B;  1S77 D;  3RYI B;  2QM8 A;  2ITC C;  4NXM O;  4LR3 A;  1VQ8 V;  1JJO A;  3WFV A;  1XMO B;  1B06 A;  4BAY A;  2XAS A;  2X0L A;  1N33 O;  3DGE A;  4UXN A;  2CTP A;  4CBC A;  2IU0 A;  1EZJ A;  4I4T B;  3ASN B;  1T5E A;  1CXZ B;  1U97 A;  1AI7 A;  1BHA A;  3E2E A;  1KKC A;  3ZHR A;  1I5X A;  4MVM A;  2XAQ A;  4FFB A;  2ADQ B;  2LW1 A;  3F5W C;  3HKD A;  4JYA B;  1NTM H;  3Q4H B;  3JAS A;  2UXD B;  2HJD A;  4MVU A;  4TT3 G;  5EIB D;  4FZ1 A;  3BAB A;  4FM1 A;  1HNZ B;  3H1K H;  3OR7 C;  1VQ9 V;  5CA1 A;  5KUM A;  3K5M A;  4X66 B;  4WCE V;  3QG5 A;  3VQX A;  4XBF A;  1SQX H;  2HR3 A;  3K57 A;  1AJQ A;  3C3T A;  4WFE A;  1BSM A;  3ZBH A;  1Y76 A;  3VQV A;  2FTK A;  4G2K A;  3CCS V;  4DR2 B;  5KAI Z;  1WAZ A;  5ITZ B;  2JJ1 G;  2GDS A;  3P32 A;  1AIL A;  2CGO A;  2W0F C;  4HAM A;  4J9Z B;  1OCO C;  1NH2 B;  1OCZ B;  1BQ0 A;  2YSU B;  2EIL C;  2DYR C;  1URF A;  3K3W A;  3JAW B;  3ZMS A;  1G4Y B;  4R6Z A;  1YTF B;  1SKV A;  1CEZ A;  1V9P A;  2YIB D;  2WLK A;  3APQ A;  2AZ0 A;  1XI1 A;  1K3E A;  4KHP O;  3OEH G;  4L87 A;  1KUQ A;  1KC8 W;  3ZMZ A;  5FL7 G;  5B1B B;  4I50 B;  2A79 B;  2OIE A;  1J95 A;  3ABK B;  2X7R B;  3WB0 A;  1R3L C;  4J7J A;  2Y69 C;  5B1A C;  3UT5 A;  2Q0A A;  3F7Y C;  2ZM6 O;  4O4J B;  2DWD C;  2EIJ B;  3DXR A;  4JI2 B;  4D7T A;  5CMU A;  3EVK A;  3LUT B;  3M99 B;  1ZWI C;  2RJZ A;  5IYZ A;  4C7U A;  3SPI A;  1FPO A;  2JIZ G;  3JAK B;  4UV8 A;  3KCX A;  1XNR O;  3I55 V;  2R72 A;  5J2T A;  2WLM A;  1ZAU A;  3SYA A;  1Q7Y W;  4B3T O;  4JF3 A;  3N2K B;  4J11 A;  3STZ C;  3HKC B;  2QKC A;  2DW4 A;  1WJZ A;  5KMG B;  1BL8 A;  5LP6 A;  5IWA B;  2LGW A;  3O65 A;  5GON A;  1PKX A;  1UJW B;  1F23 A;  2HHH B;  4J42 A;  2ZT9 B;  3E22 A;  2WA3 A;  4NXN O;  4O4L A;  1PNK A;  3UQ8 A;  1VMG A;  1KB9 F;  1NH2 D;  4K0K O;  4F6E A;  4DV5 B;  2XAF A;  3I5D A;  1NT2 B;  3RVZ A;  1JJ2 U;  1V55 B;  3DSQ A;  2M6Y A;  1H8E G;  4B3M B;  3N2G B;  2QKS A;  4I7Z B;  3WG7 C;  4DUZ B;  1ORQ C;  5TIS Z;  4YJ3 A;  1YTF D;  2P5O A;  1JQ0 A;  5JH7 A;  2UUC O;  1WB8 A;  2LW7 A;  4DO2 A;  2V4D A;  4RQE A;  4BIZ A;  2WWW A;  3GWK C;  4J10 A;  2QKA A;  5BMV B;  3E89 A;  4DV6 B;  4LF7 O;  2QEX V;  3RVY A;  2GUZ B;  2FML A;  3SYQ A;  4K8Z A;  4K3A A;  4X20 A;  1IBM O;  2NR5 A;  2Z5U A;  1FAF A;  1GN2 A;  2F43 G;  4K8X A;  2PYL A;  2ZE8 A;  2RDC A;  4IGG A;  1XMQ B;  1AI4 A;  2DYS C;  3CXC U;  2AHY A;  4JAU A;  1K92 A;  1Z5W A;  4I0X B;  3B8M A;  2PY5 A;  2H3O A;  5JVD A;  1HNX O;  2H8P C;  3U0Z A;  1FD9 A;  4BW9 A;  1RPR A;  4JGS A;  1M1K W;  4TV8 A;  3RT3 C;  1M5I A;  4DR3 O;  5LOV B;  3B8N A;  4BIO A;  1FXK C;  4WFG A;  1XDC A;  1XHZ A;  2W6J G;  1O9G A;  1FFT B;  3K79 A;  3JAM N;  3FAV A;  5L3E A;  4JTD B;  4WFA V;  2ATK C;  4LWS A;  2IJI A;  2E5L O;  2N04 A;  3LSS A;  3P3P A;  3OUF A;  3H9V A;  5JQG B;  3CRM A;  5DM6 V;  5LA6 B;  1N32 O;  1NTZ H;  2BE3 A;  3O9O A;  5LYJ B;  1D2D A;  3W7W A;  2H94 A;  3L9D A;  4X64 B;  3CS5 A;  1GMG A;  4KL1 A;  4PDV A;  2WLI B;  1LUV A;  1DF5 A;  3QVN A;  4JTC B;  3OAA G;  1Q86 W;  2XHB A;  2Y4T A;  4RQF A;  1Y74 B;  5B66 Z;  5B5E Z;  1Y67 A;  4X1I B;  3ETG A;  1VP7 A;  3IFX A;  3K08 A;  2LQT A;  4OPA A;  1K5Q A;  4X62 B;  4XDL A;  1K73 W;  1KD1 W;  3WB1 A;  4R50 A;  2X6B A;  4UFZ A;  4B3R O;  2AW9 A;  2P90 A;  3JAR B;  1I08 A;  3OGI B;  1NZ6 A;  4DR6 B;  4JV5 O;  4WBN A;  1W2B U;  2Z0A A;  5KA6 A;  5IJ0 B;  1O9H A;  3MAQ A;  3CYO A;  1XHX A;  1JR9 A;  2GBO A;  1H2M A;  3X2Q B;  4IT5 A;  2LGQ A;  3ICX A;  1SER A;  3AK1 A;  5C8Y B;  1ZTE A;  3HKE A;  1FFX B;  1LR1 A;  2KG7 B;  3L75 H;  5B3S B;  1WA8 A;  1N33 B;  4AI8 A;  3B09 A;  2QJ1 A;  2YUA A;  5IYD O;  3ABM C;  2Z3Y A;  3ETE A;  4F6R A;  2AXT Z;  3CJH A;  4MTO A;  4LP8 A;  4W4K A;  5LHI A;  1U96 A;  5B1O A;  2ZIN A;  1AI6 A;  2EX3 A;  1S0V A;  4TUY B;  1Z5V A;  3E8H A;  5J2U B;  3AK3 A;  1E1R G;  4O4I B;  2MK3 A;  1BHB A;  1CP9 A;  2HVJ C;  1QQC A;  4UV9 A;  3G80 A;  3HKB B;  3E35 A;  1QLN A;  1VQM V;  1LNQ A;  1IVS A;  4FLW A;  1M57 B;  3W7S A;  2EIM B;  3E8F A;  1NR1 A;  4KFM A;  3OW2 U;  4FM0 A;  4R7C A;  3CCE V;  4B7K A;  2JEX A;  3KZI Z;  4CH3 A;  3K9A A;  2F4V O;  2LO1 A;  4J41 A;  2LP7 A;  3MHH C;  2QM4 A;  1QBZ A;  1IDS A;  1TUB B;  4O4H A;  3CCM V;  2Q7H A;  5GTH Z;  3CXH F;  4TV9 B;  1HDJ A;  4P9O A;  1S3J A;  2Q73 A;  1NI8 A;  3ETD A;  5CBF A;  4O2B A;  4H33 A;  4GX1 A;  3CHX A;  2HKO A;  3J81 N;  1GAX A;  3AG2 B;  2DQ0 A;  1V54 B;  2XND G;  4ZOL A;  2ZE5 A;  5IJ9 A;  2WLL A;  1GRJ A;  3E83 A;  1JX9 A;  1P84 F;  5LGU A;  3LSQ A;  1Q5O A;  2WSS G;  3SYO A;  4J7Z A;  4KXR A;  3JAL A;  4IYI A;  5LXT B;  4MW3 A;  4FPP A;  3QTC A;  2E3C A;  1PL4 A;  4KHP B;  4JYY A;  1SS3 A;  2WAM A;  1RSO A;  4J7K A;  3K04 A;  3ZHQ A;  5CA0 B;  2B9Z A;  3AG3 C;  3AEI A;  4UCS A;  1YI2 V;  2ARH A;  5JCO C;  1AVM A;  4LBE C;  1SQP H;  2HEP A;  5EZY A;  3TGU H;  2ZM6 B;  4FMT A;  1RM1 B;  2W0X A;  2VS0 A;  3CCL V;  1ZL8 A;  2OCC B;  3PN1 A;  1E1Q G;  1Y6X A;  1XNR B;  1Q43 A;  5LBQ A;  1QLE B;  1BT8 A;  1R3K C;  4PEL A;  4RAI A;  1K8A W;  4UVC A;  1FS0 G;  1QCE A;  4B3T B;  4IHJ A;  3RGB A;  4WF9 V;  4EFB A;  4EB6 A;  4D6T H;  3HKD B;  2YXH A;  5LL6 Y;  3JAS B;  4UCT A;  2CUG A;  5EBW C;  2UU9 O;  3T1Y O;  3H1I H;  1H2K A;  2RNB A;  3NR7 A;  3C90 A;  1SQB H;  3ABL C;  4NXN B;  4YXW G;  1PNL A;  5D5P A;  1K97 A;  4UCR A;  1N8R W;  4X89 A;  4K0K B;  3BHP A;  2F66 C;  3OE7 G;  3OMN B;  3HPL C;  4I5S A;  2JK5 C;  5IE9 A;  2QSA A;  4CH5 A;  4EEQ A;  4A5U B;  1JFF B;  2Y48 A;  4YIP A;  4BWA A;  3HR0 A;  2WLH A;  2UUC B;  1G6U A;  4YJ2 A;  2OIG A;  4QE7 A;  3ZMT A;  3STL C;  1XL6 A;  1OCC B;  1NBM G;  4LF7 B;  1NQT A;  1GK9 A;  4JI5 O;  1EN5 A;  4JI0 O;  4UCO A;  4H0L B;  2JEU A;  4TQF A;  3TET A;  1AP6 A;  4GX2 A;  1IBM B;  2ILM A;  2YDE A;  3L73 H;  4OPH A;  3CCU V;  2YI9 A;  4HNA B;  3H1H H;  2VQF O;  3U11 A;  4CC6 A;  1ARO P;  5DEC A;  2ZXW B;  5IY5 B;  2K1E A;  1R6K A;  2YXY A;  3SJB C;  4LH6 A;  1AR4 A;  1KP2 A;  5F2V O;  2YI8 A;  3ZCC A;  5L3B A;  1HNX B;  3GWO A;  4BR6 A;  1P49 A;  2G38 A;  2EIK B;  3OTF A;  4YY3 O;  4DR3 B;  3MDS A;  1E79 G;  1XIL A;  3G71 V;  3DC6 A;  4DW1 A;  2BCC H;  2JRI A;  1F7Y A;  4X1Y B;  2PGG A;  4UCV A;  4CS4 A;  5BR8 O;  2B5U A;  2PI5 A;  1QVG U;  5IDJ A;  1S72 V;  2E5L B;  1AI5 A;  5C93 A;  4LF9 O;  1AB3 A;  5J2T B;  2EIJ C;  1FJG O;  1OJH A;  1Q6I A;  5A2Q N;  1NKD A;  4ICG A;  3CC7 V;  4DR7 O;  1MSW D;  2NN4 A;  5EYP B;  4FLY A;  5LP6 B;  3CB2 A;  4JZ2 A;  4ZHQ A;  1TVK A;  1WN7 A;  5FLX N;  2EIN C;  2P22 C;  1HR0 O;  1D5N A;  1WPB A;  1YXB A;  1QR8 A;  2NNU A;  3ZHU A;  5IYB O;  1XQ8 A;  1SET A;  3FYE B;  1XUQ A;  4N23 A;  2Q6A A;  1VQ5 V;  4YJ3 B;  1VQ4 V;  1ZUQ A;  4B3R B;  4MTF A;  3FYI B;  4FK5 C;  1ROP A;  3AG4 C;  2UXX A;  3BRC A;  4CZZ A;  4LFC O;  4ZI7 A;  2WLJ A;  2YXL A;  4JV5 B;  1JOY A;  4LF4 O;  2Y0P A;  4GZR B;  4LFB O;  1US6 A;  4E4E A;  1KYO F;  1R1B A;  2XTA A;  2EUL A;  2GHY A;  4OX9 O;  4JAA A;  5HFL A;  4PA4 A;  5GW7 A;  2R9A A;  2EJ7 A;  2CTR A;  4IIJ A;  5H5N A;  4LFA O;  5JCO A;  4FLU A;  3AG1 C;  3OT7 A;  1MZE A;  4B7E A;  1B6Q A;  2M7W A;  1YCI A;  4PHZ A;  2UXB O;  3K5N A;  2N05 A;  1XNQ O;  2ZQM A;  5JVD B;  5A9G A;  1SQV H;  1KQS U;  4P2Z A;  4MSW C;  1ZLZ A;  2YC0 A;  1IBL O;  2LFR A;  1R6N A;  2YIB A;  1TGO A;  4I4T A;  2ZCE A;  1SRY A;  3A0R A;  2CH7 B;  3ZED A;  4LWS B;  2P67 A;  3FB7 C;  4PD4 F;  4DV4 O;  3BCC H;  3Q4H A;  2ZR2 A;  4DV0 O;  5L3D A;  1RP3 B;  2UXC O;  4I55 B;  3KKY A;  2KKW A;  2XAG A;  4RO2 A;  3OGC C;  2XT9 A;  3SPG A;  2F4V B;  2JJ2 G;  5KHG A;  1QR9 A;  3QO7 A;  4JI1 B;  2LJ2 A;  4X8A A;  4ZIB A;  1HP8 A;  5FNV A;  4DV1 O;  3B4S A;  3SYP A;  4FLX A;  3ZHS A;  1H2L A;  3G67 A;  1YVW A;  4DV2 O;  1VQ6 V;  3QO8 A;  1OCO B;  2DMX A;  2P4K A;  3FB8 C;  3L72 H;  1JA8 A;  1MMM A;  4Z1V A;  5ITZ A;  2GTS A;  1ENV A;  3CRA A;  4BW5 A;  2OTL V;  2EIL B;  4XDK A;  2QM7 A;  1K4D C;  3GVM A;  2DYR B;  4UUJ C;  3FD9 A;  3A0B Z;  5GTI Z;  3OEE G;  3F5T A;  4FLV A;  4AQY O;  1ZX3 A;  2B1I A;  3ETQ A;  3SYC A;  4GX0 A;  1SC5 B;  2VWJ A;  2Q5Z A;  1BE3 H;  3S3W A;  2AZ2 A;  4DR4 O;  3JAW A;  4TOI A;  2DJV A;  1AP5 A;  1MG1 A;  2JGU A;  4DR5 O;  1EZV H;  2Q69 A;  4X1K B;  2Y69 B;  3SPH A;  5B1A B;  3ZMU A;  5LMU O;  1Q3E A;  4U3F H;  3BEH A;  3CJH B;  4I50 A;  1UFI A;  2ETN A;  1ZSP A;  2ZNI A;  2BSK B;  4CH4 A;  3RYH B;  1MOF A;  1XMO O;  4TSF G;  2K9P A;  3CRC A;  2Q67 A;  3CE2 A;  3OR6 C;  3IGA C;  4DYL A;  1G8M A;  1YIT V;  5KHI A;  2VQE O;  1OCR B;  3T1Y B;  3JAK A;  4JPR A;  2KB1 A;  1QVF U;  4GX5 A;  4G28 B;  5KAF Z;  3N2K A;  4B3S O;  1PV0 A;  4GKJ O;  2HVK C;  3HKC A;  3VBB A;  3TXQ A;  3NXS A;  3T2M A;  4ASU G;  1KU9 A;  5EBL C; 
#chains in the Genus database with same CATH homology
 3E83 A;  2EBO A;  1VQ8 V;  4G27 B;  1JX9 A;  3WFV A;  2EIM C;  5LGU A;  3LSQ A;  4BAY A;  2XAS A;  3WG7 B;  2X0L A;  2IU3 A;  2WPD G;  2WSS G;  4PDL A;  3DGE A;  3SYO A;  4UXN A;  1H8H G;  5L3C A;  1K9M W;  5CN0 A;  2EIN B;  4MW3 A;  4CBC A;  1FXH A;  1NJI W;  2IU0 A;  1EZJ A;  4FPP A;  4JAV A;  3E86 A;  3ASN B;  3CCR V;  1OCR C;  1AI7 A;  1AR1 B;  4HYO A;  3K06 A;  1BHA A;  3E2E A;  2WAM A;  4P30 A;  1CPY A;  1I5X A;  4MVM A;  3K04 A;  1DLB A;  2XAQ A;  2DQ3 A;  4X88 A;  3AG3 C;  1YHQ V;  3AEI A;  1YI2 V;  4JYC A;  1RPO A;  3F5W C;  4LBE C;  3JD4 A;  3JYC A;  4FMT A;  4QPK A;  4PA6 A;  3ZRX A;  4GCZ A;  1F51 A;  1RM1 B;  1KEC A;  1M56 C;  2XAH A;  3T1C A;  4MVU A;  3ZRV A;  1SZT A;  3CCL V;  3AG4 B;  2JDI G;  2DYS B;  4TT3 G;  2OCC B;  1M90 W;  1E1Q G;  2X6A A;  5LBQ A;  1QLE B;  1TUE B;  1R3K C;  4PEL A;  4RAI A;  4DXW A;  4UVC A;  3OR7 C;  3SPJ A;  1K8A W;  1VQ9 V;  2V1D A;  1FS0 G;  1QCE A;  5KUM A;  4WF9 V;  3CCQ V;  1K33 A;  4WCE V;  2CK3 G;  3T4D A;  4XBF A;  5LGT A;  2HR3 A;  2QA4 V;  1Y66 A;  4MW8 A;  1AJQ A;  4WFE A;  5KUK A;  5EBW C;  1FXK B;  2FTK A;  4G2K A;  2ITD C;  3CCS V;  4F4L A;  3ABL C;  2JJ1 G;  4YXW G;  1PNL A;  3P32 A;  5LHG A;  3AG1 B;  2W0F C;  1K97 A;  2P6J A;  1N8R W;  4HAM A;  4N21 A;  4X89 A;  3W7U A;  3X2Q C;  1GTO A;  1GO3 F;  4Z1M G;  3ZRW A;  3OE7 G;  3UKM A;  3OMN B;  4J9Z B;  2HLD G;  1OCO C;  3HPL C;  1JVM A;  1RM1 C;  1NH2 B;  1NR7 A;  4I5S A;  1OCZ B;  2JK5 C;  3BY6 A;  1HWY A;  2ZR3 A;  4U7O A;  2YSU B;  2OCC C;  2EIL C;  5E1A C;  5B3S C;  2Y48 A;  2DYR C;  2R9R B;  3K3W A;  1VQK V;  3LDE A;  3ASO C;  2WLH A;  1L1F A;  3ZMS A;  3CME V;  3OM3 B;  1G4Y B;  4R6Z A;  1YTF B;  3E8B A;  1CEZ A;  3CP1 A;  4QE7 A;  3ZMT A;  4PDR A;  1DF4 A;  4QIW F;  3STL C;  1PL0 A;  1W0K G;  1K4C C;  1XL6 A;  2WLK A;  1OCC B;  1NBM G;  4JAS A;  5L3F A;  1NQT A;  1GK9 A;  2XAJ A;  3ZRW B;  1K3E A;  4WFF A;  1WPX A;  2JEU A;  3P30 A;  3OEH G;  4L87 A;  3TET A;  1KC8 W;  1XL4 A;  3ZMZ A;  1GKF A;  2EZO A;  5KA5 A;  5FL7 G;  4GX2 A;  5B1B B;  1S76 D;  4H37 A;  2A79 B;  3CCJ V;  1J95 A;  3ABK B;  5J9P C;  1W0J G;  2X7R B;  1P4R A;  3CCU V;  4PA7 A;  1NVP B;  1R3L C;  2Y69 C;  3TCU A;  5B1A C;  3F7Y C;  3ZN0 A;  4FIP C;  4RUF A;  2ZDI C;  3OMI B;  3VOU A;  1ARO P;  3RW0 A;  1VQ7 V;  2DWD C;  2EIJ B;  2ZXW B;  1Y4M A;  5IY5 B;  2NLJ C;  3E8G A;  5CMU A;  2K1E A;  5H9C A;  2HJF C;  1R6K A;  1ZWI C;  2W6I G;  3LUT B;  3M99 B;  4QJF B;  4ZKI A;  1M57 C;  1GM8 A;  1KP2 A;  3SPI A;  2JIZ G;  3ZCC A;  3CCV V;  4UV8 A;  5L3B A;  1I5Y A;  1KP3 A;  3GWO A;  3I55 V;  5BZB A;  2WLM A;  2IH3 C;  3ABU A;  3SYA A;  1Q7Y W;  1M9N A;  4JF3 A;  3R65 A;  2OT5 A;  2EIK B;  3STZ C;  1E79 G;  4P9P A;  3G71 V;  2DW4 A;  1BL8 A;  4BIU A;  2WLL B;  2LFS A;  3ZJZ A;  1PKX A;  1UJW B;  1F23 A;  3B77 A;  2QE7 G;  2B5U A;  1PNK A;  2PI5 A;  3AG2 C;  3RBZ A;  1AJN A;  1V54 C;  3LDD A;  2QTO A;  3OMA B;  3ABM B;  3OUS A;  5IDJ A;  2IJJ A;  1NH2 D;  1S72 V;  1QVG U;  1AI5 A;  3I56 V;  5C93 A;  3CD6 V;  2XAF A;  4I9W A;  2EIJ C;  3EHB B;  3RVZ A;  1F4M A;  1NKD A;  3CC7 V;  1JJ2 U;  1V55 B;  2UXN A;  1VQP V;  1H8E G;  4LC1 A;  3UM7 A;  1MSW D;  5H6R A;  3QNE A;  3JCZ A;  5DN6 G;  2QKS A;  3WG7 C;  1S5H C;  3CC2 V;  1ORQ C;  4KUM A;  4MT8 A;  2WLN A;  1YTF D;  1JQ0 A;  3W7X A;  2EIN C;  4DO2 A;  2EIK C;  2IW5 A;  2IH1 C;  4RQE A;  4BIZ A;  3ASN C;  5B1N A;  3CPW U;  2WWW A;  1YIJ V;  1QR8 A;  3E89 A;  2NNU A;  5IYB O;  2QEX V;  3RVY A;  4HZ3 A;  4EKW A;  1F4N A;  1SET A;  3FYE B;  1THZ A;  4R8C A;  3SYQ A;  1JCH A;  1GM7 A;  3SPC A;  4LCU C;  4N23 A;  1NVP D;  2Z5U A;  2Q6A A;  1VQ5 V;  1GM9 A;  3IC7 A;  3K03 A;  2IJH A;  2F43 G;  1VQ4 V;  4MTF A;  3FYI B;  1MAB G;  1EBO A;  1R3I C;  3ZMV A;  4FK5 C;  1ROP A;  3AG4 C;  3ABT A;  1AI4 A;  2UXX A;  4XDJ A;  3D36 A;  4CZZ A;  3CMA V;  3CC4 V;  1YSC A;  2DYS C;  2WLJ A;  3CXC U;  1JOY A;  3KG2 A;  2AHY A;  3H01 A;  4J9Y B;  4JAU A;  4PA9 A;  1K92 A;  4WFH A;  1QLE C;  3MHS C;  4MVS A;  3K0D A;  3JD0 A;  3B8M A;  3FKS G;  2H8P C;  2HFE C;  4Q20 A;  1RPR A;  2GHY A;  4JGS A;  1M1K W;  1K7D A;  4MVQ A;  1OHH G;  3LNM B;  3B8N A;  1FXK C;  5HFL A;  4PA4 A;  5GW7 A;  4WFG A;  4E2L A;  5CBH A;  1FXV A;  4JYB A;  2W6J G;  1FFT B;  1P7B A;  1K34 A;  3AG1 C;  3K79 A;  4KP4 A;  3OFN G;  5L3E A;  1R3J C;  1B6Q A;  2M7W A;  4JTD B;  1PNM A;  2WLI A;  3GB7 C;  3QO5 A;  2ATK C;  2ZQM A;  4OXS A;  4WFA V;  2IJI A;  1OCZ C;  3FB5 C;  1KQS U;  4P2Z A;  4MSW C;  3LSS A;  3OUF A;  5EBM C;  2HG5 C;  5EK0 A;  5DM6 V;  4MTG A;  3PJS K;  4MVO A;  5EC1 C;  1AJP A;  2LFR A;  1R6N A;  3T4Z A;  3AG3 B;  3F7V C;  4JTA B;  3W7W A;  2H94 A;  2BOB C;  1SES A;  3G4S V;  1OCC C;  1DTO A;  1SRY A;  3A0R A;  1Q81 W;  1GMG A;  4PDV A;  5CBG A;  1OZ0 A;  2WLI B;  1DF5 A;  1M56 B;  4U7N A;  2P67 A;  4JTC B;  2ZD9 A;  5B1B C;  3FB7 C;  3OAA G;  4UVB A;  1Q86 W;  2B1G A;  1YJN V;  4RQF A;  3ABK C;  1VQO V;  3W7T A;  2ZR2 A;  3ETG A;  2BOC C;  5L3D A;  4WFB V;  3IFX A;  2XOK G;  3K08 A;  3ML0 A;  1K5Q A;  2XAG A;  4RO2 A;  1H38 A;  3OGC C;  4XDL A;  1K73 W;  1KD1 W;  4R50 A;  2X6B A;  1VQN V;  4RUE A;  3SPG A;  2P90 A;  2ZXW C;  5IY5 C;  2JJ2 G;  1QR9 A;  3QO7 A;  4X8A A;  4TWK A;  1W2B U;  2Q68 A;  3SYP A;  5KA6 A;  1R73 A;  4FJC C;  1PD3 A;  3ABL B;  3HB3 B;  3CYO A;  5LGN A;  3X2Q B;  1VQ6 V;  1FXK A;  3QO8 A;  1OCO B;  2A0L A;  3JD2 A;  1SER A;  4MS2 A;  3FB8 C;  5HFM A;  2R9I A;  1WLE A;  1ENV A;  4BW5 A;  2OTL V;  2EIL B;  4XDK A;  2V7Q G;  5B3S B;  2QM7 A;  1K4D C;  2DYR B;  4UUJ C;  3ASO B;  3LDC A;  3OEE G;  2X6C A;  5IYD O;  2EZP A;  2GSM B;  3ABM C;  2Z3Y A;  3ETE A;  1YJ9 V;  2B1I A;  1KKD A;  2ZDI A;  3SYC A;  5CA3 A;  1IXM A;  2AHZ A;  4MTO A;  4GX0 A;  1V55 C;  4PDM A;  4LP8 A;  5LHI A;  5B1O A;  3ZN1 A;  1AI6 A;  1MG1 A;  1S0V A;  3JD3 A;  5IYC O;  2PI4 A;  3E8H A;  5L3G A;  1VQL V;  2A9H A;  4PA3 A;  1E1R G;  4GT1 A;  2Q69 A;  2MK3 A;  1BHB A;  1CP9 A;  3K0G A;  2HVJ C;  2Y69 B;  4UV9 A;  3SPH A;  4ZBM A;  5B1A B;  4UVA A;  3ZMU A;  4QNH B;  1H2G A;  1JPX A;  3MD0 A;  3BEH A;  4QPJ A;  3E35 A;  1QLN A;  2D3O W;  2DWE C;  2IJK A;  1VQM V;  2EJR A;  2OTJ V;  1LNQ A;  1M57 B;  3W7S A;  1EFR G;  1MOF A;  2EIM B;  3E8F A;  5LHH A;  4QE9 A;  2YEV A;  4TSF G;  1NR1 A;  1Q82 W;  4KFM A;  3OW2 U;  3SJQ C;  3JD1 A;  4R7C A;  4MTX A;  2Q67 A;  3CCE V;  3OR6 C;  5H6Q A;  3ZRS A;  3EFF K;  3IGA C;  2JEX A;  1G8M A;  3G6E V;  1YIT V;  1COW G;  3K9A A;  1OCR B;  2LP7 A;  3MHH C;  4JPR A;  1QBZ A;  2KB1 A;  1QVF U;  4GX5 A;  1YJW V;  4G28 B;  4MVZ A;  3CCM V;  4MVR A;  3DTU B;  3TK1 A;  1BMF G;  4P9O A;  1S3J A;  3ETD A;  3D3I A;  5CBF A;  4H33 A;  3ZIA G;  2HVK C;  5EC2 C;  4GX1 A;  1K5S A;  2HKO A;  3VBB A;  3FB6 C;  2C2A A;  2YEV B;  2DQ0 A;  3AG2 B;  2P7T C;  1V54 B;  2XND G;  1S77 D;  2WLL A;  2QM8 A;  3NXS A;  2ITC C;  3T2M A;  4ASU G;  5EBL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...