4WFEA

Human traak k+ channel in a k+ bound conductive conformation
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
259
structure length
253
Chain Sequence
RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
total genus 97
structure length 253
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4wfeA00
2HVJC 5B3SC 4PA4A 3SYOA 2W0FC 4WFHA 4H33A 4X8AA 3PJSK 3RBZA 3EFFK 4EKWA 3E8FA 3F7VC 5CBFA 3AG2C 2EIKC 4MVZA 2IH3C 3SPCA 4RAIA 2WLLB 2Y69C 3ABLC 3K03A 4CBCA 2WLLA 3OGCC 5EK0A 2IH1C 1XL4A 2X6BA 1JVMA 3OUSA 2EINC 4PDRA 1V55C 3FB6C 3SPGA 5J9PC 1BL8A 3E8HA 4UUJC 2P7TC 2X6CA 2QTOA 3HPLC 2K1EA 2DWEC 4OXSA 4MVQA 3T2MA 3WG7C 3LDDA 4DXWA 4MTOA 3E83A 4J9YB 5EC1C 3E8GA 5KUKA 4MVOA 1XL6A 4H37A 3T1CA 5E1AC 3AG1C 3IGAC 4P9PA 3FB5C 3VOUA 4WFEA 4LP8A 3ABKC 4I9WA 5EBMC 3RVYA 3IFXA 4JTCB 3T4DA 4X89A 2R9RB 4R8CA 3K04A 3GB7C 3X2QC 4MW8A 4X88A 4G27B 1R3IC 3UM7A 2WLKA 4GX1A 5EC2C 2BOBC 5B1AC 3K06A 2WLMA 1V54C 3FB8C 4HZ3A 3UKMA 3SJQC 3LDEA 3ABMC 2BOCC 4LBEC 2NLJC 2WLIA 4WFGA 3TCUA 4QE9A 1M56C 3JYCA 4P9OA 3SPIA 5BZBA 4MVRA 4MW3A 2AHYA 2ZD9A 3R65A 4BW5A 3OUFA 1OCZC 1QLEC 4GX5A 3STLC 2A0LA 4JTAB 1K4CC 2HG5C 2EIMC 2EIJC 2WLHA 3AG3C 1KKDA 2ITDC 2EILC 2OCCC 3E86A 3F7YC 3STZC 3LNMB 3SYCA 3LDCA 2QKSA 3ZJZA 3K08A 4F4LA 1OCOC 4PA3A 4XDKA 5EBLC 4PA9A 3SPJA 3K0GA 3E89A 5KUMA 3LUTB 2DYRC 1ZWIC 3E8BA 1M57C 5CBGA 4JTDB 2ZXWC 2A9HA 1G4YB 1R3KC 2DWDC 1R3JC 2YEVA 4MVMA 4PDVA 4WFFA 4GX0A 4QE7A 4RUEA 2JK5C 2Q69A 2WLIB 2WLJA 3AG4C 4J9ZB 4PA6A 3ZRSA 4PDLA 3RVZA 3KG2A 4GX2A 2KB1A 2HVKC 4HYOA 4MTFA 4R6ZA 3RW0A 4MVSA 3TETA 1OCCC 2ATKC 5CBHA 4PDMA 4R50A 3ASOC 4R7CA 5IY5C 4PA7A 4MTGA 3BEHA 3ASNC 2DYSC 2HJFC 4ZBMA 5B1BC 2X6AA 2Q6AA 3F5WC 3SPHA 3SYPA 2H8PC 1R3LC 2Q67A 4MS2A 2ITCC 4MVUA 2HFEC 3SYQA 1OCRC 3OR6C 4P2ZA 3OR7C 4P30A 1LNQA 4RUFA 1ORQC 3K0DA 5EBWC 3SYAA 4KFMA 2WLNA 2AHZA 1J95A 2A79B 1P7BA 3T4ZA 2Q68A 4G28B 1K4DC 4XDJA 4LCUC 4XDLA 4QNHB 3FB7C 4MSWC 4TWKA 4RO2A 1S5HC
chains in the Genus database with same CATH superfamily
1GM8A 3BA9A 4PA4A 3SYOA 3EXAA 3G71V 3CC2V 3ZN1A 4WF9V 2EIKC 2WLLB 3ABLC 2JJ2G 2IH1C 1F4NA 3CCUV 2YIAA 2CGNA 1NR7A 4D7TA 3WG7C 4LF5O 3FAVA 3E83A 4DR1B 1Z2GA 1ZTEA 4TUYA 1XL6A 3CP1A 3IGAC 3CCJV 1AI5A 3D8CA 5L3GA 1W59A 3H9VA 3QO7A 3A0RA 4PD4F 4RQFA 3RYCA 3X2QC 3ICXA 5LP6B 1HR0B 2K9PA 4LF4B 5J2UA 3PN1A 1R6TA 4GKKB 3FB8C 2XAFA 4YJ2B 3AG2B 1WP7A 3AG7A 3BCCH 1K73W 3CCRV 1XHZA 1SQQH 2JJ1G 3IJ4A 5BZBA 3APQA 4DR5B 4NTXA 1K4CC 2CUGA 1AI6A 1Y74B 1Z5VA 1AP6A 2LQTA 3LNNA 1SF9A 1M4UA 1FFXA 4JYYA 3CMEV 1TUBA 4JI5B 1H2KA 1HW7A 4HNAB 1S72V 4O4LA 4YY3B 2YEVB 1URFA 4WFFA 2F4VO 1GK9A 4JV5B 3RW0A 5CBHA 3ZEDA 3BRCA 2EX3A 5KHGA 3CRAA 2DE0X 1M90W 3B77A 2VQFB 1BT8A 2E3CA 5KHIA 2UXCB 3RYFA 3G4SV 3QG5A 4P30A 3DC5A 4Q6GA 3CXCU 1CEZA 1ROPA 5J2TA 5BR8B 1XNQB 3JD4A 3ZHUA 2PY5A 4JGSA 2UUBO 4L87A 2ZXWB 2UXDB 2Y0PA 1YDXA 3B4SA 3EFFK 4FLTA 1KQSU 4PI2A 1GH6A 1JVMA 4DO2A 1M56B 3J81N 2IJJA 2FTKA 2YXYA 4DW0A 1HNZB 4QGPA 2Q73A 4LR3A 1VQ7V 2LW1A 3ZMVA 2BTOA 4D7SA 4FLWA 1XMOO 1E1RG 4B3SB 1MNGA 2CAZC 1KMIZ 3CB2A 4OPAA 1P49A 5IYCO 4QIWF 4GZRB 4J7ZA 5EC2C 3ABKB 4DV3B 4K3AA 2WLIA 3TCUA 4JI7B 2AGAA 3DXRB 2ZE8A 2KG7A 1KKDA 2BTQA 5AG2A 2OCHA 5CA1A 3SYCA 2BSKA 1K92A 2ZM6B 5LA6B 1AJPA 3T1YO 1AR4A 2RMKB 3H1IH 4BIOA 4FFKA 1L1FA 4LF5B 4PA9A 4I50A 1Q82W 3U11A 5HFLA 3HKEB 4GX0A 3BAAA 2Q69A 2N05A 1VQ8V 1I08A 1BGYH 5ITZA 4GX2A 4DV2O 2HVKC 1EN4A 4K35A 2QGNA 3I56V 4GKKO 2A3QA 4LFCO 1M9NA 2QWPB 2FL4A 3K5MA 2Q67A 4MS2A 2OWOA 1PNKA 4MVUA 1U96A 1Q90D 2ZKOA 1OCRC 4GT1A 3ZHTA 1K3EA 4JI0B 4FLUA 5DN6G 4QNHB 2UXBB 4I5SA 4UCVA 1E79G 4HAMA 3ZRWB 3E8FA 1GN6A 2VQEB 4JF3A 3ETGA 1XMQB 3OGCC 1XL4A 1Y66A 2DJVA 1VQ6V 2ZNIA 1GM9A 1NBMG 2ETNA 4NYKA 2P7TC 5E79Z 1FD9A 2HP8A 1I5YA 2CK3G 2PI5A 2QWOB 1ZAUA 3M8AA 5BMVA 3L75H 3U0ZA 4JAAA 4JI2O 4DV0O 4IHJA 1BHAA 2ADPA 2PTMA 5H6RA 2Y48A 3K79A 4CS3A 1NZ6A 3T1HO 2Y0IA 3CCMV 4QJFB 4YJ3B 1K34A 2BOBC 1VQPV 2RDCA 3SJQC 2BOCC 1SERA 2VS0A 4EB6B 4F6EA 2XT9A 1P84F 4GYCB 2QM7A 3STLC 1NTZH 1OV9A 2EIJC 5JCOA 4K8ZA 5EZYB 1TAEA 2LP7A 1G6UA 2UU9B 4UCRA 5GTIZ 2FMLA 1ZWIC 1KP3A 4IGGA 3S3WA 4E4EA 2ZQMA 4I4TA 4NVPA 1EFRG 5B1AB 1NH2B 5D5QA 4R7CA 4N23A 1OCRB 3BVOA 3DTUB 3JASA 1BMFG 1XOUA 5FL7G 4X20A 3OR6C 2ZE6A 4RUFA 4PJ0Z 2PGGA 2EJRA 5KHJA 4GLXA 4XDLA 4MSWC 2WAMA 1NI8A 4UVCA 1GTOA 1TVKA 3FYIB 4FZ1A 1ZX3A 1H2LA 1K9MW 5D5PA 1MA1A 3ETEA 2MK3A 3E8HA 3AEIA 4B3RO 4MTOA 3LSUA 2ZNJA 2ADQB 1S77D 3FB5C 1HR0O 1NR1A 3K57A 5EBMC 4DR4O 4FPPA 3T4DA 4Z2WA 1IDSA 5KX5A 2ZE7A 3S3XA 4FM2A 2EBOA 3IC9A 4GX1A 1EM1A 2QKCA 2AZ0A 3IAYA 3JATB 2EIJB 2IJIA 1N36B 2DN9A 1YEWA 3ABLB 1XMQO 2CE4A 1H2SB 3EVKA 1RFYA 4DV5O 3QO8A 4CH4A 2ITDC 5DM6V 4FM0A 4FIPC 1Y74A 4J7KA 3STZC 2QKSA 1Q5OA 1FXKA 4BIZA 5LXTA 4B3RB 4K8XA 4ZI7A 4MVMA 1WA8A 3LSQA 2XNDG 1NS1A 5LMUO 3W7WA 4CC5A 2GDSA 3X2QB 2VQFO 4JI3O 3ZIAG 5L3FA 2YXHA 1W0KG 5HFMA 5IDJA 3ZMSA 5B1BC 3ZHSA 2ITCC 4IYHA 1YXBA 4GCZA 1W0JG 2A7WA 2ZDIC 3HKBA 5LL6Y 1BZKA 2GHYA 4KFMA 1N36O 4I9QA 2QE7G 1P7BA 2Q68A 3BA8A 4YJ3A 4DUZB 4RO2A 3OTOB 3UCSC 1RSOB 2QA4V 5JJNB 2LFRA 4LNUA 4PV1B 4DR7B 3Q4HB 5CB4B 4FLVA 2QSAA 3AK1A 4OXSA 2XAHA 1JX9A 1YI2V 2Q9LA 4JZ2A 2CGOA 1K5SA 2E5LB 1XMOB 4MVOA 3K9AA 1FPOA 3APOA 1KBHA 4TQDA 3ML0A 3D36A 4WFEA 5LHGA 4IHJB 1N0NA 2JIZG 4KP4A 1KUQA 4O4JB 4YXWG 1CXZB 4U7OA 5JCOC 2M6YA 5B1BB 3JATA 3L70H 5IYBO 4B7EA 5IT9N 3OEEG 3ABMC 5GW7A 1RM1B 4JYAO 2GUZB 1M56C 2XHBA 4OX9O 2A0LA 2P22C 1Q81W 1Q3EA 2BSKB 5KAFZ 5LHHA 1A32A 4FZ0A 4YJ2A 1WPXA 2CTRA 1R3KC 1PL4A 2RNBA 4CH3A 2WLIB 4PA6A 4JI8O 2ZT9B 4PDLA 3RVZA 4NXMO 3A0HZ 3I55V 3ASOC 5GTHZ 2MW2B 4LF8O 1Q6HA 4O2AA 1OCCB 4U7NA 5JH7B 3SJBC 1PNMA 4X1IB 4ASUG 1HNWB 2GSMB 2F43G 1M93A 1AI7A 4UFZA 1DF4A 1HDJA 5L3CA 1JFFB 1YZBA 5EBWC 4DV1O 2WWWA 1XBLA 4ZOLA 4TUYB 5B66Z 5EIBD 2JEUA 3OTOO 3RBZA 3R66A 3DXRA 3OUSA 1VARA 5KAIZ 3SPGA 3HPLC 1Z5WA 1SQFA 3DC6A 4DK1A 2OCCB 4ICGA 1I94O 5EC1C 2DQ0A 3KZIZ 3OMIB 1FS0G 4AQYB 4X1IA 4JAVA 1XILA 5BMVB 5IE9A 2D2CB 3OAAG 3K04A 4O4IB 4O4HB 1E1QG 1K7DA 4BW9A 1DK1A 2CTQA 4FFBA 4HZ3A 3UKMA 2YS8A 2NLJC 4O2AB 2Q7EA 2HHHB 3SJCC 2B5UA 4JYBA 4GUNA 5KMGA 1MSDA 1FXHA 4JYAB 4HNAA 1I0HA 3MHSC 5H2FZ 3A2FA 2JRIA 2W6IG 2R9IA 4U3JB 4DR1O 2BCCH 3ZJZA 2XUMA 3MDSA 4ZKIA 5KHKA 1WNSA 1H38A 2WA4A 4NKGB 2YI8A 3BHPA 3TXSA 4JTDB 1I5XA 2N74A 2F1MA 4Z1MG 5LYJB 2Q7GA 3CX5F 1OCCC 3IC7A 4TV8A 1H2MA 3CJHB 3JASB 2DYSC 4ZBMA 4IT5A 3HKEA 4J7JA 2QR4A 2H8PC 5C8YA 1BSMA 4DR5O 2VRZA 1ZL8B 1AROP 4O4LB 5CA3A 1HNWO 2EZOA 5KA5A 2HHHO 2UUAO 4TWKA 5CN0A 4NXNB 4LFBB 4RQEA 2W0FC 3PJSK 2DYRB 5GONB 4RAIA 3CE2A 2F4VB 2XASA 1D5NA 1B6QA 2WLLA 1SQXH 4JI2B 4DV0B 2YUAA 3K5LA 1N8RW 2ODMA 1FJGO 2WPDG 4EEQA 1VQKV 2EINB 3ZHQA 2YICA 4D6TH 5K1PA 2CDYA 3L71H 4EFEA 2ZINA 4I9WA 1JQ0A 3F5TA 3K59A 2BTQB 2ZE5A 4EB6A 2DQ3A 2Q0AA 5LOVA 2QDOA 2UUBB 5IJ9A 3TK1A 3E22B 3VQXA 4X66B 3BPZA 4P9OA 1FFTB 1QCEA 4FLZA 2QWNB 2ARHA 5H6QA 3ZS8C 1F23A 1RPOA 2XAQA 1XDCA 1D2DA 5KUMA 4PHZA 2DYRC 2KSDA 2IJKA 1EBOA 1O9GA 5LXTB 3CCLV 3N2KB 5LYJA 4YHHB 2YSUB 2KB1A 5KA6A 1M57B 2R9AA 3CRCA 5IWAB 4B3TO 4TV8B 3ZRWA 1VF6C 4DV3O 4ABMA 2WA3A 1MOFA 2Z3YA 5K1XA 1R3LC 1ZL8A 4TQFA 5IY5B 1IBMB 1H2NA 1J95A 1NJIW 3ASNB 3T1YB 1N4CA 4IIJB 4LCUC 3SJAC 4WCEV 1YF2A 2N04A 2YIBA 3O65A 5FNVA 1JMKC 3N2KA 2NR5A 5LGNA 4FM1A 1JJ2U 4H0LB 1ZSPA 1KYOF 1YIJV 2QEXV 2DWEC 3MD0A 2Q5ZA 3ETDA 3UO3A 2F66C 1AVMA 1HWYA 1OHHG 3T1CA 1AR1B 4U3FH 3ABKC 4JI0O 1KKCA 3RWRD 2C2AA 3QTCA 1HP8A 4NB5A 2HJDA 3OW2U 4J11A 4ZI7B 4LH7A 3ZRXA 1NH2D 3ABTA 2V1DA 4X20B 3WB0A 4RWUA 1B06A 4X1YA 4JTAB 3G6EV 3CEIA 3JD1A 1FJGB 5EBLC 1S0VA 2FKXA 4FLXA 3AG1B 3CXHF 4DV7O 3KKYA 4QE7A 4AI8A 5LP6C 1ENVA 5FPOA 1Q6UA 1LR1A 4DUYB 4PA7A 4KHPO 3BEHA 4KUMA 1JCHA 2P90A 2XAGA 4DUZO 2OIEA 1P7GA 4X64B 3H1HH 1PM9A 1LNQA 3FX7A 2B1IA 4IYIA 4LH6A 2A79B 1OZ0A 5H5NA 5LGUA 2R70A 1FAFA 1R1BA 3FD9A 2HVJC 1IBLO 1KB9F 3ZMZA 2FB5A 5KLVH 1JA8A 4B3MB 4HBNA 2GUZA 5EK0A 1G8MA 1V55C 1ZLZA 1XI1A 3ZCCA 5EIBC 2PYJA 4AQYO 4X65B 3JCUZ 2V7QG 3WU2Z 4DXWA 4UCOA 2DMXA 2DW4A 2P4KA 4TSFG 2IM9A 2B1GA 2PF4E 3AG1C 1G1XB 3ZHRA 1THZA 1LUWA 3IFXA 3UT5B 2R9RB 2CH7B 5DEDA 1QVFU 5BXZA 4O4HA 4G27B 2EULA 1QLNA 1FFXB 3K06A 5LMNO 1WN7A 4FVMA 4UXNA 5JJEB 2H94A 4LNUB 4UV9A 3D36C 3SPIA 4UCTA 1VF5B 3OMAB 1BS3A 4B7KA 4B3MO 4LFAB 3OGIB 4O2BB 1YCIA 3SPJA 1XEQA 3LUTB 3JAWB 4JAUA 5LGTA 2F95B 4JI1B 4IL6Z 1MSWD 1VQMV 3RFRA 2GTAA 4DV7B 1WB7A 4YIPA 2VWJA 4X1KA 1YJWV 4ZOLB 5IYZA 4MVSA 2ATKC 3E35A 4R50A 3JCZA 5IY5C 3HKDB 4DUYO 2KQXA 3F5WC 2RJZA 5JH7A 3QVNA 4DV5B 1O9HA 1QR8A 3OE7G 4DK0A 2O57A 4X64O 3UQ8A 1JFFA 2WLNA 2CH7A 3T4ZA 1SQBH 2QWRB 3ZMUA 4NR1A 1IX9A 1KC8W 4WFHA 4TV9B 2Q0OC 2EJ7A 4JI4B 4CBCA 4LF6B 3D3QA 3VQVA 4LWSA 1Q7YW 3K5NA 5J9PC 1VQ4V 1OCZB 2Z0AA 3CCQV 3B09A 5J2TB 1US6A 5KUKA 3RYFB 1SA0A 3NXSA 1VQLV 1GKFA 4X89A 1VF7A 4CH6A 1KU9A 5JVDB 3L73H 4X88A 3J7AU 2F23A 5CA0B 5CA0A 4I0XB 2ZM6O 3KCYA 3EHBB 5LMNB 1Y67A 2EZPA 1AI4A 1RPRA 1TGOA 2IU3A 3QO5A 4FK5C 2ZD9A 4BW5A 1VP7A 4JI4O 1SQPH 2EIMC 2QJ1A 2EILC 2DOSA 2HKOA 3E86A 3K08A 1BQZA 4XDKA 1VQNV 1QLEB 1S3JA 2ZDIA 5CBGA 1D5AA 2ZXWC 3RYIB 1NTMH 3AG4C 3QF7A 3W7XA 1LUVA 3TETA 3J80N 4UV8A 4L8JA 5IJ9B 2JGUA 4FFBB 2Q7HA 1J5EO 2HJFC 2UUAB 1ZUQA 3SPHA 2E75B 3CRRA 2LGQA 3VQYA 3JSNA 1XNRB 4J42A 2FYUH 2LW7A 4X9QA 5TISZ 4DYLA 3WFVA 2GTSA 1PL0A 3M99B 1XUQA 2IW5A 3ETQA 4X8AA 1YTFD 1I7FA 3SPCA 2JS3A 1Q8IA 3K03A 4AHCA 3SDLA 3ZN0A 3RGBA 3AK2A 2EIMB 4LF6O 1BL8A 2X6CA 3CMAV 2P06A 4MVQA 4DR3O 3T2MA 1OCOB 3HKCB 1YJ9V 1L8DA 1FYJA 3CCVV 3A0BZ 4PI0A 3JAMN 2H3OA 4UVAA 2QTSA 4CS2A 1RM1C 1NKDA 3A8TA 3N27A 3WG7B 4X66O 3CC4V 4JI5O 3GB7C 1MG1A 2Q4PA 5LBQA 4YY3O 2XTAA 4BWAA 3SR2C 2E76B 4DR7O 4KL1A 1FKAO 1QHTA 3HR0A 1TVKB 4LBEC 4DW1A 3B40A 3CRQA 4W4KA 3JYCA 2GBOA 5KX5B 3THOA 1N0JA 1MABG 2HG5C 3ZMTA 2UXCO 3AG3C 4OGQB 4MTXA 3AG4B 4DR3B 1JR9A 1IBKO 5IWAO 1Q6IA 3ASOB 5FNVB 4B3TB 1XNQO 4K0KB 1AJNA 4DR2O 1VMGA 5BY1A 1Y4MA 5LP6A 1H2GA 2IJHA 4R6ZA 3G6BA 2RN9A 2P67A 5CA1B 1V54B 3TGUH 1YJNV 1QNMA 4DV6O 3FKSG 1KECA 2XAJA 5L3DA 3ZBHA 1NU1H 1V9PA 4GKJO 2OTJV 1HNZO 2AHZA 4O4IA 4I55B 4CH5A 2PUSA 2OTLV 4LF4O 1UJWB 2HR3A 4JZGA 4NXMB 3M7MX 1RP3B 1GM7A 4X62O 5KHHA 3E2EA 4DR4B 2EINC 4PDRA 1JOYA 3AG3B 5IJ0A 4J80A 4J9YB 2IU0A 3E22A 3E8GA 3L9DA 1CPYA 4DV1B 1R73A 3ABUA 3N2GB 2P5OA 3HKBB 3TXQA 5CMUA 2ZR3A 1YTFB 3JARA 4MW8A 3K9SA 5IYZB 3UM7A 1YHQV 2HEPA 1V54C 2A06H 4LFAO 2KKWA 4WFGA 3VBBA 3O9OA 1DLBA 1SC5B 3OUFA 3OM3B 1UFIA 2JGDA 1AB3A 2Y4TA 4JI1O 4F6RA 3LDCA 1Y6XA 2UXNA 1NVPD 2IBZH 1Y76B 2GV9A 1M57C 4J41A 4TT3G 2YEVA 3FFQA 3OT7A 1M5IA 4RUEA 1P4RA 1K5QA 2LFSA 2AXTZ 3RYHA 5IYDO 4HYOA 3P32A 1K33A 1IVSA 2Q6AA 1HNXO 3SYQA 3SGIA 3B8MA 5LMUB 4MT8A 1GN4A 1IURA 1S76D 1ORQC 2HLDG 2B9ZA 5LHIA 4N21A 4GKJB 4F6RB 4XDJA 3OEHG 4LF9B 3JD2A 4J10A 4NTYA 1F4MA 1S5HC 2PI4A 4G2KA 4H33A 5CBFA 3T1HB 1DGSA 4MVZA 2IH3C 1WAZA 1PPJH 4FLYA 4LWSB 3RYHB 4UUJC 2QM8A 1QU7A 1AILA 3C3TA 3HKCA 3JARB 3BFRA 2Y69B 1BCCH 1X4TA 3DSQA 1Y76A 4I50B 1N33B 3N2GA 1RSOA 3CWBH 4B08A 1IBMO 4JTCB 2JGDB 3CC7V 4E2LA 1KD1W 1WB8A 4X1KB 4ZIBA 2E5LO 3HKDA 2L35A 4BAYA 4I7ZB 4WFBV 1GO3F 2Z5UA 1TUEB 4LF7O 5IJ0B 1SKVA 1OCZC 4W4LA 4JI8B 1YITV 2ILMA 3JD3A 2QWQB 2OCCC 3FAVB 4OPHA 2R72A 2UXBO 3E89A 3ZHVA 2EIKB 4EFBA 1QR9A 2YIDA 2A9HA 5B5EZ 4O2BA 2UUCB 1R3JC 4H13B 2JK5C 4OX9B 4J9ZB 4MTFA 1N32O 4I0XA 3BABA 1SZXA 3CCSV 1BHBA 3LSSA 1S5JA 4ZHQB 3ASNC 3CJHA 5DECA 1IZ3A 3HB3B 3VQWA 3CCEV 4PELA 3U10A 1JJOA 1WP8A 5B1NA 1COWG 1NTKH 2CTPA 4DRXA 1EZVH 1VF6A 1Q86W 2EILB 3C3SA 3OTFA 3P3NA 4DR6B 1NQTA 2X7RB 3RN4A 4QPKA 2YI9A 3B8NA 4QPJA 4LF9O 1I94B 4JI6B 1VEWA 3AG2C 4DV4O 5L3BA 1QVGU 4JYCA 3ZRVA 2X6BA 5KMGB 3FB6C 1DTOA 1F7YA 4FJCC 2DYSB 1GMGA 4KXRA 3RYCB 5JWPA 5JVDA 1N32B 4H37A 1KP2A 1GN2A 2W0XA 1OJHA 1K97A 1U97A 3W7SA 2NNUA 4LP8A 1YVWA 1HNXB 4UCUA 3H1JH 1QQCA 4O4JA 3MAQA 4CS4A 2JEXA 3CRMA 1R3IC 1SRYA 3NR7A 3LDEA 4DR6O 3H1KH 2CTWA 5LA6A 4JI3B 4B3SO 4I4TB 4QE9A 5ITZB 1WLEA 4TOIA 2AHYA 2Q8VA 3R65A 2KG7B 2QM4A 2BE3A 3GWOA 1IBKB 2AW9A 4X1YB 3F7YC 3TJTA 4K0KO 3DGEA 1SQGA 1SETA 1OCOC 2JDIG 1H8HG 1SQVH 1FXKB 1XREA 4LC1A 2X0LA 4UB8Z 1W2BU 2V4DA 1SESA 4UVBA 2P6JA 3ZRSA 1F51A 2UUCO 3KG2A 1XNRO 5L3EA 4DV6B 3OD4A 3OMNB 4H44B 5EYPB 2RCVA 1PNLA 4FMTA 5FPRA 1VIBA 1PD3A 1K8AW 4NXNO 1R6NA 5C8YB 1N34O 4DV2B 1SS3A 2HFEC 5A2QN 4CC6A 4LF7B 3AK3A 4XBFA 2YDEA 4LFCB 1MZFA 1VQOV 1NT2B 3RT3C 5B3SC 1Q43A 3FYEB 5BR8O 5A9GA 1PV0A 2Y69C 1GN3A 2ZCEA 4Q20A 1BE3H 2OT5A 1JPXA 4IIJA 3P30A 2UXDO 2QTOA 4DRXB 1NVPB 2K1EA 4NTWA 2Y4UA 5JQGB 4LFBO 5F2VO 1FXKC 4P9PA 1SA0B 3JALA 3VOUA 5JJJB 3UT5A 3CYOA 3RVYA 3CSXA 3ZX6A 3KCXA 2ZIOA 1IBLB 3WB2A 1PP9H 2LJ2A 2F93B 1WJZA 3UO2A 2XOKG 2WLMA 3W7TA 5J2UB 1CP9A 2YXLA 3MHHC 3G67A 1AP5A 2P4VA 1X59A 2ZR2A 3JAKA 4BIUA 4JPRA 3K3WA 2PYLA 1MMMA 3BY6A 3Q4HA 1IXBA 5CB4A 4YHHO 4LF8B 1QLEC 1EZJA 2WLHA 4DR2B 4WBNA 4U3JA 4JI7O 5JQGA 1MZEA 4BR6A 4F4LA 1GAXA 4PA3A 5B3SB 3K0GA 2AZ2A 4TV9A 3E8BA 1S5LZ 3D3IA 4PDVA 4AILC 3K5OA 4CZZA 5EZYA 4YIOA 2WLJA 3JD0A 3GVMA 3B2EE 2OIGA 5EYPA 3CS5A 4MTGA 4Z1VA 2UXXA 1XQ8A 4P2ZA 1XHXA 1AJQA 2LO1A 1N34B 3RYIA 4X62B 4G28B 1K4DC 1EN5A 1IXMA 2YC0A 3W7UA 5GONA 3JAWA 2QKAA 4EKWA 1YSCA 3F7VC 2WSSG 2PZSA 1WA8B 2YIBD 1QBZA 3JSLA 5FLXN 1WPBA 3CHXA 4WFAV 4JASA 2OYQA 3CD6V 2VWKA 3OFNG 4WBNB 2VQEO 1J5EB 1N33O 3LDDA 4UCSA 3JAKB 3L72H 1AR5A 5E1AC 4A5UB 3JALB 3C90A 3I5DA 2D3OW 1BQ0A 3L74H 3GWKC 5H9CA 4R8CA 3CPWU 4I55A 1M1KW 2WLKA 5B1AC 3P3PA 2RQ6A 2JS5A 2W6JG 1B04A 1V55B 4MVRA 4MW3A 1DF5A 2NN4A 3ABMB 4GX5A 2M7WA 2G38A 4C7UA 1VQ5V 1GRJA 3LNMB 3H1LH 2E74B 4KHPB 1L0LH 1TUBB 1G4YB 2DWDC 4JV5O 2UU9O 1TA8A 1EN6A 3G80A 2LGWA 4UB6Z 2ZIMA 1T5EA 4PDMA 5B1OA 2X6AA 5C93A 1FXVA 3SYPA 1SZTA 2L6LA 2JVDA 1PKXA 3OR7C 3QNEA 3K58A 1UPGA 3H01A 1B3QA 3K0DA 1VQ9V 3SYAA 4JI6O 4ZHQA 1L0NH 3WB1A 4DV4B 3FB7C 5LOVB 4X65O 1H8EG 1R6KA
chains in the Genus database with same CATH topology
4G2KA 2HVJC 1GM8A 4PA4A 3SYOA 3G71V 3CC2V 4H33A 5CBFA 2QA4V 3ZMZA 3ZN1A 4WF9V 2EIKC 4MVZA 2IH3C 2WLLB 3ABLC 2LFRA 2JJ2G 2IH1C 5EK0A 1G8MA 1F4NA 1V55C 3CCUV 4UUJC 3ZCCA 2QM8A 1NR7A 4OXSA 1YI2V 2XAHA 1JX9A 2V7QG 3WG7C 4DXWA 1K5SA 3E83A 2DW4A 2Y69B 4TSFG 4MVOA 1XL6A 2B1GA 3AG1C 3CP1A 3IGAC 3K9AA 3CCJV 1AI5A 1THZA 3ML0A 3D36A 4WFEA 5LHGA 5L3GA 3IFXA 4JTCB 3QO7A 3A0RA 2JIZG 2R9RB 3CC7V 4RQFA 4KP4A 4E2LA 1KD1W 4YXWG 3X2QC 1QVFU 4G27B 4U7OA 1QLNA 3K06A 3FB8C 2XAFA 5B1BB 4UXNA 4BAYA 3AG2B 5IYBO 3OEEG 3ABMC 4WFBV 2H94A 5GW7A 1RM1B 1K73W 1GO3F 3CCRV 2Z5UA 4UV9A 1M56C 2JJ1G 3SPIA 5BZBA 1TUEB 3OMAB 1OCZC 1YITV 2A0LA 1K4CC 3JD3A 1AI6A 2OCCC 1Q81W 3SPJA 5LHHA 3E89A 3LUTB 3CMEV 4JAUA 5LGTA 2EIKB 1MSWD 1QR9A 1S72V 1WPXA 2A9HA 1R3KC 2YEVB 1VQMV 1R3JC 4WFFA 2JK5C 2WLIB 4J9ZB 4PA6A 1GK9A 4PDLA 3RVZA 1YJWV 4MTFA 3RW0A 4MVSA 2ATKC 3E35A 5CBHA 3I55V 4R50A 3ASOC 3CCSV 1BHBA 3JCZA 3LSSA 5IY5C 3ASNC 3HB3B 3F5WC 1M90W 3B77A 1OCCB 4U7NA 3CCEV 4PELA 1PNMA 4ASUG 2GSMB 2F43G 3G4SV 1AI7A 1COWG 5B1NA 1QR8A 3OE7G 4P30A 3CXCU 1DF4A 5L3CA 1CEZA 5EBWC 1ROPA 2WWWA 2WLNA 3T4ZA 1Q86W 2EILB 3JD4A 1NQTA 2X7RB 4QPKA 3B8NA 3ZMUA 4QPJA 4JGSA 4L87A 4WFHA 2JEUA 2ZXWB 1KC8W 3RBZA 3EFFK 3AG2C 5L3BA 4CBCA 4JYCA 1QVGU 1KQSU 3ZRVA 1Q7YW 2X6BA 1JVMA 3OUSA 4DO2A 1M56B 3FB6C 1DTOA 3SPGA 5J9PC 1VQ4V 3HPLC 1OCZB 4FJCC 3CCQV 2DYSB 1GMGA 2OCCB 2IJJA 5EC1C 2DQ0A 2FTKA 5KUKA 3OMIB 4H37A 1FS0G 1KP2A 1K97A 4JAVA 3NXSA 3W7SA 1VQ7V 2NNUA 4LP8A 1VQLV 3ZMVA 3OAAG 1GKFA 4X89A 1E1RG 2PI4A 3K04A 2JEXA 4X88A 5IYCO 1R3IC 4QIWF 1E1QG 5EC2C 1SRYA 3EHBB 1K7DA 3ABKB 4HZ3A 3UKMA 3LDEA 2NLJC 2WLIA 2EZPA 3TCUA 1AI4A 1RPRA 2B5UA 2IU3A 4QE9A 3QO5A 4FK5C 4JYBA 1WLEA 1FXHA 2AHYA 2ZD9A 3R65A 4BW5A 3GWOA 3MHSC 1KKDA 2EIMC 2W6IG 2R9IA 2EILC 2HKOA 3E86A 3F7YC 3SYCA 3DGEA 1K92A 1SETA 1AJPA 3K08A 1OCOC 3ZJZA 4XDKA 2JDIG 1VQNV 1H8HG 1L1FA 4ZKIA 4PA9A 1QLEB 1S3JA 1H38A 2ZDIA 1Q82W 1FXKB 5CBGA 4LC1A 4JTDB 2ZXWC 1I5XA 2X0LA 5HFLA 4Z1MG 1W2BU 4GX0A 1SESA 2Q69A 1VQ8V 3AG4C 2P6JA 4UVBA 3ZRSA 1F51A 3KG2A 3W7XA 4GX2A 2HVKC 5L3EA 3TETA 1OCCC 4UV8A 3IC7A 3OMNB 3I56V 1PNLA 4FMTA 4ZBMA 2DYSC 2HJFC 1PD3A 1K8AW 1M9NA 3SPHA 1R6NA 2H8PC 2Q67A 4MS2A 1PNKA 4MVUA 2HFEC 1OCRC 4GT1A 1AROP 5CA3A 4XBFA 1K3EA 3WFVA 2EZOA 5KA5A 5DN6G 1VQOV 4QNHB 1PL0A 4TWKA 4I5SA 5CN0A 5B3SC 1E79G 4HAMA 3M99B 3FYEB 3ZRWB 2W0FC 4RQEA 2IW5A 4X8AA 3PJSK 2DYRB 1YTFD 3E8FA 3SPCA 4RAIA 2Y69C 4JF3A 3ETGA 3K03A 2XASA 1B6QA 2WLLA 4Q20A 3OGCC 2OT5A 1JPXA 1XL4A 1Y66A 3ZN0A 1VQ6V 3P30A 2EIMB 1BL8A 1GM9A 1NBMG 2P7TC 2X6CA 2QTOA 3CMAV 1NVPB 2K1EA 4MVQA 1N8RW 3T2MA 1OCOB 2WPDG 1YJ9V 1I5YA 1VQKV 2CK3G 2EINB 3CCVV 2PI5A 1FXKC 4P9PA 3VOUA 1BHAA 4I9WA 1JQ0A 4UVAA 3CYOA 3RVYA 5H6RA 2Y48A 1RM1C 1NKDA 3CC4V 3WG7B 2DQ3A 3K79A 3GB7C 1MG1A 5LBQA 3CCMV 4QJFB 1K34A 2BOBC 1VQPV 2XOKG 2WLMA 3W7TA 1CP9A 3MHHC 3SJQC 3TK1A 2BOCC 4LBEC 1SERA 2ZR2A 4BIUA 3JYCA 4P9OA 4JPRA 1FFTB 1QCEA 3K3WA 3BY6A 1MABG 1QLEC 2QM7A 3STLC 1EZJA 2WLHA 2HG5C 3ZMTA 2EIJC 3AG3C 5H6QA 1F23A 4F4LA 1RPOA 4PA3A 2LP7A 5B3SB 4MTXA 3AG4B 2XAQA 3K0GA 5KUMA 2DYRC 2IJKA 3ASOB 1EBOA 1ZWIC 3E8BA 1KP3A 3CCLV 1AJNA 3D3IA 4PDVA 2ZQMA 4CZZA 2WLJA 2YSUB 1Y4MA 3JD0A 1EFRG 2KB1A 5KA6A 1M57B 1H2GA 2IJHA 4R6ZA 5B1AB 1NH2B 4R7CA 4N23A 3ZRWA 2P67A 1OCRB 4MTGA 3DTUB 1BMFG 1V54B 5FL7G 1MOFA 2Z3YA 2UXXA 1YJNV 1R3LC 3FKSG 1KECA 2XAJA 5L3DA 3OR6C 4P2ZA 1AJQA 2OTJV 4RUFA 5IY5B 2AHZA 1H8EG 1J95A 1NJIW 2EJRA 3ASNB 4G28B 1K4DC 4LCUC 4WCEV 4XDLA 4MSWC 1IXMA 2WAMA 2OTLV 3W7UA 1UJWB 2HR3A 4EKWA 1YSCA 3F7VC 2WSSG 4UVCA 1GTOA 1GM7A 3FYIB 1QBZA 5LGNA 1JJ2U 3E2EA 2EINC 4PDRA 4WFAV 4JASA 1YIJV 1K9MW 3ETEA 3AG3B 2MK3A 3E8HA 2QEXV 1JOYA 3CD6V 3OFNG 2DWEC 3MD0A 3AEIA 3ETDA 3LDDA 4MTOA 4J9YB 2IU0A 3E8GA 1HWYA 1OHHG 1CPYA 3T1CA 1AR1B 5E1AC 1S77D 1R73A 3FB5C 3ABUA 1NR1A 3ABKC 2D3OW 5EBMC 4FPPA 3T4DA 5H9CA 5CMUA 2ZR3A 4R8CA 3CPWU 1YTFB 2C2AA 4MW8A 1M1KW 2EBOA 3UM7A 1YHQV 2WLKA 4GX1A 3OW2U 5B1AC 1V54C 3ZRXA 1NH2D 2EIJB 2V1DA 3ABTA 2IJIA 4WFGA 3VBBA 2W6JG 1DLBA 1V55B 3ABLB 4MVRA 4MW3A 1DF5A 3OUFA 3ABMB 4GX5A 2M7WA 4JTAB 3OM3B 3QO8A 1VQ5V 2ITDC 5DM6V 3G6EV 4FIPC 3STZC 3LNMB 3LDCA 2QKSA 2UXNA 3JD1A 1NVPD 5EBLC 1S0VA 1FXKA 4BIZA 1M57C 3AG1B 4TT3G 1G4YB 2DWDC 2YEVA 4MVMA 3LSQA 2XNDG 4QE7A 1P4RA 4RUEA 1K5QA 2LFSA 3W7WA 1ENVA 5IYDO 4HYOA 3P32A 3X2QB 4PDMA 5B1OA 1K33A 3ZIAG 5L3FA 1W0KG 4PA7A 5HFMA 5IDJA 3ZMSA 3BEHA 4KUMA 1JCHA 5B1BC 2X6AA 2P90A 2Q6AA 2XAGA 1FXVA 5C93A 3SYPA 1SZTA 2ITCC 3SYQA 3B8MA 1PKXA 3OR7C 4GCZA 4MT8A 1W0JG 2ZDIC 1LNQA 3QNEA 1S76D 1VQ9V 3H01A 1ORQC 2B1IA 2HLDG 3K0DA 2GHYA 4KFMA 3SYAA 4N21A 5LHIA 2A79B 1P7BA 1OZ0A 2Q68A 2QE7G 4XDJA 3OEHG 5LGUA 3FB7C 3JD2A 4RO2A 1F4MA 1S5HC 1R6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVJ C;  5B3S C;  4PA4 A;  3SYO A;  2W0F C;  4WFH A;  4H33 A;  4X8A A;  3PJS K;  3RBZ A;  3EFF K;  4EKW A;  3E8F A;  3F7V C;  5CBF A;  3AG2 C;  2EIK C;  4MVZ A;  2IH3 C;  3SPC A;  4RAI A;  2WLL B;  2Y69 C;  3ABL C;  3K03 A;  4CBC A;  2WLL A;  3OGC C;  5EK0 A;  2IH1 C;  1XL4 A;  2X6B A;  1JVM A;  3OUS A;  2EIN C;  4PDR A;  1V55 C;  3FB6 C;  3SPG A;  5J9P C;  1BL8 A;  3E8H A;  4UUJ C;  2P7T C;  2X6C A;  2QTO A;  3HPL C;  2K1E A;  2DWE C;  4OXS A;  4MVQ A;  3T2M A;  3WG7 C;  3LDD A;  4DXW A;  4MTO A;  3E83 A;  4J9Y B;  5EC1 C;  3E8G A;  5KUK A;  4MVO A;  1XL6 A;  4H37 A;  3T1C A;  5E1A C;  3AG1 C;  3IGA C;  4P9P A;  3FB5 C;  3VOU A;  4WFE A;  4LP8 A;  3ABK C;  4I9W A;  5EBM C;  3RVY A;  3IFX A;  4JTC B;  3T4D A;  4X89 A;  2R9R B;  4R8C A;  3K04 A;  3GB7 C;  3X2Q C;  4MW8 A;  4X88 A;  4G27 B;  1R3I C;  3UM7 A;  2WLK A;  4GX1 A;  5EC2 C;  2BOB C;  5B1A C;  3K06 A;  2WLM A;  1V54 C;  3FB8 C;  4HZ3 A;  3UKM A;  3SJQ C;  3LDE A;  3ABM C;  2BOC C;  4LBE C;  2NLJ C;  2WLI A;  4WFG A;  3TCU A;  4QE9 A;  1M56 C;  3JYC A;  4P9O A;  3SPI A;  5BZB A;  4MVR A;  4MW3 A;  2AHY A;  2ZD9 A;  3R65 A;  4BW5 A;  3OUF A;  1OCZ C;  1QLE C;  4GX5 A;  3STL C;  2A0L A;  4JTA B;  1K4C C;  2HG5 C;  2EIM C;  2EIJ C;  2WLH A;  3AG3 C;  1KKD A;  2ITD C;  2EIL C;  2OCC C;  3E86 A;  3F7Y C;  3STZ C;  3LNM B;  3SYC A;  3LDC A;  2QKS A;  3ZJZ A;  3K08 A;  4F4L A;  1OCO C;  4PA3 A;  4XDK A;  5EBL C;  4PA9 A;  3SPJ A;  3K0G A;  3E89 A;  5KUM A;  3LUT B;  2DYR C;  1ZWI C;  3E8B A;  1M57 C;  5CBG A;  4JTD B;  2ZXW C;  2A9H A;  1G4Y B;  1R3K C;  2DWD C;  1R3J C;  2YEV A;  4MVM A;  4PDV A;  4WFF A;  4GX0 A;  4QE7 A;  4RUE A;  2JK5 C;  2Q69 A;  2WLI B;  2WLJ A;  3AG4 C;  4J9Z B;  4PA6 A;  3ZRS A;  4PDL A;  3RVZ A;  3KG2 A;  4GX2 A;  2KB1 A;  2HVK C;  4HYO A;  4MTF A;  4R6Z A;  3RW0 A;  4MVS A;  3TET A;  1OCC C;  2ATK C;  5CBH A;  4PDM A;  4R50 A;  3ASO C;  4R7C A;  5IY5 C;  4PA7 A;  4MTG A;  3BEH A;  3ASN C;  2DYS C;  2HJF C;  4ZBM A;  5B1B C;  2X6A A;  2Q6A A;  3F5W C;  3SPH A;  3SYP A;  2H8P C;  1R3L C;  2Q67 A;  4MS2 A;  2ITC C;  4MVU A;  2HFE C;  3SYQ A;  1OCR C;  3OR6 C;  4P2Z A;  3OR7 C;  4P30 A;  1LNQ A;  4RUF A;  1ORQ C;  3K0D A;  5EBW C;  3SYA A;  4KFM A;  2WLN A;  2AHZ A;  1J95 A;  2A79 B;  1P7B A;  3T4Z A;  2Q68 A;  4G28 B;  1K4D C;  4XDJ A;  4LCU C;  4XDL A;  4QNH B;  3FB7 C;  4MSW C;  4TWK A;  4RO2 A;  1S5H C; 
#chains in the Genus database with same CATH topology
 1GM8 A;  3BA9 A;  4PA4 A;  3SYO A;  3EXA A;  3G71 V;  3CC2 V;  3ZN1 A;  4WF9 V;  2EIK C;  2WLL B;  3ABL C;  2JJ2 G;  2IH1 C;  1F4N A;  3CCU V;  2YIA A;  2CGN A;  1NR7 A;  4D7T A;  3WG7 C;  4LF5 O;  3FAV A;  3E83 A;  4DR1 B;  1Z2G A;  1ZTE A;  4TUY A;  1XL6 A;  3CP1 A;  3IGA C;  3CCJ V;  1AI5 A;  3D8C A;  5L3G A;  1W59 A;  3H9V A;  3QO7 A;  3A0R A;  4PD4 F;  4RQF A;  3RYC A;  3X2Q C;  3ICX A;  5LP6 B;  1HR0 B;  2K9P A;  4LF4 B;  5J2U A;  3PN1 A;  1R6T A;  4GKK B;  3FB8 C;  2XAF A;  4YJ2 B;  3AG2 B;  1WP7 A;  3AG7 A;  3BCC H;  1K73 W;  3CCR V;  1XHZ A;  1SQQ H;  2JJ1 G;  3IJ4 A;  5BZB A;  3APQ A;  4DR5 B;  4NTX A;  1K4C C;  2CUG A;  1AI6 A;  1Y74 B;  1Z5V A;  1AP6 A;  2LQT A;  3LNN A;  1SF9 A;  1M4U A;  1FFX A;  4JYY A;  3CME V;  1TUB A;  4JI5 B;  1H2K A;  1HW7 A;  4HNA B;  1S72 V;  4O4L A;  4YY3 B;  2YEV B;  1URF A;  4WFF A;  2F4V O;  1GK9 A;  4JV5 B;  3RW0 A;  5CBH A;  3ZED A;  3BRC A;  2EX3 A;  5KHG A;  3CRA A;  2DE0 X;  1M90 W;  3B77 A;  2VQF B;  1BT8 A;  2E3C A;  5KHI A;  2UXC B;  3RYF A;  3G4S V;  3QG5 A;  4P30 A;  3DC5 A;  4Q6G A;  3CXC U;  1CEZ A;  1ROP A;  5J2T A;  5BR8 B;  1XNQ B;  3JD4 A;  3ZHU A;  2PY5 A;  4JGS A;  2UUB O;  4L87 A;  2ZXW B;  2UXD B;  2Y0P A;  1YDX A;  3B4S A;  3EFF K;  4FLT A;  1KQS U;  4PI2 A;  1GH6 A;  1JVM A;  4DO2 A;  1M56 B;  3J81 N;  2IJJ A;  2FTK A;  2YXY A;  4DW0 A;  1HNZ B;  4QGP A;  2Q73 A;  4LR3 A;  1VQ7 V;  2LW1 A;  3ZMV A;  2BTO A;  4D7S A;  4FLW A;  1XMO O;  1E1R G;  4B3S B;  1MNG A;  2CAZ C;  1KMI Z;  3CB2 A;  4OPA A;  1P49 A;  5IYC O;  4QIW F;  4GZR B;  4J7Z A;  5EC2 C;  3ABK B;  4DV3 B;  4K3A A;  2WLI A;  3TCU A;  4JI7 B;  2AGA A;  3DXR B;  2ZE8 A;  2KG7 A;  1KKD A;  2BTQ A;  5AG2 A;  2OCH A;  5CA1 A;  3SYC A;  2BSK A;  1K92 A;  2ZM6 B;  5LA6 B;  1AJP A;  3T1Y O;  1AR4 A;  2RMK B;  3H1I H;  4BIO A;  4FFK A;  1L1F A;  4LF5 B;  4PA9 A;  4I50 A;  1Q82 W;  3U11 A;  5HFL A;  3HKE B;  4GX0 A;  3BAA A;  2Q69 A;  2N05 A;  1VQ8 V;  1I08 A;  1BGY H;  5ITZ A;  4GX2 A;  4DV2 O;  2HVK C;  1EN4 A;  4K35 A;  2QGN A;  3I56 V;  4GKK O;  2A3Q A;  4LFC O;  1M9N A;  2QWP B;  2FL4 A;  3K5M A;  2Q67 A;  4MS2 A;  2OWO A;  1PNK A;  4MVU A;  1U96 A;  1Q90 D;  2ZKO A;  1OCR C;  4GT1 A;  3ZHT A;  1K3E A;  4JI0 B;  4FLU A;  5DN6 G;  4QNH B;  2UXB B;  4I5S A;  4UCV A;  1E79 G;  4HAM A;  3ZRW B;  3E8F A;  1GN6 A;  2VQE B;  4JF3 A;  3ETG A;  1XMQ B;  3OGC C;  1XL4 A;  1Y66 A;  2DJV A;  1VQ6 V;  2ZNI A;  1GM9 A;  1NBM G;  2ETN A;  4NYK A;  2P7T C;  5E79 Z;  1FD9 A;  2HP8 A;  1I5Y A;  2CK3 G;  2PI5 A;  2QWO B;  1ZAU A;  3M8A A;  5BMV A;  3L75 H;  3U0Z A;  4JAA A;  4JI2 O;  4DV0 O;  4IHJ A;  1BHA A;  2ADP A;  2PTM A;  5H6R A;  2Y48 A;  3K79 A;  4CS3 A;  1NZ6 A;  3T1H O;  2Y0I A;  3CCM V;  4QJF B;  4YJ3 B;  1K34 A;  2BOB C;  1VQP V;  2RDC A;  3SJQ C;  2BOC C;  1SER A;  2VS0 A;  4EB6 B;  4F6E A;  2XT9 A;  1P84 F;  4GYC B;  2QM7 A;  3STL C;  1NTZ H;  1OV9 A;  2EIJ C;  5JCO A;  4K8Z A;  5EZY B;  1TAE A;  2LP7 A;  1G6U A;  2UU9 B;  4UCR A;  5GTI Z;  2FML A;  1ZWI C;  1KP3 A;  4IGG A;  3S3W A;  4E4E A;  2ZQM A;  4I4T A;  4NVP A;  1EFR G;  5B1A B;  1NH2 B;  5D5Q A;  4R7C A;  4N23 A;  1OCR B;  3BVO A;  3DTU B;  3JAS A;  1BMF G;  1XOU A;  5FL7 G;  4X20 A;  3OR6 C;  2ZE6 A;  4RUF A;  4PJ0 Z;  2PGG A;  2EJR A;  5KHJ A;  4GLX A;  4XDL A;  4MSW C;  2WAM A;  1NI8 A;  4UVC A;  1GTO A;  1TVK A;  3FYI B;  4FZ1 A;  1ZX3 A;  1H2L A;  1K9M W;  5D5P A;  1MA1 A;  3ETE A;  2MK3 A;  3E8H A;  3AEI A;  4B3R O;  4MTO A;  3LSU A;  2ZNJ A;  2ADQ B;  1S77 D;  3FB5 C;  1HR0 O;  1NR1 A;  3K57 A;  5EBM C;  4DR4 O;  4FPP A;  3T4D A;  4Z2W A;  1IDS A;  5KX5 A;  2ZE7 A;  3S3X A;  4FM2 A;  2EBO A;  3IC9 A;  4GX1 A;  1EM1 A;  2QKC A;  2AZ0 A;  3IAY A;  3JAT B;  2EIJ B;  2IJI A;  1N36 B;  2DN9 A;  1YEW A;  3ABL B;  1XMQ O;  2CE4 A;  1H2S B;  3EVK A;  1RFY A;  4DV5 O;  3QO8 A;  4CH4 A;  2ITD C;  5DM6 V;  4FM0 A;  4FIP C;  1Y74 A;  4J7K A;  3STZ C;  2QKS A;  1Q5O A;  1FXK A;  4BIZ A;  5LXT A;  4B3R B;  4K8X A;  4ZI7 A;  4MVM A;  1WA8 A;  3LSQ A;  2XND G;  1NS1 A;  5LMU O;  3W7W A;  4CC5 A;  2GDS A;  3X2Q B;  2VQF O;  4JI3 O;  3ZIA G;  5L3F A;  2YXH A;  1W0K G;  5HFM A;  5IDJ A;  3ZMS A;  5B1B C;  3ZHS A;  2ITC C;  4IYH A;  1YXB A;  4GCZ A;  1W0J G;  2A7W A;  2ZDI C;  3HKB A;  5LL6 Y;  1BZK A;  2GHY A;  4KFM A;  1N36 O;  4I9Q A;  2QE7 G;  1P7B A;  2Q68 A;  3BA8 A;  4YJ3 A;  4DUZ B;  4RO2 A;  3OTO B;  3UCS C;  1RSO B;  2QA4 V;  5JJN B;  2LFR A;  4LNU A;  4PV1 B;  4DR7 B;  3Q4H B;  5CB4 B;  4FLV A;  2QSA A;  3AK1 A;  4OXS A;  2XAH A;  1JX9 A;  1YI2 V;  2Q9L A;  4JZ2 A;  2CGO A;  1K5S A;  2E5L B;  1XMO B;  4MVO A;  3K9A A;  1FPO A;  3APO A;  1KBH A;  4TQD A;  3ML0 A;  3D36 A;  4WFE A;  5LHG A;  4IHJ B;  1N0N A;  2JIZ G;  4KP4 A;  1KUQ A;  4O4J B;  4YXW G;  1CXZ B;  4U7O A;  5JCO C;  2M6Y A;  5B1B B;  3JAT A;  3L70 H;  5IYB O;  4B7E A;  5IT9 N;  3OEE G;  3ABM C;  5GW7 A;  1RM1 B;  4JYA O;  2GUZ B;  1M56 C;  2XHB A;  4OX9 O;  2A0L A;  2P22 C;  1Q81 W;  1Q3E A;  2BSK B;  5KAF Z;  5LHH A;  1A32 A;  4FZ0 A;  4YJ2 A;  1WPX A;  2CTR A;  1R3K C;  1PL4 A;  2RNB A;  4CH3 A;  2WLI B;  4PA6 A;  4JI8 O;  2ZT9 B;  4PDL A;  3RVZ A;  4NXM O;  3A0H Z;  3I55 V;  3ASO C;  5GTH Z;  2MW2 B;  4LF8 O;  1Q6H A;  4O2A A;  1OCC B;  4U7N A;  5JH7 B;  3SJB C;  1PNM A;  4X1I B;  4ASU G;  1HNW B;  2GSM B;  2F43 G;  1M93 A;  1AI7 A;  4UFZ A;  1DF4 A;  1HDJ A;  5L3C A;  1JFF B;  1YZB A;  5EBW C;  4DV1 O;  2WWW A;  1XBL A;  4ZOL A;  4TUY B;  5B66 Z;  5EIB D;  2JEU A;  3OTO O;  3RBZ A;  3R66 A;  3DXR A;  3OUS A;  1VAR A;  5KAI Z;  3SPG A;  3HPL C;  1Z5W A;  1SQF A;  3DC6 A;  4DK1 A;  2OCC B;  4ICG A;  1I94 O;  5EC1 C;  2DQ0 A;  3KZI Z;  3OMI B;  1FS0 G;  4AQY B;  4X1I A;  4JAV A;  1XIL A;  5BMV B;  5IE9 A;  2D2C B;  3OAA G;  3K04 A;  4O4I B;  4O4H B;  1E1Q G;  1K7D A;  4BW9 A;  1DK1 A;  2CTQ A;  4FFB A;  4HZ3 A;  3UKM A;  2YS8 A;  2NLJ C;  4O2A B;  2Q7E A;  2HHH B;  3SJC C;  2B5U A;  4JYB A;  4GUN A;  5KMG A;  1MSD A;  1FXH A;  4JYA B;  4HNA A;  1I0H A;  3MHS C;  5H2F Z;  3A2F A;  2JRI A;  2W6I G;  2R9I A;  4U3J B;  4DR1 O;  2BCC H;  3ZJZ A;  2XUM A;  3MDS A;  4ZKI A;  5KHK A;  1WNS A;  1H38 A;  2WA4 A;  4NKG B;  2YI8 A;  3BHP A;  3TXS A;  4JTD B;  1I5X A;  2N74 A;  2F1M A;  4Z1M G;  5LYJ B;  2Q7G A;  3CX5 F;  1OCC C;  3IC7 A;  4TV8 A;  1H2M A;  3CJH B;  3JAS B;  2DYS C;  4ZBM A;  4IT5 A;  3HKE A;  4J7J A;  2QR4 A;  2H8P C;  5C8Y A;  1BSM A;  4DR5 O;  2VRZ A;  1ZL8 B;  1ARO P;  4O4L B;  5CA3 A;  1HNW O;  2EZO A;  5KA5 A;  2HHH O;  2UUA O;  4TWK A;  5CN0 A;  4NXN B;  4LFB B;  4RQE A;  2W0F C;  3PJS K;  2DYR B;  5GON B;  4RAI A;  3CE2 A;  2F4V B;  2XAS A;  1D5N A;  1B6Q A;  2WLL A;  1SQX H;  4JI2 B;  4DV0 B;  2YUA A;  3K5L A;  1N8R W;  2ODM A;  1FJG O;  2WPD G;  4EEQ A;  1VQK V;  2EIN B;  3ZHQ A;  2YIC A;  4D6T H;  5K1P A;  2CDY A;  3L71 H;  4EFE A;  2ZIN A;  4I9W A;  1JQ0 A;  3F5T A;  3K59 A;  2BTQ B;  2ZE5 A;  4EB6 A;  2DQ3 A;  2Q0A A;  5LOV A;  2QDO A;  2UUB B;  5IJ9 A;  3TK1 A;  3E22 B;  3VQX A;  4X66 B;  3BPZ A;  4P9O A;  1FFT B;  1QCE A;  4FLZ A;  2QWN B;  2ARH A;  5H6Q A;  3ZS8 C;  1F23 A;  1RPO A;  2XAQ A;  1XDC A;  1D2D A;  5KUM A;  4PHZ A;  2DYR C;  2KSD A;  2IJK A;  1EBO A;  1O9G A;  5LXT B;  3CCL V;  3N2K B;  5LYJ A;  4YHH B;  2YSU B;  2KB1 A;  5KA6 A;  1M57 B;  2R9A A;  3CRC A;  5IWA B;  4B3T O;  4TV8 B;  3ZRW A;  1VF6 C;  4DV3 O;  4ABM A;  2WA3 A;  1MOF A;  2Z3Y A;  5K1X A;  1R3L C;  1ZL8 A;  4TQF A;  5IY5 B;  1IBM B;  1H2N A;  1J95 A;  1NJI W;  3ASN B;  3T1Y B;  1N4C A;  4IIJ B;  4LCU C;  3SJA C;  4WCE V;  1YF2 A;  2N04 A;  2YIB A;  3O65 A;  5FNV A;  1JMK C;  3N2K A;  2NR5 A;  5LGN A;  4FM1 A;  1JJ2 U;  4H0L B;  1ZSP A;  1KYO F;  1YIJ V;  2QEX V;  2DWE C;  3MD0 A;  2Q5Z A;  3ETD A;  3UO3 A;  2F66 C;  1AVM A;  1HWY A;  1OHH G;  3T1C A;  1AR1 B;  4U3F H;  3ABK C;  4JI0 O;  1KKC A;  3RWR D;  2C2A A;  3QTC A;  1HP8 A;  4NB5 A;  2HJD A;  3OW2 U;  4J11 A;  4ZI7 B;  4LH7 A;  3ZRX A;  1NH2 D;  3ABT A;  2V1D A;  4X20 B;  3WB0 A;  4RWU A;  1B06 A;  4X1Y A;  4JTA B;  3G6E V;  3CEI A;  3JD1 A;  1FJG B;  5EBL C;  1S0V A;  2FKX A;  4FLX A;  3AG1 B;  3CXH F;  4DV7 O;  3KKY A;  4QE7 A;  4AI8 A;  5LP6 C;  1ENV A;  5FPO A;  1Q6U A;  1LR1 A;  4DUY B;  4PA7 A;  4KHP O;  3BEH A;  4KUM A;  1JCH A;  2P90 A;  2XAG A;  4DUZ O;  2OIE A;  1P7G A;  4X64 B;  3H1H H;  1PM9 A;  1LNQ A;  3FX7 A;  2B1I A;  4IYI A;  4LH6 A;  2A79 B;  1OZ0 A;  5H5N A;  5LGU A;  2R70 A;  1FAF A;  1R1B A;  3FD9 A;  2HVJ C;  1IBL O;  1KB9 F;  3ZMZ A;  2FB5 A;  5KLV H;  1JA8 A;  4B3M B;  4HBN A;  2GUZ A;  5EK0 A;  1G8M A;  1V55 C;  1ZLZ A;  1XI1 A;  3ZCC A;  5EIB C;  2PYJ A;  4AQY O;  4X65 B;  3JCU Z;  2V7Q G;  3WU2 Z;  4DXW A;  4UCO A;  2DMX A;  2DW4 A;  2P4K A;  4TSF G;  2IM9 A;  2B1G A;  2PF4 E;  3AG1 C;  1G1X B;  3ZHR A;  1THZ A;  1LUW A;  3IFX A;  3UT5 B;  2R9R B;  2CH7 B;  5DED A;  1QVF U;  5BXZ A;  4O4H A;  4G27 B;  2EUL A;  1QLN A;  1FFX B;  3K06 A;  5LMN O;  1WN7 A;  4FVM A;  4UXN A;  5JJE B;  2H94 A;  4LNU B;  4UV9 A;  3D36 C;  3SPI A;  4UCT A;  1VF5 B;  3OMA B;  1BS3 A;  4B7K A;  4B3M O;  4LFA B;  3OGI B;  4O2B B;  1YCI A;  3SPJ A;  1XEQ A;  3LUT B;  3JAW B;  4JAU A;  5LGT A;  2F95 B;  4JI1 B;  4IL6 Z;  1MSW D;  1VQM V;  3RFR A;  2GTA A;  4DV7 B;  1WB7 A;  4YIP A;  2VWJ A;  4X1K A;  1YJW V;  4ZOL B;  5IYZ A;  4MVS A;  2ATK C;  3E35 A;  4R50 A;  3JCZ A;  5IY5 C;  3HKD B;  4DUY O;  2KQX A;  3F5W C;  2RJZ A;  5JH7 A;  3QVN A;  4DV5 B;  1O9H A;  1QR8 A;  3OE7 G;  4DK0 A;  2O57 A;  4X64 O;  3UQ8 A;  1JFF A;  2WLN A;  2CH7 A;  3T4Z A;  1SQB H;  2QWR B;  3ZMU A;  4NR1 A;  1IX9 A;  1KC8 W;  4WFH A;  4TV9 B;  2Q0O C;  2EJ7 A;  4JI4 B;  4CBC A;  4LF6 B;  3D3Q A;  3VQV A;  4LWS A;  1Q7Y W;  3K5N A;  5J9P C;  1VQ4 V;  1OCZ B;  2Z0A A;  3CCQ V;  3B09 A;  5J2T B;  1US6 A;  5KUK A;  3RYF B;  1SA0 A;  3NXS A;  1VQL V;  1GKF A;  4X89 A;  1VF7 A;  4CH6 A;  1KU9 A;  5JVD B;  3L73 H;  4X88 A;  3J7A U;  2F23 A;  5CA0 B;  5CA0 A;  4I0X B;  2ZM6 O;  3KCY A;  3EHB B;  5LMN B;  1Y67 A;  2EZP A;  1AI4 A;  1RPR A;  1TGO A;  2IU3 A;  3QO5 A;  4FK5 C;  2ZD9 A;  4BW5 A;  1VP7 A;  4JI4 O;  1SQP H;  2EIM C;  2QJ1 A;  2EIL C;  2DOS A;  2HKO A;  3E86 A;  3K08 A;  1BQZ A;  4XDK A;  1VQN V;  1QLE B;  1S3J A;  2ZDI A;  5CBG A;  1D5A A;  2ZXW C;  3RYI B;  1NTM H;  3AG4 C;  3QF7 A;  3W7X A;  1LUV A;  3TET A;  3J80 N;  4UV8 A;  4L8J A;  5IJ9 B;  2JGU A;  4FFB B;  2Q7H A;  1J5E O;  2HJF C;  2UUA B;  1ZUQ A;  3SPH A;  2E75 B;  3CRR A;  2LGQ A;  3VQY A;  3JSN A;  1XNR B;  4J42 A;  2FYU H;  2LW7 A;  4X9Q A;  5TIS Z;  4DYL A;  3WFV A;  2GTS A;  1PL0 A;  3M99 B;  1XUQ A;  2IW5 A;  3ETQ A;  4X8A A;  1YTF D;  1I7F A;  3SPC A;  2JS3 A;  1Q8I A;  3K03 A;  4AHC A;  3SDL A;  3ZN0 A;  3RGB A;  3AK2 A;  2EIM B;  4LF6 O;  1BL8 A;  2X6C A;  3CMA V;  2P06 A;  4MVQ A;  4DR3 O;  3T2M A;  1OCO B;  3HKC B;  1YJ9 V;  1L8D A;  1FYJ A;  3CCV V;  3A0B Z;  4PI0 A;  3JAM N;  2H3O A;  4UVA A;  2QTS A;  4CS2 A;  1RM1 C;  1NKD A;  3A8T A;  3N27 A;  3WG7 B;  4X66 O;  3CC4 V;  4JI5 O;  3GB7 C;  1MG1 A;  2Q4P A;  5LBQ A;  4YY3 O;  2XTA A;  4BWA A;  3SR2 C;  2E76 B;  4DR7 O;  4KL1 A;  1FKA O;  1QHT A;  3HR0 A;  1TVK B;  4LBE C;  4DW1 A;  3B40 A;  3CRQ A;  4W4K A;  3JYC A;  2GBO A;  5KX5 B;  3THO A;  1N0J A;  1MAB G;  2HG5 C;  3ZMT A;  2UXC O;  3AG3 C;  4OGQ B;  4MTX A;  3AG4 B;  4DR3 B;  1JR9 A;  1IBK O;  5IWA O;  1Q6I A;  3ASO B;  5FNV B;  4B3T B;  1XNQ O;  4K0K B;  1AJN A;  4DR2 O;  1VMG A;  5BY1 A;  1Y4M A;  5LP6 A;  1H2G A;  2IJH A;  4R6Z A;  3G6B A;  2RN9 A;  2P67 A;  5CA1 B;  1V54 B;  3TGU H;  1YJN V;  1QNM A;  4DV6 O;  3FKS G;  1KEC A;  2XAJ A;  5L3D A;  3ZBH A;  1NU1 H;  1V9P A;  4GKJ O;  2OTJ V;  1HNZ O;  2AHZ A;  4O4I A;  4I55 B;  4CH5 A;  2PUS A;  2OTL V;  4LF4 O;  1UJW B;  2HR3 A;  4JZG A;  4NXM B;  3M7M X;  1RP3 B;  1GM7 A;  4X62 O;  5KHH A;  3E2E A;  4DR4 B;  2EIN C;  4PDR A;  1JOY A;  3AG3 B;  5IJ0 A;  4J80 A;  4J9Y B;  2IU0 A;  3E22 A;  3E8G A;  3L9D A;  1CPY A;  4DV1 B;  1R73 A;  3ABU A;  3N2G B;  2P5O A;  3HKB B;  3TXQ A;  5CMU A;  2ZR3 A;  1YTF B;  3JAR A;  4MW8 A;  3K9S A;  5IYZ B;  3UM7 A;  1YHQ V;  2HEP A;  1V54 C;  2A06 H;  4LFA O;  2KKW A;  4WFG A;  3VBB A;  3O9O A;  1DLB A;  1SC5 B;  3OUF A;  3OM3 B;  1UFI A;  2JGD A;  1AB3 A;  2Y4T A;  4JI1 O;  4F6R A;  3LDC A;  1Y6X A;  2UXN A;  1NVP D;  2IBZ H;  1Y76 B;  2GV9 A;  1M57 C;  4J41 A;  4TT3 G;  2YEV A;  3FFQ A;  3OT7 A;  1M5I A;  4RUE A;  1P4R A;  1K5Q A;  2LFS A;  2AXT Z;  3RYH A;  5IYD O;  4HYO A;  3P32 A;  1K33 A;  1IVS A;  2Q6A A;  1HNX O;  3SYQ A;  3SGI A;  3B8M A;  5LMU B;  4MT8 A;  1GN4 A;  1IUR A;  1S76 D;  1ORQ C;  2HLD G;  2B9Z A;  5LHI A;  4N21 A;  4GKJ B;  4F6R B;  4XDJ A;  3OEH G;  4LF9 B;  3JD2 A;  4J10 A;  4NTY A;  1F4M A;  1S5H C;  2PI4 A;  4G2K A;  4H33 A;  5CBF A;  3T1H B;  1DGS A;  4MVZ A;  2IH3 C;  1WAZ A;  1PPJ H;  4FLY A;  4LWS B;  3RYH B;  4UUJ C;  2QM8 A;  1QU7 A;  1AIL A;  3C3T A;  3HKC A;  3JAR B;  3BFR A;  2Y69 B;  1BCC H;  1X4T A;  3DSQ A;  1Y76 A;  4I50 B;  1N33 B;  3N2G A;  1RSO A;  3CWB H;  4B08 A;  1IBM O;  4JTC B;  2JGD B;  3CC7 V;  4E2L A;  1KD1 W;  1WB8 A;  4X1K B;  4ZIB A;  2E5L O;  3HKD A;  2L35 A;  4BAY A;  4I7Z B;  4WFB V;  1GO3 F;  2Z5U A;  1TUE B;  4LF7 O;  5IJ0 B;  1SKV A;  1OCZ C;  4W4L A;  4JI8 B;  1YIT V;  2ILM A;  3JD3 A;  2QWQ B;  2OCC C;  3FAV B;  4OPH A;  2R72 A;  2UXB O;  3E89 A;  3ZHV A;  2EIK B;  4EFB A;  1QR9 A;  2YID A;  2A9H A;  5B5E Z;  4O2B A;  2UUC B;  1R3J C;  4H13 B;  2JK5 C;  4OX9 B;  4J9Z B;  4MTF A;  1N32 O;  4I0X A;  3BAB A;  1SZX A;  3CCS V;  1BHB A;  3LSS A;  1S5J A;  4ZHQ B;  3ASN C;  3CJH A;  5DEC A;  1IZ3 A;  3HB3 B;  3VQW A;  3CCE V;  4PEL A;  3U10 A;  1JJO A;  1WP8 A;  5B1N A;  1COW G;  1NTK H;  2CTP A;  4DRX A;  1EZV H;  1VF6 A;  1Q86 W;  2EIL B;  3C3S A;  3OTF A;  3P3N A;  4DR6 B;  1NQT A;  2X7R B;  3RN4 A;  4QPK A;  2YI9 A;  3B8N A;  4QPJ A;  4LF9 O;  1I94 B;  4JI6 B;  1VEW A;  3AG2 C;  4DV4 O;  5L3B A;  1QVG U;  4JYC A;  3ZRV A;  2X6B A;  5KMG B;  3FB6 C;  1DTO A;  1F7Y A;  4FJC C;  2DYS B;  1GMG A;  4KXR A;  3RYC B;  5JWP A;  5JVD A;  1N32 B;  4H37 A;  1KP2 A;  1GN2 A;  2W0X A;  1OJH A;  1K97 A;  1U97 A;  3W7S A;  2NNU A;  4LP8 A;  1YVW A;  1HNX B;  4UCU A;  3H1J H;  1QQC A;  4O4J A;  3MAQ A;  4CS4 A;  2JEX A;  3CRM A;  1R3I C;  1SRY A;  3NR7 A;  3LDE A;  4DR6 O;  3H1K H;  2CTW A;  5LA6 A;  4JI3 B;  4B3S O;  4I4T B;  4QE9 A;  5ITZ B;  1WLE A;  4TOI A;  2AHY A;  2Q8V A;  3R65 A;  2KG7 B;  2QM4 A;  2BE3 A;  3GWO A;  1IBK B;  2AW9 A;  4X1Y B;  3F7Y C;  3TJT A;  4K0K O;  3DGE A;  1SQG A;  1SET A;  1OCO C;  2JDI G;  1H8H G;  1SQV H;  1FXK B;  1XRE A;  4LC1 A;  2X0L A;  4UB8 Z;  1W2B U;  2V4D A;  1SES A;  4UVB A;  2P6J A;  3ZRS A;  1F51 A;  2UUC O;  3KG2 A;  1XNR O;  5L3E A;  4DV6 B;  3OD4 A;  3OMN B;  4H44 B;  5EYP B;  2RCV A;  1PNL A;  4FMT A;  5FPR A;  1VIB A;  1PD3 A;  1K8A W;  4NXN O;  1R6N A;  5C8Y B;  1N34 O;  4DV2 B;  1SS3 A;  2HFE C;  5A2Q N;  4CC6 A;  4LF7 B;  3AK3 A;  4XBF A;  2YDE A;  4LFC B;  1MZF A;  1VQO V;  1NT2 B;  3RT3 C;  5B3S C;  1Q43 A;  3FYE B;  5BR8 O;  5A9G A;  1PV0 A;  2Y69 C;  1GN3 A;  2ZCE A;  4Q20 A;  1BE3 H;  2OT5 A;  1JPX A;  4IIJ A;  3P30 A;  2UXD O;  2QTO A;  4DRX B;  1NVP B;  2K1E A;  4NTW A;  2Y4U A;  5JQG B;  4LFB O;  5F2V O;  1FXK C;  4P9P A;  1SA0 B;  3JAL A;  3VOU A;  5JJJ B;  3UT5 A;  3CYO A;  3RVY A;  3CSX A;  3ZX6 A;  3KCX A;  2ZIO A;  1IBL B;  3WB2 A;  1PP9 H;  2LJ2 A;  2F93 B;  1WJZ A;  3UO2 A;  2XOK G;  2WLM A;  3W7T A;  5J2U B;  1CP9 A;  2YXL A;  3MHH C;  3G67 A;  1AP5 A;  2P4V A;  1X59 A;  2ZR2 A;  3JAK A;  4BIU A;  4JPR A;  3K3W A;  2PYL A;  1MMM A;  3BY6 A;  3Q4H A;  1IXB A;  5CB4 A;  4YHH O;  4LF8 B;  1QLE C;  1EZJ A;  2WLH A;  4DR2 B;  4WBN A;  4U3J A;  4JI7 O;  5JQG A;  1MZE A;  4BR6 A;  4F4L A;  1GAX A;  4PA3 A;  5B3S B;  3K0G A;  2AZ2 A;  4TV9 A;  3E8B A;  1S5L Z;  3D3I A;  4PDV A;  4AIL C;  3K5O A;  4CZZ A;  5EZY A;  4YIO A;  2WLJ A;  3JD0 A;  3GVM A;  3B2E E;  2OIG A;  5EYP A;  3CS5 A;  4MTG A;  4Z1V A;  2UXX A;  1XQ8 A;  4P2Z A;  1XHX A;  1AJQ A;  2LO1 A;  1N34 B;  3RYI A;  4X62 B;  4G28 B;  1K4D C;  1EN5 A;  1IXM A;  2YC0 A;  3W7U A;  5GON A;  3JAW A;  2QKA A;  4EKW A;  1YSC A;  3F7V C;  2WSS G;  2PZS A;  1WA8 B;  2YIB D;  1QBZ A;  3JSL A;  5FLX N;  1WPB A;  3CHX A;  4WFA V;  4JAS A;  2OYQ A;  3CD6 V;  2VWK A;  3OFN G;  4WBN B;  2VQE O;  1J5E B;  1N33 O;  3LDD A;  4UCS A;  3JAK B;  3L72 H;  1AR5 A;  5E1A C;  4A5U B;  3JAL B;  3C90 A;  3I5D A;  2D3O W;  1BQ0 A;  3L74 H;  3GWK C;  5H9C A;  4R8C A;  3CPW U;  4I55 A;  1M1K W;  2WLK A;  5B1A C;  3P3P A;  2RQ6 A;  2JS5 A;  2W6J G;  1B04 A;  1V55 B;  4MVR A;  4MW3 A;  1DF5 A;  2NN4 A;  3ABM B;  4GX5 A;  2M7W A;  2G38 A;  4C7U A;  1VQ5 V;  1GRJ A;  3LNM B;  3H1L H;  2E74 B;  4KHP B;  1L0L H;  1TUB B;  1G4Y B;  2DWD C;  4JV5 O;  2UU9 O;  1TA8 A;  1EN6 A;  3G80 A;  2LGW A;  4UB6 Z;  2ZIM A;  1T5E A;  4PDM A;  5B1O A;  2X6A A;  5C93 A;  1FXV A;  3SYP A;  1SZT A;  2L6L A;  2JVD A;  1PKX A;  3OR7 C;  3QNE A;  3K58 A;  1UPG A;  3H01 A;  1B3Q A;  3K0D A;  1VQ9 V;  3SYA A;  4JI6 O;  4ZHQ A;  1L0N H;  3WB1 A;  4DV4 B;  3FB7 C;  5LOV B;  4X65 O;  1H8E G;  1R6K A; 
#chains in the Genus database with same CATH homology
 4G2K A;  2HVJ C;  1GM8 A;  4PA4 A;  3SYO A;  3G71 V;  3CC2 V;  4H33 A;  5CBF A;  2QA4 V;  3ZMZ A;  3ZN1 A;  4WF9 V;  2EIK C;  4MVZ A;  2IH3 C;  2WLL B;  3ABL C;  2LFR A;  2JJ2 G;  2IH1 C;  5EK0 A;  1G8M A;  1F4N A;  1V55 C;  3CCU V;  4UUJ C;  3ZCC A;  2QM8 A;  1NR7 A;  4OXS A;  1YI2 V;  2XAH A;  1JX9 A;  2V7Q G;  3WG7 C;  4DXW A;  1K5S A;  3E83 A;  2DW4 A;  2Y69 B;  4TSF G;  4MVO A;  1XL6 A;  2B1G A;  3AG1 C;  3CP1 A;  3IGA C;  3K9A A;  3CCJ V;  1AI5 A;  1THZ A;  3ML0 A;  3D36 A;  4WFE A;  5LHG A;  5L3G A;  3IFX A;  4JTC B;  3QO7 A;  3A0R A;  2JIZ G;  2R9R B;  3CC7 V;  4RQF A;  4KP4 A;  4E2L A;  1KD1 W;  4YXW G;  3X2Q C;  1QVF U;  4G27 B;  4U7O A;  1QLN A;  3K06 A;  3FB8 C;  2XAF A;  5B1B B;  4UXN A;  4BAY A;  3AG2 B;  5IYB O;  3OEE G;  3ABM C;  4WFB V;  2H94 A;  5GW7 A;  1RM1 B;  1K73 W;  1GO3 F;  3CCR V;  2Z5U A;  4UV9 A;  1M56 C;  2JJ1 G;  3SPI A;  5BZB A;  1TUE B;  3OMA B;  1OCZ C;  1YIT V;  2A0L A;  1K4C C;  3JD3 A;  1AI6 A;  2OCC C;  1Q81 W;  3SPJ A;  5LHH A;  3E89 A;  3LUT B;  3CME V;  4JAU A;  5LGT A;  2EIK B;  1MSW D;  1QR9 A;  1S72 V;  1WPX A;  2A9H A;  1R3K C;  2YEV B;  1VQM V;  1R3J C;  4WFF A;  2JK5 C;  2WLI B;  4J9Z B;  4PA6 A;  1GK9 A;  4PDL A;  3RVZ A;  1YJW V;  4MTF A;  3RW0 A;  4MVS A;  2ATK C;  3E35 A;  5CBH A;  3I55 V;  4R50 A;  3ASO C;  3CCS V;  1BHB A;  3JCZ A;  3LSS A;  5IY5 C;  3ASN C;  3HB3 B;  3F5W C;  1M90 W;  3B77 A;  1OCC B;  4U7N A;  3CCE V;  4PEL A;  1PNM A;  4ASU G;  2GSM B;  2F43 G;  3G4S V;  1AI7 A;  1COW G;  5B1N A;  1QR8 A;  3OE7 G;  4P30 A;  3CXC U;  1DF4 A;  5L3C A;  1CEZ A;  5EBW C;  1ROP A;  2WWW A;  2WLN A;  3T4Z A;  1Q86 W;  2EIL B;  3JD4 A;  1NQT A;  2X7R B;  4QPK A;  3B8N A;  3ZMU A;  4QPJ A;  4JGS A;  4L87 A;  4WFH A;  2JEU A;  2ZXW B;  1KC8 W;  3RBZ A;  3EFF K;  3AG2 C;  5L3B A;  4CBC A;  4JYC A;  1QVG U;  1KQS U;  3ZRV A;  1Q7Y W;  2X6B A;  1JVM A;  3OUS A;  4DO2 A;  1M56 B;  3FB6 C;  1DTO A;  3SPG A;  5J9P C;  1VQ4 V;  3HPL C;  1OCZ B;  4FJC C;  3CCQ V;  2DYS B;  1GMG A;  2OCC B;  2IJJ A;  5EC1 C;  2DQ0 A;  2FTK A;  5KUK A;  3OMI B;  4H37 A;  1FS0 G;  1KP2 A;  1K97 A;  4JAV A;  3NXS A;  3W7S A;  1VQ7 V;  2NNU A;  4LP8 A;  1VQL V;  3ZMV A;  3OAA G;  1GKF A;  4X89 A;  1E1R G;  2PI4 A;  3K04 A;  2JEX A;  4X88 A;  5IYC O;  1R3I C;  4QIW F;  1E1Q G;  5EC2 C;  1SRY A;  3EHB B;  1K7D A;  3ABK B;  4HZ3 A;  3UKM A;  3LDE A;  2NLJ C;  2WLI A;  2EZP A;  3TCU A;  1AI4 A;  1RPR A;  2B5U A;  2IU3 A;  4QE9 A;  3QO5 A;  4FK5 C;  4JYB A;  1WLE A;  1FXH A;  2AHY A;  2ZD9 A;  3R65 A;  4BW5 A;  3GWO A;  3MHS C;  1KKD A;  2EIM C;  2W6I G;  2R9I A;  2EIL C;  2HKO A;  3E86 A;  3F7Y C;  3SYC A;  3DGE A;  1K92 A;  1SET A;  1AJP A;  3K08 A;  1OCO C;  3ZJZ A;  4XDK A;  2JDI G;  1VQN V;  1H8H G;  1L1F A;  4ZKI A;  4PA9 A;  1QLE B;  1S3J A;  1H38 A;  2ZDI A;  1Q82 W;  1FXK B;  5CBG A;  4LC1 A;  4JTD B;  2ZXW C;  1I5X A;  2X0L A;  5HFL A;  4Z1M G;  1W2B U;  4GX0 A;  1SES A;  2Q69 A;  1VQ8 V;  3AG4 C;  2P6J A;  4UVB A;  3ZRS A;  1F51 A;  3KG2 A;  3W7X A;  4GX2 A;  2HVK C;  5L3E A;  3TET A;  1OCC C;  4UV8 A;  3IC7 A;  3OMN B;  3I56 V;  1PNL A;  4FMT A;  4ZBM A;  2DYS C;  2HJF C;  1PD3 A;  1K8A W;  1M9N A;  3SPH A;  1R6N A;  2H8P C;  2Q67 A;  4MS2 A;  1PNK A;  4MVU A;  2HFE C;  1OCR C;  4GT1 A;  1ARO P;  5CA3 A;  4XBF A;  1K3E A;  3WFV A;  2EZO A;  5KA5 A;  5DN6 G;  1VQO V;  4QNH B;  1PL0 A;  4TWK A;  4I5S A;  5CN0 A;  5B3S C;  1E79 G;  4HAM A;  3M99 B;  3FYE B;  3ZRW B;  2W0F C;  4RQE A;  2IW5 A;  4X8A A;  3PJS K;  2DYR B;  1YTF D;  3E8F A;  3SPC A;  4RAI A;  2Y69 C;  4JF3 A;  3ETG A;  3K03 A;  2XAS A;  1B6Q A;  2WLL A;  4Q20 A;  3OGC C;  2OT5 A;  1JPX A;  1XL4 A;  1Y66 A;  3ZN0 A;  1VQ6 V;  3P30 A;  2EIM B;  1BL8 A;  1GM9 A;  1NBM G;  2P7T C;  2X6C A;  2QTO A;  3CMA V;  1NVP B;  2K1E A;  4MVQ A;  1N8R W;  3T2M A;  1OCO B;  2WPD G;  1YJ9 V;  1I5Y A;  1VQK V;  2CK3 G;  2EIN B;  3CCV V;  2PI5 A;  1FXK C;  4P9P A;  3VOU A;  1BHA A;  4I9W A;  1JQ0 A;  4UVA A;  3CYO A;  3RVY A;  5H6R A;  2Y48 A;  1RM1 C;  1NKD A;  3CC4 V;  3WG7 B;  2DQ3 A;  3K79 A;  3GB7 C;  1MG1 A;  5LBQ A;  3CCM V;  4QJF B;  1K34 A;  2BOB C;  1VQP V;  2XOK G;  2WLM A;  3W7T A;  1CP9 A;  3MHH C;  3SJQ C;  3TK1 A;  2BOC C;  4LBE C;  1SER A;  2ZR2 A;  4BIU A;  3JYC A;  4P9O A;  4JPR A;  1FFT B;  1QCE A;  3K3W A;  3BY6 A;  1MAB G;  1QLE C;  2QM7 A;  3STL C;  1EZJ A;  2WLH A;  2HG5 C;  3ZMT A;  2EIJ C;  3AG3 C;  5H6Q A;  1F23 A;  4F4L A;  1RPO A;  4PA3 A;  2LP7 A;  5B3S B;  4MTX A;  3AG4 B;  2XAQ A;  3K0G A;  5KUM A;  2DYR C;  2IJK A;  3ASO B;  1EBO A;  1ZWI C;  3E8B A;  1KP3 A;  3CCL V;  1AJN A;  3D3I A;  4PDV A;  2ZQM A;  4CZZ A;  2WLJ A;  2YSU B;  1Y4M A;  3JD0 A;  1EFR G;  2KB1 A;  5KA6 A;  1M57 B;  1H2G A;  2IJH A;  4R6Z A;  5B1A B;  1NH2 B;  4R7C A;  4N23 A;  3ZRW A;  2P67 A;  1OCR B;  4MTG A;  3DTU B;  1BMF G;  1V54 B;  5FL7 G;  1MOF A;  2Z3Y A;  2UXX A;  1YJN V;  1R3L C;  3FKS G;  1KEC A;  2XAJ A;  5L3D A;  3OR6 C;  4P2Z A;  1AJQ A;  2OTJ V;  4RUF A;  5IY5 B;  2AHZ A;  1H8E G;  1J95 A;  1NJI W;  2EJR A;  3ASN B;  4G28 B;  1K4D C;  4LCU C;  4WCE V;  4XDL A;  4MSW C;  1IXM A;  2WAM A;  2OTL V;  3W7U A;  1UJW B;  2HR3 A;  4EKW A;  1YSC A;  3F7V C;  2WSS G;  4UVC A;  1GTO A;  1GM7 A;  3FYI B;  1QBZ A;  5LGN A;  1JJ2 U;  3E2E A;  2EIN C;  4PDR A;  4WFA V;  4JAS A;  1YIJ V;  1K9M W;  3ETE A;  3AG3 B;  2MK3 A;  3E8H A;  2QEX V;  1JOY A;  3CD6 V;  3OFN G;  2DWE C;  3MD0 A;  3AEI A;  3ETD A;  3LDD A;  4MTO A;  4J9Y B;  2IU0 A;  3E8G A;  1HWY A;  1OHH G;  1CPY A;  3T1C A;  1AR1 B;  5E1A C;  1S77 D;  1R73 A;  3FB5 C;  3ABU A;  1NR1 A;  3ABK C;  2D3O W;  5EBM C;  4FPP A;  3T4D A;  5H9C A;  5CMU A;  2ZR3 A;  4R8C A;  3CPW U;  1YTF B;  2C2A A;  4MW8 A;  1M1K W;  2EBO A;  3UM7 A;  1YHQ V;  2WLK A;  4GX1 A;  3OW2 U;  5B1A C;  1V54 C;  3ZRX A;  1NH2 D;  2EIJ B;  2V1D A;  3ABT A;  2IJI A;  4WFG A;  3VBB A;  2W6J G;  1DLB A;  1V55 B;  3ABL B;  4MVR A;  4MW3 A;  1DF5 A;  3OUF A;  3ABM B;  4GX5 A;  2M7W A;  4JTA B;  3OM3 B;  3QO8 A;  1VQ5 V;  2ITD C;  5DM6 V;  3G6E V;  4FIP C;  3STZ C;  3LNM B;  3LDC A;  2QKS A;  2UXN A;  3JD1 A;  1NVP D;  5EBL C;  1S0V A;  1FXK A;  4BIZ A;  1M57 C;  3AG1 B;  4TT3 G;  1G4Y B;  2DWD C;  2YEV A;  4MVM A;  3LSQ A;  2XND G;  4QE7 A;  1P4R A;  4RUE A;  1K5Q A;  2LFS A;  3W7W A;  1ENV A;  5IYD O;  4HYO A;  3P32 A;  3X2Q B;  4PDM A;  5B1O A;  1K33 A;  3ZIA G;  5L3F A;  1W0K G;  4PA7 A;  5HFM A;  5IDJ A;  3ZMS A;  3BEH A;  4KUM A;  1JCH A;  5B1B C;  2X6A A;  2P90 A;  2Q6A A;  2XAG A;  1FXV A;  5C93 A;  3SYP A;  1SZT A;  2ITC C;  3SYQ A;  3B8M A;  1PKX A;  3OR7 C;  4GCZ A;  4MT8 A;  1W0J G;  2ZDI C;  1LNQ A;  3QNE A;  1S76 D;  1VQ9 V;  3H01 A;  1ORQ C;  2B1I A;  2HLD G;  3K0D A;  2GHY A;  4KFM A;  3SYA A;  4N21 A;  5LHI A;  2A79 B;  1P7B A;  1OZ0 A;  2Q68 A;  2QE7 G;  4XDJ A;  3OEH G;  5LGU A;  3FB7 C;  3JD2 A;  4RO2 A;  1F4M A;  1S5H C;  1R6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...