4WFEA

Human traak k+ channel in a k+ bound conductive conformation
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
259
structure length
253
Chain Sequence
RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 97
structure length 253
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4wfeA00
1QLEC 2R9RB 4MVOA 4F4LA 4H33A 3JYCA 2H8PC 4MW8A 2ITCC 3ASOC 3IGAC 2WLIB 4PA4A 3TETA 3SYAA 3BEHA 4X89A 3E8FA 5B3SC 2OCCC 2IH1C 4MSWC 3UKMA 2A0LA 5E1AC 2IH3C 3R65A 4R8CA 4WFEA 2DYRC 4R7CA 3SPHA 5IY5C 4MTGA 5EK0A 1M56C 1R3KC 2WLLB 3OR7C 3OGCC 1G4YB 3F7YC 3FB6C 2ZXWC 4MS2A 1OCOC 2WLNA 3LDEA 4HYOA 4XDJA 5J9PC 2EIMC 5B1BC 4MVQA 3LDDA 4WFHA 3E8BA 4QNHB 1OCRC 3ASNC 3ABMC 1XL4A 5EBLC 3F7VC 4H37A 1LNQA 2WLJA 3SPJA 1R3IC 2EIKC 2WLIA 1OCZC 4MVMA 5B1AC 4MVUA 1XL6A 4PA9A 2WLMA 2EILC 1V54C 4OXSA 5KUKA 2NLJC 1V55C 2WLLA 5BZBA 2K1EA 3K03A 3T1CA 2AHZA 5KUMA 4LCUC 1ZWIC 2Q67A 2HFEC 3E89A 4BW5A 5CBHA 2DYSC 3K0DA 4X8AA 4XDKA 1M57C 2EIJC 2W0FC 2X6AA 3RVZA 3SYPA 3AG2C 2Q6AA 4JTDB 3FB7C 4TWKA 2KB1A 4JTCB 4X88A 3WG7C 2A9HA 4GX2A 4RUEA 3OUFA 3X2QC 3KG2A 2HVKC 4MW3A 4MVRA 2YEVA 3FB5C 4PDRA 2A79B 3HPLC 4LP8A 3SPCA 4WFGA 3UM7A 4RUFA 1R3JC 4P9OA 5CBFA 2Q69A 3K06A 1S5HC 3F5WC 4G28B 3K0GA 3RW0A 3E83A 1K4DC 4GX0A 3T4ZA 3AG3C 4J9YB 5EBWC 3E86A 3SYQA 3AG1C 2P7TC 3VOUA 4GX1A 2WLKA 3FB8C 4QE9A 4ZBMA 4RO2A 3OUSA 4MVSA 3GB7C 3LUTB 4PDMA 1K4CC 2X6BA 4WFFA 2BOBC 1R3LC 3RVYA 2EINC 1ORQC 2HG5C 3RBZA 1JVMA 4R50A 3ZJZA 2ATKC 2QTOA 4MVZA 2BOCC 2X6CA 4PDLA 4R6ZA 3ABKC 1P7BA 3E8GA 4HZ3A 4QE7A 5EC2C 4P9PA 3AG4C 3PJSK 3IFXA 5EBMC 2DWDC 4PDVA 4CBCA 2HVJC 4I9WA 4DXWA 1KKDA 2QKSA 3STZC 2JK5C 4KFMA 4RAIA 3SYOA 1J95A 2Q68A 3T2MA 2DWEC 4PA3A 3OR6C 3TCUA 2Y69C 3SPGA 3ZRSA 4JTAB 4PA6A 3E8HA 4G27B 5EC1C 2WLHA 4MTFA 4GX5A 3LDCA 5CBGA 4XDLA 3EFFK 3T4DA 2ZD9A 2AHYA 3SPIA 4MTOA 4LBEC 4EKWA 3K04A 3ABLC 3K08A 4J9ZB 4UUJC 4P2ZA 4PA7A 3STLC 4P30A 2HJFC 3LNMB 1OCCC 3SYCA 1BL8A 3SJQC 2ITDC
chains in the Genus database with same CATH superfamily
2R9RB 4UCSA 3W7SA 4MW8A 5B1NA 4X89A 1M90W 2IH1C 1S3JA 1SA0A 2YDEA 2A0LA 3WB1A 4B3SB 2BE3A 1WN7A 5LHHA 1G4YB 4FPPA 4Z1VA 5CA1A 4HYOA 2HR3A 4BIOA 2YC0A 3J7AU 3CHXA 4YJ2A 1JOYA 1XOUA 5B1AC 1VF6C 1SQXH 4NTYA 4CS4A 1XNRO 3N27A 2ZR3A 2P06A 3S3XA 3E35A 1M57C 5LGTA 2P6JA 3AG2C 3APQA 4UV8A 4X88A 3G6BA 4GX2A 4J7JA 4DV0B 1M5IA 1W59A 4Q6GA 3ETEA 4FLYA 1MZEA 4JI2B 1Y76A 4WFBV 4UXNA 4AQYO 3ETGA 2GHYA 5LYJB 4P9OA 4EB6A 4LFCB 2HEPA 4G28B 5GONA 3P32A 4IHJB 1L0NH 3E86A 3CB2A 2LW7A 1WP7A 1PL0A 4O4JB 1KP2A 5IJ0B 3CJHA 3E22B 3FFQA 2PYJA 1HDJA 5J2UA 2ZM6O 1WA8B 4HZ3A 3AG4C 1VQ4V 4H0LB 4PDVA 4FLVA 4JI8B 1DLBA 2WPDG 1TVKA 1J95A 4JTAB 3C90A 4JI7O 4H13B 4X20B 5FNVA 2P90A 5LP6B 3G80A 1YSCA 2F1MA 4TV8A 4FLWA 4GKKB 3APOA 3ZBHA 5A9GA 4O2AB 2RQ6A 1YZBA 2XOKG 1XNQO 3JASB 2ZNJA 2H94A 3WU2Z 2Y4TA 2G38A 1DF5A 2DOSA 4R7CA 1M56C 5JQGA 3N2KB 2WSSG 4CH6A 4I4TB 3ASOB 5LMUB 1AP5A 1AI4A 2KQXA 2OCCB 4QNHB 2CGOA 3JATA 3RFRA 4O2BB 1R3IC 2EIKC 1E1RG 4UVAA 2VWKA 3K58A 4PA9A 4DRXB 2WLMA 3JALB 2UU9B 1UPGA 2NLJC 2UXDO 4FZ1A 4JYAB 3CXHF 3T1CA 1TGOA 3H1HH 2ZE5A 2Z0AA 5LXTA 2EILB 1BQ0A 1RM1C 1IZ3A 4FM1A 1YHQV 4MTXA 2RJZA 1P7GA 2HHHO 4FJCC 1ENVA 3SPCA 2EIJB 4DW1A 4NYKA 4X62B 3CYOA 4FFBA 5JJNB 2QWQB 1N8RW 4UVBA 3OFNG 1K5QA 1DTOA 4UV9A 1NTZH 2V1DA 2ZE8A 4RO2A 3ETQA 1PPJH 3LUTB 1GN3A 2JGDB 2F93B 1SERA 3DGEA 3J80N 1MNGA 3E8GA 4C7UA 2GUZB 4E2LA 1COWG 3ZRXA 4CBCA 4I9WA 1GN6A 4BAYA 3ABLB 1AJNA 1NR1A 1P49A 4JI1B 4FFKA 4PA3A 4GKJO 2DMXA 5EZYB 2YSUB 4MTFA 4LF8B 3QO7A 2QSAA 4NXNO 2Q0OC 3IAYA 1OCCC 1QBZA 1QU7A 2QDOA 2ITDC 1VF7A 4MVOA 4H33A 1VIBA 3IJ4A 2OIEA 4LC1A 5IDJA 2PUSA 1A32A 1EN5A 5IY5C 3B8NA 4DV4B 1NQTA 3F5TA 1N33O 1OCOC 2EIMC 3ZMTA 5CN0A 1GN4A 1EN4A 3LSQA 1IX9A 4JV5B 1SC5B 3L74H 1AILA 4J80A 2ZXWB 1IBMB 1BCCH 2A7WA 1QLNA 2JVDA 4DV7B 2WLLA 1HR0O 3E89A 4BW5A 4N23A 2YIDA 4TWKA 2WA4A 1V54B 1O9HA 2JRIA 3X2QC 2LGQA 4CZZA 4FM0A 5LYJA 5LL6Y 2YI9A 2BTQA 4IHJA 1JCHA 5L3EA 4QIWF 1PKXA 1RSOB 1H38A 3UO3A 5IJ0A 3K3WA 4JF3A 2E5LB 3H1JH 3RT3C 1FJGB 3ZHRA 2PTMA 1WA8A 2EJ7A 2QWNB 1K92A 5KHGA 1BHAA 4LF7B 2GTAA 2BOBC 1R3LC 4UCOA 1JVMA 3ZJZA 4WBNA 4PDLA 3BRCA 4PI2A 3JD1A 1VQKV 3AG1B 2CH7A 1XREA 2JK5C 4RAIA 3OEEG 3QTCA 4X20A 2LFRA 5KA5A 2XAHA 5LP6A 3ZHTA 1KB9F 1ZTEA 1FXHA 3D36A 4UB6Z 4XDLA 4UCVA 1OV9A 4J9ZB 2FB5A 4O2AA 2OIGA 3JASA 2FKXA 2Q5ZA 3JYCA 2LQTA 2LW1A 3SYAA 1WLEA 2RMKB 2V7QG 4HNAB 3B2EE 4B3MO 1SF9A 4IT5A 4DV3O 2JDIG 1KQSU 1NS1A 2B1GA 1Z2GA 3OGIB 4O2BA 3QNEA 2AZ0A 2ADPA 2UXBB 4WFHA 2OYQA 4ZIBA 2JJ1G 3KKYA 4DRXA 3JALA 3SPJA 2IU0A 4FIPC 3CX5F 3NR7A 3Q4HB 1OCRB 2AHZA 1N34B 4K8ZA 4DR1O 4X8AA 3W7WA 4X1IB 4J11A 4JI3B 1EBOA 3UCSC 4DR7B 4DR6B 4OPAA 4RUFA 4NTWA 2OCHA 3F5WC 3UO2A 2IJKA 1M4UA 1MG1A 3AG3C 3ABUA 3SYQA 4J10A 2JGDA 2E75B 4QPJA 5A2QN 1IVSA 1K4CC 4DW0A 4YY3B 3EVKA 4U3JB 3DSQA 3BHPA 3OAAG 4NXMO 5CMUA 1GTOA 4DK1A 4WCEV 4OX9B 3I5DA 5EZYA 5LOVA 1XUQA 1PNMA 1G1XB 2XAJA 2L35A 1D2DA 3P30A 4LWSA 4DUYB 3RN4A 5DM6V 3ABTA 5LMNB 1VARA 2ARHA 4P30A 5IY5B 4FK5C 1KMIZ 1N0NA 1K3EA 1FYJA 1QLEC 3NXSA 3U10A 4PA4A 3BEHA 1YJWV 2VS0A 1HNXB 3JARB 3JSLA 4CH5A 3KCXA 1VQ7V 5EK0A 2VRZA 3OGCC 4LFAB 4XDJA 4B3TO 1K5SA 4ZKIA 3ABMC 4X65B 1SKVA 2DQ3A 2R70A 3X2QB 1NTKH 4OXSA 2ZE6A 2UXNA 4JPRA 4XDKA 4TOIA 4KHPO 3OTOB 1IBLB 1FXKC 3HKCA 4DV2B 3K5MA 2YIAA 4L8JA 4EFEA 1H2KA 3OE7G 3K79A 3QO8A 3K57A 1RSOA 3FB5C 1ZUQA 2NR5A 2UUCO 1D5NA 4X66O 3UM7A 5CBFA 1X4TA 3KCYA 2ZDIA 1EZJA 2P22C 4HBNA 3RW0A 4DV6O 1JPXA 4J9YB 5JJJB 1THZA 2E76B 1Q7YW 2X6BA 3W7XA 3TXQA 1F23A 1MZFA 1AVMA 1H2MA 3OEHG 4IYIA 1R6TA 3AEIA 1SETA 1KKDA 2QKSA 4JI6O 5JVDA 1Y67A 3T2MA 1IBKB 3OR6C 1NKDA 1SQFA 4GCZA 3ABKB 3D3QA 1KUQA 1IXBA 1E79G 4GLXA 2VQEB 1OJHA 3CXCU 2QM7A 1EM1A 2ZR2A 3HKBB 3CMEV 1XMOB 2Q8VA 1IURA 1G6UA 4UUJC 4PA7A 5IWAB 1JJ2U 4HNAA 4K35A 3JAWB 2H8PC 3IGAC 1JX9A 1Y74A 3ZMVA 1LUVA 4QPKA 4BW9A 3UKMA 2AGAA 2JEUA 2RN9A 2BTOA 4KL1A 4B3RO 1ROPA 1Q5OA 3F7YC 2JS5A 5B1BC 3B77A 3CS5A 2OTLV 1SZTA 4O4HB 2AXTZ 4DV0O 5ITZB 3Q4HA 2XUMA 2WLIA 4DV5B 4DR2B 4JI2O 5KX5A 2Y4UA 1PNLA 3ZMSA 1JR9A 4X1IA 4K0KO 4LF4O 2LGWA 4GZRB 4LF9B 3RVZA 4FLXA 4Q20A 5DEDA 4RQFA 4AHCA 1V55B 1GRJA 2ADQB 1SS3A 2IJIA 1H8EG 4LP8A 1Q82W 1FFXB 2QKCA 5GW7A 3G71V 2K9PA 2CTQA 2PZSA 1SESA 4I0XB 4U3JA 3OT7A 2WLKA 4DO2A 1S72V 1OHHG 5IT9N 2E3CA 2OT5A 2EINC 2F4VB 3HKDA 4JYCA 1KU9A 2AW9A 2EBOA 4PV1B 1IXMA 5IYZA 5HFLA 3ZRWB 2Y0IA 5H9CA 2Y69C 4XBFA 5J2TB 3P3PA 5EC1C 4GX5A 5CBGA 3EFFK 1YCIA 5LMUO 4NR1A 4ZOLA 4F4LA 3JARA 2ZT9B 1WB7A 5B3SC 3UT5B 2UU9O 2CUGA 1U96A 1EZVH 4JI5O 3ZHVA 3ZX6A 4F6RB 1JMKC 1OCZC 3TK1A 2B5UA 5TISZ 3FAVB 4X62O 3R66A 2CDYA 5H5NA 3ASNB 5BZBA 1J5EB 1NVPB 3ZCCA 1F4MA 5KUMA 4GYCB 3ZS8C 3WG7C 2KB1A 4CS2A 4MVRA 4EEQA 1VQ5V 2P5OA 2XAFA 3HB3B 1AP6A 2XTAA 4JI1O 3E83A 2Z3YA 3W7UA 4PJ0Z 4PHZA 4ZBMA 4MVSA 2ZM6B 4WFFA 2QKAA 2UUBB 1I5YA 1EN6A 3B09A 5KAIZ 3CP1A 1B06A 3SJCC 3A0HZ 2A3QA 4P9PA 4K3AA 2QGNA 2DWDC 5EBMC 2IBZH 4JAUA 2HKOA 4LFBO 1H2SB 1HNZO 1GN2A 1NT2B 3CWBH 3HKBA 5LGUA 2Q9LA 4TQDA 3JAKB 4CS3A 2Y0PA 2CE4A 3CCMV 1QVGU 5B5EZ 5IYCO 3SPIA 3VQXA 3JAWA 2OWOA 1P4RA 4J42A 3SYCA 3L71H 2VQFO 1XNQB 2YI8A 5H6QA 5C8YA 2LJ2A 1UFIA 1IBMO 3E8FA 5BXZA 3DC5A 4JI0O 1QVFU 4ZHQB 4DV7O 2D3OW 3P3NA 1VQLV 2UXCO 2GV9A 4FLTA 1R3KC 4O4HA 5ITZA 5K1XA 3E8BA 1K73W 1W0JG 2IW5A 1BS3A 5KAFZ 1XEQA 2UXDB 3CC2V 1JA8A 2Q67A 1B04A 4LNUB 1BHBA 4ASUG 5B1AB 1VP7A 3H1KH 4RUEA 2CTWA 4FM2A 4LF7O 1FFXA 2JS3A 3HPLC 4LF6O 1M57B 3AG2B 2KKWA 3ZN0A 1YDXA 3CCLV 4GX0A 2MK3A 1P84F 1N32B 2RCVA 4GX1A 1NU1H 2N05A 1YTFB 3CCUV 3CRAA 2ETNA 2QTOA 2R9IA 4OGQB 1R6KA 4RWUA 3WB2A 1UJWB 4CC5A 3PJSK 3ZRWA 1ZX3A 4YJ3B 5J2TA 1O9GA 1SQVH 2DWEC 1YF2A 4NTXA 4NB5A 4O4JA 3E22A 3AG4B 3CD6V 1L1FA 1WJZA 4EFBA 1K97A 3T4DA 1BMFG 4EKWA 1FPOA 2B9ZA 4JGSA 2UXBO 3PN1A 2P4VA 4DV1B 1AJQA 1VF5B 1R1BA 5GTHZ 3UT5A 4CH3A 4DR5B 3SDLA 4DR4O 5EYPB 5E1AC 1PM9A 2DYRC 2M6YA 1WNSA 4RQEA 1N34O 4MS2A 4K8XA 4F6RA 3RYIB 1I5XA 1DGSA 4DK0A 3LDDA 2C2AA 4DR7O 3FAVA 4H37A 4DR6O 1M56B 1GH6A 4I55B 4YHHO 1US6A 1HP8A 2HP8A 4JI4O 3K59A 1I94O 2X7RB 4FLZA 2FYUH 3N2KA 1XHZA 1MABG 1VQOV 4I4TA 2YIBA 4UCRA 2EIKB 1CPYA 2DYSC 1YEWA 1X59A 2Z5UA 1PD3A 2QWOB 1S5JA 3KG2A 3OD4A 3QF7A 1MOFA 3T1HO 5LBQA 5L3FA 4OX9O 1RM1B 3A0RA 2YXYA 1Y66A 4B7EA 3SR2C 4LH7A 2QEXV 3ML0A 1MSWD 4Z1MG 1S0VA 5LMNO 2UUAO 1I08A 5EC2C 4FVMA 1F7YA 5BR8B 3STZC 1S76D 3JAKA 1BSMA 1HNXO 4WF9V 3OM3B 3LDCA 1XMQB 4DR3B 5B66Z 1I0HA 5L3DA 4LBEC 2F23A 3STLC 2GUZA 4I50B 1KYOF 2EX3A 3BY6A 4ZHQA 5C93A 3UQ8A 1VQNV 2ITCC 1PP9H 4B3MB 3OTFA 2XAGA 4R8CA 1OCCB 1GMGA 1XDCA 1U97A 3OTOO 2F95B 3QVNA 1TUEB 2RNBA 1XHXA 3SJBC 4FZ0A 4O4IB 1PV0A 2OTJV 3F7VC 4MVMA 5BMVB 1OCOB 1K9MW 1ZLZA 2EIMB 3C3SA 4LNUA 2ZCEA 2B1IA 5KUKA 1VF6A 4YIOA 4DR1B 4EB6B 5IYDO 2UXXA 3OMNB 5GONB 4LCUC 2LP7A 3ZMZA 5CBHA 1BE3H 3K0DA 5KMGB 1YITV 1QR8A 3CRRA 3JD4A 3CRQA 2WAMA 3CJHB 2HVKC 3CCJV 1NZ6A 5IE9A 4X64B 1R73A 2L6LA 4BWAA 5BY1A 2P7TC 2EULA 2IU3A 5EIBD 2VQEO 3EHBB 4IGGA 4YJ3A 1P7BA 3ZN1A 1YXBA 4TV8B 3IFXA 3BA9A 2EJRA 5FLXN 4DXWA 5LP6C 1T5EA 4IL6Z 4KFMA 4UFZA 4W4KA 3HKEB 3D36C 2D2CB 4DYLA 2XNDG 4I9QA 1N36B 1NR7A 3D3IA 5KHIA 2AHYA 4MTOA 3K04A 1TA8A 2ZE7A 1K33A 5LA6B 1BL8A 2ZNIA 2FTKA 4JZ2A 4DV5O 4DR2O 2LO1A 2Q73A 2QM8A 3ASOC 4D7SA 2OCCC 4AI8A 1Q81W 3RYIA 3R65A 2P67A 3OR7C 1XBLA 3VQYA 1SQQH 3SJAC 5L3BA 4B3SO 1W0KG 4DUZB 1E1QG 3JD0A 1AR1B 5L3GA 2WLJA 4BR6A 3ZEDA 1V9PA 1FAFA 3DXRB 1VQ8V 4JAAA 2EILC 1LUWA 3AK1A 1KP3A 4KXRA 3A8TA 2YXHA 4TT3G 1Q3EA 4FFBB 4GUNA 3VQWA 1HNWB 2WWWA 3QG5A 1Q86W 2EIJC 3SYPA 2DE0X 2JEXA 3RYCB 2IJHA 4LF5B 1L8DA 1KBHA 2F4VO 1GO3F 2A79B 3T1YB 3KZIZ 4TSFG 3MHSC 1R3JC 1NH2B 1AR5A 1S5HC 3L75H 1GM7A 3U0ZA 1YJ9V 2GTSA 4LFCO 1M93A 1SRYA 1K4DC 3K5LA 3VOUA 2QE7G 1H8HG 3IC9A 3MD0A 4R50A 3AG3B 1VQ9V 4JI6B 1FKAO 3VQVA 4TUYB 4JI8O 2DQ0A 4B08A 3K9AA 2PY5A 3SPGA 3JD3A 2YICA 4ABMA 3FYIB 5D5PA 1LR1A 2QR4A 4I50A 4JYYA 3K08A 1XILA 1Q43A 2KSDA 2A06H 2BSKB 2BCCH 1VQ6V 3E2EA 4KP4A 4GKKO 3TETA 4B3RB 3TXSA 4FLUA 3OW2U 5CB4B 4WFEA 1J5EO 2E74B 2WLLB 1QLEB 3CPWU 2FMLA 4O4IA 2ZXWC 4X9QA 4QGPA 3MHHC 2Q7HA 1HWYA 5L3CA 5IYBO 1Q6IA 5KHHA 5BMVA 2KG7B 4IIJB 1XQ8A 1BGYH 2DJVA 5JH7B 4UVCA 4BIUA 4K0KB 1V54C 2BTQB 4D6TH 4LF4B 1NTMH 5KMGA 3ABMB 3DTUB 2QWPB 4QJFB 1ZWIC 2WA3A 1RFYA 4JYAO 2Q6AA 4JTDB 1MSDA 1WP8A 3WB0A 1ZL8B 2F43G 2UUBO 3K9SA 3CCEV 2ZDIC 3JCZA 4WBNB 1XNRB 1FXKB 1DF4A 3CC7V 3C3TA 3GVMA 2CH7B 3AG1C 2QM4A 3B8MA 4PD4F 5H2FZ 3CCVV 4CC6A 1YJNV 1BQZA 5CA0B 4LH6A 4AQYB 2JIZG 4JYBA 2CAZC 3HKEA 1NVPD 3M7MX 1YVWA 1GM8A 2GSMB 1BZKA 2Q68A 1H2GA 2YIBD 3K5NA 3EXAA 2W6IG 3G4SV 2WLHA 2ZD9A 5LA6A 3THOA 1QQCA 3QO5A 4LF8O 1TUBB 2IJJA 4U7OA 5F2VO 1K34A 1WB8A 3I56V 1NJIW 1I7FA 1QNMA 3G67A 1GAXA 1EFRG 3J81N 2CTPA 4MSWC 2PF4E 3I55V 4JI7B 1MMMA 1VQPV 4JI5B 5J9PC 3FB6C 2CGNA 2Q0AA 3JD2A 3BFRA 3LDEA 4W4LA 4DV4O 4FMTA 1FS0G 1OCRC 2JJ2G 3DXRA 2JGUA 3FX7A 4PI0A 4JV5O 5FPRA 2AZ2A 1XL6A 5B1BB 3GWKC 3OMAB 3N2GB 3FYEB 4J7ZA 3RYCA 1AI5A 4ZI7B 3HR0A 2W0FC 1WPBA 1N32O 4JAVA 3LSUA 4JTCB 2A9HA 3S3WA 1GKFA 3G6EV 2H3OA 3H01A 3BPZA 3RYHB 4X1KB 2P4KA 4ICGA 3B40A 5LOVB 5HFMA 2E5LO 4LR3A 5D5QA 3OUSA 4LWSB 1FJGO 4PDMA 1S5LZ 2R72A 3RVYA 1ORQC 2HHHB 2ATKC 1WPXA 1JFFB 4TUYA 4DV1O 4BIZA 4LFBB 1URFA 1HNZB 1Q8IA 4DR5O 1H2LA 2EINB 5H6RA 3RWRD 1N0JA 3A0BZ 4I0XA 2RDCA 2GBOA 3ZHUA 1F51A 4U7NA 1XI1A 4HAMA 4YIPA 1FXVA 1Y6XA 3BVOA 2BSKA 2ZIOA 2VQFB 5JCOA 2PI5A 1CXZB 2Y69B 1D5AA 1Q6UA 3SJQC 3A2FA 4TQFA 3BABA 1QR9A 4YXWG 4JI0B 3CEIA 5CB4A 4GKJB 1YTFD 2UXCB 2ZKOA 5EIBC 2ZINA 4MTGA 3U11A 5K1PA 2NN4A 1F4NA 4J41A 2KG7A 4IIJA 1VMGA 4MVQA 4NXNB 5JH7A 5B3SB 5KLVH 5LGNA 3O65A 4Z2WA 3HKCB 3CCSV 1HW7A 1RPOA 3CC4V 3LNNA 4X1YB 4B7KA 3L72H 1ZSPA 2K1EA 3K03A 3MDSA 1OCZB 3M99B 1N33B 2EZPA 1ZL8A 1GK9A 5E79Z 3RYFB 3BAAA 4TV9B 1KECA 3FB7C 4L87A 1AROP 3OUFA 4JI3O 1FXKA 2Q7GA 4LF6B 4MW3A 3TJTA 2ILMA 2YUAA 1JQ0A 4N21A 4WFGA 3WG7B 2MW2B 3K06A 2ZIMA 2YEVB 1H2NA 1SZXA 3K0GA 5BR8O 1HR0B 4F6EA 2XASA 2F66C 5JVDB 5EBWC 2HJDA 3IC7A 4GT1A 5CA0A 3DC6A 4IYHA 1M1KW 5DECA 1XMQO 4DR3O 4MT8A 2HG5C 1K7DA 2LFSA 4MVZA 4YY3O 2X6CA 3ZHSA 3ABKC 2N74A 4UCUA 3RGBA 1W2BU 5IJ9B 3SYOA 1WAZA 1Y74B 2V4DA 3E8HA 4O4LB 1TUBA 2VWJA 4DUYO 3BCCH 4OPHA 2XHBA 2YS8A 1N4CA 2QWRB 2HJFC 2QTSA 4DR4B 2QJ1A 2R9AA 4A5UB 3ICXA 4I5SA 2WLIB 2XT9A 3K5OA 1GM9A 4KUMA 5KX5B 4UCTA 2IH3C 5KHKA 5LHGA 3ZIAG 4UB8Z 1RP3B 4AILC 1SA0B 1B6QA 2CK3G 2WLNA 3L9DA 3B4SA 4LFAO 1OZ0A 1AJPA 2XAQA 2W0XA 5CA1B 1XL4A 1LNQA 4YHHB 1NI8A 4JI4B 1SQBH 1I94B 1VQMV 5KA6A 3AG7A 1YIJV 4E4EA 3N2GA 4X65O 4YJ2B 1NBMG 4PELA 1BT8A 4ZI7A 1V55C 4X64O 5DN6G 1VEWA 2YXLA 1Q6HA 4DV3B 5FL7G 1R6NA 2X6AA 1AB3A 3SGIA 3JSNA 1FD9A 3ZRVA 1IBLO 4DV2O 2PYLA 3CCQV 3T1HB 4PDRA 2ODMA 3RYHA 3L70H 3HKDB 2PI4A 4X1KA 2Q69A 2O57A 3AK3A 1K8AW 3O9OA 1Y76B 3JCUZ 5IYZB 4I7ZB 1N36O 5JCOC 3H1IH 3H1LH 1JFFA 2UUAB 3RBZA 1Y4MA 3W7TA 3BA8A 2DW4A 5J2UB 2Y48A 3CSXA 2W6JG 4ZOLB 1CEZA 3ZHQA 3TCUA 2CTRA 4CH4A 3FD9A 3ZRSA 1KKCA 1M9NA 1IBKO 2N04A 1TVKB 4NKGB 1JJOA 3L73H 3TGUH 2FL4A 5FNVB 3VBBA 2X0LA 4P2ZA 4NXMB 4DUZO 1XMOO 3LNMB 3LSSA 4G2KA 3JAMN 5IWAO 2EZOA 1TAEA 3H9VA 1KD1W 1G8MA 5KHJA 1FFTB 2ZQMA 1QHTA 5JJEB 3SPHA 1HNWO 1CP9A 5FPOA 3D8CA 2QA4V 2NNUA 5GTIZ 3CRCA 1KC8W 5JQGB 1SQGA 3ASNC 3WFVA 3CCRV 4LF5O 5EBLC 4X1YA 3M8AA 2DYRB 3ZMUA 5EYPA 4MVUA 5CA3A 3T1YO 3JATB 5LHIA 1Z5VA 3RYFA 3GWOA 3OMIB 4TV9A 1DK1A 2HFEC 1SQPH 2GDSA 3ETDA 4H44B 4B3TB 4LF9O 4U3FH 3CE2A 5LXTB 4I55A 2PGGA 2YEVA 2DYSB 3FKSG 1RPRA 4D7TA 1PNKA 5JWPA 3T4ZA 4KHPB 1Q90D 3FB8C 4QE9A 5B1OA 1IDSA 3GB7C 1Z5WA 4JASA 2IM9A 2UUCB 2BOCC 4R6ZA 4X66B 1L0LH 1MA1A 5IJ9A 4JZGA 4QE7A 2DN9A 3AK2A 2M7WA 2HVJC 5C8YB 1QCEA 2Q4PA 1AI7A 4O4LA 3MAQA 1S77D 4DV6B 2HLDG 4NVPA 4G27B 4PA6A 2Q7EA 3CRMA 4WFAV 1YI2V 1PL4A 3ABLC 1ZAUA 1NH2D 5AG2A 1B3QA 3CMAV 1AR4A 1AI6A 4J7KA
chains in the Genus database with same CATH topology
1QLEC 2R9RB 1NJIW 3NXSA 3W7SA 4MW8A 5B1NA 4PA4A 1EFRG 3BEHA 4X89A 1YJWV 4MSWC 2IH1C 1S3JA 1M90W 2A0LA 5E1AC 3I55V 2DYRC 1VQ7V 5EK0A 4RQEA 5LHHA 1VQPV 3OGCC 1G4YB 4FPPA 5J9PC 3FB6C 4MS2A 4XDJA 4HYOA 3JD2A 1K5SA 3LDEA 4ZKIA 1I5XA 2HR3A 3LDDA 4FMTA 2C2AA 1FS0G 1OCRC 2JJ2G 3ABMC 4H37A 1JOYA 1M56B 5B1AC 1XL6A 2DQ3A 5B1BB 3X2QB 2X7RB 3OMAB 4OXSA 2ZR3A 2UXNA 1MABG 1VQOV 3FYEB 4JPRA 2EIKB 1AI5A 1CPYA 2DYSC 3E35A 4XDKA 1M57C 2W0FC 5LGTA 2P6JA 1FXKC 3AG2C 2Z5UA 1PD3A 4JAVA 4UV8A 4JTCB 4X88A 2A9HA 4GX2A 1GKFA 3KG2A 3G6EV 3ETEA 3OE7G 3K79A 3QO8A 3FB5C 4WFBV 4UXNA 1MOFA 5LBQA 3UM7A 3ETGA 2GHYA 4P9OA 5CBFA 3H01A 5L3FA 1RM1B 2ZDIA 1EZJA 3A0RA 4G28B 3RW0A 1Y66A 3P32A 1JPXA 4J9YB 3E86A 2QEXV 1PL0A 5HFMA 1KP2A 1THZA 3OUSA 1Q7YW 4PDMA 2X6BA 3W7XA 3ML0A 3RVYA 1MSWD 1F23A 1ORQC 4Z1MG 2ATKC 1S0VA 1WPXA 4HZ3A 3OEHG 5EC2C 4BIZA 3AG4C 1VQ4V 4PDVA 3AEIA 1SETA 1KKDA 2QKSA 3STZC 1DLBA 2WPDG 1S76D 2EINB 1J95A 5H6RA 3T2MA 3OR6C 1NKDA 4GCZA 4JTAB 3ABKB 4WF9V 1F51A 4U7NA 1E79G 4HAMA 2P90A 3OM3B 1FXVA 3LDCA 3CXCU 2QM7A 2ZR2A 5L3DA 3CMEV 1YSCA 4LBEC 4UUJC 4PA7A 3STLC 2PI5A 1JJ2U 2Y69B 3SJQC 3BY6A 1QR9A 4YXWG 5C93A 1VQNV 2H8PC 2ITCC 2XOKG 3IGAC 1JX9A 3ZMVA 2H94A 1YTFD 4QPKA 3UKMA 2JEUA 1DF5A 2XAGA 4R8CA 1OCCB 4R7CA 1GMGA 1ROPA 4MTGA 1M56C 1F4NA 2WSSG 3F7YC 3ASOB 5B1BC 3B77A 4MVQA 2OTLV 1AI4A 1SZTA 1TUEB 5B3SB 2OCCB 4QNHB 5LGNA 3CCSV 2OTJV 3F7VC 1RPOA 1R3IC 2EIKC 2WLIA 1E1RG 4MVMA 3CC4V 4UVAA 1OCOB 4PA9A 1K9MW 2WLMA 2EIMB 1PNLA 2B1IA 3ZMSA 5KUKA 2NLJC 2K1EA 3K03A 3T1CA 5IYDO 2UXXA 3OMNB 4LCUC 2LP7A 1OCZB 3M99B 2EZPA 3ZMZA 5CBHA 3K0DA 3RVZA 1GK9A 1YITV 4Q20A 1QR8A 2EILB 1KECA 3FB7C 4RQFA 1RM1C 3JD4A 1AROP 4L87A 3OUFA 2WAMA 1YHQV 1V55B 1FXKA 2IJIA 2HVKC 4MTXA 4MW3A 4FJCC 1ENVA 1H8EG 4LP8A 1Q82W 3CCJV 3SPCA 1JQ0A 2EIJB 4N21A 4WFGA 3CYOA 3WG7B 3K06A 5GW7A 3G71V 2YEVB 1N8RW 3K0GA 4UVBA 3OFNG 2XASA 1R73A 1K5QA 5EBWC 3IC7A 1DTOA 1SESA 4UV9A 2P7TC 4GT1A 2WLKA 2IU3A 4DO2A 2V1DA 4RO2A 1S72V 1M1KW 1OHHG 3LUTB 3EHBB 4MT8A 2OT5A 2EINC 1SERA 2HG5C 3DGEA 1K7DA 2LFSA 4MVZA 4JYCA 2X6CA 3ABKC 1P7BA 3E8GA 3ZN1A 4E2LA 3IFXA 1COWG 2EBOA 3ZRXA 2EJRA 4CBCA 1W2BU 4I9WA 4DXWA 1IXMA 4BAYA 3ABLB 1AJNA 1NR1A 4KFMA 5HFLA 3SYOA 3ZRWB 4PA3A 5H9CA 2Y69C 4XBFA 2XNDG 1NR7A 2YSUB 3E8HA 5EC1C 4MTFA 4GX5A 3D3IA 5CBGA 3EFFK 3QO7A 2AHYA 4MTOA 3K04A 2HJFC 1OCCC 1K33A 1QBZA 1BL8A 2ITDC 2FTKA 4F4LA 4MVOA 4H33A 4I5SA 2QM8A 3ASOC 2WLIB 5B3SC 1GM9A 4KUMA 2OCCC 4LC1A 5IDJA 1Q81W 2IH3C 3R65A 5LHGA 3ZIAG 5IY5C 2P67A 3B8NA 3OR7C 1NQTA 5L3BA 1B6QA 1OCOC 2CK3G 2WLNA 2EIMC 1W0KG 3ZMTA 5CN0A 1OZ0A 1AJPA 2XAQA 3LSQA 1E1QG 3JD0A 1XL4A 1AR1B 5L3GA 1LNQA 2WLJA 1OCZC 1VQMV 5KA6A 1YIJV 2ZXWB 3TK1A 1VQ8V 2B5UA 2EILC 1QLNA 1NBMG 4PELA 1KP3A 1V55C 4TT3G 2WLLA 3ASNB 5BZBA 1NVPB 5DN6G 2WWWA 3ZCCA 1F4MA 5KUMA 3E89A 4BW5A 1Q86W 4N23A 5FL7G 2EIJC 1R6NA 2X6AA 3SYPA 3WG7C 4TWKA 2KB1A 1V54B 2JEXA 3ZRVA 3X2QC 2IJHA 4CZZA 3CCQV 4MVRA 1GO3F 1VQ5V 4PDRA 2A79B 2XAFA 2PI4A 4TSFG 3MHSC 1JCHA 1R3JC 1NH2B 3HB3B 5L3EA 2Q69A 4QIWF 1PKXA 1S5HC 1K8AW 1GM7A 1YJ9V 1H38A 1SRYA 3E83A 1K4DC 3K3WA 4JF3A 2Z3YA 3VOUA 2QE7G 3W7UA 1H8HG 4ZBMA 1K92A 4MVSA 1BHAA 4WFFA 2BOBC 1I5YA 1R3LC 3RBZA 1JVMA 3MD0A 4R50A 3ZJZA 1Y4MA 3CP1A 4PDLA 3AG3B 3W7TA 3JD1A 1VQKV 2DW4A 4P9PA 3AG1B 1VQ9V 2Y48A 5EBMC 2DWDC 4JAUA 2HKOA 2W6JG 1CEZA 2JK5C 4RAIA 3OEEG 3TCUA 2LFRA 2DQ0A 5KA5A 3K9AA 3SPGA 2XAHA 3ZRSA 1M9NA 3JD3A 5LGUA 1FXHA 3D36A 3FYIB 3CCMV 4XDLA 1QVGU 5IYCO 3SPIA 4J9ZB 3K08A 3VBBA 2X0LA 4P2ZA 1P4RA 3LNMB 3LSSA 3SYCA 4G2KA 1VQ6V 5H6QA 2EZOA 3E2EA 3JYCA 4KP4A 1KD1W 3TETA 3SYAA 1WLEA 2V7QG 1G8MA 3E8FA 1FFTB 1QVFU 2ZQMA 2D3OW 3OW2U 1VQLV 4WFEA 3SPHA 1CP9A 1R3KC 2WLLB 1QLEB 3CPWU 2JDIG 2ZXWC 2QA4V 1KQSU 2NNUA 2B1GA 3MHHC 3QNEA 1KC8W 4WFHA 3E8BA 1HWYA 5L3CA 2JJ1G 1K73W 5IYBO 1W0JG 2IW5A 3ASNC 3WFVA 3CCRV 5EBLC 2DYRB 3SPJA 3ZMUA 2IU0A 4FIPC 4UVCA 4MVUA 4BIUA 5CA3A 5LHIA 3CC2V 1V54C 1OCRB 3ABMB 3GWOA 3OMIB 3DTUB 2AHZA 4QJFB 1ZWIC 2Q67A 1BHBA 2HFEC 4ASUG 4X8AA 3ETDA 3W7WA 5B1AB 2Q6AA 4JTDB 1EBOA 4RUEA 2F43G 3CCEV 2YEVA 2ZDIC 3HPLC 2DYSB 3JCZA 1M57B 3FKSG 4RUFA 1FXKB 3AG2B 1DF4A 3ZN0A 3CC7V 1RPRA 3F5WC 1PNKA 2IJKA 1MG1A 3CCLV 4GX0A 3T4ZA 3AG3C 2MK3A 3ABUA 3SYQA 3AG1C 4GX1A 3B8MA 3FB8C 4QPJA 1YTFB 4QE9A 5B1OA 3CCUV 3GB7C 3CCVV 1K4CC 1YJNV 4JASA 2QTOA 2R9IA 2BOCC 4R6ZA 3OAAG 1R6KA 2JIZG 4JYBA 4QE7A 1UJWB 5CMUA 1GTOA 3PJSK 3ZRWA 1NVPD 4WCEV 2M7WA 2HVJC 1GM8A 2GSMB 1QCEA 1PNMA 1AI7A 2Q68A 2XAJA 2DWEC 1S77D 3P30A 1H2GA 2HLDG 2W6IG 3AG4B 3G4SV 4PA6A 4G27B 3CD6V 2WLHA 1L1FA 4WFAV 1YI2V 1K97A 3T4DA 1BMFG 2ZD9A 5DM6V 3ABTA 4EKWA 3ABLC 4JGSA 3QO5A 1NH2D 2IJJA 4P30A 5IY5B 4FK5C 4U7OA 1AJQA 3CMAV 1K34A 1AI6A 1K3EA 3I56V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLE C;  2R9R B;  4MVO A;  4F4L A;  4H33 A;  3JYC A;  2H8P C;  4MW8 A;  2ITC C;  3ASO C;  3IGA C;  2WLI B;  4PA4 A;  3TET A;  3SYA A;  3BEH A;  4X89 A;  3E8F A;  5B3S C;  2OCC C;  2IH1 C;  4MSW C;  3UKM A;  2A0L A;  5E1A C;  2IH3 C;  3R65 A;  4R8C A;  4WFE A;  2DYR C;  4R7C A;  3SPH A;  5IY5 C;  4MTG A;  5EK0 A;  1M56 C;  1R3K C;  2WLL B;  3OR7 C;  3OGC C;  1G4Y B;  3F7Y C;  3FB6 C;  2ZXW C;  4MS2 A;  1OCO C;  2WLN A;  3LDE A;  4HYO A;  4XDJ A;  5J9P C;  2EIM C;  5B1B C;  4MVQ A;  3LDD A;  4WFH A;  3E8B A;  4QNH B;  1OCR C;  3ASN C;  3ABM C;  1XL4 A;  5EBL C;  3F7V C;  4H37 A;  1LNQ A;  2WLJ A;  3SPJ A;  1R3I C;  2EIK C;  2WLI A;  1OCZ C;  4MVM A;  5B1A C;  4MVU A;  1XL6 A;  4PA9 A;  2WLM A;  2EIL C;  1V54 C;  4OXS A;  5KUK A;  2NLJ C;  1V55 C;  2WLL A;  5BZB A;  2K1E A;  3K03 A;  3T1C A;  2AHZ A;  5KUM A;  4LCU C;  1ZWI C;  2Q67 A;  2HFE C;  3E89 A;  4BW5 A;  5CBH A;  2DYS C;  3K0D A;  4X8A A;  4XDK A;  1M57 C;  2EIJ C;  2W0F C;  2X6A A;  3RVZ A;  3SYP A;  3AG2 C;  2Q6A A;  4JTD B;  3FB7 C;  4TWK A;  2KB1 A;  4JTC B;  4X88 A;  3WG7 C;  2A9H A;  4GX2 A;  4RUE A;  3OUF A;  3X2Q C;  3KG2 A;  2HVK C;  4MW3 A;  4MVR A;  2YEV A;  3FB5 C;  4PDR A;  2A79 B;  3HPL C;  4LP8 A;  3SPC A;  4WFG A;  3UM7 A;  4RUF A;  1R3J C;  4P9O A;  5CBF A;  2Q69 A;  3K06 A;  1S5H C;  3F5W C;  4G28 B;  3K0G A;  3RW0 A;  3E83 A;  1K4D C;  4GX0 A;  3T4Z A;  3AG3 C;  4J9Y B;  5EBW C;  3E86 A;  3SYQ A;  3AG1 C;  2P7T C;  3VOU A;  4GX1 A;  2WLK A;  3FB8 C;  4QE9 A;  4ZBM A;  4RO2 A;  3OUS A;  4MVS A;  3GB7 C;  3LUT B;  4PDM A;  1K4C C;  2X6B A;  4WFF A;  2BOB C;  1R3L C;  3RVY A;  2EIN C;  1ORQ C;  2HG5 C;  3RBZ A;  1JVM A;  4R50 A;  3ZJZ A;  2ATK C;  2QTO A;  4MVZ A;  2BOC C;  2X6C A;  4PDL A;  4R6Z A;  3ABK C;  1P7B A;  3E8G A;  4HZ3 A;  4QE7 A;  5EC2 C;  4P9P A;  3AG4 C;  3PJS K;  3IFX A;  5EBM C;  2DWD C;  4PDV A;  4CBC A;  2HVJ C;  4I9W A;  4DXW A;  1KKD A;  2QKS A;  3STZ C;  2JK5 C;  4KFM A;  4RAI A;  3SYO A;  1J95 A;  2Q68 A;  3T2M A;  2DWE C;  4PA3 A;  3OR6 C;  3TCU A;  2Y69 C;  3SPG A;  3ZRS A;  4JTA B;  4PA6 A;  3E8H A;  4G27 B;  5EC1 C;  2WLH A;  4MTF A;  4GX5 A;  3LDC A;  5CBG A;  4XDL A;  3EFF K;  3T4D A;  2ZD9 A;  2AHY A;  3SPI A;  4MTO A;  4LBE C;  4EKW A;  3K04 A;  3ABL C;  3K08 A;  4J9Z B;  4UUJ C;  4P2Z A;  4PA7 A;  3STL C;  4P30 A;  2HJF C;  3LNM B;  1OCC C;  3SYC A;  1BL8 A;  3SJQ C;  2ITD C; 
#chains in the Genus database with same CATH topology
 2R9R B;  4UCS A;  3W7S A;  4MW8 A;  5B1N A;  4X89 A;  1M90 W;  2IH1 C;  1S3J A;  1SA0 A;  2YDE A;  2A0L A;  3WB1 A;  4B3S B;  2BE3 A;  1WN7 A;  5LHH A;  1G4Y B;  4FPP A;  4Z1V A;  5CA1 A;  4HYO A;  2HR3 A;  4BIO A;  2YC0 A;  3J7A U;  3CHX A;  4YJ2 A;  1JOY A;  1XOU A;  5B1A C;  1VF6 C;  1SQX H;  4NTY A;  4CS4 A;  1XNR O;  3N27 A;  2ZR3 A;  2P06 A;  3S3X A;  3E35 A;  1M57 C;  5LGT A;  2P6J A;  3AG2 C;  3APQ A;  4UV8 A;  4X88 A;  3G6B A;  4GX2 A;  4J7J A;  4DV0 B;  1M5I A;  1W59 A;  4Q6G A;  3ETE A;  4FLY A;  1MZE A;  4JI2 B;  1Y76 A;  4WFB V;  4UXN A;  4AQY O;  3ETG A;  2GHY A;  5LYJ B;  4P9O A;  4EB6 A;  4LFC B;  2HEP A;  4G28 B;  5GON A;  3P32 A;  4IHJ B;  1L0N H;  3E86 A;  3CB2 A;  2LW7 A;  1WP7 A;  1PL0 A;  4O4J B;  1KP2 A;  5IJ0 B;  3CJH A;  3E22 B;  3FFQ A;  2PYJ A;  1HDJ A;  5J2U A;  2ZM6 O;  1WA8 B;  4HZ3 A;  3AG4 C;  1VQ4 V;  4H0L B;  4PDV A;  4FLV A;  4JI8 B;  1DLB A;  2WPD G;  1TVK A;  1J95 A;  4JTA B;  3C90 A;  4JI7 O;  4H13 B;  4X20 B;  5FNV A;  2P90 A;  5LP6 B;  3G80 A;  1YSC A;  2F1M A;  4TV8 A;  4FLW A;  4GKK B;  3APO A;  3ZBH A;  5A9G A;  4O2A B;  2RQ6 A;  1YZB A;  2XOK G;  1XNQ O;  3JAS B;  2ZNJ A;  2H94 A;  3WU2 Z;  2Y4T A;  2G38 A;  1DF5 A;  2DOS A;  4R7C A;  1M56 C;  5JQG A;  3N2K B;  2WSS G;  4CH6 A;  4I4T B;  3ASO B;  5LMU B;  1AP5 A;  1AI4 A;  2KQX A;  2OCC B;  4QNH B;  2CGO A;  3JAT A;  3RFR A;  4O2B B;  1R3I C;  2EIK C;  1E1R G;  4UVA A;  2VWK A;  3K58 A;  4PA9 A;  4DRX B;  2WLM A;  3JAL B;  2UU9 B;  1UPG A;  2NLJ C;  2UXD O;  4FZ1 A;  4JYA B;  3CXH F;  3T1C A;  1TGO A;  3H1H H;  2ZE5 A;  2Z0A A;  5LXT A;  2EIL B;  1BQ0 A;  1RM1 C;  1IZ3 A;  4FM1 A;  1YHQ V;  4MTX A;  2RJZ A;  1P7G A;  2HHH O;  4FJC C;  1ENV A;  3SPC A;  2EIJ B;  4DW1 A;  4NYK A;  4X62 B;  3CYO A;  4FFB A;  5JJN B;  2QWQ B;  1N8R W;  4UVB A;  3OFN G;  1K5Q A;  1DTO A;  4UV9 A;  1NTZ H;  2V1D A;  2ZE8 A;  4RO2 A;  3ETQ A;  1PPJ H;  3LUT B;  1GN3 A;  2JGD B;  2F93 B;  1SER A;  3DGE A;  3J80 N;  1MNG A;  3E8G A;  4C7U A;  2GUZ B;  4E2L A;  1COW G;  3ZRX A;  4CBC A;  4I9W A;  1GN6 A;  4BAY A;  3ABL B;  1AJN A;  1NR1 A;  1P49 A;  4JI1 B;  4FFK A;  4PA3 A;  4GKJ O;  2DMX A;  5EZY B;  2YSU B;  4MTF A;  4LF8 B;  3QO7 A;  2QSA A;  4NXN O;  2Q0O C;  3IAY A;  1OCC C;  1QBZ A;  1QU7 A;  2QDO A;  2ITD C;  1VF7 A;  4MVO A;  4H33 A;  1VIB A;  3IJ4 A;  2OIE A;  4LC1 A;  5IDJ A;  2PUS A;  1A32 A;  1EN5 A;  5IY5 C;  3B8N A;  4DV4 B;  1NQT A;  3F5T A;  1N33 O;  1OCO C;  2EIM C;  3ZMT A;  5CN0 A;  1GN4 A;  1EN4 A;  3LSQ A;  1IX9 A;  4JV5 B;  1SC5 B;  3L74 H;  1AIL A;  4J80 A;  2ZXW B;  1IBM B;  1BCC H;  2A7W A;  1QLN A;  2JVD A;  4DV7 B;  2WLL A;  1HR0 O;  3E89 A;  4BW5 A;  4N23 A;  2YID A;  4TWK A;  2WA4 A;  1V54 B;  1O9H A;  2JRI A;  3X2Q C;  2LGQ A;  4CZZ A;  4FM0 A;  5LYJ A;  5LL6 Y;  2YI9 A;  2BTQ A;  4IHJ A;  1JCH A;  5L3E A;  4QIW F;  1PKX A;  1RSO B;  1H38 A;  3UO3 A;  5IJ0 A;  3K3W A;  4JF3 A;  2E5L B;  3H1J H;  3RT3 C;  1FJG B;  3ZHR A;  2PTM A;  1WA8 A;  2EJ7 A;  2QWN B;  1K92 A;  5KHG A;  1BHA A;  4LF7 B;  2GTA A;  2BOB C;  1R3L C;  4UCO A;  1JVM A;  3ZJZ A;  4WBN A;  4PDL A;  3BRC A;  4PI2 A;  3JD1 A;  1VQK V;  3AG1 B;  2CH7 A;  1XRE A;  2JK5 C;  4RAI A;  3OEE G;  3QTC A;  4X20 A;  2LFR A;  5KA5 A;  2XAH A;  5LP6 A;  3ZHT A;  1KB9 F;  1ZTE A;  1FXH A;  3D36 A;  4UB6 Z;  4XDL A;  4UCV A;  1OV9 A;  4J9Z B;  2FB5 A;  4O2A A;  2OIG A;  3JAS A;  2FKX A;  2Q5Z A;  3JYC A;  2LQT A;  2LW1 A;  3SYA A;  1WLE A;  2RMK B;  2V7Q G;  4HNA B;  3B2E E;  4B3M O;  1SF9 A;  4IT5 A;  4DV3 O;  2JDI G;  1KQS U;  1NS1 A;  2B1G A;  1Z2G A;  3OGI B;  4O2B A;  3QNE A;  2AZ0 A;  2ADP A;  2UXB B;  4WFH A;  2OYQ A;  4ZIB A;  2JJ1 G;  3KKY A;  4DRX A;  3JAL A;  3SPJ A;  2IU0 A;  4FIP C;  3CX5 F;  3NR7 A;  3Q4H B;  1OCR B;  2AHZ A;  1N34 B;  4K8Z A;  4DR1 O;  4X8A A;  3W7W A;  4X1I B;  4J11 A;  4JI3 B;  1EBO A;  3UCS C;  4DR7 B;  4DR6 B;  4OPA A;  4RUF A;  4NTW A;  2OCH A;  3F5W C;  3UO2 A;  2IJK A;  1M4U A;  1MG1 A;  3AG3 C;  3ABU A;  3SYQ A;  4J10 A;  2JGD A;  2E75 B;  4QPJ A;  5A2Q N;  1IVS A;  1K4C C;  4DW0 A;  4YY3 B;  3EVK A;  4U3J B;  3DSQ A;  3BHP A;  3OAA G;  4NXM O;  5CMU A;  1GTO A;  4DK1 A;  4WCE V;  4OX9 B;  3I5D A;  5EZY A;  5LOV A;  1XUQ A;  1PNM A;  1G1X B;  2XAJ A;  2L35 A;  1D2D A;  3P30 A;  4LWS A;  4DUY B;  3RN4 A;  5DM6 V;  3ABT A;  5LMN B;  1VAR A;  2ARH A;  4P30 A;  5IY5 B;  4FK5 C;  1KMI Z;  1N0N A;  1K3E A;  1FYJ A;  1QLE C;  3NXS A;  3U10 A;  4PA4 A;  3BEH A;  1YJW V;  2VS0 A;  1HNX B;  3JAR B;  3JSL A;  4CH5 A;  3KCX A;  1VQ7 V;  5EK0 A;  2VRZ A;  3OGC C;  4LFA B;  4XDJ A;  4B3T O;  1K5S A;  4ZKI A;  3ABM C;  4X65 B;  1SKV A;  2DQ3 A;  2R70 A;  3X2Q B;  1NTK H;  4OXS A;  2ZE6 A;  2UXN A;  4JPR A;  4XDK A;  4TOI A;  4KHP O;  3OTO B;  1IBL B;  1FXK C;  3HKC A;  4DV2 B;  3K5M A;  2YIA A;  4L8J A;  4EFE A;  1H2K A;  3OE7 G;  3K79 A;  3QO8 A;  3K57 A;  1RSO A;  3FB5 C;  1ZUQ A;  2NR5 A;  2UUC O;  1D5N A;  4X66 O;  3UM7 A;  5CBF A;  1X4T A;  3KCY A;  2ZDI A;  1EZJ A;  2P22 C;  4HBN A;  3RW0 A;  4DV6 O;  1JPX A;  4J9Y B;  5JJJ B;  1THZ A;  2E76 B;  1Q7Y W;  2X6B A;  3W7X A;  3TXQ A;  1F23 A;  1MZF A;  1AVM A;  1H2M A;  3OEH G;  4IYI A;  1R6T A;  3AEI A;  1SET A;  1KKD A;  2QKS A;  4JI6 O;  5JVD A;  1Y67 A;  3T2M A;  1IBK B;  3OR6 C;  1NKD A;  1SQF A;  4GCZ A;  3ABK B;  3D3Q A;  1KUQ A;  1IXB A;  1E79 G;  4GLX A;  2VQE B;  1OJH A;  3CXC U;  2QM7 A;  1EM1 A;  2ZR2 A;  3HKB B;  3CME V;  1XMO B;  2Q8V A;  1IUR A;  1G6U A;  4UUJ C;  4PA7 A;  5IWA B;  1JJ2 U;  4HNA A;  4K35 A;  3JAW B;  2H8P C;  3IGA C;  1JX9 A;  1Y74 A;  3ZMV A;  1LUV A;  4QPK A;  4BW9 A;  3UKM A;  2AGA A;  2JEU A;  2RN9 A;  2BTO A;  4KL1 A;  4B3R O;  1ROP A;  1Q5O A;  3F7Y C;  2JS5 A;  5B1B C;  3B77 A;  3CS5 A;  2OTL V;  1SZT A;  4O4H B;  2AXT Z;  4DV0 O;  5ITZ B;  3Q4H A;  2XUM A;  2WLI A;  4DV5 B;  4DR2 B;  4JI2 O;  5KX5 A;  2Y4U A;  1PNL A;  3ZMS A;  1JR9 A;  4X1I A;  4K0K O;  4LF4 O;  2LGW A;  4GZR B;  4LF9 B;  3RVZ A;  4FLX A;  4Q20 A;  5DED A;  4RQF A;  4AHC A;  1V55 B;  1GRJ A;  2ADQ B;  1SS3 A;  2IJI A;  1H8E G;  4LP8 A;  1Q82 W;  1FFX B;  2QKC A;  5GW7 A;  3G71 V;  2K9P A;  2CTQ A;  2PZS A;  1SES A;  4I0X B;  4U3J A;  3OT7 A;  2WLK A;  4DO2 A;  1S72 V;  1OHH G;  5IT9 N;  2E3C A;  2OT5 A;  2EIN C;  2F4V B;  3HKD A;  4JYC A;  1KU9 A;  2AW9 A;  2EBO A;  4PV1 B;  1IXM A;  5IYZ A;  5HFL A;  3ZRW B;  2Y0I A;  5H9C A;  2Y69 C;  4XBF A;  5J2T B;  3P3P A;  5EC1 C;  4GX5 A;  5CBG A;  3EFF K;  1YCI A;  5LMU O;  4NR1 A;  4ZOL A;  4F4L A;  3JAR A;  2ZT9 B;  1WB7 A;  5B3S C;  3UT5 B;  2UU9 O;  2CUG A;  1U96 A;  1EZV H;  4JI5 O;  3ZHV A;  3ZX6 A;  4F6R B;  1JMK C;  1OCZ C;  3TK1 A;  2B5U A;  5TIS Z;  3FAV B;  4X62 O;  3R66 A;  2CDY A;  5H5N A;  3ASN B;  5BZB A;  1J5E B;  1NVP B;  3ZCC A;  1F4M A;  5KUM A;  4GYC B;  3ZS8 C;  3WG7 C;  2KB1 A;  4CS2 A;  4MVR A;  4EEQ A;  1VQ5 V;  2P5O A;  2XAF A;  3HB3 B;  1AP6 A;  2XTA A;  4JI1 O;  3E83 A;  2Z3Y A;  3W7U A;  4PJ0 Z;  4PHZ A;  4ZBM A;  4MVS A;  2ZM6 B;  4WFF A;  2QKA A;  2UUB B;  1I5Y A;  1EN6 A;  3B09 A;  5KAI Z;  3CP1 A;  1B06 A;  3SJC C;  3A0H Z;  2A3Q A;  4P9P A;  4K3A A;  2QGN A;  2DWD C;  5EBM C;  2IBZ H;  4JAU A;  2HKO A;  4LFB O;  1H2S B;  1HNZ O;  1GN2 A;  1NT2 B;  3CWB H;  3HKB A;  5LGU A;  2Q9L A;  4TQD A;  3JAK B;  4CS3 A;  2Y0P A;  2CE4 A;  3CCM V;  1QVG U;  5B5E Z;  5IYC O;  3SPI A;  3VQX A;  3JAW A;  2OWO A;  1P4R A;  4J42 A;  3SYC A;  3L71 H;  2VQF O;  1XNQ B;  2YI8 A;  5H6Q A;  5C8Y A;  2LJ2 A;  1UFI A;  1IBM O;  3E8F A;  5BXZ A;  3DC5 A;  4JI0 O;  1QVF U;  4ZHQ B;  4DV7 O;  2D3O W;  3P3N A;  1VQL V;  2UXC O;  2GV9 A;  4FLT A;  1R3K C;  4O4H A;  5ITZ A;  5K1X A;  3E8B A;  1K73 W;  1W0J G;  2IW5 A;  1BS3 A;  5KAF Z;  1XEQ A;  2UXD B;  3CC2 V;  1JA8 A;  2Q67 A;  1B04 A;  4LNU B;  1BHB A;  4ASU G;  5B1A B;  1VP7 A;  3H1K H;  4RUE A;  2CTW A;  4FM2 A;  4LF7 O;  1FFX A;  2JS3 A;  3HPL C;  4LF6 O;  1M57 B;  3AG2 B;  2KKW A;  3ZN0 A;  1YDX A;  3CCL V;  4GX0 A;  2MK3 A;  1P84 F;  1N32 B;  2RCV A;  4GX1 A;  1NU1 H;  2N05 A;  1YTF B;  3CCU V;  3CRA A;  2ETN A;  2QTO A;  2R9I A;  4OGQ B;  1R6K A;  4RWU A;  3WB2 A;  1UJW B;  4CC5 A;  3PJS K;  3ZRW A;  1ZX3 A;  4YJ3 B;  5J2T A;  1O9G A;  1SQV H;  2DWE C;  1YF2 A;  4NTX A;  4NB5 A;  4O4J A;  3E22 A;  3AG4 B;  3CD6 V;  1L1F A;  1WJZ A;  4EFB A;  1K97 A;  3T4D A;  1BMF G;  4EKW A;  1FPO A;  2B9Z A;  4JGS A;  2UXB O;  3PN1 A;  2P4V A;  4DV1 B;  1AJQ A;  1VF5 B;  1R1B A;  5GTH Z;  3UT5 A;  4CH3 A;  4DR5 B;  3SDL A;  4DR4 O;  5EYP B;  5E1A C;  1PM9 A;  2DYR C;  2M6Y A;  1WNS A;  4RQE A;  1N34 O;  4MS2 A;  4K8X A;  4F6R A;  3RYI B;  1I5X A;  1DGS A;  4DK0 A;  3LDD A;  2C2A A;  4DR7 O;  3FAV A;  4H37 A;  4DR6 O;  1M56 B;  1GH6 A;  4I55 B;  4YHH O;  1US6 A;  1HP8 A;  2HP8 A;  4JI4 O;  3K59 A;  1I94 O;  2X7R B;  4FLZ A;  2FYU H;  3N2K A;  1XHZ A;  1MAB G;  1VQO V;  4I4T A;  2YIB A;  4UCR A;  2EIK B;  1CPY A;  2DYS C;  1YEW A;  1X59 A;  2Z5U A;  1PD3 A;  2QWO B;  1S5J A;  3KG2 A;  3OD4 A;  3QF7 A;  1MOF A;  3T1H O;  5LBQ A;  5L3F A;  4OX9 O;  1RM1 B;  3A0R A;  2YXY A;  1Y66 A;  4B7E A;  3SR2 C;  4LH7 A;  2QEX V;  3ML0 A;  1MSW D;  4Z1M G;  1S0V A;  5LMN O;  2UUA O;  1I08 A;  5EC2 C;  4FVM A;  1F7Y A;  5BR8 B;  3STZ C;  1S76 D;  3JAK A;  1BSM A;  1HNX O;  4WF9 V;  3OM3 B;  3LDC A;  1XMQ B;  4DR3 B;  5B66 Z;  1I0H A;  5L3D A;  4LBE C;  2F23 A;  3STL C;  2GUZ A;  4I50 B;  1KYO F;  2EX3 A;  3BY6 A;  4ZHQ A;  5C93 A;  3UQ8 A;  1VQN V;  2ITC C;  1PP9 H;  4B3M B;  3OTF A;  2XAG A;  4R8C A;  1OCC B;  1GMG A;  1XDC A;  1U97 A;  3OTO O;  2F95 B;  3QVN A;  1TUE B;  2RNB A;  1XHX A;  3SJB C;  4FZ0 A;  4O4I B;  1PV0 A;  2OTJ V;  3F7V C;  4MVM A;  5BMV B;  1OCO B;  1K9M W;  1ZLZ A;  2EIM B;  3C3S A;  4LNU A;  2ZCE A;  2B1I A;  5KUK A;  1VF6 A;  4YIO A;  4DR1 B;  4EB6 B;  5IYD O;  2UXX A;  3OMN B;  5GON B;  4LCU C;  2LP7 A;  3ZMZ A;  5CBH A;  1BE3 H;  3K0D A;  5KMG B;  1YIT V;  1QR8 A;  3CRR A;  3JD4 A;  3CRQ A;  2WAM A;  3CJH B;  2HVK C;  3CCJ V;  1NZ6 A;  5IE9 A;  4X64 B;  1R73 A;  2L6L A;  4BWA A;  5BY1 A;  2P7T C;  2EUL A;  2IU3 A;  5EIB D;  2VQE O;  3EHB B;  4IGG A;  4YJ3 A;  1P7B A;  3ZN1 A;  1YXB A;  4TV8 B;  3IFX A;  3BA9 A;  2EJR A;  5FLX N;  4DXW A;  5LP6 C;  1T5E A;  4IL6 Z;  4KFM A;  4UFZ A;  4W4K A;  3HKE B;  3D36 C;  2D2C B;  4DYL A;  2XND G;  4I9Q A;  1N36 B;  1NR7 A;  3D3I A;  5KHI A;  2AHY A;  4MTO A;  3K04 A;  1TA8 A;  2ZE7 A;  1K33 A;  5LA6 B;  1BL8 A;  2ZNI A;  2FTK A;  4JZ2 A;  4DV5 O;  4DR2 O;  2LO1 A;  2Q73 A;  2QM8 A;  3ASO C;  4D7S A;  2OCC C;  4AI8 A;  1Q81 W;  3RYI A;  3R65 A;  2P67 A;  3OR7 C;  1XBL A;  3VQY A;  1SQQ H;  3SJA C;  5L3B A;  4B3S O;  1W0K G;  4DUZ B;  1E1Q G;  3JD0 A;  1AR1 B;  5L3G A;  2WLJ A;  4BR6 A;  3ZED A;  1V9P A;  1FAF A;  3DXR B;  1VQ8 V;  4JAA A;  2EIL C;  1LUW A;  3AK1 A;  1KP3 A;  4KXR A;  3A8T A;  2YXH A;  4TT3 G;  1Q3E A;  4FFB B;  4GUN A;  3VQW A;  1HNW B;  2WWW A;  3QG5 A;  1Q86 W;  2EIJ C;  3SYP A;  2DE0 X;  2JEX A;  3RYC B;  2IJH A;  4LF5 B;  1L8D A;  1KBH A;  2F4V O;  1GO3 F;  2A79 B;  3T1Y B;  3KZI Z;  4TSF G;  3MHS C;  1R3J C;  1NH2 B;  1AR5 A;  1S5H C;  3L75 H;  1GM7 A;  3U0Z A;  1YJ9 V;  2GTS A;  4LFC O;  1M93 A;  1SRY A;  1K4D C;  3K5L A;  3VOU A;  2QE7 G;  1H8H G;  3IC9 A;  3MD0 A;  4R50 A;  3AG3 B;  1VQ9 V;  4JI6 B;  1FKA O;  3VQV A;  4TUY B;  4JI8 O;  2DQ0 A;  4B08 A;  3K9A A;  2PY5 A;  3SPG A;  3JD3 A;  2YIC A;  4ABM A;  3FYI B;  5D5P A;  1LR1 A;  2QR4 A;  4I50 A;  4JYY A;  3K08 A;  1XIL A;  1Q43 A;  2KSD A;  2A06 H;  2BSK B;  2BCC H;  1VQ6 V;  3E2E A;  4KP4 A;  4GKK O;  3TET A;  4B3R B;  3TXS A;  4FLU A;  3OW2 U;  5CB4 B;  4WFE A;  1J5E O;  2E74 B;  2WLL B;  1QLE B;  3CPW U;  2FML A;  4O4I A;  2ZXW C;  4X9Q A;  4QGP A;  3MHH C;  2Q7H A;  1HWY A;  5L3C A;  5IYB O;  1Q6I A;  5KHH A;  5BMV A;  2KG7 B;  4IIJ B;  1XQ8 A;  1BGY H;  2DJV A;  5JH7 B;  4UVC A;  4BIU A;  4K0K B;  1V54 C;  2BTQ B;  4D6T H;  4LF4 B;  1NTM H;  5KMG A;  3ABM B;  3DTU B;  2QWP B;  4QJF B;  1ZWI C;  2WA3 A;  1RFY A;  4JYA O;  2Q6A A;  4JTD B;  1MSD A;  1WP8 A;  3WB0 A;  1ZL8 B;  2F43 G;  2UUB O;  3K9S A;  3CCE V;  2ZDI C;  3JCZ A;  4WBN B;  1XNR B;  1FXK B;  1DF4 A;  3CC7 V;  3C3T A;  3GVM A;  2CH7 B;  3AG1 C;  2QM4 A;  3B8M A;  4PD4 F;  5H2F Z;  3CCV V;  4CC6 A;  1YJN V;  1BQZ A;  5CA0 B;  4LH6 A;  4AQY B;  2JIZ G;  4JYB A;  2CAZ C;  3HKE A;  1NVP D;  3M7M X;  1YVW A;  1GM8 A;  2GSM B;  1BZK A;  2Q68 A;  1H2G A;  2YIB D;  3K5N A;  3EXA A;  2W6I G;  3G4S V;  2WLH A;  2ZD9 A;  5LA6 A;  3THO A;  1QQC A;  3QO5 A;  4LF8 O;  1TUB B;  2IJJ A;  4U7O A;  5F2V O;  1K34 A;  1WB8 A;  3I56 V;  1NJI W;  1I7F A;  1QNM A;  3G67 A;  1GAX A;  1EFR G;  3J81 N;  2CTP A;  4MSW C;  2PF4 E;  3I55 V;  4JI7 B;  1MMM A;  1VQP V;  4JI5 B;  5J9P C;  3FB6 C;  2CGN A;  2Q0A A;  3JD2 A;  3BFR A;  3LDE A;  4W4L A;  4DV4 O;  4FMT A;  1FS0 G;  1OCR C;  2JJ2 G;  3DXR A;  2JGU A;  3FX7 A;  4PI0 A;  4JV5 O;  5FPR A;  2AZ2 A;  1XL6 A;  5B1B B;  3GWK C;  3OMA B;  3N2G B;  3FYE B;  4J7Z A;  3RYC A;  1AI5 A;  4ZI7 B;  3HR0 A;  2W0F C;  1WPB A;  1N32 O;  4JAV A;  3LSU A;  4JTC B;  2A9H A;  3S3W A;  1GKF A;  3G6E V;  2H3O A;  3H01 A;  3BPZ A;  3RYH B;  4X1K B;  2P4K A;  4ICG A;  3B40 A;  5LOV B;  5HFM A;  2E5L O;  4LR3 A;  5D5Q A;  3OUS A;  4LWS B;  1FJG O;  4PDM A;  1S5L Z;  2R72 A;  3RVY A;  1ORQ C;  2HHH B;  2ATK C;  1WPX A;  1JFF B;  4TUY A;  4DV1 O;  4BIZ A;  4LFB B;  1URF A;  1HNZ B;  1Q8I A;  4DR5 O;  1H2L A;  2EIN B;  5H6R A;  3RWR D;  1N0J A;  3A0B Z;  4I0X A;  2RDC A;  2GBO A;  3ZHU A;  1F51 A;  4U7N A;  1XI1 A;  4HAM A;  4YIP A;  1FXV A;  1Y6X A;  3BVO A;  2BSK A;  2ZIO A;  2VQF B;  5JCO A;  2PI5 A;  1CXZ B;  2Y69 B;  1D5A A;  1Q6U A;  3SJQ C;  3A2F A;  4TQF A;  3BAB A;  1QR9 A;  4YXW G;  4JI0 B;  3CEI A;  5CB4 A;  4GKJ B;  1YTF D;  2UXC B;  2ZKO A;  5EIB C;  2ZIN A;  4MTG A;  3U11 A;  5K1P A;  2NN4 A;  1F4N A;  4J41 A;  2KG7 A;  4IIJ A;  1VMG A;  4MVQ A;  4NXN B;  5JH7 A;  5B3S B;  5KLV H;  5LGN A;  3O65 A;  4Z2W A;  3HKC B;  3CCS V;  1HW7 A;  1RPO A;  3CC4 V;  3LNN A;  4X1Y B;  4B7K A;  3L72 H;  1ZSP A;  2K1E A;  3K03 A;  3MDS A;  1OCZ B;  3M99 B;  1N33 B;  2EZP A;  1ZL8 A;  1GK9 A;  5E79 Z;  3RYF B;  3BAA A;  4TV9 B;  1KEC A;  3FB7 C;  4L87 A;  1ARO P;  3OUF A;  4JI3 O;  1FXK A;  2Q7G A;  4LF6 B;  4MW3 A;  3TJT A;  2ILM A;  2YUA A;  1JQ0 A;  4N21 A;  4WFG A;  3WG7 B;  2MW2 B;  3K06 A;  2ZIM A;  2YEV B;  1H2N A;  1SZX A;  3K0G A;  5BR8 O;  1HR0 B;  4F6E A;  2XAS A;  2F66 C;  5JVD B;  5EBW C;  2HJD A;  3IC7 A;  4GT1 A;  5CA0 A;  3DC6 A;  4IYH A;  1M1K W;  5DEC A;  1XMQ O;  4DR3 O;  4MT8 A;  2HG5 C;  1K7D A;  2LFS A;  4MVZ A;  4YY3 O;  2X6C A;  3ZHS A;  3ABK C;  2N74 A;  4UCU A;  3RGB A;  1W2B U;  5IJ9 B;  3SYO A;  1WAZ A;  1Y74 B;  2V4D A;  3E8H A;  4O4L B;  1TUB A;  2VWJ A;  4DUY O;  3BCC H;  4OPH A;  2XHB A;  2YS8 A;  1N4C A;  2QWR B;  2HJF C;  2QTS A;  4DR4 B;  2QJ1 A;  2R9A A;  4A5U B;  3ICX A;  4I5S A;  2WLI B;  2XT9 A;  3K5O A;  1GM9 A;  4KUM A;  5KX5 B;  4UCT A;  2IH3 C;  5KHK A;  5LHG A;  3ZIA G;  4UB8 Z;  1RP3 B;  4AIL C;  1SA0 B;  1B6Q A;  2CK3 G;  2WLN A;  3L9D A;  3B4S A;  4LFA O;  1OZ0 A;  1AJP A;  2XAQ A;  2W0X A;  5CA1 B;  1XL4 A;  1LNQ A;  4YHH B;  1NI8 A;  4JI4 B;  1SQB H;  1I94 B;  1VQM V;  5KA6 A;  3AG7 A;  1YIJ V;  4E4E A;  3N2G A;  4X65 O;  4YJ2 B;  1NBM G;  4PEL A;  1BT8 A;  4ZI7 A;  1V55 C;  4X64 O;  5DN6 G;  1VEW A;  2YXL A;  1Q6H A;  4DV3 B;  5FL7 G;  1R6N A;  2X6A A;  1AB3 A;  3SGI A;  3JSN A;  1FD9 A;  3ZRV A;  1IBL O;  4DV2 O;  2PYL A;  3CCQ V;  3T1H B;  4PDR A;  2ODM A;  3RYH A;  3L70 H;  3HKD B;  2PI4 A;  4X1K A;  2Q69 A;  2O57 A;  3AK3 A;  1K8A W;  3O9O A;  1Y76 B;  3JCU Z;  5IYZ B;  4I7Z B;  1N36 O;  5JCO C;  3H1I H;  3H1L H;  1JFF A;  2UUA B;  3RBZ A;  1Y4M A;  3W7T A;  3BA8 A;  2DW4 A;  5J2U B;  2Y48 A;  3CSX A;  2W6J G;  4ZOL B;  1CEZ A;  3ZHQ A;  3TCU A;  2CTR A;  4CH4 A;  3FD9 A;  3ZRS A;  1KKC A;  1M9N A;  1IBK O;  2N04 A;  1TVK B;  4NKG B;  1JJO A;  3L73 H;  3TGU H;  2FL4 A;  5FNV B;  3VBB A;  2X0L A;  4P2Z A;  4NXM B;  4DUZ O;  1XMO O;  3LNM B;  3LSS A;  4G2K A;  3JAM N;  5IWA O;  2EZO A;  1TAE A;  3H9V A;  1KD1 W;  1G8M A;  5KHJ A;  1FFT B;  2ZQM A;  1QHT A;  5JJE B;  3SPH A;  1HNW O;  1CP9 A;  5FPO A;  3D8C A;  2QA4 V;  2NNU A;  5GTI Z;  3CRC A;  1KC8 W;  5JQG B;  1SQG A;  3ASN C;  3WFV A;  3CCR V;  4LF5 O;  5EBL C;  4X1Y A;  3M8A A;  2DYR B;  3ZMU A;  5EYP A;  4MVU A;  5CA3 A;  3T1Y O;  3JAT B;  5LHI A;  1Z5V A;  3RYF A;  3GWO A;  3OMI B;  4TV9 A;  1DK1 A;  2HFE C;  1SQP H;  2GDS A;  3ETD A;  4H44 B;  4B3T B;  4LF9 O;  4U3F H;  3CE2 A;  5LXT B;  4I55 A;  2PGG A;  2YEV A;  2DYS B;  3FKS G;  1RPR A;  4D7T A;  1PNK A;  5JWP A;  3T4Z A;  4KHP B;  1Q90 D;  3FB8 C;  4QE9 A;  5B1O A;  1IDS A;  3GB7 C;  1Z5W A;  4JAS A;  2IM9 A;  2UUC B;  2BOC C;  4R6Z A;  4X66 B;  1L0L H;  1MA1 A;  5IJ9 A;  4JZG A;  4QE7 A;  2DN9 A;  3AK2 A;  2M7W A;  2HVJ C;  5C8Y B;  1QCE A;  2Q4P A;  1AI7 A;  4O4L A;  3MAQ A;  1S77 D;  4DV6 B;  2HLD G;  4NVP A;  4G27 B;  4PA6 A;  2Q7E A;  3CRM A;  4WFA V;  1YI2 V;  1PL4 A;  3ABL C;  1ZAU A;  1NH2 D;  5AG2 A;  1B3Q A;  3CMA V;  1AR4 A;  1AI6 A;  4J7K A; 
#chains in the Genus database with same CATH homology
 1QLE C;  2R9R B;  1NJI W;  3NXS A;  3W7S A;  4MW8 A;  5B1N A;  4PA4 A;  1EFR G;  3BEH A;  4X89 A;  1YJW V;  4MSW C;  2IH1 C;  1S3J A;  1M90 W;  2A0L A;  5E1A C;  3I55 V;  2DYR C;  1VQ7 V;  5EK0 A;  4RQE A;  5LHH A;  1VQP V;  3OGC C;  1G4Y B;  4FPP A;  5J9P C;  3FB6 C;  4MS2 A;  4XDJ A;  4HYO A;  3JD2 A;  1K5S A;  3LDE A;  4ZKI A;  1I5X A;  2HR3 A;  3LDD A;  4FMT A;  2C2A A;  1FS0 G;  1OCR C;  2JJ2 G;  3ABM C;  4H37 A;  1JOY A;  1M56 B;  5B1A C;  1XL6 A;  2DQ3 A;  5B1B B;  3X2Q B;  2X7R B;  3OMA B;  4OXS A;  2ZR3 A;  2UXN A;  1MAB G;  1VQO V;  3FYE B;  4JPR A;  2EIK B;  1AI5 A;  1CPY A;  2DYS C;  3E35 A;  4XDK A;  1M57 C;  2W0F C;  5LGT A;  2P6J A;  1FXK C;  3AG2 C;  2Z5U A;  1PD3 A;  4JAV A;  4UV8 A;  4JTC B;  4X88 A;  2A9H A;  4GX2 A;  1GKF A;  3KG2 A;  3G6E V;  3ETE A;  3OE7 G;  3K79 A;  3QO8 A;  3FB5 C;  4WFB V;  4UXN A;  1MOF A;  5LBQ A;  3UM7 A;  3ETG A;  2GHY A;  4P9O A;  5CBF A;  3H01 A;  5L3F A;  1RM1 B;  2ZDI A;  1EZJ A;  3A0R A;  4G28 B;  3RW0 A;  1Y66 A;  3P32 A;  1JPX A;  4J9Y B;  3E86 A;  2QEX V;  1PL0 A;  5HFM A;  1KP2 A;  1THZ A;  3OUS A;  1Q7Y W;  4PDM A;  2X6B A;  3W7X A;  3ML0 A;  3RVY A;  1MSW D;  1F23 A;  1ORQ C;  4Z1M G;  2ATK C;  1S0V A;  1WPX A;  4HZ3 A;  3OEH G;  5EC2 C;  4BIZ A;  3AG4 C;  1VQ4 V;  4PDV A;  3AEI A;  1SET A;  1KKD A;  2QKS A;  3STZ C;  1DLB A;  2WPD G;  1S76 D;  2EIN B;  1J95 A;  5H6R A;  3T2M A;  3OR6 C;  1NKD A;  4GCZ A;  4JTA B;  3ABK B;  4WF9 V;  1F51 A;  4U7N A;  1E79 G;  4HAM A;  2P90 A;  3OM3 B;  1FXV A;  3LDC A;  3CXC U;  2QM7 A;  2ZR2 A;  5L3D A;  3CME V;  1YSC A;  4LBE C;  4UUJ C;  4PA7 A;  3STL C;  2PI5 A;  1JJ2 U;  2Y69 B;  3SJQ C;  3BY6 A;  1QR9 A;  4YXW G;  5C93 A;  1VQN V;  2H8P C;  2ITC C;  2XOK G;  3IGA C;  1JX9 A;  3ZMV A;  2H94 A;  1YTF D;  4QPK A;  3UKM A;  2JEU A;  1DF5 A;  2XAG A;  4R8C A;  1OCC B;  4R7C A;  1GMG A;  1ROP A;  4MTG A;  1M56 C;  1F4N A;  2WSS G;  3F7Y C;  3ASO B;  5B1B C;  3B77 A;  4MVQ A;  2OTL V;  1AI4 A;  1SZT A;  1TUE B;  5B3S B;  2OCC B;  4QNH B;  5LGN A;  3CCS V;  2OTJ V;  3F7V C;  1RPO A;  1R3I C;  2EIK C;  2WLI A;  1E1R G;  4MVM A;  3CC4 V;  4UVA A;  1OCO B;  4PA9 A;  1K9M W;  2WLM A;  2EIM B;  1PNL A;  2B1I A;  3ZMS A;  5KUK A;  2NLJ C;  2K1E A;  3K03 A;  3T1C A;  5IYD O;  2UXX A;  3OMN B;  4LCU C;  2LP7 A;  1OCZ B;  3M99 B;  2EZP A;  3ZMZ A;  5CBH A;  3K0D A;  3RVZ A;  1GK9 A;  1YIT V;  4Q20 A;  1QR8 A;  2EIL B;  1KEC A;  3FB7 C;  4RQF A;  1RM1 C;  3JD4 A;  1ARO P;  4L87 A;  3OUF A;  2WAM A;  1YHQ V;  1V55 B;  1FXK A;  2IJI A;  2HVK C;  4MTX A;  4MW3 A;  4FJC C;  1ENV A;  1H8E G;  4LP8 A;  1Q82 W;  3CCJ V;  3SPC A;  1JQ0 A;  2EIJ B;  4N21 A;  4WFG A;  3CYO A;  3WG7 B;  3K06 A;  5GW7 A;  3G71 V;  2YEV B;  1N8R W;  3K0G A;  4UVB A;  3OFN G;  2XAS A;  1R73 A;  1K5Q A;  5EBW C;  3IC7 A;  1DTO A;  1SES A;  4UV9 A;  2P7T C;  4GT1 A;  2WLK A;  2IU3 A;  4DO2 A;  2V1D A;  4RO2 A;  1S72 V;  1M1K W;  1OHH G;  3LUT B;  3EHB B;  4MT8 A;  2OT5 A;  2EIN C;  1SER A;  2HG5 C;  3DGE A;  1K7D A;  2LFS A;  4MVZ A;  4JYC A;  2X6C A;  3ABK C;  1P7B A;  3E8G A;  3ZN1 A;  4E2L A;  3IFX A;  1COW G;  2EBO A;  3ZRX A;  2EJR A;  4CBC A;  1W2B U;  4I9W A;  4DXW A;  1IXM A;  4BAY A;  3ABL B;  1AJN A;  1NR1 A;  4KFM A;  5HFL A;  3SYO A;  3ZRW B;  4PA3 A;  5H9C A;  2Y69 C;  4XBF A;  2XND G;  1NR7 A;  2YSU B;  3E8H A;  5EC1 C;  4MTF A;  4GX5 A;  3D3I A;  5CBG A;  3EFF K;  3QO7 A;  2AHY A;  4MTO A;  3K04 A;  2HJF C;  1OCC C;  1K33 A;  1QBZ A;  1BL8 A;  2ITD C;  2FTK A;  4F4L A;  4MVO A;  4H33 A;  4I5S A;  2QM8 A;  3ASO C;  2WLI B;  5B3S C;  1GM9 A;  4KUM A;  2OCC C;  4LC1 A;  5IDJ A;  1Q81 W;  2IH3 C;  3R65 A;  5LHG A;  3ZIA G;  5IY5 C;  2P67 A;  3B8N A;  3OR7 C;  1NQT A;  5L3B A;  1B6Q A;  1OCO C;  2CK3 G;  2WLN A;  2EIM C;  1W0K G;  3ZMT A;  5CN0 A;  1OZ0 A;  1AJP A;  2XAQ A;  3LSQ A;  1E1Q G;  3JD0 A;  1XL4 A;  1AR1 B;  5L3G A;  1LNQ A;  2WLJ A;  1OCZ C;  1VQM V;  5KA6 A;  1YIJ V;  2ZXW B;  3TK1 A;  1VQ8 V;  2B5U A;  2EIL C;  1QLN A;  1NBM G;  4PEL A;  1KP3 A;  1V55 C;  4TT3 G;  2WLL A;  3ASN B;  5BZB A;  1NVP B;  5DN6 G;  2WWW A;  3ZCC A;  1F4M A;  5KUM A;  3E89 A;  4BW5 A;  1Q86 W;  4N23 A;  5FL7 G;  2EIJ C;  1R6N A;  2X6A A;  3SYP A;  3WG7 C;  4TWK A;  2KB1 A;  1V54 B;  2JEX A;  3ZRV A;  3X2Q C;  2IJH A;  4CZZ A;  3CCQ V;  4MVR A;  1GO3 F;  1VQ5 V;  4PDR A;  2A79 B;  2XAF A;  2PI4 A;  4TSF G;  3MHS C;  1JCH A;  1R3J C;  1NH2 B;  3HB3 B;  5L3E A;  2Q69 A;  4QIW F;  1PKX A;  1S5H C;  1K8A W;  1GM7 A;  1YJ9 V;  1H38 A;  1SRY A;  3E83 A;  1K4D C;  3K3W A;  4JF3 A;  2Z3Y A;  3VOU A;  2QE7 G;  3W7U A;  1H8H G;  4ZBM A;  1K92 A;  4MVS A;  1BHA A;  4WFF A;  2BOB C;  1I5Y A;  1R3L C;  3RBZ A;  1JVM A;  3MD0 A;  4R50 A;  3ZJZ A;  1Y4M A;  3CP1 A;  4PDL A;  3AG3 B;  3W7T A;  3JD1 A;  1VQK V;  2DW4 A;  4P9P A;  3AG1 B;  1VQ9 V;  2Y48 A;  5EBM C;  2DWD C;  4JAU A;  2HKO A;  2W6J G;  1CEZ A;  2JK5 C;  4RAI A;  3OEE G;  3TCU A;  2LFR A;  2DQ0 A;  5KA5 A;  3K9A A;  3SPG A;  2XAH A;  3ZRS A;  1M9N A;  3JD3 A;  5LGU A;  1FXH A;  3D36 A;  3FYI B;  3CCM V;  4XDL A;  1QVG U;  5IYC O;  3SPI A;  4J9Z B;  3K08 A;  3VBB A;  2X0L A;  4P2Z A;  1P4R A;  3LNM B;  3LSS A;  3SYC A;  4G2K A;  1VQ6 V;  5H6Q A;  2EZO A;  3E2E A;  3JYC A;  4KP4 A;  1KD1 W;  3TET A;  3SYA A;  1WLE A;  2V7Q G;  1G8M A;  3E8F A;  1FFT B;  1QVF U;  2ZQM A;  2D3O W;  3OW2 U;  1VQL V;  4WFE A;  3SPH A;  1CP9 A;  1R3K C;  2WLL B;  1QLE B;  3CPW U;  2JDI G;  2ZXW C;  2QA4 V;  1KQS U;  2NNU A;  2B1G A;  3MHH C;  3QNE A;  1KC8 W;  4WFH A;  3E8B A;  1HWY A;  5L3C A;  2JJ1 G;  1K73 W;  5IYB O;  1W0J G;  2IW5 A;  3ASN C;  3WFV A;  3CCR V;  5EBL C;  2DYR B;  3SPJ A;  3ZMU A;  2IU0 A;  4FIP C;  4UVC A;  4MVU A;  4BIU A;  5CA3 A;  5LHI A;  3CC2 V;  1V54 C;  1OCR B;  3ABM B;  3GWO A;  3OMI B;  3DTU B;  2AHZ A;  4QJF B;  1ZWI C;  2Q67 A;  1BHB A;  2HFE C;  4ASU G;  4X8A A;  3ETD A;  3W7W A;  5B1A B;  2Q6A A;  4JTD B;  1EBO A;  4RUE A;  2F43 G;  3CCE V;  2YEV A;  2ZDI C;  3HPL C;  2DYS B;  3JCZ A;  1M57 B;  3FKS G;  4RUF A;  1FXK B;  3AG2 B;  1DF4 A;  3ZN0 A;  3CC7 V;  1RPR A;  3F5W C;  1PNK A;  2IJK A;  1MG1 A;  3CCL V;  4GX0 A;  3T4Z A;  3AG3 C;  2MK3 A;  3ABU A;  3SYQ A;  3AG1 C;  4GX1 A;  3B8M A;  3FB8 C;  4QPJ A;  1YTF B;  4QE9 A;  5B1O A;  3CCU V;  3GB7 C;  3CCV V;  1K4C C;  1YJN V;  4JAS A;  2QTO A;  2R9I A;  2BOC C;  4R6Z A;  3OAA G;  1R6K A;  2JIZ G;  4JYB A;  4QE7 A;  1UJW B;  5CMU A;  1GTO A;  3PJS K;  3ZRW A;  1NVP D;  4WCE V;  2M7W A;  2HVJ C;  1GM8 A;  2GSM B;  1QCE A;  1PNM A;  1AI7 A;  2Q68 A;  2XAJ A;  2DWE C;  1S77 D;  3P30 A;  1H2G A;  2HLD G;  2W6I G;  3AG4 B;  3G4S V;  4PA6 A;  4G27 B;  3CD6 V;  2WLH A;  1L1F A;  4WFA V;  1YI2 V;  1K97 A;  3T4D A;  1BMF G;  2ZD9 A;  5DM6 V;  3ABT A;  4EKW A;  3ABL C;  4JGS A;  3QO5 A;  1NH2 D;  2IJJ A;  4P30 A;  5IY5 B;  4FK5 C;  4U7O A;  1AJQ A;  3CMA V;  1K34 A;  1AI6 A;  1K3E A;  3I56 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...