4WFFA

Human traak k+ channel in a k+ bound nonconductive conformation
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
259
structure length
253
Chain Sequence
b'RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 95
structure length 253
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4wffA00
4MW8A 4PA9A 5B3SC 5CBHA 2DWEC 2HVJC 1OCZC 4HZ3A 4TWKA 1QLEC 2Q69A 3K0GA 4PA3A 3STLC 3GB7C 1R3LC 2A9HA 4J9ZB 4JTCB 5CBFA 4RUFA 4OXSA 3SPGA 2Q68A 1R3KC 2HFEC 3SPIA 3SYOA 1K4DC 2ITDC 1P7BA 2EINC 1BL8A 4MVUA 2BOBC 2AHYA 3E83A 4MVMA 4WFFA 4MTFA 2QTOA 3ABLC 1R3IC 2Q6AA 3RW0A 2X6CA 3F7VC 3E86A 4MVZA 3STZC 3T2MA 5J9PC 1JVMA 2EIJC 1LNQA 4J9YB 4MVQA 4CBCA 3TETA 4G28B 3SJQC 4KFMA 3FB7C 3UM7A 3LUTB 2BOCC 3FB8C 4MVRA 4P2ZA 5IY5C 3UKMA 3ASNC 2EIKC 4WFGA 3RVZA 2WLHA 4P9OA 1XL4A 2YEVA 5KUKA 2JK5C 4X88A 2H8PC 2QKSA 4G27B 3K06A 1S5HC 4DXWA 1V54C 2EILC 3K0DA 3VOUA 3R65A 4H33A 3LDDA 3OUSA 2HJFC 2WLLA 2WLIA 2HVKC 3WG7C 3T4ZA 4I9WA 3E8GA 4MTGA 2Q67A 3K08A 4R7CA 2OCCC 4XDJA 3LDCA 3AG3C 4LBEC 1G4YB 5E1AC 4MVOA 1K4CC 4RAIA 2DYRC 4ZBMA 5EBMC 3OGCC 2ZXWC 1OCCC 5B1AC 3IGAC 3SPCA 3ZJZA 4UUJC 2DYSC 3AG1C 1ORQC 3E8FA 2A0LA 3BEHA 1XL6A 3F7YC 3K04A 3E89A 1ZWIC 5EC1C 3AG2C 3EFFK 4H37A 2NLJC 4QNHB 4R50A 2EIMC 2WLLB 2WLIB 2WLKA 2WLNA 2X6AA 3SYCA 2WLJA 3F5WC 4R6ZA 3PJSK 4XDKA 4JTAB 4PDLA 4GX1A 2KB1A 2IH1C 3RBZA 1OCRC 4JTDB 3K03A 1KKDA 3LNMB 3HPLC 4GX2A 4PA6A 2AHZA 4MW3A 4PDMA 4WFEA 4RUEA 5B1BC 5KUMA 3X2QC 3E8BA 2HG5C 4GX5A 4MS2A 4WFHA 1J95A 2W0FC 1M56C 3ABKC 4PDRA 3OUFA 3OR6C 2K1EA 4MTOA 4PA7A 2A79B 4HYOA 4LCUC 2WLMA 3T1CA 4PA4A 1V55C 3OR7C 2ATKC 3T4DA 2Y69C 3SPJA 4XDLA 3AG4C 4P30A 3ASOC 2X6BA 4X89A 4PDVA 4X8AA 4EKWA 4MSWC 3RVYA 3LDEA 1M57C 3FB6C 3FB5C 4LP8A 2R9RB 5EBLC 3ABMC 1OCOC 4GX0A 3SPHA 3SYAA 5BZBA 3JYCA 4RO2A 4P9PA 4R8CA 2P7TC 3ZRSA 2ITCC 3IFXA 4BW5A 5CBGA 2ZD9A 3TCUA 5EC2C 5EK0A 3SYQA 4MVSA 2IH3C 5EBWC 3SYPA 3KG2A 1R3JC 2DWDC 4QE7A 4F4LA 3E8HA 4QE9A
chains in the Genus database with same CATH superfamily
5GW7A 4FLUA 2DWEC 4DR4B 3ETEA 4TV8B 3GB7C 1AB3A 4YJ3B 4OGQB 1K4DC 2EINC 4JAVA 1BL8A 4MVMA 2Q6AA 1E1QG 1GK9A 2KG7A 4JI2O 3JASB 1NKDA 1OCOB 2B9ZA 2UXDO 3CRRA 5IY5C 3UKMA 3BAAA 2FMLA 2IJJA 1GMGA 3DTUB 2M6YA 1XHZA 3FKSG 3VOUA 2XAFA 4U3JA 2LGQA 4FM2A 5IDJA 3JD3A 3UT5A 2DYRC 3OGCC 1U97A 3ABMB 4TOIA 3SPCA 5IJ0B 1XUQA 1AR1B 1AJQA 3AG1C 4D7SA 3JCUZ 1MSDA 2XAJA 2PUSA 1LUWA 3HKEA 3OTOB 2ZE7A 4RWUA 4YHHB 2FB5A 3QO5A 1GN2A 3ZHTA 1W0JG 1NTZH 1RM1B 2X6AA 3SYCA 1P7GA 3TXSA 5LMUB 3SDLA 4X65B 3ZHRA 2LQTA 4IL6Z 4LF9B 2E74B 1Y4MA 4IIJB 4LFAO 1J5EB 2JDIG 4RQEA 4O4JB 4DR7B 2OIGA 2V7QG 4K3AA 3H1JH 1M4UA 5DM6V 1SQXH 4J42A 3CS5A 3G67A 3JAWB 3LDEA 1XNQO 2ZQMA 5KMGB 1TUEB 3ZRSA 1SQBH 2WWWA 2QJ1A 1F51A 4X20B 2QGNA 4ICGA 1A32A 5JCOC 4J9ZB 3IAYA 4PHZA 1Y74A 1TVKA 4I50A 1S76D 5ITZA 3STZC 3T2MA 4LFBO 1X59A 4GKJB 4ZOLB 1HP8A 1XMOO 2QTSA 4J9YB 2ZCEA 3UM7A 1Q7YW 2A7WA 1EN6A 2YIDA 3SJAC 5IYZB 3CC7V 4WFGA 1VQ4V 1K9MW 1XOUA 2VS0A 3OGIB 3BABA 3ZRXA 5J2UB 3QVNA 2Y4UA 4K8ZA 3RT3C 1HW7A 1SA0B 2QR4A 2ZXWC 2WA3A 1N36B 2A06H 4JYCA 4X62B 3GWKC 1B06A 4NXMO 4JTAB 1S5LZ 1SQGA 1YCIA 3CWBH 4DR1B 1WB8A 1MSWD 4EFBA 3OEHG 1QHTA 3L70H 4X64O 3LNNA 4MS2A 4PDRA 1BZKA 1Q6HA 2RNBA 2XNDG 3SR2C 2CTQA 2ZE5A 3CX5F 1AP6A 4TV8A 2JJ2G 3N27A 4YJ3A 3ZHQA 2P6JA 2ZD9A 1GO3F 2D2CB 3JASA 4MVSA 4C7UA 2AXTZ 4EB6A 4FZ1A 3K0GA 1JR9A 4JTCB 1V9PA 4YY3O 1R3IC 3A0RA 1WP7A 2YS8A 3BPZA 4ASUG 1H2KA 3FYIB 5IJ9B 1OV9A 3OM3B 4KHPO 4UVCA 5IJ0A 3SJBC 2CGNA 2IJHA 3S3XA 1VF5B 3ZEDA 2B1GA 1OCZB 1PNKA 1QLEB 1S5HC 1YIJV 1YITV 1U96A 5JJEB 1XEQA 3JARB 4R7CA 3AG3C 1EN5A 2YXLA 4LR3A 2V4DA 3ZHVA 1EFRG 1SQPH 2DYSC 4DUZB 4TT3G 4O4JA 4UV9A 4F6EA 5DN6G 4UV8A 2QSAA 4QNHB 4R50A 2WLLB 1SQVH 3K9SA 3A0BZ 2WSSG 1AJNA 1ZLZA 2DMXA 2WA4A 3AK2A 2OIEA 4F6RB 4GX1A 2KB1A 2Q5ZA 1Q86W 1T5EA 3JAWA 2EJ7A 3JSNA 3P3NA 4PDMA 4ZKIA 1QLNA 1Z2GA 1PPJH 4JI1B 1VIBA 3JSLA 5KMGA 4LCUC 4NXNB 2WLMA 2YDEA 2DN9A 3KCYA 4WFAV 1JJ2U 1QR9A 4FIPC 2H3OA 2Z5UA 3Q4HB 1JQ0A 3G71V 4X20A 3WB0A 2Q7EA 1CPYA 2MW2B 2GHYA 1XMQB 4K0KB 1N4CA 2OCHA 3JATB 5LL6Y 4I9QA 2ILMA 3ABMC 3RFRA 4QPJA 3CC2V 4B3TO 2XOKG 4P9PA 4JAUA 3CCUV 4OX9O 3OEEG 4ZOLA 1VQLV 1RM1C 4BW9A 1NZ6A 3TK1A 4BIOA 1CXZB 1ROPA 5CBFA 1V55B 2CGOA 4RUFA 5IYZA 1KUQA 3KKYA 1X4TA 3L74H 3B77A 1JCHA 3IC7A 2F66C 1R1BA 3OW2U 5J2UA 3ZRWB 2Z0AA 4MVQA 3KZIZ 3TETA 3EVKA 1H2LA 4X66O 4JYAB 1SA0A 1K73W 5EZYB 1KP3A 3CCQV 4ZI7B 1Y66A 1Q6IA 3K79A 3B8MA 4NVPA 2C2AA 4DXWA 2XTAA 2QWPB 3SGIA 3DSQA 2WPDG 3K08A 4LBEC 4RAIA 4LF5B 2FTKA 1VF6A 2ADPA 2PTMA 1ENVA 2VQEB 4B7EA 2BSKA 4WFBV 2A0LA 3BEHA 4BIZA 3F7YC 3MHHC 2ZM6B 1FJGB 1RFYA 1BQ0A 3BCCH 3OTFA 3ABUA 1FYJA 3N2GB 4DV1B 2KSDA 4LF8B 4I7ZB 1Q43A 4JI0O 5B5EZ 5J2TB 4PA6A 1ZL8B 4MW3A 1N32O 1M56C 1GTOA 3WFVA 5KX5B 2K1EA 4I55B 2GTSA 4AQYB 5L3BA 1F7YA 1WLEA 4H13B 1L1FA 2QKCA 3JD1A 1QBZA 2E5LO 4CH6A 2N74A 1MZFA 5LHGA 1RSOA 2PGGA 3SPHA 4R8CA 1KU9A 3IFXA 1NQTA 1FXHA 3X2QB 4JI8O 2Q9LA 4ABMA 5L3EA 3OMIB 5IJ9A 1IBKO 4HZ3A 4GLXA 2OYQA 2ARHA 2WAMA 4TQDA 1QVFU 1IXMA 1VF6C 1S3JA 1MNGA 4KP4A 2BOBC 1RPOA 4MVZA 1LNQA 1H38A 1JMKC 3EHBB 4DR3B 4PELA 3JARA 1AI5A 2ZT9B 4LNUB 4PI2A 4KFMA 3FB7C 4J10A 4DV7B 3FFQA 2ZE8A 4I5SA 4DV4B 1G6UA 4JI7B 2NNUA 3QG5A 4YXWG 3NR7A 4D6TH 3K06A 2EILC 4NTXA 4JV5O 3R65A 1E1RG 2WLLA 3LSQA 1VEWA 1ZSPA 4MTGA 5BXZA 3RYFB 1JPXA 4Z1MG 2QEXV 3B4SA 4MVOA 1AI7A 1HR0O 1VQ7V 2YSUB 3UCSC 2OT5A 2JRIA 4WBNA 3OFNG 1H2MA 5L3DA 5DEDA 3Q4HA 4PD4F 3P32A 2EBOA 3M99B 3WG7B 4AHCA 4RUEA 4LF7B 5B1BC 4UB8Z 1DTOA 3A2FA 4D7TA 4PA4A 1G8MA 3CRMA 3CHXA 5H9CA 2IU0A 3ASNB 4X89A 3WB1A 1BS3A 1VARA 1PNMA 2AW9A 4O4LB 4O4IB 1YVWA 2Q0OC 1EZJA 3FB5C 1OCRB 4QIWF 3W7UA 3SYAA 2W0XA 4NR1A 2P7TC 4BW5A 3K3WA 4DV0B 3KG2A 4JI5B 4PA9A 2UXNA 2VQFB 4DV5B 2D3OW 2CH7A 2YXYA 2UUBB 3JD0A 3SPIA 4LFCB 1BHBA 1DF4A 4LF4O 4TQFA 3ZMSA 4WCEV 1SC5B 4B3MB 3OAAG 3I56V 4FM1A 1YHQV 4CBCA 2N05A 4G28B 1BHAA 2YEVB 2HP8A 2Y0IA 4DV2B 3APQA 4NB5A 2ODMA 1RP3B 4K35A 5B3SB 5C8YB 3T1HO 4X88A 2AZ0A 2BTOA 2YIAA 2YUAA 1I94B 4H33A 2ETNA 2HJFC 2UU9B 3RWRD 4HBNA 2QM7A 3N2GA 5KHKA 3ABLB 4ZBMA 1N34B 4DR6B 5J2TA 2EIJB 2YIBA 1ZL8A 3IGAC 5BMVB 1HNXB 1ORQC 5KX5A 4I55A 3BA9A 4XDKA 4CZZA 2XHBA 4OPAA 4UCOA 3LNMB 1ZUQA 1BCCH 5KUMA 2OCCB 2JEXA 1AP5A 4FPPA 1XNRB 2XT9A 3OUFA 1Y67A 1KYOF 1IBLO 3T4DA 1QCEA 4XDLA 5LA6B 1EZVH 1M57C 5BR8O 4UCRA 3K5MA 1WPBA 1OZ0A 4FMTA 1V54B 1NJIW 4DV3B 5BZBA 4JYBA 1YJNV 1BT8A 1B6QA 2B1IA 4A5UB 4FLYA 3CC4V 2IJKA 3G6BA 1FXKB 2LGWA 4Z1VA 3SPGA 4BR6A 2UUAB 1NH2B 2XASA 1VF7A 2QTOA 1GM7A 5LP6B 1YXBA 4JI3B 1KKCA 3ETQA 3HR0A 1ZTEA 3RYFA 2MK3A 5LYJB 2F4VO 3MHSC 5GONB 4B3RB 3DC6A 3UO2A 2FYUH 2PYJA 4DW0A 4P2ZA 4DR2B 2EIKC 1KMIZ 3RVZA 3AK3A 3CPWU 3AK1A 3G4SV 2H8PC 1E79G 2HVKC 2OTJV 4X1YB 5JH7A 2R9IA 4IHJB 5KHIA 5EBMC 5K1PA 3S3WA 1QR8A 1O9HA 1XHXA 3E8FA 1NVPD 1TGOA 1IBMO 2N04A 5EC1C 1FS0G 1S77D 2QDOA 2JS5A 4J80A 1W0KG 1AR5A 4I4TB 2WLIB 2YXHA 4FLVA 2GTAA 1SQFA 2GV9A 1MOFA 4YIPA 3HPLC 1VQ8V 2AHZA 1VQNV 4O4IA 5JJNB 1AI4A 1NTMH 3OR6C 4I0XB 2P06A 1KD1W 1N8RW 4HNAB 3P30A 3AG2B 3E35A 4B3SB 1R73A 5KAIZ 3ZRVA 3ZBHA 5KAFZ 3HKBB 4PI0A 1YJWV 1HNZO 1B04A 4RO2A 2LO1A 4GCZA 4UCSA 2IH3C 5EBWC 2CDYA 1NTKH 3E8HA 4PJ0Z 1OCCB 5B1AB 5CBHA 2HVJC 1QNMA 4U3FH 2EZPA 3THOA 2UXBB 2HFEC 4JZGA 4DV6B 1WJZA 2ITDC 2ZNIA 3AG4B 5C8YA 1UJWB 4MT8A 3A8TA 1HNWB 4H44B 2BTQB 1WP8A 1KBHA 2VWKA 3T1YO 3GVMA 3L9DA 3ASNC 5BMVA 5L3FA 1BQZA 3G80A 2R72A 1XBLA 3APOA 4GKKB 5CB4B 2QWRB 1WPXA 1R6TA 5FNVB 1TA8A 3ETDA 4JI6O 1IDSA 4L8JA 1R6KA 4UCUA 4LWSB 1PNLA 4W4KA 4BAYA 1UFIA 3IJ4A 2DQ0A 1M1KW 5IYDO 4JI4O 2ZNJA 2L6LA 4LF6O 4DUYB 5LA6A 1EM1A 1BE3H 3CRQA 3FAVB 2B5UA 1VMGA 2UUCB 1N33O 2W0FC 5LBQA 4DYLA 2YICA 5D5PA 2IBZH 4IIJA 4JAAA 3GWOA 1THZA 4GUNA 3T1CA 3L75H 2ATKC 4DR5B 1K5SA 4CH5A 1GM9A 1I5YA 1FXKA 1AILA 2RCVA 1YTFD 5IWAO 4LP8A 1H2GA 1OCOC 4GX0A 5CN0A 3JYCA 1S0VA 3ETGA 4FM0A 4JZ2A 1YSCA 5LP6A 2HHHO 4QPKA 4L87A 4J41A 5LYJA 2W6IG 3QTCA 2JGDB 3CB2A 3CMAV 4CS2A 1EN4A 3JAKB 4JI2B 5IYBO 3ML0A 3OMAB 5CA3A 4FZ0A 1Z5WA 3ASOB 2Z3YA 2UXDB 3HKCB 1VQKV 4X1YA 1OHHG 4IHJA 3U11A 4NKGB 3H01A 4TV9B 3D8CA 2CTWA 4O2BB 3A0HZ 4KL1A 1V54C 2EJRA 2F23A 2Y69B 3LDDA 2WLIA 4I4TA 1QQCA 3DGEA 4GZRB 3OMNB 5FPOA 4XDJA 3FD9A 2OWOA 5AG2A 3QO8A 3BY6A 1K7DA 3CCLV 1DF5A 4PV1B 3RN4A 1B3QA 5IY5B 4Q20A 4I0XA 3R66A 4LFAB 1SERA 3H1LH 5JVDB 2LW1A 3PJSK 4R6ZA 4HNAA 4O2AB 5LP6C 4JTDB 5A9GA 2K9PA 3OTOO 4YHHO 3HKDB 3HKBA 2XAGA 4W4LA 2VRZA 2QE7G 5LMUO 4JF3A 1BMFG 4TUYB 4IYHA 1Q6UA 4X65O 2HR3A 4PA7A 1XNQB 4LF9O 3K57A 3AG1B 1Q90D 1J5EO 2RJZA 3ZMTA 1K5QA 4DR7O 3ZMZA 3BA8A 2ZIOA 1FFXB 5EK0A 3SYQA 3CCSV 5CMUA 2BTQA 3BVOA 4LH6A 5B1OA 1L0NH 1XQ8A 1GN6A 1AR4A 4PA3A 4LFBB 4KUMA 1XMOB 2KG7B 2AGAA 2EIMB 1D5NA 3O65A 4IGGA 3C3SA 1D2DA 3E86A 5CB4A 3CYOA 3IC9A 5FNVA 2BCCH 1Q3EA 1Y6XA 4J7JA 4DK1A 3CCJV 2DW4A 2P90A 5IE9A 4LWSA 4GKJO 2QKSA 5IT9N 3CXHF 4GT1A 5LGNA 4I9WA 1G4YB 5E1AC 1NR1A 2ZR3A 1Q5OA 2F43G 1OCCC 1XILA 3FAVA 5B1AC 4NXMB 1WA8B 1UPGA 3TJTA 3W7XA 3EFFK 3N2KB 1MG1A 4X64B 1FAFA 3W7WA 1WN7A 1F4NA 1N36O 4LC1A 2YIBD 4E2LA 1HWYA 4X62O 2PI4A 1US6A 2BE3A 1LR1A 4F6RA 1VQ9V 2ZIMA 4WFEA 1GAXA 1J95A 5H6QA 2ZXWB 3CCRV 4DR1O 1S5JA 3HB3B 4HYOA 1WB7A 4BWAA 2JGDA 2X6BA 4KXRA 5KHJA 1KQSU 3C90A 3JAKA 1XI1A 2Q0AA 1SKVA 5KHHA 3FB6C 2R9RB 3LSSA 1QVGU 1IVSA 1CEZA 3JATA 3HKCA 5BY1A 5B66Z 2HLDG 1CP9A 3SYPA 1W2BU 5CA0B 4YY3B 1AVMA 1MA1A 2FKXA 1Q82W 1OCZC 1QLEC 4TV9A 2A9HA 2Q68A 1GN4A 1M9NA 1R3KC 4FLXA 4YIOA 4MVUA 4XBFA 2PYLA 4O2BA 2NN4A 4UVBA 3RW0A 2X6CA 3TGUH 1PP9H 1COWG 3W7SA 4KHPB 5EIBC 4Q6GA 3LUTB 3G6EV 4YJ2B 3ZRWA 3ABKB 5TISZ 5JQGB 5KA6A 3KCXA 5LHIA 4P9OA 5KUKA 1FFTB 3J80N 5EZYA 4G27B 4ZI7A 3OUSA 5JVDA 3E8GA 2GSMB 1XDCA 4O2AA 2X7RB 4J11A 1FPOA 2RDCA 2HKOA 3MDSA 4CH4A 3E89A 4TUYA 4JGSA 1NBMG 1H2SB 1Z5VA 3JD2A 2QM8A 4PDLA 4DUZO 1VQOV 3K03A 5A2QN 2V1DA 5K1XA 3ZN1A 1IX9A 1VQ6V 3AEIA 3CJHB 2EZOA 3ZS8C 4GX5A 4WFHA 1G1XB 3AG3B 5DECA 1O9GA 1N0JA 3C3TA 3U0ZA 1FFXA 3CSXA 3UO3A 2DYSB 1M90W 1V55C 2Y69C 4B3TB 2P4KA 1PL0A 4JI1O 2ZR2A 4PDVA 5D5QA 4OX9B 4EKWA 1GH6A 2XAHA 3RYCB 4NXNO 5H2FZ 4CS3A 4DRXB 2CK3G 4IYIA 3JD4A 2IJIA 4EB6B 1XREA 5H5NA 1XMQO 1SESA 4K0KO 2DWDC 3B40A 4QE7A 4QE9A 1LUVA 2QWQB 1SRYA 2Q69A 1PV0A 1F4MA 4TSFG 5GTHZ 1HDJA 4N21A 2JIZG 4FJCC 3FYEB 4CS4A 2HJDA 3K5OA 4X66B 2P22C 1JFFB 1ZAUA 2XUMA 3OE7G 5JCOA 3H1HH 4B08A 1QU7A 2QM4A 3CCVV 5LGUA 3MD0A 2BOCC 1I0HA 1SS3A 1I08A 3VQWA 1NVPB 1WA8A 4LNUA 3ZN0A 2Y48A 2H94A 3K0DA 3N2KA 4JYAO 4X1IB 3EXAA 1WNSA 2CTRA 3P3PA 2GBOA 2R70A 3CE2A 3JAMN 5LMNO 4JI0B 1EBOA 1P49A 4FFBB 3CMEV 4FVMA 4EEQA 2EIMC 4LF5O 1KP2A 2WLNA 2VQEO 3H1IH 1N32B 2IH1C 3RBZA 2ZM6O 2L35A 1FJGO 3CRAA 2F93B 3RYIB 5KLVH 5JJJB 5LOVB 3K58A 3X2QC 3CD6V 4DV1O 2JS3A 4LF8O 2QWNB 4MTOA 2E5LB 2A79B 3ZX6A 4NTYA 2Y0PA 4UCTA 5CA0A 4J7ZA 1VQ5V 3RYHB 2AZ2A 1W59A 3K5NA 3RVYA 4JI8B 2R9AA 4AQYO 4JPRA 2HEPA 5EBLC 1IBKB 3B8NA 3LSUA 4O4LA 5CBGA 1BSMA 3TCUA 1OJHA 1NS1A 3OT7A 1M56B 1Q81W 2M7WA 2YC0A 4YJ2A 2O57A 1NH2D 5JQGA 4U7OA 3CP1A 3E83A 3I5DA 3QF7A 5F2VO 4X1KB 1NU1H 1R6NA 3VQYA 5JWPA 2EULA 4CC5A 3SJQC 2CUGA 2UXXA 4JV5B 4UB6Z 2NR5A 1DK1A 1GKFA 2DQ3A 1RPRA 2WLHA 1TUBB 4DR3O 2YEVA 1HR0B 4DV7O 3WG7C 1YF2A 1DGSA 4DV4O 2PZSA 3D36A 4JI7O 3LDCA 2BSKB 3JALB 1K4CC 2JJ1G 2UXCO 4UUJC 3CJHA 4AILC 1IURA 3WB2A 4HAMA 4H37A 2WLKA 3F5WC 4JYYA 1OCRC 3U10A 2EILB 1SZXA 3E2EA 1YTFB 4DW1A 3RGBA 3J81N 3H9VA 3RYCA 3E8BA 4DRXA 3CXCU 5IYCO 4FLZA 3ABKC 4UXNA 3VQVA 2E75B 1SF9A 3BRCA 3L72H 3OR7C 4LF7O 2E76B 4X8AA 1NT2B 1RSOB 5LHHA 2A3QA 1YZBA 3E22B 3VBBA 1BGYH 1JFFA 4O4HB 1K33A 1Q8IA 5B1BB 2P67A 3M7MX 2P5OA 5B3SC 4LF4B 3B2EE 3D36C 4TWKA 2YI8A 2KKWA 3DXRB 3SYOA 4DV0O 5EYPB 4JI5O 1KC8W 4WFFA 3ABLC 2VQFO 4DV5O 3F7VC 2XAQA 4X1IA 4UFZA 1URFA 2EIJC 3K9AA 3UQ8A 2Q73A 2UUBO 2KQXA 3T1HB 4LFCO 4ZHQB 3FB8C 4MVRA 2QKAA 5GONA 4CC6A 4B3MO 2Q7HA 4FLWA 4FFBA 3D3QA 1M93A 1IZ3A 5E79Z 3ZMVA 2IM9A 1VP7A 3T4ZA 4DV2O 2OCCC 1SETA 3DC5A 4JASA 1VQMV 4DR4O 2W6JG 3H1KH 4Z2WA 1KECA 1YI2V 1NR7A 3RYIA 1I94O 4WBNB 1JOYA 1KB9F 4QGPA 5LOVA 2UU9O 3MAQA 1XL6A 1ZWIC 2LFSA 5KHGA 1N34O 2Q4PA 4DR6O 1MZEA 2LW7A 2G38A 1Y76B 1HNXO 3L71H 5HFMA 4DO2A 1KKDA 3RYHA 2EINB 1IBLB 2GUZB 5EIBD 4EFEA 4NTWA 1FXKC 3I55V 5BR8B 1FD9A 4WF9V 2IW5A 3QO7A 4P30A 5HFLA 1XNRO 1P84F 2DE0X 2GDSA 2P4VA 4X1KA 2ITCC 3J7AU 5EC2C 4G2KA 3VQXA 2DYRB 2CH7B 4ZIBA 2Q7GA 5GTIZ 5L3CA 4FFKA 4DK0A 5CA1B 4DV3O 3STLC 5LXTB 4NYKA 4UCVA 4OXSA 3ZHUA 4IT5A 2F4VB 1P7BA 1TUBA 1I5XA 5LMNB 2FL4A 1M57B 2RN9A 3QNEA 1JVMA 4FLTA 2UUAO 3JALA 2RQ6A 2CTPA 4QJFB 1D5AA 1L0LH 1H2NA 4K8XA 1IXBA 2DJVA 4JI3O 1XL4A 3B09A 3CCMV 4B3RO 4OPHA 1S72V 3CRCA 3ZMUA 1H8EG 2PF4E 4LH7A 1PM9A 4DR2O 5KA5A 5B1NA 1IBMB 1K97A 2RMKB 2LJ2A 1AI6A 3K04A 3AG2C 1GM8A 2NLJC 5FPRA 4AI8A 4N23A 1K92A 4U3JB 4CH3A 2EIKB 2WLJA 2ZINA 1ZX3A 1P4RA 2LFRA 1MABG 3UT5B 2X0LA 4GYCB 3CCEV 3O9OA 3E22A 1K34A 3HKEB 1L8DA 4O4HA 5C93A 1HNZB 3SPJA 2EX3A 2Y4TA 3JCZA 1VQPV 3AG4C 2Q8VA 3DXRA 1M5IA 4BIUA 5EYPA 4UVAA 3PN1A 3F5TA 3SJCC 1SZTA 2QA4V 4B3SO 3K59A 1TAEA 1R3JC 2DOSA 1PKXA 4MW8A 2JGUA 4FK5C 2JEUA 4ZHQA 3OD4A 2ZDIA 1FXVA 1R3LC 2VWJA 3WU2Z 2UXCB 2F95B 2AHYA 3T1YB 4MTFA 3BFRA 4E4EA 2E3CA 5J9PC 1K3EA 2UXBO 4DV6O 5L3GA 1HNWO 1Y74B 1AROP 1TVKB 1FKAO 4I50B 2LP7A 1DLBA 5JH7B 2JK5C 4X9QA 4JI6B 5ITZB 1JX9A 2ADQB 1Y76A 2Q67A 2IU3A 1I7FA 2ZKOA 3ICXA 1YJ9V 4JI4B 1N0NA 1NI8A 1YDXA 3ZJZA 2CE4A 4LF6B 2GUZA 4GKKO 1JA8A 3ZIAG 1AJPA 1N33B 1GRJA 4H0LB 2QWOB 1SQQH 4B7KA 1MMMA 3K5LA 1K8AW 3D3IA 4GX2A 2JVDA 1F23A 5FL7G 1WAZA 5LGTA 3BHPA 3TXQA 1H8HG 2HG5C 2YI9A 2ZDIC 3ZHSA 3HKDA 4MTXA 4DUYO 3W7TA 5IWAB 3CEIA 2UUCO 1PL4A 4RQFA 1JJOA 3ASOC 5CA1A 1PD3A 3FX7A 1YEWA 3ABTA 2F1MA 2HHHB 4MSWC 5LXTA 1GN3A 2PI5A 4U7NA 2CAZC 2OTLV 2PY5A 3M8AA 5FLXN 3L73H 3NXSA 4DR5O 5H6RA 4J7KA 3ZCCA 3AG7A 4F4LA 2ZE6A
chains in the Genus database with same CATH topology
5GW7A 5L3EA 1Q81W 3OMIB 3CMAV 2DWEC 2M7WA 4HZ3A 3ETEA 3GB7C 2WAMA 5IYBO 1NH2D 3ML0A 1QVFU 3OMAB 5CA3A 1IXMA 1K4DC 4U7OA 3CP1A 2EINC 1S3JA 4JAVA 1BL8A 3ASOB 2BOBC 2Z3YA 3E83A 4KP4A 4MVMA 2Q6AA 1E1QG 1RPOA 1R6NA 1GK9A 4MVZA 1VQKV 1LNQA 1H38A 1NKDA 3EHBB 1OHHG 4PELA 1OCOB 1AI5A 3SJQC 4KFMA 3FB7C 2UXXA 3H01A 3UKMA 5IY5C 1GKFA 4I5SA 2IJJA 2DQ3A 1RPRA 2NNUA 4YXWG 2WLHA 1GMGA 3DTUB 2YEVA 3FKSG 3K06A 1V54C 2EILC 2EJRA 2XAFA 2Y69B 3R65A 1E1RG 3LDDA 3VOUA 2WLLA 2WLIA 3WG7C 3LSQA 4MTGA 3DGEA 1JPXA 3D36A 3JD3A 3OMNB 5IDJA 4XDJA 4Z1MG 3LDCA 2QEXV 4MVOA 1K4CC 1AI7A 2DYRC 3OGCC 2JJ1G 3ABMB 3QO8A 3SPCA 4UUJC 1AJQA 1AR1B 3AG1C 3BY6A 1K7DA 1VQ7V 3CCLV 1DF5A 2YSUB 2OT5A 2XAJA 4HAMA 4H37A 3QO5A 3OFNG 5IY5B 4Q20A 1SERA 1W0JG 2WLKA 1RM1B 2X6AA 3SYCA 5L3DA 3F5WC 4R6ZA 3PJSK 1OCRC 4JTDB 3P32A 2EILB 2EBOA 3E2EA 1YTFB 3M99B 2XAGA 3WG7B 1Y4MA 4RUEA 5B1BC 2JDIG 4RQEA 3E8BA 2QE7G 3CXCU 5IYCO 3ABKC 1DTOA 4JF3A 1BMFG 4UXNA 2HR3A 4PA7A 2V7QG 4PA4A 3AG1B 3OR7C 1G8MA 5DM6V 2IU0A 5H9CA 3ZMTA 3ASNB 4X89A 4X8AA 1K5QA 5LHHA 3LDEA 3VBBA 3ZMZA 1PNMA 1EZJA 3FB5C 1OCRB 4QIWF 3W7UA 2ZQMA 3SYAA 1TUEB 2P7TC 3ZRSA 4BW5A 2WWWA 3K3WA 5EK0A 3SYQA 3CCSV 1K33A 1F51A 5B1BB 3KG2A 2P67A 5CMUA 5B1OA 5B3SC 4PA9A 2UXNA 2D3OW 4TWKA 4PA3A 4J9ZB 4KUMA 3SYOA 3JD0A 3SPIA 2EIMB 1BHBA 1KC8W 1DF4A 4WFFA 3ABLC 3ZMSA 1S76D 4WCEV 3F7VC 2XAQA 3E86A 3STZC 3T2MA 2EIJC 3K9AA 3OAAG 3I56V 3CYOA 4J9YB 1YHQV 4CBCA 1BHAA 4G28B 1Q7YW 3UM7A 3FB8C 4MVRA 2YEVB 3CCJV 2DW4A 2P90A 3CC7V 4WFGA 1VQ4V 5B3SB 1K9MW 4X88A 2QKSA 4H33A 2HJFC 3ZMVA 4GT1A 5LGNA 3T4ZA 4I9WA 3ZRXA 2QM7A 2OCCC 1SETA 1VQMV 4JASA 1G4YB 2W6JG 3ABLB 1NR1A 5E1AC 4ZBMA 2ZR3A 1KECA 1YI2V 1NR7A 2ZXWC 2F43G 1OCCC 5B1AC 2EIJB 1JOYA 3IGAC 1ORQC 1XL6A 4JYCA 1ZWIC 2LFSA 3W7XA 3EFFK 1MG1A 4XDKA 4JTAB 4CZZA 3W7WA 1F4NA 5HFMA 4DO2A 4LC1A 4E2LA 1KKDA 1HWYA 2PI4A 3LNMB 1MSWD 2EINB 3OEHG 1VQ9V 4WFEA 5KUMA 2OCCB 4MS2A 2JEXA 1J95A 4FPPA 4PDRA 5H6QA 3OUFA 2ZXWB 3CCRV 3HB3B 4HYOA 1FXKC 3I55V 4WF9V 3T4DA 2IW5A 1QCEA 2XNDG 3QO7A 4XDLA 4P30A 2X6BA 5HFLA 1KQSU 1M57C 2JJ2G 1OZ0A 2P6JA 3FB6C 1V54B 4FMTA 1NJIW 2R9RB 3LSSA 1QVGU 5BZBA 4JYBA 1YJNV 1CEZA 2ITCC 2ZD9A 1GO3F 5EC2C 2HLDG 1CP9A 4G2KA 4MVSA 3SYPA 1W2BU 1B6QA 2DYRB 2B1IA 5L3CA 3CC4V 1Q82W 2IJKA 1OCZC 3STLC 1QLEC 1FXKB 3K0GA 2A9HA 4JTCB 4OXSA 3SPGA 2Q68A 1M9NA 1R3KC 1P7BA 1NH2B 1I5XA 4MVUA 4XBFA 2XASA 2QTOA 1R3IC 3A0RA 4UVBA 2X6CA 3RW0A 1COWG 1GM7A 3W7SA 1M57B 3QNEA 1JVMA 2MK3A 4ASUG 3MHSC 3FYIB 3LUTB 3OM3B 3G6EV 4QJFB 4P2ZA 3ZRWA 3ABKB 4UVCA 2EIKC 5KA6A 3RVZA 5LHIA 4P9OA 1XL4A 1FFTB 2IJHA 5KUKA 3CPWU 3CCMV 2B1GA 1OCZB 1PNKA 2H8PC 1QLEB 4G27B 1S5HC 3G4SV 3ZMUA 1H8EG 1S72V 1E79G 1YIJV 1YITV 3OUSA 2HVKC 2OTJV 5KA5A 5B1NA 3E8GA 1K97A 2GSMB 2R9IA 4R7CA 2X7RB 3AG3C 5EBMC 1QR8A 1EFRG 2HKOA 2DYSC 1AI6A 3E8FA 1NVPD 3K04A 4TT3G 3E89A 4UV9A 5EC1C 1FS0G 5DN6G 4UV8A 1S77D 3AG2C 1GM8A 2NLJC 1W0KG 4R50A 4JGSA 1NBMG 4N23A 2WLLB 4QNHB 1K92A 2WLIB 2EIKB 2WLJA 2WSSG 1AJNA 3JD2A 2QM8A 4PDLA 4GX1A 1P4RA 2KB1A 1MABG 2LFRA 1Q86W 1VQOV 3K03A 2X0LA 1MOFA 2V1DA 3HPLC 3ZN1A 3CCEV 1VQ8V 1VQ6V 2AHZA 1VQNV 4PDMA 4ZKIA 1QLNA 3AEIA 2EZOA 4GX5A 4WFHA 1K34A 3AG3B 1AI4A 3OR6C 4LCUC 2WLMA 5C93A 2DYSB 1KD1W 4WFAV 1V55C 1N8RW 1M90W 1JJ2U 1QR9A 2Y69C 4FIPC 3SPJA 2Z5UA 3JCZA 1VQPV 1JQ0A 1PL0A 3P30A 3G71V 3AG4C 2ZR2A 1CPYA 3AG2B 3E35A 4PDVA 1R73A 3ZRVA 4EKWA 2GHYA 2XAHA 1YJWV 4BIUA 4UVAA 2CK3G 3ABMC 3CC2V 4QPJA 3JD4A 2XOKG 4P9PA 4RO2A 1SZTA 2QA4V 4JAUA 2IJIA 3CCUV 4GCZA 3OEEG 2IH3C 5EBWC 1SESA 1R3JC 1PKXA 2DWDC 4QE7A 3E8HA 1VQLV 1OCCB 4QE9A 5B1AB 1RM1C 4MW8A 5CBHA 1SRYA 2HVJC 4FK5C 2JEUA 3TK1A 1ROPA 2Q69A 1F4MA 1FXVA 1R3LC 2ZDIA 5CBFA 1V55B 2EZPA 4RUFA 4TSFG 2HFEC 4N21A 2JIZG 4FJCC 3FYEB 2ITDC 3AG4B 3B77A 2AHYA 1UJWB 4MT8A 1JCHA 3IC7A 4MTFA 3OE7G 5J9PC 1K3EA 3OW2U 3ZRWB 4MVQA 3TETA 5L3GA 3CCVV 5LGUA 3MD0A 2BOCC 1K73W 1KP3A 3CCQV 3ASNC 5L3FA 1AROP 1NVPB 3ZN0A 1Y66A 3K79A 3B8MA 2LP7A 1DLBA 2JK5C 2Y48A 2C2AA 4DXWA 2H94A 3K0DA 1JX9A 2WPDG 2Q67A 1WPXA 3K08A 2IU3A 4LBEC 3ETDA 4RAIA 1YJ9V 2FTKA 1ENVA 3ZJZA 1R6KA 1PNLA 4WFBV 2A0LA 3BEHA 4BIZA 3F7YC 3MHHC 3ZIAG 4BAYA 1EBOA 2DQ0A 1M1KW 1AJPA 5IYDO 3CMEV 2EIMC 1KP2A 2WLNA 3ABUA 2IH1C 3RBZA 1K8AW 3D3IA 4GX2A 1F23A 4PA6A 5FL7G 5LGTA 4MW3A 2B5UA 3X2QC 3CD6V 1H8HG 2HG5C 2ZDIC 2W0FC 1M56C 1GTOA 3WFVA 5LBQA 2K1EA 3GWOA 4MTOA 4MTXA 1THZA 2A79B 3T1CA 3W7TA 2ATKC 5L3BA 1K5SA 1WLEA 1GM9A 4RQFA 3ASOC 1VQ5V 1PD3A 1I5YA 3ABTA 1L1FA 1FXKA 4MSWC 3JD1A 1QBZA 3RVYA 1YTFD 4U7NA 2OTLV 2PI5A 4JPRA 4LP8A 5LHGA 3NXSA 1H2GA 5EBLC 1OCOC 5H6RA 4GX0A 5CN0A 3B8NA 3SPHA 3JYCA 1S0VA 4R8CA 3ETGA 5CBGA 3IFXA 1NQTA 3ZCCA 1FXHA 3TCUA 1YSCA 4QPKA 3X2QB 4F4LA 4L87A 1M56B 2W6IG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MW8 A;  4PA9 A;  5B3S C;  5CBH A;  2DWE C;  2HVJ C;  1OCZ C;  4HZ3 A;  4TWK A;  1QLE C;  2Q69 A;  3K0G A;  4PA3 A;  3STL C;  3GB7 C;  1R3L C;  2A9H A;  4J9Z B;  4JTC B;  5CBF A;  4RUF A;  4OXS A;  3SPG A;  2Q68 A;  1R3K C;  2HFE C;  3SPI A;  3SYO A;  1K4D C;  2ITD C;  1P7B A;  2EIN C;  1BL8 A;  4MVU A;  2BOB C;  2AHY A;  3E83 A;  4MVM A;  4WFF A;  4MTF A;  2QTO A;  3ABL C;  1R3I C;  2Q6A A;  3RW0 A;  2X6C A;  3F7V C;  3E86 A;  4MVZ A;  3STZ C;  3T2M A;  5J9P C;  1JVM A;  2EIJ C;  1LNQ A;  4J9Y B;  4MVQ A;  4CBC A;  3TET A;  4G28 B;  3SJQ C;  4KFM A;  3FB7 C;  3UM7 A;  3LUT B;  2BOC C;  3FB8 C;  4MVR A;  4P2Z A;  5IY5 C;  3UKM A;  3ASN C;  2EIK C;  4WFG A;  3RVZ A;  2WLH A;  4P9O A;  1XL4 A;  2YEV A;  5KUK A;  2JK5 C;  4X88 A;  2H8P C;  2QKS A;  4G27 B;  3K06 A;  1S5H C;  4DXW A;  1V54 C;  2EIL C;  3K0D A;  3VOU A;  3R65 A;  4H33 A;  3LDD A;  3OUS A;  2HJF C;  2WLL A;  2WLI A;  2HVK C;  3WG7 C;  3T4Z A;  4I9W A;  3E8G A;  4MTG A;  2Q67 A;  3K08 A;  4R7C A;  2OCC C;  4XDJ A;  3LDC A;  3AG3 C;  4LBE C;  1G4Y B;  5E1A C;  4MVO A;  1K4C C;  4RAI A;  2DYR C;  4ZBM A;  5EBM C;  3OGC C;  2ZXW C;  1OCC C;  5B1A C;  3IGA C;  3SPC A;  3ZJZ A;  4UUJ C;  2DYS C;  3AG1 C;  1ORQ C;  3E8F A;  2A0L A;  3BEH A;  1XL6 A;  3F7Y C;  3K04 A;  3E89 A;  1ZWI C;  5EC1 C;  3AG2 C;  3EFF K;  4H37 A;  2NLJ C;  4QNH B;  4R50 A;  2EIM C;  2WLL B;  2WLI B;  2WLK A;  2WLN A;  2X6A A;  3SYC A;  2WLJ A;  3F5W C;  4R6Z A;  3PJS K;  4XDK A;  4JTA B;  4PDL A;  4GX1 A;  2KB1 A;  2IH1 C;  3RBZ A;  1OCR C;  4JTD B;  3K03 A;  1KKD A;  3LNM B;  3HPL C;  4GX2 A;  4PA6 A;  2AHZ A;  4MW3 A;  4PDM A;  4WFE A;  4RUE A;  5B1B C;  5KUM A;  3X2Q C;  3E8B A;  2HG5 C;  4GX5 A;  4MS2 A;  4WFH A;  1J95 A;  2W0F C;  1M56 C;  3ABK C;  4PDR A;  3OUF A;  3OR6 C;  2K1E A;  4MTO A;  4PA7 A;  2A79 B;  4HYO A;  4LCU C;  2WLM A;  3T1C A;  4PA4 A;  1V55 C;  3OR7 C;  2ATK C;  3T4D A;  2Y69 C;  3SPJ A;  4XDL A;  3AG4 C;  4P30 A;  3ASO C;  2X6B A;  4X89 A;  4PDV A;  4X8A A;  4EKW A;  4MSW C;  3RVY A;  3LDE A;  1M57 C;  3FB6 C;  3FB5 C;  4LP8 A;  2R9R B;  5EBL C;  3ABM C;  1OCO C;  4GX0 A;  3SPH A;  3SYA A;  5BZB A;  3JYC A;  4RO2 A;  4P9P A;  4R8C A;  2P7T C;  3ZRS A;  2ITC C;  3IFX A;  4BW5 A;  5CBG A;  2ZD9 A;  3TCU A;  5EC2 C;  5EK0 A;  3SYQ A;  4MVS A;  2IH3 C;  5EBW C;  3SYP A;  3KG2 A;  1R3J C;  2DWD C;  4QE7 A;  4F4L A;  3E8H A;  4QE9 A; 
#chains in the Genus database with same CATH topology
 5GW7 A;  4FLU A;  2DWE C;  4DR4 B;  3ETE A;  4TV8 B;  3GB7 C;  1AB3 A;  4YJ3 B;  4OGQ B;  1K4D C;  2EIN C;  4JAV A;  1BL8 A;  4MVM A;  2Q6A A;  1E1Q G;  1GK9 A;  2KG7 A;  4JI2 O;  3JAS B;  1NKD A;  1OCO B;  2B9Z A;  2UXD O;  3CRR A;  5IY5 C;  3UKM A;  3BAA A;  2FML A;  2IJJ A;  1GMG A;  3DTU B;  2M6Y A;  1XHZ A;  3FKS G;  3VOU A;  2XAF A;  4U3J A;  2LGQ A;  4FM2 A;  5IDJ A;  3JD3 A;  3UT5 A;  2DYR C;  3OGC C;  1U97 A;  3ABM B;  4TOI A;  3SPC A;  5IJ0 B;  1XUQ A;  1AR1 B;  1AJQ A;  3AG1 C;  4D7S A;  3JCU Z;  1MSD A;  2XAJ A;  2PUS A;  1LUW A;  3HKE A;  3OTO B;  2ZE7 A;  4RWU A;  4YHH B;  2FB5 A;  3QO5 A;  1GN2 A;  3ZHT A;  1W0J G;  1NTZ H;  1RM1 B;  2X6A A;  3SYC A;  1P7G A;  3TXS A;  5LMU B;  3SDL A;  4X65 B;  3ZHR A;  2LQT A;  4IL6 Z;  4LF9 B;  2E74 B;  1Y4M A;  4IIJ B;  4LFA O;  1J5E B;  2JDI G;  4RQE A;  4O4J B;  4DR7 B;  2OIG A;  2V7Q G;  4K3A A;  3H1J H;  1M4U A;  5DM6 V;  1SQX H;  4J42 A;  3CS5 A;  3G67 A;  3JAW B;  3LDE A;  1XNQ O;  2ZQM A;  5KMG B;  1TUE B;  3ZRS A;  1SQB H;  2WWW A;  2QJ1 A;  1F51 A;  4X20 B;  2QGN A;  4ICG A;  1A32 A;  5JCO C;  4J9Z B;  3IAY A;  4PHZ A;  1Y74 A;  1TVK A;  4I50 A;  1S76 D;  5ITZ A;  3STZ C;  3T2M A;  4LFB O;  1X59 A;  4GKJ B;  4ZOL B;  1HP8 A;  1XMO O;  2QTS A;  4J9Y B;  2ZCE A;  3UM7 A;  1Q7Y W;  2A7W A;  1EN6 A;  2YID A;  3SJA C;  5IYZ B;  3CC7 V;  4WFG A;  1VQ4 V;  1K9M W;  1XOU A;  2VS0 A;  3OGI B;  3BAB A;  3ZRX A;  5J2U B;  3QVN A;  2Y4U A;  4K8Z A;  3RT3 C;  1HW7 A;  1SA0 B;  2QR4 A;  2ZXW C;  2WA3 A;  1N36 B;  2A06 H;  4JYC A;  4X62 B;  3GWK C;  1B06 A;  4NXM O;  4JTA B;  1S5L Z;  1SQG A;  1YCI A;  3CWB H;  4DR1 B;  1WB8 A;  1MSW D;  4EFB A;  3OEH G;  1QHT A;  3L70 H;  4X64 O;  3LNN A;  4MS2 A;  4PDR A;  1BZK A;  1Q6H A;  2RNB A;  2XND G;  3SR2 C;  2CTQ A;  2ZE5 A;  3CX5 F;  1AP6 A;  4TV8 A;  2JJ2 G;  3N27 A;  4YJ3 A;  3ZHQ A;  2P6J A;  2ZD9 A;  1GO3 F;  2D2C B;  3JAS A;  4MVS A;  4C7U A;  2AXT Z;  4EB6 A;  4FZ1 A;  3K0G A;  1JR9 A;  4JTC B;  1V9P A;  4YY3 O;  1R3I C;  3A0R A;  1WP7 A;  2YS8 A;  3BPZ A;  4ASU G;  1H2K A;  3FYI B;  5IJ9 B;  1OV9 A;  3OM3 B;  4KHP O;  4UVC A;  5IJ0 A;  3SJB C;  2CGN A;  2IJH A;  3S3X A;  1VF5 B;  3ZED A;  2B1G A;  1OCZ B;  1PNK A;  1QLE B;  1S5H C;  1YIJ V;  1YIT V;  1U96 A;  5JJE B;  1XEQ A;  3JAR B;  4R7C A;  3AG3 C;  1EN5 A;  2YXL A;  4LR3 A;  2V4D A;  3ZHV A;  1EFR G;  1SQP H;  2DYS C;  4DUZ B;  4TT3 G;  4O4J A;  4UV9 A;  4F6E A;  5DN6 G;  4UV8 A;  2QSA A;  4QNH B;  4R50 A;  2WLL B;  1SQV H;  3K9S A;  3A0B Z;  2WSS G;  1AJN A;  1ZLZ A;  2DMX A;  2WA4 A;  3AK2 A;  2OIE A;  4F6R B;  4GX1 A;  2KB1 A;  2Q5Z A;  1Q86 W;  1T5E A;  3JAW A;  2EJ7 A;  3JSN A;  3P3N A;  4PDM A;  4ZKI A;  1QLN A;  1Z2G A;  1PPJ H;  4JI1 B;  1VIB A;  3JSL A;  5KMG A;  4LCU C;  4NXN B;  2WLM A;  2YDE A;  2DN9 A;  3KCY A;  4WFA V;  1JJ2 U;  1QR9 A;  4FIP C;  2H3O A;  2Z5U A;  3Q4H B;  1JQ0 A;  3G71 V;  4X20 A;  3WB0 A;  2Q7E A;  1CPY A;  2MW2 B;  2GHY A;  1XMQ B;  4K0K B;  1N4C A;  2OCH A;  3JAT B;  5LL6 Y;  4I9Q A;  2ILM A;  3ABM C;  3RFR A;  4QPJ A;  3CC2 V;  4B3T O;  2XOK G;  4P9P A;  4JAU A;  3CCU V;  4OX9 O;  3OEE G;  4ZOL A;  1VQL V;  1RM1 C;  4BW9 A;  1NZ6 A;  3TK1 A;  4BIO A;  1CXZ B;  1ROP A;  5CBF A;  1V55 B;  2CGO A;  4RUF A;  5IYZ A;  1KUQ A;  3KKY A;  1X4T A;  3L74 H;  3B77 A;  1JCH A;  3IC7 A;  2F66 C;  1R1B A;  3OW2 U;  5J2U A;  3ZRW B;  2Z0A A;  4MVQ A;  3KZI Z;  3TET A;  3EVK A;  1H2L A;  4X66 O;  4JYA B;  1SA0 A;  1K73 W;  5EZY B;  1KP3 A;  3CCQ V;  4ZI7 B;  1Y66 A;  1Q6I A;  3K79 A;  3B8M A;  4NVP A;  2C2A A;  4DXW A;  2XTA A;  2QWP B;  3SGI A;  3DSQ A;  2WPD G;  3K08 A;  4LBE C;  4RAI A;  4LF5 B;  2FTK A;  1VF6 A;  2ADP A;  2PTM A;  1ENV A;  2VQE B;  4B7E A;  2BSK A;  4WFB V;  2A0L A;  3BEH A;  4BIZ A;  3F7Y C;  3MHH C;  2ZM6 B;  1FJG B;  1RFY A;  1BQ0 A;  3BCC H;  3OTF A;  3ABU A;  1FYJ A;  3N2G B;  4DV1 B;  2KSD A;  4LF8 B;  4I7Z B;  1Q43 A;  4JI0 O;  5B5E Z;  5J2T B;  4PA6 A;  1ZL8 B;  4MW3 A;  1N32 O;  1M56 C;  1GTO A;  3WFV A;  5KX5 B;  2K1E A;  4I55 B;  2GTS A;  4AQY B;  5L3B A;  1F7Y A;  1WLE A;  4H13 B;  1L1F A;  2QKC A;  3JD1 A;  1QBZ A;  2E5L O;  4CH6 A;  2N74 A;  1MZF A;  5LHG A;  1RSO A;  2PGG A;  3SPH A;  4R8C A;  1KU9 A;  3IFX A;  1NQT A;  1FXH A;  3X2Q B;  4JI8 O;  2Q9L A;  4ABM A;  5L3E A;  3OMI B;  5IJ9 A;  1IBK O;  4HZ3 A;  4GLX A;  2OYQ A;  2ARH A;  2WAM A;  4TQD A;  1QVF U;  1IXM A;  1VF6 C;  1S3J A;  1MNG A;  4KP4 A;  2BOB C;  1RPO A;  4MVZ A;  1LNQ A;  1H38 A;  1JMK C;  3EHB B;  4DR3 B;  4PEL A;  3JAR A;  1AI5 A;  2ZT9 B;  4LNU B;  4PI2 A;  4KFM A;  3FB7 C;  4J10 A;  4DV7 B;  3FFQ A;  2ZE8 A;  4I5S A;  4DV4 B;  1G6U A;  4JI7 B;  2NNU A;  3QG5 A;  4YXW G;  3NR7 A;  4D6T H;  3K06 A;  2EIL C;  4NTX A;  4JV5 O;  3R65 A;  1E1R G;  2WLL A;  3LSQ A;  1VEW A;  1ZSP A;  4MTG A;  5BXZ A;  3RYF B;  1JPX A;  4Z1M G;  2QEX V;  3B4S A;  4MVO A;  1AI7 A;  1HR0 O;  1VQ7 V;  2YSU B;  3UCS C;  2OT5 A;  2JRI A;  4WBN A;  3OFN G;  1H2M A;  5L3D A;  5DED A;  3Q4H A;  4PD4 F;  3P32 A;  2EBO A;  3M99 B;  3WG7 B;  4AHC A;  4RUE A;  4LF7 B;  5B1B C;  4UB8 Z;  1DTO A;  3A2F A;  4D7T A;  4PA4 A;  1G8M A;  3CRM A;  3CHX A;  5H9C A;  2IU0 A;  3ASN B;  4X89 A;  3WB1 A;  1BS3 A;  1VAR A;  1PNM A;  2AW9 A;  4O4L B;  4O4I B;  1YVW A;  2Q0O C;  1EZJ A;  3FB5 C;  1OCR B;  4QIW F;  3W7U A;  3SYA A;  2W0X A;  4NR1 A;  2P7T C;  4BW5 A;  3K3W A;  4DV0 B;  3KG2 A;  4JI5 B;  4PA9 A;  2UXN A;  2VQF B;  4DV5 B;  2D3O W;  2CH7 A;  2YXY A;  2UUB B;  3JD0 A;  3SPI A;  4LFC B;  1BHB A;  1DF4 A;  4LF4 O;  4TQF A;  3ZMS A;  4WCE V;  1SC5 B;  4B3M B;  3OAA G;  3I56 V;  4FM1 A;  1YHQ V;  4CBC A;  2N05 A;  4G28 B;  1BHA A;  2YEV B;  2HP8 A;  2Y0I A;  4DV2 B;  3APQ A;  4NB5 A;  2ODM A;  1RP3 B;  4K35 A;  5B3S B;  5C8Y B;  3T1H O;  4X88 A;  2AZ0 A;  2BTO A;  2YIA A;  2YUA A;  1I94 B;  4H33 A;  2ETN A;  2HJF C;  2UU9 B;  3RWR D;  4HBN A;  2QM7 A;  3N2G A;  5KHK A;  3ABL B;  4ZBM A;  1N34 B;  4DR6 B;  5J2T A;  2EIJ B;  2YIB A;  1ZL8 A;  3IGA C;  5BMV B;  1HNX B;  1ORQ C;  5KX5 A;  4I55 A;  3BA9 A;  4XDK A;  4CZZ A;  2XHB A;  4OPA A;  4UCO A;  3LNM B;  1ZUQ A;  1BCC H;  5KUM A;  2OCC B;  2JEX A;  1AP5 A;  4FPP A;  1XNR B;  2XT9 A;  3OUF A;  1Y67 A;  1KYO F;  1IBL O;  3T4D A;  1QCE A;  4XDL A;  5LA6 B;  1EZV H;  1M57 C;  5BR8 O;  4UCR A;  3K5M A;  1WPB A;  1OZ0 A;  4FMT A;  1V54 B;  1NJI W;  4DV3 B;  5BZB A;  4JYB A;  1YJN V;  1BT8 A;  1B6Q A;  2B1I A;  4A5U B;  4FLY A;  3CC4 V;  2IJK A;  3G6B A;  1FXK B;  2LGW A;  4Z1V A;  3SPG A;  4BR6 A;  2UUA B;  1NH2 B;  2XAS A;  1VF7 A;  2QTO A;  1GM7 A;  5LP6 B;  1YXB A;  4JI3 B;  1KKC A;  3ETQ A;  3HR0 A;  1ZTE A;  3RYF A;  2MK3 A;  5LYJ B;  2F4V O;  3MHS C;  5GON B;  4B3R B;  3DC6 A;  3UO2 A;  2FYU H;  2PYJ A;  4DW0 A;  4P2Z A;  4DR2 B;  2EIK C;  1KMI Z;  3RVZ A;  3AK3 A;  3CPW U;  3AK1 A;  3G4S V;  2H8P C;  1E79 G;  2HVK C;  2OTJ V;  4X1Y B;  5JH7 A;  2R9I A;  4IHJ B;  5KHI A;  5EBM C;  5K1P A;  3S3W A;  1QR8 A;  1O9H A;  1XHX A;  3E8F A;  1NVP D;  1TGO A;  1IBM O;  2N04 A;  5EC1 C;  1FS0 G;  1S77 D;  2QDO A;  2JS5 A;  4J80 A;  1W0K G;  1AR5 A;  4I4T B;  2WLI B;  2YXH A;  4FLV A;  2GTA A;  1SQF A;  2GV9 A;  1MOF A;  4YIP A;  3HPL C;  1VQ8 V;  2AHZ A;  1VQN V;  4O4I A;  5JJN B;  1AI4 A;  1NTM H;  3OR6 C;  4I0X B;  2P06 A;  1KD1 W;  1N8R W;  4HNA B;  3P30 A;  3AG2 B;  3E35 A;  4B3S B;  1R73 A;  5KAI Z;  3ZRV A;  3ZBH A;  5KAF Z;  3HKB B;  4PI0 A;  1YJW V;  1HNZ O;  1B04 A;  4RO2 A;  2LO1 A;  4GCZ A;  4UCS A;  2IH3 C;  5EBW C;  2CDY A;  1NTK H;  3E8H A;  4PJ0 Z;  1OCC B;  5B1A B;  5CBH A;  2HVJ C;  1QNM A;  4U3F H;  2EZP A;  3THO A;  2UXB B;  2HFE C;  4JZG A;  4DV6 B;  1WJZ A;  2ITD C;  2ZNI A;  3AG4 B;  5C8Y A;  1UJW B;  4MT8 A;  3A8T A;  1HNW B;  4H44 B;  2BTQ B;  1WP8 A;  1KBH A;  2VWK A;  3T1Y O;  3GVM A;  3L9D A;  3ASN C;  5BMV A;  5L3F A;  1BQZ A;  3G80 A;  2R72 A;  1XBL A;  3APO A;  4GKK B;  5CB4 B;  2QWR B;  1WPX A;  1R6T A;  5FNV B;  1TA8 A;  3ETD A;  4JI6 O;  1IDS A;  4L8J A;  1R6K A;  4UCU A;  4LWS B;  1PNL A;  4W4K A;  4BAY A;  1UFI A;  3IJ4 A;  2DQ0 A;  1M1K W;  5IYD O;  4JI4 O;  2ZNJ A;  2L6L A;  4LF6 O;  4DUY B;  5LA6 A;  1EM1 A;  1BE3 H;  3CRQ A;  3FAV B;  2B5U A;  1VMG A;  2UUC B;  1N33 O;  2W0F C;  5LBQ A;  4DYL A;  2YIC A;  5D5P A;  2IBZ H;  4IIJ A;  4JAA A;  3GWO A;  1THZ A;  4GUN A;  3T1C A;  3L75 H;  2ATK C;  4DR5 B;  1K5S A;  4CH5 A;  1GM9 A;  1I5Y A;  1FXK A;  1AIL A;  2RCV A;  1YTF D;  5IWA O;  4LP8 A;  1H2G A;  1OCO C;  4GX0 A;  5CN0 A;  3JYC A;  1S0V A;  3ETG A;  4FM0 A;  4JZ2 A;  1YSC A;  5LP6 A;  2HHH O;  4QPK A;  4L87 A;  4J41 A;  5LYJ A;  2W6I G;  3QTC A;  2JGD B;  3CB2 A;  3CMA V;  4CS2 A;  1EN4 A;  3JAK B;  4JI2 B;  5IYB O;  3ML0 A;  3OMA B;  5CA3 A;  4FZ0 A;  1Z5W A;  3ASO B;  2Z3Y A;  2UXD B;  3HKC B;  1VQK V;  4X1Y A;  1OHH G;  4IHJ A;  3U11 A;  4NKG B;  3H01 A;  4TV9 B;  3D8C A;  2CTW A;  4O2B B;  3A0H Z;  4KL1 A;  1V54 C;  2EJR A;  2F23 A;  2Y69 B;  3LDD A;  2WLI A;  4I4T A;  1QQC A;  3DGE A;  4GZR B;  3OMN B;  5FPO A;  4XDJ A;  3FD9 A;  2OWO A;  5AG2 A;  3QO8 A;  3BY6 A;  1K7D A;  3CCL V;  1DF5 A;  4PV1 B;  3RN4 A;  1B3Q A;  5IY5 B;  4Q20 A;  4I0X A;  3R66 A;  4LFA B;  1SER A;  3H1L H;  5JVD B;  2LW1 A;  3PJS K;  4R6Z A;  4HNA A;  4O2A B;  5LP6 C;  4JTD B;  5A9G A;  2K9P A;  3OTO O;  4YHH O;  3HKD B;  3HKB A;  2XAG A;  4W4L A;  2VRZ A;  2QE7 G;  5LMU O;  4JF3 A;  1BMF G;  4TUY B;  4IYH A;  1Q6U A;  4X65 O;  2HR3 A;  4PA7 A;  1XNQ B;  4LF9 O;  3K57 A;  3AG1 B;  1Q90 D;  1J5E O;  2RJZ A;  3ZMT A;  1K5Q A;  4DR7 O;  3ZMZ A;  3BA8 A;  2ZIO A;  1FFX B;  5EK0 A;  3SYQ A;  3CCS V;  5CMU A;  2BTQ A;  3BVO A;  4LH6 A;  5B1O A;  1L0N H;  1XQ8 A;  1GN6 A;  1AR4 A;  4PA3 A;  4LFB B;  4KUM A;  1XMO B;  2KG7 B;  2AGA A;  2EIM B;  1D5N A;  3O65 A;  4IGG A;  3C3S A;  1D2D A;  3E86 A;  5CB4 A;  3CYO A;  3IC9 A;  5FNV A;  2BCC H;  1Q3E A;  1Y6X A;  4J7J A;  4DK1 A;  3CCJ V;  2DW4 A;  2P90 A;  5IE9 A;  4LWS A;  4GKJ O;  2QKS A;  5IT9 N;  3CXH F;  4GT1 A;  5LGN A;  4I9W A;  1G4Y B;  5E1A C;  1NR1 A;  2ZR3 A;  1Q5O A;  2F43 G;  1OCC C;  1XIL A;  3FAV A;  5B1A C;  4NXM B;  1WA8 B;  1UPG A;  3TJT A;  3W7X A;  3EFF K;  3N2K B;  1MG1 A;  4X64 B;  1FAF A;  3W7W A;  1WN7 A;  1F4N A;  1N36 O;  4LC1 A;  2YIB D;  4E2L A;  1HWY A;  4X62 O;  2PI4 A;  1US6 A;  2BE3 A;  1LR1 A;  4F6R A;  1VQ9 V;  2ZIM A;  4WFE A;  1GAX A;  1J95 A;  5H6Q A;  2ZXW B;  3CCR V;  4DR1 O;  1S5J A;  3HB3 B;  4HYO A;  1WB7 A;  4BWA A;  2JGD A;  2X6B A;  4KXR A;  5KHJ A;  1KQS U;  3C90 A;  3JAK A;  1XI1 A;  2Q0A A;  1SKV A;  5KHH A;  3FB6 C;  2R9R B;  3LSS A;  1QVG U;  1IVS A;  1CEZ A;  3JAT A;  3HKC A;  5BY1 A;  5B66 Z;  2HLD G;  1CP9 A;  3SYP A;  1W2B U;  5CA0 B;  4YY3 B;  1AVM A;  1MA1 A;  2FKX A;  1Q82 W;  1OCZ C;  1QLE C;  4TV9 A;  2A9H A;  2Q68 A;  1GN4 A;  1M9N A;  1R3K C;  4FLX A;  4YIO A;  4MVU A;  4XBF A;  2PYL A;  4O2B A;  2NN4 A;  4UVB A;  3RW0 A;  2X6C A;  3TGU H;  1PP9 H;  1COW G;  3W7S A;  4KHP B;  5EIB C;  4Q6G A;  3LUT B;  3G6E V;  4YJ2 B;  3ZRW A;  3ABK B;  5TIS Z;  5JQG B;  5KA6 A;  3KCX A;  5LHI A;  4P9O A;  5KUK A;  1FFT B;  3J80 N;  5EZY A;  4G27 B;  4ZI7 A;  3OUS A;  5JVD A;  3E8G A;  2GSM B;  1XDC A;  4O2A A;  2X7R B;  4J11 A;  1FPO A;  2RDC A;  2HKO A;  3MDS A;  4CH4 A;  3E89 A;  4TUY A;  4JGS A;  1NBM G;  1H2S B;  1Z5V A;  3JD2 A;  2QM8 A;  4PDL A;  4DUZ O;  1VQO V;  3K03 A;  5A2Q N;  2V1D A;  5K1X A;  3ZN1 A;  1IX9 A;  1VQ6 V;  3AEI A;  3CJH B;  2EZO A;  3ZS8 C;  4GX5 A;  4WFH A;  1G1X B;  3AG3 B;  5DEC A;  1O9G A;  1N0J A;  3C3T A;  3U0Z A;  1FFX A;  3CSX A;  3UO3 A;  2DYS B;  1M90 W;  1V55 C;  2Y69 C;  4B3T B;  2P4K A;  1PL0 A;  4JI1 O;  2ZR2 A;  4PDV A;  5D5Q A;  4OX9 B;  4EKW A;  1GH6 A;  2XAH A;  3RYC B;  4NXN O;  5H2F Z;  4CS3 A;  4DRX B;  2CK3 G;  4IYI A;  3JD4 A;  2IJI A;  4EB6 B;  1XRE A;  5H5N A;  1XMQ O;  1SES A;  4K0K O;  2DWD C;  3B40 A;  4QE7 A;  4QE9 A;  1LUV A;  2QWQ B;  1SRY A;  2Q69 A;  1PV0 A;  1F4M A;  4TSF G;  5GTH Z;  1HDJ A;  4N21 A;  2JIZ G;  4FJC C;  3FYE B;  4CS4 A;  2HJD A;  3K5O A;  4X66 B;  2P22 C;  1JFF B;  1ZAU A;  2XUM A;  3OE7 G;  5JCO A;  3H1H H;  4B08 A;  1QU7 A;  2QM4 A;  3CCV V;  5LGU A;  3MD0 A;  2BOC C;  1I0H A;  1SS3 A;  1I08 A;  3VQW A;  1NVP B;  1WA8 A;  4LNU A;  3ZN0 A;  2Y48 A;  2H94 A;  3K0D A;  3N2K A;  4JYA O;  4X1I B;  3EXA A;  1WNS A;  2CTR A;  3P3P A;  2GBO A;  2R70 A;  3CE2 A;  3JAM N;  5LMN O;  4JI0 B;  1EBO A;  1P49 A;  4FFB B;  3CME V;  4FVM A;  4EEQ A;  2EIM C;  4LF5 O;  1KP2 A;  2WLN A;  2VQE O;  3H1I H;  1N32 B;  2IH1 C;  3RBZ A;  2ZM6 O;  2L35 A;  1FJG O;  3CRA A;  2F93 B;  3RYI B;  5KLV H;  5JJJ B;  5LOV B;  3K58 A;  3X2Q C;  3CD6 V;  4DV1 O;  2JS3 A;  4LF8 O;  2QWN B;  4MTO A;  2E5L B;  2A79 B;  3ZX6 A;  4NTY A;  2Y0P A;  4UCT A;  5CA0 A;  4J7Z A;  1VQ5 V;  3RYH B;  2AZ2 A;  1W59 A;  3K5N A;  3RVY A;  4JI8 B;  2R9A A;  4AQY O;  4JPR A;  2HEP A;  5EBL C;  1IBK B;  3B8N A;  3LSU A;  4O4L A;  5CBG A;  1BSM A;  3TCU A;  1OJH A;  1NS1 A;  3OT7 A;  1M56 B;  1Q81 W;  2M7W A;  2YC0 A;  4YJ2 A;  2O57 A;  1NH2 D;  5JQG A;  4U7O A;  3CP1 A;  3E83 A;  3I5D A;  3QF7 A;  5F2V O;  4X1K B;  1NU1 H;  1R6N A;  3VQY A;  5JWP A;  2EUL A;  4CC5 A;  3SJQ C;  2CUG A;  2UXX A;  4JV5 B;  4UB6 Z;  2NR5 A;  1DK1 A;  1GKF A;  2DQ3 A;  1RPR A;  2WLH A;  1TUB B;  4DR3 O;  2YEV A;  1HR0 B;  4DV7 O;  3WG7 C;  1YF2 A;  1DGS A;  4DV4 O;  2PZS A;  3D36 A;  4JI7 O;  3LDC A;  2BSK B;  3JAL B;  1K4C C;  2JJ1 G;  2UXC O;  4UUJ C;  3CJH A;  4AIL C;  1IUR A;  3WB2 A;  4HAM A;  4H37 A;  2WLK A;  3F5W C;  4JYY A;  1OCR C;  3U10 A;  2EIL B;  1SZX A;  3E2E A;  1YTF B;  4DW1 A;  3RGB A;  3J81 N;  3H9V A;  3RYC A;  3E8B A;  4DRX A;  3CXC U;  5IYC O;  4FLZ A;  3ABK C;  4UXN A;  3VQV A;  2E75 B;  1SF9 A;  3BRC A;  3L72 H;  3OR7 C;  4LF7 O;  2E76 B;  4X8A A;  1NT2 B;  1RSO B;  5LHH A;  2A3Q A;  1YZB A;  3E22 B;  3VBB A;  1BGY H;  1JFF A;  4O4H B;  1K33 A;  1Q8I A;  5B1B B;  2P67 A;  3M7M X;  2P5O A;  5B3S C;  4LF4 B;  3B2E E;  3D36 C;  4TWK A;  2YI8 A;  2KKW A;  3DXR B;  3SYO A;  4DV0 O;  5EYP B;  4JI5 O;  1KC8 W;  4WFF A;  3ABL C;  2VQF O;  4DV5 O;  3F7V C;  2XAQ A;  4X1I A;  4UFZ A;  1URF A;  2EIJ C;  3K9A A;  3UQ8 A;  2Q73 A;  2UUB O;  2KQX A;  3T1H B;  4LFC O;  4ZHQ B;  3FB8 C;  4MVR A;  2QKA A;  5GON A;  4CC6 A;  4B3M O;  2Q7H A;  4FLW A;  4FFB A;  3D3Q A;  1M93 A;  1IZ3 A;  5E79 Z;  3ZMV A;  2IM9 A;  1VP7 A;  3T4Z A;  4DV2 O;  2OCC C;  1SET A;  3DC5 A;  4JAS A;  1VQM V;  4DR4 O;  2W6J G;  3H1K H;  4Z2W A;  1KEC A;  1YI2 V;  1NR7 A;  3RYI A;  1I94 O;  4WBN B;  1JOY A;  1KB9 F;  4QGP A;  5LOV A;  2UU9 O;  3MAQ A;  1XL6 A;  1ZWI C;  2LFS A;  5KHG A;  1N34 O;  2Q4P A;  4DR6 O;  1MZE A;  2LW7 A;  2G38 A;  1Y76 B;  1HNX O;  3L71 H;  5HFM A;  4DO2 A;  1KKD A;  3RYH A;  2EIN B;  1IBL B;  2GUZ B;  5EIB D;  4EFE A;  4NTW A;  1FXK C;  3I55 V;  5BR8 B;  1FD9 A;  4WF9 V;  2IW5 A;  3QO7 A;  4P30 A;  5HFL A;  1XNR O;  1P84 F;  2DE0 X;  2GDS A;  2P4V A;  4X1K A;  2ITC C;  3J7A U;  5EC2 C;  4G2K A;  3VQX A;  2DYR B;  2CH7 B;  4ZIB A;  2Q7G A;  5GTI Z;  5L3C A;  4FFK A;  4DK0 A;  5CA1 B;  4DV3 O;  3STL C;  5LXT B;  4NYK A;  4UCV A;  4OXS A;  3ZHU A;  4IT5 A;  2F4V B;  1P7B A;  1TUB A;  1I5X A;  5LMN B;  2FL4 A;  1M57 B;  2RN9 A;  3QNE A;  1JVM A;  4FLT A;  2UUA O;  3JAL A;  2RQ6 A;  2CTP A;  4QJF B;  1D5A A;  1L0L H;  1H2N A;  4K8X A;  1IXB A;  2DJV A;  4JI3 O;  1XL4 A;  3B09 A;  3CCM V;  4B3R O;  4OPH A;  1S72 V;  3CRC A;  3ZMU A;  1H8E G;  2PF4 E;  4LH7 A;  1PM9 A;  4DR2 O;  5KA5 A;  5B1N A;  1IBM B;  1K97 A;  2RMK B;  2LJ2 A;  1AI6 A;  3K04 A;  3AG2 C;  1GM8 A;  2NLJ C;  5FPR A;  4AI8 A;  4N23 A;  1K92 A;  4U3J B;  4CH3 A;  2EIK B;  2WLJ A;  2ZIN A;  1ZX3 A;  1P4R A;  2LFR A;  1MAB G;  3UT5 B;  2X0L A;  4GYC B;  3CCE V;  3O9O A;  3E22 A;  1K34 A;  3HKE B;  1L8D A;  4O4H A;  5C93 A;  1HNZ B;  3SPJ A;  2EX3 A;  2Y4T A;  3JCZ A;  1VQP V;  3AG4 C;  2Q8V A;  3DXR A;  1M5I A;  4BIU A;  5EYP A;  4UVA A;  3PN1 A;  3F5T A;  3SJC C;  1SZT A;  2QA4 V;  4B3S O;  3K59 A;  1TAE A;  1R3J C;  2DOS A;  1PKX A;  4MW8 A;  2JGU A;  4FK5 C;  2JEU A;  4ZHQ A;  3OD4 A;  2ZDI A;  1FXV A;  1R3L C;  2VWJ A;  3WU2 Z;  2UXC B;  2F95 B;  2AHY A;  3T1Y B;  4MTF A;  3BFR A;  4E4E A;  2E3C A;  5J9P C;  1K3E A;  2UXB O;  4DV6 O;  5L3G A;  1HNW O;  1Y74 B;  1ARO P;  1TVK B;  1FKA O;  4I50 B;  2LP7 A;  1DLB A;  5JH7 B;  2JK5 C;  4X9Q A;  4JI6 B;  5ITZ B;  1JX9 A;  2ADQ B;  1Y76 A;  2Q67 A;  2IU3 A;  1I7F A;  2ZKO A;  3ICX A;  1YJ9 V;  4JI4 B;  1N0N A;  1NI8 A;  1YDX A;  3ZJZ A;  2CE4 A;  4LF6 B;  2GUZ A;  4GKK O;  1JA8 A;  3ZIA G;  1AJP A;  1N33 B;  1GRJ A;  4H0L B;  2QWO B;  1SQQ H;  4B7K A;  1MMM A;  3K5L A;  1K8A W;  3D3I A;  4GX2 A;  2JVD A;  1F23 A;  5FL7 G;  1WAZ A;  5LGT A;  3BHP A;  3TXQ A;  1H8H G;  2HG5 C;  2YI9 A;  2ZDI C;  3ZHS A;  3HKD A;  4MTX A;  4DUY O;  3W7T A;  5IWA B;  3CEI A;  2UUC O;  1PL4 A;  4RQF A;  1JJO A;  3ASO C;  5CA1 A;  1PD3 A;  3FX7 A;  1YEW A;  3ABT A;  2F1M A;  2HHH B;  4MSW C;  5LXT A;  1GN3 A;  2PI5 A;  4U7N A;  2CAZ C;  2OTL V;  2PY5 A;  3M8A A;  5FLX N;  3L73 H;  3NXS A;  4DR5 O;  5H6R A;  4J7K A;  3ZCC A;  3AG7 A;  4F4L A;  2ZE6 A; 
#chains in the Genus database with same CATH homology
 5GW7 A;  5L3E A;  1Q81 W;  3OMI B;  3CMA V;  2DWE C;  2M7W A;  4HZ3 A;  3ETE A;  3GB7 C;  2WAM A;  5IYB O;  1NH2 D;  3ML0 A;  1QVF U;  3OMA B;  5CA3 A;  1IXM A;  1K4D C;  4U7O A;  3CP1 A;  2EIN C;  1S3J A;  4JAV A;  1BL8 A;  3ASO B;  2BOB C;  2Z3Y A;  3E83 A;  4KP4 A;  4MVM A;  2Q6A A;  1E1Q G;  1RPO A;  1R6N A;  1GK9 A;  4MVZ A;  1VQK V;  1LNQ A;  1H38 A;  1NKD A;  3EHB B;  1OHH G;  4PEL A;  1OCO B;  1AI5 A;  3SJQ C;  4KFM A;  3FB7 C;  2UXX A;  3H01 A;  3UKM A;  5IY5 C;  1GKF A;  4I5S A;  2IJJ A;  2DQ3 A;  1RPR A;  2NNU A;  4YXW G;  2WLH A;  1GMG A;  3DTU B;  2YEV A;  3FKS G;  3K06 A;  1V54 C;  2EIL C;  2EJR A;  2XAF A;  2Y69 B;  3R65 A;  1E1R G;  3LDD A;  3VOU A;  2WLL A;  2WLI A;  3WG7 C;  3LSQ A;  4MTG A;  3DGE A;  1JPX A;  3D36 A;  3JD3 A;  3OMN B;  5IDJ A;  4XDJ A;  4Z1M G;  3LDC A;  2QEX V;  4MVO A;  1K4C C;  1AI7 A;  2DYR C;  3OGC C;  2JJ1 G;  3ABM B;  3QO8 A;  3SPC A;  4UUJ C;  1AJQ A;  1AR1 B;  3AG1 C;  3BY6 A;  1K7D A;  1VQ7 V;  3CCL V;  1DF5 A;  2YSU B;  2OT5 A;  2XAJ A;  4HAM A;  4H37 A;  3QO5 A;  3OFN G;  5IY5 B;  4Q20 A;  1SER A;  1W0J G;  2WLK A;  1RM1 B;  2X6A A;  3SYC A;  5L3D A;  3F5W C;  4R6Z A;  3PJS K;  1OCR C;  4JTD B;  3P32 A;  2EIL B;  2EBO A;  3E2E A;  1YTF B;  3M99 B;  2XAG A;  3WG7 B;  1Y4M A;  4RUE A;  5B1B C;  2JDI G;  4RQE A;  3E8B A;  2QE7 G;  3CXC U;  5IYC O;  3ABK C;  1DTO A;  4JF3 A;  1BMF G;  4UXN A;  2HR3 A;  4PA7 A;  2V7Q G;  4PA4 A;  3AG1 B;  3OR7 C;  1G8M A;  5DM6 V;  2IU0 A;  5H9C A;  3ZMT A;  3ASN B;  4X89 A;  4X8A A;  1K5Q A;  5LHH A;  3LDE A;  3VBB A;  3ZMZ A;  1PNM A;  1EZJ A;  3FB5 C;  1OCR B;  4QIW F;  3W7U A;  2ZQM A;  3SYA A;  1TUE B;  2P7T C;  3ZRS A;  4BW5 A;  2WWW A;  3K3W A;  5EK0 A;  3SYQ A;  3CCS V;  1K33 A;  1F51 A;  5B1B B;  3KG2 A;  2P67 A;  5CMU A;  5B1O A;  5B3S C;  4PA9 A;  2UXN A;  2D3O W;  4TWK A;  4PA3 A;  4J9Z B;  4KUM A;  3SYO A;  3JD0 A;  3SPI A;  2EIM B;  1BHB A;  1KC8 W;  1DF4 A;  4WFF A;  3ABL C;  3ZMS A;  1S76 D;  4WCE V;  3F7V C;  2XAQ A;  3E86 A;  3STZ C;  3T2M A;  2EIJ C;  3K9A A;  3OAA G;  3I56 V;  3CYO A;  4J9Y B;  1YHQ V;  4CBC A;  1BHA A;  4G28 B;  1Q7Y W;  3UM7 A;  3FB8 C;  4MVR A;  2YEV B;  3CCJ V;  2DW4 A;  2P90 A;  3CC7 V;  4WFG A;  1VQ4 V;  5B3S B;  1K9M W;  4X88 A;  2QKS A;  4H33 A;  2HJF C;  3ZMV A;  4GT1 A;  5LGN A;  3T4Z A;  4I9W A;  3ZRX A;  2QM7 A;  2OCC C;  1SET A;  1VQM V;  4JAS A;  1G4Y B;  2W6J G;  3ABL B;  1NR1 A;  5E1A C;  4ZBM A;  2ZR3 A;  1KEC A;  1YI2 V;  1NR7 A;  2ZXW C;  2F43 G;  1OCC C;  5B1A C;  2EIJ B;  1JOY A;  3IGA C;  1ORQ C;  1XL6 A;  4JYC A;  1ZWI C;  2LFS A;  3W7X A;  3EFF K;  1MG1 A;  4XDK A;  4JTA B;  4CZZ A;  3W7W A;  1F4N A;  5HFM A;  4DO2 A;  4LC1 A;  4E2L A;  1KKD A;  1HWY A;  2PI4 A;  3LNM B;  1MSW D;  2EIN B;  3OEH G;  1VQ9 V;  4WFE A;  5KUM A;  2OCC B;  4MS2 A;  2JEX A;  1J95 A;  4FPP A;  4PDR A;  5H6Q A;  3OUF A;  2ZXW B;  3CCR V;  3HB3 B;  4HYO A;  1FXK C;  3I55 V;  4WF9 V;  3T4D A;  2IW5 A;  1QCE A;  2XND G;  3QO7 A;  4XDL A;  4P30 A;  2X6B A;  5HFL A;  1KQS U;  1M57 C;  2JJ2 G;  1OZ0 A;  2P6J A;  3FB6 C;  1V54 B;  4FMT A;  1NJI W;  2R9R B;  3LSS A;  1QVG U;  5BZB A;  4JYB A;  1YJN V;  1CEZ A;  2ITC C;  2ZD9 A;  1GO3 F;  5EC2 C;  2HLD G;  1CP9 A;  4G2K A;  4MVS A;  3SYP A;  1W2B U;  1B6Q A;  2DYR B;  2B1I A;  5L3C A;  3CC4 V;  1Q82 W;  2IJK A;  1OCZ C;  3STL C;  1QLE C;  1FXK B;  3K0G A;  2A9H A;  4JTC B;  4OXS A;  3SPG A;  2Q68 A;  1M9N A;  1R3K C;  1P7B A;  1NH2 B;  1I5X A;  4MVU A;  4XBF A;  2XAS A;  2QTO A;  1R3I C;  3A0R A;  4UVB A;  2X6C A;  3RW0 A;  1COW G;  1GM7 A;  3W7S A;  1M57 B;  3QNE A;  1JVM A;  2MK3 A;  4ASU G;  3MHS C;  3FYI B;  3LUT B;  3OM3 B;  3G6E V;  4QJF B;  4P2Z A;  3ZRW A;  3ABK B;  4UVC A;  2EIK C;  5KA6 A;  3RVZ A;  5LHI A;  4P9O A;  1XL4 A;  1FFT B;  2IJH A;  5KUK A;  3CPW U;  3CCM V;  2B1G A;  1OCZ B;  1PNK A;  2H8P C;  1QLE B;  4G27 B;  1S5H C;  3G4S V;  3ZMU A;  1H8E G;  1S72 V;  1E79 G;  1YIJ V;  1YIT V;  3OUS A;  2HVK C;  2OTJ V;  5KA5 A;  5B1N A;  3E8G A;  1K97 A;  2GSM B;  2R9I A;  4R7C A;  2X7R B;  3AG3 C;  5EBM C;  1QR8 A;  1EFR G;  2HKO A;  2DYS C;  1AI6 A;  3E8F A;  1NVP D;  3K04 A;  4TT3 G;  3E89 A;  4UV9 A;  5EC1 C;  1FS0 G;  5DN6 G;  4UV8 A;  1S77 D;  3AG2 C;  1GM8 A;  2NLJ C;  1W0K G;  4R50 A;  4JGS A;  1NBM G;  4N23 A;  2WLL B;  4QNH B;  1K92 A;  2WLI B;  2EIK B;  2WLJ A;  2WSS G;  1AJN A;  3JD2 A;  2QM8 A;  4PDL A;  4GX1 A;  1P4R A;  2KB1 A;  1MAB G;  2LFR A;  1Q86 W;  1VQO V;  3K03 A;  2X0L A;  1MOF A;  2V1D A;  3HPL C;  3ZN1 A;  3CCE V;  1VQ8 V;  1VQ6 V;  2AHZ A;  1VQN V;  4PDM A;  4ZKI A;  1QLN A;  3AEI A;  2EZO A;  4GX5 A;  4WFH A;  1K34 A;  3AG3 B;  1AI4 A;  3OR6 C;  4LCU C;  2WLM A;  5C93 A;  2DYS B;  1KD1 W;  4WFA V;  1V55 C;  1N8R W;  1M90 W;  1JJ2 U;  1QR9 A;  2Y69 C;  4FIP C;  3SPJ A;  2Z5U A;  3JCZ A;  1VQP V;  1JQ0 A;  1PL0 A;  3P30 A;  3G71 V;  3AG4 C;  2ZR2 A;  1CPY A;  3AG2 B;  3E35 A;  4PDV A;  1R73 A;  3ZRV A;  4EKW A;  2GHY A;  2XAH A;  1YJW V;  4BIU A;  4UVA A;  2CK3 G;  3ABM C;  3CC2 V;  4QPJ A;  3JD4 A;  2XOK G;  4P9P A;  4RO2 A;  1SZT A;  2QA4 V;  4JAU A;  2IJI A;  3CCU V;  4GCZ A;  3OEE G;  2IH3 C;  5EBW C;  1SES A;  1R3J C;  1PKX A;  2DWD C;  4QE7 A;  3E8H A;  1VQL V;  1OCC B;  4QE9 A;  5B1A B;  1RM1 C;  4MW8 A;  5CBH A;  1SRY A;  2HVJ C;  4FK5 C;  2JEU A;  3TK1 A;  1ROP A;  2Q69 A;  1F4M A;  1FXV A;  1R3L C;  2ZDI A;  5CBF A;  1V55 B;  2EZP A;  4RUF A;  4TSF G;  2HFE C;  4N21 A;  2JIZ G;  4FJC C;  3FYE B;  2ITD C;  3AG4 B;  3B77 A;  2AHY A;  1UJW B;  4MT8 A;  1JCH A;  3IC7 A;  4MTF A;  3OE7 G;  5J9P C;  1K3E A;  3OW2 U;  3ZRW B;  4MVQ A;  3TET A;  5L3G A;  3CCV V;  5LGU A;  3MD0 A;  2BOC C;  1K73 W;  1KP3 A;  3CCQ V;  3ASN C;  5L3F A;  1ARO P;  1NVP B;  3ZN0 A;  1Y66 A;  3K79 A;  3B8M A;  2LP7 A;  1DLB A;  2JK5 C;  2Y48 A;  2C2A A;  4DXW A;  2H94 A;  3K0D A;  1JX9 A;  2WPD G;  2Q67 A;  1WPX A;  3K08 A;  2IU3 A;  4LBE C;  3ETD A;  4RAI A;  1YJ9 V;  2FTK A;  1ENV A;  3ZJZ A;  1R6K A;  1PNL A;  4WFB V;  2A0L A;  3BEH A;  4BIZ A;  3F7Y C;  3MHH C;  3ZIA G;  4BAY A;  1EBO A;  2DQ0 A;  1M1K W;  1AJP A;  5IYD O;  3CME V;  2EIM C;  1KP2 A;  2WLN A;  3ABU A;  2IH1 C;  3RBZ A;  1K8A W;  3D3I A;  4GX2 A;  1F23 A;  4PA6 A;  5FL7 G;  5LGT A;  4MW3 A;  2B5U A;  3X2Q C;  3CD6 V;  1H8H G;  2HG5 C;  2ZDI C;  2W0F C;  1M56 C;  1GTO A;  3WFV A;  5LBQ A;  2K1E A;  3GWO A;  4MTO A;  4MTX A;  1THZ A;  2A79 B;  3T1C A;  3W7T A;  2ATK C;  5L3B A;  1K5S A;  1WLE A;  1GM9 A;  4RQF A;  3ASO C;  1VQ5 V;  1PD3 A;  1I5Y A;  3ABT A;  1L1F A;  1FXK A;  4MSW C;  3JD1 A;  1QBZ A;  3RVY A;  1YTF D;  4U7N A;  2OTL V;  2PI5 A;  4JPR A;  4LP8 A;  5LHG A;  3NXS A;  1H2G A;  5EBL C;  1OCO C;  5H6R A;  4GX0 A;  5CN0 A;  3B8N A;  3SPH A;  3JYC A;  1S0V A;  4R8C A;  3ETG A;  5CBG A;  3IFX A;  1NQT A;  3ZCC A;  1FXH A;  3TCU A;  1YSC A;  4QPK A;  3X2Q B;  4F4L A;  4L87 A;  1M56 B;  2W6I G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...