4WFFA

Human traak k+ channel in a k+ bound nonconductive conformation
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
259
structure length
253
Chain Sequence
RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
total genus 95
structure length 253
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4wffA00
2Q69A 2QKSA 1OCOC 1OCRC 4BW5A 3K06A 5EK0A 4MVOA 4QE9A 3ASOC 4P9PA 4PDRA 3SJQC 4MS2A 2X6CA 1P7BA 2DYSC 3AG1C 1XL6A 4PA9A 1R3IC 4QE7A 4RAIA 4H33A 3STZC 1OCCC 2HG5C 4WFEA 4JTAB 4XDLA 3TCUA 4UUJC 3T1CA 2W0FC 2Y69C 3OGCC 4GX1A 4MSWC 3UM7A 3GB7C 3K0GA 4R50A 4WFGA 5CBHA 3AG2C 1XL4A 2ATKC 2EIMC 5BZBA 4P2ZA 4RO2A 5B1AC 3SYAA 2IH3C 3STLC 1M56C 2ITCC 3E8FA 2WLNA 5EBMC 4I9WA 1R3KC 3SYOA 2OCCC 3T4DA 2JK5C 3X2QC 4MVUA 1G4YB 3OR7C 4GX5A 3SPHA 5EC2C 2Q67A 2WLLB 4MVSA 3LDDA 5CBGA 3LNMB 5B1BC 2WLJA 3RBZA 3T2MA 3ASNC 4GX2A 3T4ZA 3FB5C 4MW8A 3FB8C 4MTGA 3SYCA 2ZD9A 1ORQC 4WFHA 4X88A 4G27B 2R9RB 3F5WC 4LP8A 2WLKA 2HFEC 2X6AA 4HZ3A 3K03A 4LBEC 4HYOA 2DWDC 3E8BA 4ZBMA 4CBCA 3SPJA 2YEVA 3IFXA 2AHYA 2BOCC 3HPLC 3TETA 4WFFA 2HVJC 2QTOA 4XDJA 3SPGA 1J95A 2BOBC 4MVMA 4H37A 1QLEC 2WLLA 1S5HC 2NLJC 3IGAC 4JTDB 3K08A 4RUFA 3AG3C 2X6BA 1M57C 4R7CA 3E86A 4R8CA 2DYRC 1JVMA 3AG4C 3R65A 3F7YC 2K1EA 4P9OA 4LCUC 1ZWIC 2Q6AA 1R3JC 4GX0A 4F4LA 3ABKC 2KB1A 4J9ZB 4RUEA 3SPIA 3VOUA 1KKDA 2ITDC 3LDEA 5J9PC 5EBWC 4R6ZA 4MVZA 1V55C 5B3SC 2ZXWC 5CBFA 4PA6A 3LUTB 4MTOA 2EIJC 5EBLC 3ZJZA 2A9HA 2DWEC 3FB7C 2WLIA 4DXWA 4QNHB 3E8HA 2A0LA 1K4DC 2HJFC 3RVYA 2P7TC 3OR6C 2H8PC 3OUFA 3ABMC 5E1AC 1K4CC 4OXSA 5KUKA 3RW0A 2IH1C 3F7VC 3KG2A 4XDKA 2EINC 2WLHA 2Q68A 3K04A 4TWKA 3SYPA 3JYCA 4P30A 4X8AA 4MVQA 4EKWA 4J9YB 4MTFA 4PA3A 1BL8A 4MW3A 4MVRA 2WLMA 3K0DA 3EFFK 3ZRSA 2AHZA 3WG7C 2WLIB 3OUSA 1LNQA 4PDMA 1R3LC 3E83A 4PDVA 3E89A 4PDLA 1V54C 4X89A 3RVZA 3E8GA 2HVKC 5KUMA 3FB6C 1OCZC 4G28B 2EILC 2EIKC 3SPCA 3SYQA 3ABLC 3LDCA 4KFMA 4JTCB 3BEHA 3PJSK 4PA4A 5IY5C 5EC1C 2A79B 3UKMA 4PA7A
chains in the Genus database with same CATH superfamily
2QKSA 1A32A 4BW5A 2GV9A 3FYEB 5BR8O 3CS5A 2PI5A 1GK9A 4H33A 1I7FA 2GDSA 3CRRA 5JJEB 1WN7A 3GB7C 5JQGB 4DR2O 5BZBA 1HWYA 1Q6IA 2XUMA 4YY3B 2N74A 1RPOA 4DUYB 3X2QC 4MT8A 2UXDO 5B1BC 2WLJA 1IBLB 2OWOA 1P49A 2IJHA 5L3EA 4QPKA 4YHHO 2F66C 3D36C 1AILA 3JAKB 3FKSG 3CCEV 4B3SO 1TVKB 4B08A 2Y0IA 4EFBA 3OEEG 4FLVA 5LOVB 2WPDG 2Z5UA 4FZ1A 1XNRB 1EN6A 4LF7B 4XDJA 5LYJB 2EZPA 2YIBA 3ZHVA 5JH7A 1UJWB 2RJZA 4TSFG 5LMUO 4DV5O 4FM1A 4NTYA 2D2CB 3G80A 4WBNA 4BAYA 3OT7A 2DYRB 4GYCB 1K9MW 3VOUA 4JZ2A 3B09A 4O4JA 2EJRA 4JYBA 2ZXWC 3LUTB 1PD3A 5GONB 5EBLC 3P3PA 1I0HA 3U0ZA 3OW2U 2P7TC 4TUYB 2JEUA 1YSCA 3CE2A 1KBHA 2WLMA 2IBZH 4J80A 1F4NA 1FPOA 5IYCO 3OUSA 1CEZA 1NTMH 2K9PA 1JFFB 3RYFB 3CPWU 4H37A 1PNMA 3DGEA 4W4LA 5CA1A 4P9PA 5L3GA 2DYSC 4DV1O 3A2FA 1B6QA 3ZIAG 1BHBA 4GX1A 4BR6A 1FFXB 1WP7A 2EX3A 2JGUA 2ZR2A 2GTAA 2WLNA 5EBMC 2UXBO 1GTOA 2EIKB 2Q67A 2Q73A 1XQ8A 2V1DA 5IDJA 2D3OW 1NZ6A 1TUEB 4L8JA 1K73W 2DMXA 4LP8A 4U3FH 4AHCA 2YXYA 3WB1A 1X59A 1N4CA 4FLXA 4J42A 1M4UA 4B3MB 5IJ0B 4O4LA 4NKGB 1M9NA 1R1BA 1NBMG 1SQXH 3TGUH 2XOKG 4CS2A 1DK1A 4LF4B 2IJKA 2LW7A 3CJHA 3N2KA 1AJNA 4LCUC 1ZWIC 1NU1H 1XMOB 3ICXA 1AI5A 3N2GA 3MHSC 4RUEA 4FMTA 2YUAA 1PKXA 4I7ZB 4JGSA 3FX7A 1B04A 1KYOF 1PNLA 1BCCH 2QA4V 3E8HA 3N27A 5TISZ 3DC6A 2BE3A 1AB3A 2XAHA 3F7VC 5JVDA 2H94A 2WLHA 2Q68A 4TWKA 3ZHQA 1VQ4V 1JQ0A 1MSDA 4WBNB 4X65B 1BL8A 4UV8A 2WLIB 1K33A 2R9AA 3ASNB 1Q81W 4YIOA 2HVKC 4LFCB 1OCZC 3SPCA 1XBLA 4LFCO 3SYQA 1U97A 5H9CA 5BR8B 1UPGA 3SJQC 3MAQA 4PA9A 5IWAB 3T1CA 1TUBA 1EZJA 3JAKA 1J5EO 3AG1B 1QHTA 4LNUB 5KA5A 3CCMV 4PHZA 3AG2C 1B06A 1H8HG 1RM1B 2QM7A 4D7TA 4IHJB 2OIGA 4DV6O 2IJIA 3OR7C 2EILB 4KHPB 4IL6Z 2ZM6B 3ASNC 3SYCA 4WFHA 2F23A 2HFEC 3ZRWA 1TAEA 3K03A 4I9QA 2EJ7A 3G6BA 4CBCA 2X0LA 2YS8A 2YEVB 2QTOA 4PELA 3A0BZ 1VQ6V 3BFRA 5IJ9A 1K3EA 2RCVA 1KC8W 2A06H 1KB9F 3AG4C 4OPHA 1VQPV 1FFTB 3ABKC 1M57B 4DK1A 4X20B 1KKDA 1EN5A 2CTRA 1SF9A 3GVMA 1JOYA 3OE7G 2A0LA 4J7KA 2P90A 4O4IA 1QNMA 2QKAA 2ETNA 4FM2A 4P30A 4X8AA 1GAXA 3H01A 1H2SB 4MW3A 4MVRA 4X64B 2CDYA 2P5OA 3CRAA 4DO2A 1S3JA 3LSUA 3GWOA 4JI4B 1BQZA 5KHGA 4DR7O 1F23A 4DUYO 3BCCH 1Q6UA 5LMNO 1N32B 3E22A 4PDRA 4X1IB 3UQ8A 1XL6A 4O2BB 5EIBC 3BA9A 2VS0A 1NVPD 2Y69C 4A5UB 4R50A 1N34B 5B1AC 1OCRB 2IH3C 2ZKOA 1XNRO 2F1MA 1SQGA 1FYJA 3JALB 3C3SA 4RQFA 1G4YB 5LYJA 4DV2B 4UCOA 3J81N 4DRXB 2MK3A 3ZCCA 1HNZB 2DN9A 3OM3B 3A0RA 4TV8A 2BTQA 1NQTA 1Q90D 3JASA 4LWSB 3TETA 4K35A 2EIJB 3OTFA 3QNEA 1CP9A 1XOUA 1YJNV 3AG3C 1VQMV 2QWOB 5FLXN 2Q9LA 3F5TA 4NXMO 3QF7A 1N0JA 1R6NA 2QM8A 1VF7A 4NR1A 5C8YA 2A7WA 3ZMTA 5E1AC 1DGSA 3B77A 4CS3A 3T1YO 1MOFA 1YXBA 3K5NA 2JEXA 3W7XA 1AJQA 4U3JA 3JYCA 4Q6GA 4DV7B 1Y67A 4ZI7A 1GMGA 4KXRA 1HDJA 2PZSA 1BQ0A 3G71V 3CSXA 4JI1B 3VQVA 2HR3A 1RSOB 4CH5A 3FAVB 1V54C 5L3FA 4G28B 4EFEA 3ABLC 2YI9A 3K06A 4MVOA 3ASOC 3FFQA 3CHXA 2HKOA 3AK2A 3CRQA 4RAIA 4JYAO 1L8DA 4XDLA 3L73H 3W7WA 3M7MX 3UCSC 3UM7A 5J2UA 3THOA 5JJJB 4X1KA 3SYAA 1AP5A 5LP6A 1ROPA 4QPJA 2YIDA 2JK5C 3ABLB 4FLWA 3SPHA 2WLLB 1PV0A 2OTLV 4MW8A 3U10A 2UU9O 3IC9A 5LBQA 2UU9B 2ZE6A 3B4SA 4B3RO 3A8TA 1SKVA 2R9RB 1N33B 4DUZB 1Q82W 4DR3B 3OMAB 5CA0A 2EINB 2HLDG 1YHQV 1XNQB 4WFFA 5FPOA 2UXBB 5LP6B 2NN4A 1S5HC 1Q7YW 5DN6G 2XHBA 1XUQA 4J10A 1Q5OA 1SQFA 2B1GA 2ZNIA 2CTQA 4I4TA 4I5SA 4DR6B 3HKEB 3K5LA 4EEQA 2UUAB 1FXKC 5LHGA 1YVWA 2WA4A 1PL0A 4NXNB 3IAYA 1P84F 1QVGU 1S5LZ 1K4CC 2IH1C 4XDKA 2ZDIC 2LP7A 4LF5O 1J5EB 2ZR3A 4DW0A 1KECA 2Y48A 1W0JG 1KUQA 3OD4A 4BIZA 5C8YB 1AJPA 2OTJV 2UXXA 3JD0A 4JI6B 4JYYA 4JTCB 4TT3G 2A79B 3L9DA 1GN4A 3JASB 2FYUH 1GN6A 4LWSA 4QE9A 3W7TA 4TQFA 4JTAB 3I55V 1GRJA 2AZ2A 1GH6A 1H2KA 2ZINA 2VQEB 3OTOB 1SA0A 3KCXA 4I0XA 2LFRA 3L72H 3DXRB 4I9WA 2KG7B 1AROP 5AG2A 1V9PA 3AEIA 4OPAA 1OCZB 4MVSA 4JAUA 3H1JH 4DV4B 4JI5O 3W7SA 4UVBA 4X88A 1HR0O 1P4RA 2X6AA 2GSMB 4HYOA 3AK3A 4I50B 4E4EA 4X1IA 5B5EZ 3E22B 2ARHA 2YEVA 4IYIA 2Q5ZA 3HPLC 2FB5A 4YJ3B 4JI8O 3UT5B 4CH4A 2WLLA 3IGAC 3ZRWB 3CD6V 5J2TB 3CC2V 3JAMN 3A0HZ 1JVMA 4LF8O 5GW7A 1CPYA 2Q0AA 2CAZC 4X64O 1WNSA 3OEHG 1PP9H 2WA3A 4R6ZA 1QLEB 1Y74A 5H5NA 4RWUA 4BIOA 1UFIA 2KKWA 1SZXA 1VP7A 4X20A 4AQYB 2ZQMA 2Q8VA 3KG2A 1ENVA 4FVMA 1FAFA 2Y0PA 1IXMA 3K0DA 1N36O 1D5AA 2QJ1A 2VQFB 4JI1O 4FFKA 4C7UA 2QGNA 4UXNA 2CTPA 1M5IA 1AI6A 5L3DA 2RN9A 3FB6C 4FFBA 3BAAA 1W2BU 3LDCA 3CC4V 4TUYA 4PA7A 3HKDB 2E74B 1WA8B 2W0XA 3WB0A 1HW7A 5LHHA 1AR4A 1K97A 4BW9A 4CS4A 3ZN1A 1S77D 3OGCC 3BPZA 4Z1MG 4JI7B 4TV9B 1P7GA 5LA6A 4HAMA 2B1IA 4YY3O 4DR7B 3JATB 4WFBV 3T4DA 2PYLA 1US6A 1MNGA 2CUGA 5LMNB 4EB6B 3JCUZ 1XMQO 3ZN0A 3RYIA 3T4ZA 4J11A 1VQ5V 1N33O 4BIUA 3HR0A 1SZTA 4TV8B 3ZRXA 3APOA 4JI3O 1SERA 1ZX3A 2P22C 3RFRA 2VWJA 4ZBMA 2Q0OC 2LFSA 4DRXA 3S3WA 2EULA 3IJ4A 1FXKB 4JI0B 5HFMA 1NJIW 3OAAG 3L75H 3T1YB 2ILMA 4DV7O 3R65A 1QU7A 2N04A 4TV9A 4DR6O 5IYZB 4F4LA 3WFVA 5LHIA 3AG3B 4AI8A 4J7JA 1VQ8V 2CK3G 2ZCEA 1YF2A 3ZHSA 2WLIA 3RVYA 1OZ0A 4FM0A 3HKCB 4G2KA 4FFBB 1XDCA 4LF9O 3B8MA 3T1HO 5HFLA 3RYCB 1SS3A 3APQA 2R9IA 1E1RG 2QM4A 3RVZA 5KUMA 4JI6O 2EIKC 4D7SA 1NTZH 1NH2D 1IX9A 5C93A 5EC1C 3NXSA 3JSNA 3UKMA 2JVDA 2Q69A 1Q86W 4DR1B 3ZHTA 1FXKA 4I4TB 4DR1O 1H2LA 1VMGA 3OTOO 4ABMA 1GN2A 2P06A 3FD9A 1ZL8B 5LL6Y 1H2NA 3C90A 4H44B 5EIBD 3RYIB 4IIJB 4RQEA 4U7OA 4EB6A 1IBMB 1YI2V 2WAMA 1SQQH 2PYJA 2UUBO 3ZMSA 1YEWA 5LA6B 5K1PA 4I50A 1Q8IA 1F7YA 2QR4A 2ADPA 3CRCA 2ZXWB 2UXDB 1V55B 4RUFA 5B3SB 2WWWA 1QBZA 1TVKA 1AP6A 2P67A 4Z2WA 4B3TO 2JIZG 3ABKB 4FJCC 4YHHB 3DXRA 4O2AB 1S72V 3ZRVA 1XHZA 1XMOO 3K57A 3P3NA 2FTKA 2Y4UA 3LDEA 1QR9A 3L70H 1TA8A 1JJ2U 2EIJC 3RYCA 2KG7A 2F4VO 4WCEV 3HKBB 1O9HA 4X65O 4X1YA 1LNQA 4PDMA 2YXLA 4UVAA 1U96A 1JCHA 1EFRG 4GUNA 2PY5A 2EILC 2M7WA 3X2QB 2XNDG 2E5LO 3PJSK 2V4DA 2OCHA 1Y4MA 4ZOLB 5IT9N 2PTMA 3J7AU 5B1AB 4N21A 2EIMB 1RM1C 2GBOA 3AG2B 5EYPB 3N2GB 3AG1C 1R3IC 4GLXA 2PGGA 1SQPH 3P30A 4O4HB 2GHYA 3CYOA 5LGTA 1YITV 4P2ZA 4FLZA 5IE9A 3SYOA 4K8XA 2ZT9B 1Q3EA 1T5EA 4MVUA 4DV0O 2PF4E 3GWKC 5CBGA 3LNMB 1HP8A 3FB5C 5JCOC 4UCUA 4K0KB 3G67A 2L35A 4B7EA 4DV3O 4B3RB 5B1NA 1M93A 2YDEA 3D3IA 1HNWO 1BS3A 1WLEA 5KHHA 2DWDC 2O57A 5FPRA 1SA0B 1IBKO 3IFXA 2UXCB 2UXCO 1NTKH 2AXTZ 1NI8A 1URFA 3RYHB 2LW1A 1QLEC 3K59A 3G4SV 4DW1A 1K5SA 2YIBD 3ETQA 1WJZA 4DV4O 1IURA 3U11A 1PNKA 1FD9A 2ODMA 1OHHG 2P6JA 1HNXO 4J9ZB 3EHBB 3CCLV 5LXTA 3LSQA 4PA6A 1GKFA 4D6TH 2A9HA 1JFFA 3RYFA 5BMVB 2Z3YA 4NXNO 2AGAA 5KHKA 3CRMA 3OGIB 1BSMA 4JAAA 2EINC 2B5UA 4LF9B 3K9AA 1WB7A 5ITZA 1OV9A 3P32A 4KL1A 2AHZA 2P4VA 4UB8Z 3SJAC 2EZOA 2HHHO 1AR5A 1MG1A 4GKJB 3OMNB 2WSSG 4YXWG 5LXTB 3K58A 1QCEA 3BEHA 3K9SA 1VQLV 4JI2O 4J41A 3H1HH 5DEDA 2JS5A 3TJTA 1SQBH 2E75B 4K3AA 3CCRV 4ZI7B 4B3SB 2DYSB 2JGDB 1NS1A 2EIMC 4NB5A 1M56C 2CGNA 3DC5A 4GX5A 5EC2C 4GT1A 1V54B 2W6JG 4GX2A 5D5QA 4DV2O 3CCVV 1MMMA 1GM9A 2ZE8A 1HR0B 1XHXA 1QLNA 3B40A 4X1KB 3KKYA 4CC6A 1FKAO 2BOCC 4AILC 1SETA 2DQ3A 1D5NA 4GZRB 1J95A 3VQWA 3KZIZ 4IHJA 3ZBHA 1LUVA 1JJOA 5KLVH 1DF5A 2M6YA 1N8RW 4K8ZA 4UV9A 3H1IH 1IBLO 4X62B 1Z2GA 4X62O 2JJ1G 2LGQA 2B9ZA 3JARA 3E86A 1IXBA 4ZKIA 3F7YC 2K1EA 4P9OA 1WP8A 3QVNA 3T1HB 1JR9A 2RDCA 4JAVA 4O2BA 5EZYB 1VQNV 2QTSA 1V55C 5B3SC 3L74H 2DWEC 2RMKB 1K4DC 1LUWA 4GKKB 3IC7A 2YXHA 1EZVH 5EYPA 2Q4PA 4W4KA 2X7RB 1L0NH 4I55A 4MTFA 4QIWF 3EFFK 4PDVA 1N34O 2Z0AA 5LGUA 1NR7A 1KQSU 1DLBA 3I5DA 4B7KA 5IY5C 4X1YB 1XEQA 3E2EA 1OCRC 2AZ0A 1GM7A 2YI8A 2X6CA 1H8EG 1H2GA 1Q43A 1YDXA 4ZHQB 2Y69B 1OCCC 3RWRD 3JD3A 1G1XB 5ITZB 2GTSA 2UUBB 2YSUB 4YIPA 2Q7HA 3K0GA 4DYLA 2ATKC 3JARB 4DR2B 3ABUA 1G6UA 2IM9A 3SJCC 5DM6V 1KP2A 3Q4HB 3LDDA 5KAIZ 4Q20A 3FB8C 1VF6C 2EBOA 2QWPB 4O2AA 1PM9A 1S0VA 3OMIB 3JALA 1ZAUA 3BA8A 3SGIA 4PJ0Z 4HZ3A 4LBEC 3JSLA 2OT5A 3ZEDA 3E8BA 1I08A 1W59A 5B66Z 3ABMB 3ZMUA 4NTWA 4XBFA 2HEPA 3CCQV 3SPGA 3VQYA 4TQDA 3RYHA 3K08A 4N23A 2BCCH 1M57C 5LMUB 4DV5B 2GUZA 2G38A 4R8CA 5H6RA 3MD0A 1KP3A 3QTCA 2ZE5A 2XAGA 2FKXA 2NR5A 2E3CA 2V7QG 2XAFA 4DR5B 5CA1B 1VEWA 1MZEA 2RNBA 2BSKB 4FPPA 3B2EE 3H9VA 3CCSV 5J9PC 1RSOA 4FIPC 4JV5B 1KU9A 2IU0A 3SYPA 3K04A 5KX5B 2VRZA 3O65A 4PA3A 3QO5A 2PI4A 4KP4A 5KMGB 1NT2B 3H1LH 5KHIA 1FXHA 3ZRSA 1YTFB 1R73A 1E1QG 1QVFU 2YIAA 5KA6A 1R3LC 2CE4A 2CTWA 5GONA 2YC0A 5B1OA 4KFMA 2OCCB 4F6EA 1Y66A 1M56B 3JCZA 1K5QA 3OFNG 1K8AW 5CBHA 4DV1B 2HG5C 4WFEA 4UUJC 3TXQA 5JVDB 4QGPA 4IIJA 1IBKB 1THZA 2ZDIA 1D2DA 2E5LB 1I5XA 2BTQB 3C3TA 1N0NA 3RBZA 4NYKA 2HP8A 2R72A 3MHHC 1ORQC 3JAWA 4G27B 2WLKA 5LGNA 4OX9O 5IJ0A 1QQCA 4B3MO 3CJHB 3SPJA 4FLYA 1K34A 2LQTA 3RGBA 4TOIA 4DV0B 3CWBH 3BY6A 5FNVB 1YZBA 2RQ6A 1QR8A 5DECA 3W7UA 4LFAO 5JQGA 4ZOLA 4K0KO 2NNUA 1YCIA 4LF8B 1OJHA 1MZFA 3AG4B 3E35A 3CB2A 3BRCA 3JD1A 5GTIZ 2XAJA 2KB1A 3HKCA 1I94O 4LH7A 3ZX6A 1SRYA 1I94B 2QWQB 2QWNB 4H0LB 4GKJO 3RN4A 1VARA 2F93B 3OR6C 2Q7EA 3K5OA 4JI2B 1N32O 3RW0A 3ETGA 5CA3A 4MVQA 4J9YB 3CP1A 5KHJA 1XREA 4Z1VA 2VQFO 4IGGA 3AK1A 5KMGA 1HNXB 3HKBA 3B8NA 2XAQA 3N2KB 2JRIA 1GN3A 4CZZA 2KQXA 2DW4A 1WB8A 2ZE7A 3G6EV 5EK0A 2LGWA 3CMAV 4BWAA 1M90W 2QDOA 4JI5B 4ICGA 4DK0A 5IJ9B 1S76D 4O4LB 2XTAA 3DSQA 1BE3H 1ZSPA 4RO2A 3CXCU 2OCCC 3UT5A 1B3QA 4DV6B 1G8MA 1JMKC 1AR1B 3QO7A 5L3BA 1VIBA 5H6QA 1K92A 2IJJA 5L3CA 3S3XA 2UUCO 3F5WC 5LOVA 1FS0G 3ETDA 5JWPA 1JPXA 1FFXA 2CGOA 1WA8A 2AHYA 4JYCA 3CMEV 2OIEA 4LF7O 1MA1A 4MVMA 3VBBA 1L1FA 3MDSA 2ZIMA 1JA8A 4UCTA 4GKKO 4I0XB 2MW2B 1Y76B 1ZL8A 5A9GA 2IU3A 3M99B 4ZIBA 4DR5O 2Q6AA 1AI4A 1R3JC 4GX0A 4PV1B 4CC5A 2PUSA 4JI8B 2JS3A 5CBFA 1WPBA 4PI2A 4OGQB 4MTOA 3ZJZA 3CEIA 4IT5A 4DXWA 1ZUQA 1SQVH 3ABMC 1RFYA 5KUKA 2ZIOA 2P4KA 3H1KH 3JD2A 3QO8A 1VQOV 5E79Z 1RP3B 4JYAB 4O4JB 5CB4B 3D36A 2AW9A 1BGYH 3D8CA 5IYZA 3ZS8C 4GCZA 4PDLA 5D5PA 1JX9A 5B1BB 2HHHB 4JI4O 4X89A 3E8GA 2DJVA 4LFBB 2CH7A 2QWRB 5KX5A 1L0LH 3EVKA 4MS2A 3R66A 4WFAV 2DE0X 4JASA 2N05A 2W0FC 4DUZO 1OCCB 5FL7G 4LF6O 5FNVA 1XL4A 3ASOB 3ZHRA 1EN4A 1FJGB 1Y76A 2BSKA 5IY5B 3O9OA 4FZ0A 1IBMO 3WG7B 4UCSA 3DTUB 3JAWB 1YIJV 2ADQB 3JATA 2W6IG 1IDSA 3I56V 4YJ2A 4FLTA 2UUAO 1FXVA 1CXZB 1GO3F 2BOBC 1MABG 5CA0B 2KSDA 4JTDB 3LNNA 4JV5O 3HKDA 1YTFD 1NH2B 1VQKV 1XI1A 2DYRC 5H2FZ 5K1XA 2Y4TA 4JI3B 2F95B 5GTHZ 4NXMB 5JCOA 2H3OA 3UO3A 1XNQO 1VF5B 3SPIA 3ABTA 1WAZA 5EBWC 5J2UB 2F4VB 4JI0O 4NTXA 1VF6A 4OXSA 1S5JA 4ZHQA 3ZHUA 1ZLZA 5JJNB 1Y74B 3VQXA 1Z5WA 5BXZA 1KD1W 1BMFG 2Q7GA 3QG5A 3WG7C 4X66O 2GUZB 3BHPA 4CH6A 4PD4F 3UO2A 1IVSA 3WU2Z 4ASUG 4PA4A 1Z5VA 2DOSA 5J2TA 5BMVA 1OCOC 4UCVA 1W0KG 1RPRA 4U3JB 1PPJH 4F6RA 2VWKA 1P7BA 4QE7A 3FYIB 1DF4A 3TCUA 5IWAO 4LF5B 2YICA 5JH7B 4CH3A 3AG7A 4UVCA 3J80N 5BY1A 3CCUV 3STLC 1H2MA 2ITCC 3TK1A 1NKDA 1WPXA 1E79G 4YJ2B 1NR1A 3JD4A 4E2LA 4QJFB 4U7NA 4MTGA 4YJ3A 3HKEA 1NVPB 3K5MA 3K79A 2UUCB 3NR7A 1HNWB 4DR3O 3Q4HA 4HNAA 3ZMZA 4JF3A 3SR2C 1VQ7V 5A2QN 1GM8A 1EM1A 1AVMA 2HJDA 2JJ2G 4KUMA 3WB2A 4R7CA 4IYHA 2XASA 3ML0A 1M1KW 1LR1A 4LH6A 4O4HA 2ITDC 2ZNJA 2JGDA 5IYDO 3FB7C 4LR3A 1SC5B 3ETEA 4UB6Z 4B3TB 3OUFA 4FK5C 3SJBC 4L87A 1COWG 3BABA 5CB4A 1BHAA 4EKWA 1F4MA 3HB3B 2OYQA 1O9GA 3M8AA 4F6RB 3E89A 2LO1A 1EBOA 1ZTEA 5EZYA 4H13B 4KHPO 1KMIZ 4AQYO 1SESA 3PN1A 3SDLA 3K3WA 3LSSA 4MTXA 2XT9A 4DR4O 3STZC 4DR4B 1YJWV 4LF6B 4MSWC 2VQEO 4HNAB 4WFGA 2R70A 1OCOB 3E8FA 3CX5F 1R3KC 1F51A 4JZGA 1KKCA 2E76B 2UXNA 3T2MA 2ZD9A 2BTOA 1HNZO 1X4TA 4X9QA 3EXAA 5IYBO 1Y6XA 3TXSA 4UFZA 4OX9B 2FMLA 4JI7O 5KAFZ 2A3QA 2QEXV 2HVJC 1R6TA 2LJ2A 4HBNA 3D3QA 1BZKA 2NLJC 2QKCA 1XMQB 2ZM6O 2FL4A 3ZMVA 4FLUA 4LF4O 2QE7G 2X6BA 1PL4A 4LFAB 3RT3C 4UCRA 3CC7V 1DTOA 4DV3B 4J7ZA 2DQ0A 2F43G 1VQ9V 5CMUA 4JPRA 2IW5A 1Q6HA 4PI0A 3KCYA 1R6KA 4WF9V 3CCJV 4O4IB 5CN0A 2L6LA 3L71H 4MVZA 1TGOA 1IZ3A 4LNUA 4QNHB 5LP6C 2CH7B 4LC1A 1TUBB 2C2AA 2HJFC 4NVPA 4LFBO 2H8PC 1AI7A 3FAVA 2JDIG 2QSAA 3BVOA 1MSWD 1YJ9V 1H38A 4X66B 4I55B 1I5YA 1K7DA 1N36B 3E83A 3CXHF 1FJGO 1XILA 5F2VO 1BT8A
chains in the Genus database with same CATH topology
2QKSA 5B1AB 4BW5A 3K06A 4N21A 5EK0A 3G6EV 2EIMB 4MVOA 1RM1C 3ASOC 3FYEB 3AG2B 2HKOA 3CMAV 2PI5A 1GK9A 1M90W 3AG1C 4RAIA 1R3IC 4H33A 4XDLA 3P30A 3W7WA 3UM7A 2GHYA 3CYOA 1S76D 3GB7C 5LGTA 1YITV 5BZBA 1HWYA 4P2ZA 4RO2A 3SYAA 1ROPA 4QPJA 3CXCU 3SYOA 1RPOA 2OCCC 2JK5C 3ABLB 3X2QC 4MVUA 3SPHA 1G8MA 2WLLB 4MT8A 2OTLV 5CBGA 3LNMB 5B1BC 2WLJA 1AR1B 3QO7A 5L3BA 3FB5C 4MW8A 2IJHA 5L3EA 4QPKA 5LBQA 5H6QA 1K92A 2IJJA 5L3CA 2R9RB 3F5WC 3FKSG 5B1NA 1FS0G 3CCEV 3ETDA 1Q82W 3D3IA 1WLEA 3OMAB 1JPXA 2DWDC 2EINB 3OEEG 2HLDG 3IFXA 2AHYA 4JYCA 1YHQV 3CMEV 2WPDG 2Z5UA 4WFFA 4XDJA 4MVMA 1QLEC 1S5HC 2EZPA 3VBBA 1Q7YW 1L1FA 3G4SV 1UJWB 5DN6G 4TSFG 1K5SA 1PNKA 2IU3A 2B1GA 3M99B 4BAYA 2DYRB 1OHHG 2Q6AA 1AI4A 1R3JC 4GX0A 4I5SA 2P6JA 1K9MW 4J9ZB 3VOUA 3EHBB 1FXKC 3CCLV 5LHGA 2EJRA 4JYBA 2ZXWC 3LSQA 4PA6A 3LUTB 1PD3A 5CBFA 1GKFA 4MTOA 3ZJZA 5EBLC 2A9HA 4DXWA 1PL0A 2Z3YA 3OW2U 2P7TC 1QVGU 3ABMC 2JEUA 1K4CC 5KUKA 2IH1C 3JD2A 3QO8A 4XDKA 2EINC 1VQOV 2B5UA 1YSCA 3K9AA 3D36A 3P32A 2ZDIC 2LP7A 2WLMA 1F4NA 5IYCO 2AHZA 2ZR3A 3OUSA 2EZOA 1KECA 4GCZA 1CEZA 4PDLA 2Y48A 1W0JG 1JX9A 1MG1A 5B1BB 4BIZA 4X89A 3E8GA 1AJPA 3OMNB 2WSSG 2OTJV 2UXXA 3JD0A 4YXWG 4JTCB 3CPWU 1QCEA 3BEHA 4TT3G 2A79B 4H37A 1PNMA 1VQLV 3DGEA 4QE9A 4P9PA 3W7TA 4MS2A 5L3GA 4WFAV 2DYSC 1B6QA 4JASA 4JTAB 3ZIAG 3I55V 3CCRV 1BHBA 2W0FC 1OCCB 5FL7G 4GX1A 2DYSB 1XL4A 3ASOB 2EIMC 2LFRA 2ZR2A 1M56C 2WLNA 5EBMC 4I9WA 5IY5B 1AROP 3AEIA 4GX5A 1GTOA 2EIKB 1OCZB 2Q67A 5EC2C 4GT1A 4MVSA 1V54B 4JAUA 2W6JG 2V1DA 4GX2A 5IDJA 2D3OW 3WG7B 3W7SA 4UVBA 3DTUB 1TUEB 3CCVV 4X88A 1K73W 4LP8A 1YIJV 1GM9A 1P4RA 2W6IG 2X6AA 2GSMB 4HYOA 1QLNA 3I56V 2YEVA 1M9NA 2BOCC 3HPLC 1NBMG 1FXVA 1SETA 1GO3F 2DQ3A 1J95A 2BOBC 1MABG 2WLLA 2XOKG 3IGAC 4JTDB 1DF5A 1N8RW 3ZRWB 4UV9A 3CD6V 2IJKA 1YTFD 3CC2V 2JJ1G 1NH2B 1VQKV 3E86A 2DYRC 1JVMA 4ZKIA 5GW7A 1AJNA 1CPYA 3F7YC 2K1EA 4P9OA 4LCUC 1ZWIC 1AI5A 3MHSC 4RUEA 4FMTA 3SPIA 1PKXA 3ABTA 3OEHG 4JAVA 4JGSA 1VQNV 5EBWC 4R6ZA 1V55C 5B3SC 1QLEB 1PNLA 2DWEC 2QA4V 3E8HA 1K4DC 3IC7A 2ZQMA 4OXSA 2XAHA 3F7VC 3KG2A 2H94A 2WLHA 2Q68A 4TWKA 1ENVA 1VQ4V 2X7RB 1JQ0A 1BMFG 1KD1W 4MTFA 1IXMA 1BL8A 4QIWF 3K0DA 3EFFK 4UV8A 3WG7C 2WLIB 1K33A 4PDVA 3ASNB 4UXNA 1Q81W 5LGUA 1AI6A 1NR7A 1KQSU 2HVKC 5L3DA 3FB6C 1OCZC 3SPCA 1DLBA 3SYQA 1W2BU 3LDCA 4ASUG 3CC4V 4PA4A 5IY5C 4PA7A 3E2EA 1OCOC 1OCRC 1W0KG 5H9CA 1RPRA 1GM7A 5LHHA 3SJQC 2X6CA 1H8EG 1H2GA 1K97A 1P7BA 4QE7A 3FYIB 4PA9A 2Y69B 1DF4A 1OCCC 3TCUA 3ZN1A 3T1CA 1S77D 3JD3A 1EZJA 3OGCC 2YSUB 3AG1B 5KA5A 3CCMV 3K0GA 4Z1MG 3AG2C 1H8HG 2ATKC 1RM1B 2QM7A 4UVCA 4HAMA 3ABUA 2B1IA 3CCUV 3STLC 2ITCC 3TK1A 1NKDA 1WPXA 4WFBV 1E79G 3T4DA 2IJIA 3OR7C 5DM6V 2EILB 1KP2A 3LDDA 1NR1A 3JD4A 3ZN0A 4E2LA 3ASNC 3T4ZA 4MTGA 4Q20A 3FB8C 2EBOA 4U7NA 3SYCA 4QJFB 1NVPB 4WFHA 1VQ5V 3OMIB 1S0VA 3K79A 4BIUA 2HFEC 1SZTA 4HZ3A 3ZRWA 3ZRXA 3K03A 4LBEC 1SERA 2OT5A 3E8BA 4ZBMA 4CBCA 2LFSA 2X0LA 3ABMB 3ZMZA 3ZMUA 4JF3A 1VQ7V 2YEVB 4XBFA 2QTOA 1GM8A 4PELA 3SPGA 3CCQV 3K08A 1VQ6V 4N23A 1FXKB 5HFMA 1K3EA 2JJ2G 1NJIW 3OAAG 1M57C 4KUMA 4R7CA 1KC8W 2XASA 4R8CA 5H6RA 3ML0A 3MD0A 3AG4C 1KP3A 3R65A 2XAGA 1M1KW 2V7QG 2XAFA 4F4LA 3WFVA 5LHIA 1VQPV 1FFTB 3ABKC 1M57B 1KKDA 4FPPA 2ITDC 3AG3B 3CCSV 1VQ8V 5J9PC 2CK3G 4FIPC 5IYDO 1JOYA 3OE7G 3FB7C 2WLIA 2A0LA 3ETEA 3RVYA 1OZ0A 2P90A 3OUFA 4G2KA 4FK5C 4L87A 2IU0A 3SYPA 1COWG 3K04A 4P30A 4X8AA 1BHAA 3H01A 3B8MA 4EKWA 1F4MA 3HB3B 4PA3A 3QO5A 4MW3A 4MVRA 2PI4A 4KP4A 1FXHA 3ZRSA 1YTFB 1R73A 5HFLA 1E1QG 4DO2A 1QVFU 5KA6A 1R3LC 1S3JA 3E89A 3GWOA 2R9IA 1EBOA 1E1RG 3RVZA 5KUMA 2EIKC 1F23A 5B1OA 4KFMA 2OCCB 5C93A 1NH2D 5EC1C 3NXSA 3UKMA 1Y66A 1M56B 2Q69A 1Q86W 1SESA 1FXKA 3JCZA 4PDRA 3K3WA 1K5QA 3OFNG 1K8AW 3LSSA 5CBHA 1XL6A 4MTXA 3STZC 2HG5C 4WFEA 4UUJC 1YJWV 1NVPD 2Y69C 4MSWC 4R50A 4WFGA 5B1AC 1OCOB 1OCRB 2IH3C 3E8FA 1THZA 2ZDIA 1R3KC 4RQFA 1G4YB 1I5XA 1F51A 2UXNA 3RBZA 3T2MA 4RQEA 4U7OA 2ZD9A 1YI2V 3MHHC 1ORQC 2WAMA 2MK3A 3ZCCA 4G27B 2WLKA 5LGNA 3ZMSA 5IYBO 3OM3B 3A0RA 1NQTA 3SPJA 1K34A 3TETA 2QEXV 2HVJC 2EIJB 3BY6A 2NLJC 3QNEA 1CP9A 2ZXWB 1V55B 4RUFA 5B3SB 2WWWA 1QBZA 1YJNV 3ZMVA 2P67A 3AG3C 1QR8A 3W7UA 2QE7G 2X6BA 2JIZG 3ABKB 4FJCC 2NNUA 3CC7V 1DTOA 1VQMV 1S72V 2DQ0A 2F43G 3ZRVA 3AG4B 3E35A 1VQ9V 5CMUA 3JD1A 4JPRA 2IW5A 1R6NA 2QM8A 2XAJA 2KB1A 1R6KA 4WF9V 3CCJV 5CN0A 2FTKA 1SRYA 3LDEA 1QR9A 4MVZA 1JJ2U 2EIJC 4QNHB 4LC1A 2HJFC 2C2AA 3ZMTA 3OR6C 2H8PC 5E1AC 4WCEV 3B77A 1AI7A 1MOFA 3RW0A 3ETGA 5CA3A 2JEXA 3W7XA 1AJQA 2JDIG 3JYCA 4MVQA 4J9YB 3CP1A 1MSWD 1YJ9V 1H38A 1GMGA 1I5YA 1K7DA 3G71V 1LNQA 4PDMA 3E83A 4UVAA 1JCHA 2HR3A 3B8NA 2XAQA 1V54C 1EFRG 5L3FA 4G28B 2EILC 4CZZA 2M7WA 3ABLC 3X2QB 2XNDG 3PJSK 2DW4A 1Y4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q69 A;  2QKS A;  1OCO C;  1OCR C;  4BW5 A;  3K06 A;  5EK0 A;  4MVO A;  4QE9 A;  3ASO C;  4P9P A;  4PDR A;  3SJQ C;  4MS2 A;  2X6C A;  1P7B A;  2DYS C;  3AG1 C;  1XL6 A;  4PA9 A;  1R3I C;  4QE7 A;  4RAI A;  4H33 A;  3STZ C;  1OCC C;  2HG5 C;  4WFE A;  4JTA B;  4XDL A;  3TCU A;  4UUJ C;  3T1C A;  2W0F C;  2Y69 C;  3OGC C;  4GX1 A;  4MSW C;  3UM7 A;  3GB7 C;  3K0G A;  4R50 A;  4WFG A;  5CBH A;  3AG2 C;  1XL4 A;  2ATK C;  2EIM C;  5BZB A;  4P2Z A;  4RO2 A;  5B1A C;  3SYA A;  2IH3 C;  3STL C;  1M56 C;  2ITC C;  3E8F A;  2WLN A;  5EBM C;  4I9W A;  1R3K C;  3SYO A;  2OCC C;  3T4D A;  2JK5 C;  3X2Q C;  4MVU A;  1G4Y B;  3OR7 C;  4GX5 A;  3SPH A;  5EC2 C;  2Q67 A;  2WLL B;  4MVS A;  3LDD A;  5CBG A;  3LNM B;  5B1B C;  2WLJ A;  3RBZ A;  3T2M A;  3ASN C;  4GX2 A;  3T4Z A;  3FB5 C;  4MW8 A;  3FB8 C;  4MTG A;  3SYC A;  2ZD9 A;  1ORQ C;  4WFH A;  4X88 A;  4G27 B;  2R9R B;  3F5W C;  4LP8 A;  2WLK A;  2HFE C;  2X6A A;  4HZ3 A;  3K03 A;  4LBE C;  4HYO A;  2DWD C;  3E8B A;  4ZBM A;  4CBC A;  3SPJ A;  2YEV A;  3IFX A;  2AHY A;  2BOC C;  3HPL C;  3TET A;  4WFF A;  2HVJ C;  2QTO A;  4XDJ A;  3SPG A;  1J95 A;  2BOB C;  4MVM A;  4H37 A;  1QLE C;  2WLL A;  1S5H C;  2NLJ C;  3IGA C;  4JTD B;  3K08 A;  4RUF A;  3AG3 C;  2X6B A;  1M57 C;  4R7C A;  3E86 A;  4R8C A;  2DYR C;  1JVM A;  3AG4 C;  3R65 A;  3F7Y C;  2K1E A;  4P9O A;  4LCU C;  1ZWI C;  2Q6A A;  1R3J C;  4GX0 A;  4F4L A;  3ABK C;  2KB1 A;  4J9Z B;  4RUE A;  3SPI A;  3VOU A;  1KKD A;  2ITD C;  3LDE A;  5J9P C;  5EBW C;  4R6Z A;  4MVZ A;  1V55 C;  5B3S C;  2ZXW C;  5CBF A;  4PA6 A;  3LUT B;  4MTO A;  2EIJ C;  5EBL C;  3ZJZ A;  2A9H A;  2DWE C;  3FB7 C;  2WLI A;  4DXW A;  4QNH B;  3E8H A;  2A0L A;  1K4D C;  2HJF C;  3RVY A;  2P7T C;  3OR6 C;  2H8P C;  3OUF A;  3ABM C;  5E1A C;  1K4C C;  4OXS A;  5KUK A;  3RW0 A;  2IH1 C;  3F7V C;  3KG2 A;  4XDK A;  2EIN C;  2WLH A;  2Q68 A;  3K04 A;  4TWK A;  3SYP A;  3JYC A;  4P30 A;  4X8A A;  4MVQ A;  4EKW A;  4J9Y B;  4MTF A;  4PA3 A;  1BL8 A;  4MW3 A;  4MVR A;  2WLM A;  3K0D A;  3EFF K;  3ZRS A;  2AHZ A;  3WG7 C;  2WLI B;  3OUS A;  1LNQ A;  4PDM A;  1R3L C;  3E83 A;  4PDV A;  3E89 A;  4PDL A;  1V54 C;  4X89 A;  3RVZ A;  3E8G A;  2HVK C;  5KUM A;  3FB6 C;  1OCZ C;  4G28 B;  2EIL C;  2EIK C;  3SPC A;  3SYQ A;  3ABL C;  3LDC A;  4KFM A;  4JTC B;  3BEH A;  3PJS K;  4PA4 A;  5IY5 C;  5EC1 C;  2A79 B;  3UKM A;  4PA7 A; 
#chains in the Genus database with same CATH topology
 2QKS A;  1A32 A;  4BW5 A;  2GV9 A;  3FYE B;  5BR8 O;  3CS5 A;  2PI5 A;  1GK9 A;  4H33 A;  1I7F A;  2GDS A;  3CRR A;  5JJE B;  1WN7 A;  3GB7 C;  5JQG B;  4DR2 O;  5BZB A;  1HWY A;  1Q6I A;  2XUM A;  4YY3 B;  2N74 A;  1RPO A;  4DUY B;  3X2Q C;  4MT8 A;  2UXD O;  5B1B C;  2WLJ A;  1IBL B;  2OWO A;  1P49 A;  2IJH A;  5L3E A;  4QPK A;  4YHH O;  2F66 C;  3D36 C;  1AIL A;  3JAK B;  3FKS G;  3CCE V;  4B3S O;  1TVK B;  4B08 A;  2Y0I A;  4EFB A;  3OEE G;  4FLV A;  5LOV B;  2WPD G;  2Z5U A;  4FZ1 A;  1XNR B;  1EN6 A;  4LF7 B;  4XDJ A;  5LYJ B;  2EZP A;  2YIB A;  3ZHV A;  5JH7 A;  1UJW B;  2RJZ A;  4TSF G;  5LMU O;  4DV5 O;  4FM1 A;  4NTY A;  2D2C B;  3G80 A;  4WBN A;  4BAY A;  3OT7 A;  2DYR B;  4GYC B;  1K9M W;  3VOU A;  4JZ2 A;  3B09 A;  4O4J A;  2EJR A;  4JYB A;  2ZXW C;  3LUT B;  1PD3 A;  5GON B;  5EBL C;  3P3P A;  1I0H A;  3U0Z A;  3OW2 U;  2P7T C;  4TUY B;  2JEU A;  1YSC A;  3CE2 A;  1KBH A;  2WLM A;  2IBZ H;  4J80 A;  1F4N A;  1FPO A;  5IYC O;  3OUS A;  1CEZ A;  1NTM H;  2K9P A;  1JFF B;  3RYF B;  3CPW U;  4H37 A;  1PNM A;  3DGE A;  4W4L A;  5CA1 A;  4P9P A;  5L3G A;  2DYS C;  4DV1 O;  3A2F A;  1B6Q A;  3ZIA G;  1BHB A;  4GX1 A;  4BR6 A;  1FFX B;  1WP7 A;  2EX3 A;  2JGU A;  2ZR2 A;  2GTA A;  2WLN A;  5EBM C;  2UXB O;  1GTO A;  2EIK B;  2Q67 A;  2Q73 A;  1XQ8 A;  2V1D A;  5IDJ A;  2D3O W;  1NZ6 A;  1TUE B;  4L8J A;  1K73 W;  2DMX A;  4LP8 A;  4U3F H;  4AHC A;  2YXY A;  3WB1 A;  1X59 A;  1N4C A;  4FLX A;  4J42 A;  1M4U A;  4B3M B;  5IJ0 B;  4O4L A;  4NKG B;  1M9N A;  1R1B A;  1NBM G;  1SQX H;  3TGU H;  2XOK G;  4CS2 A;  1DK1 A;  4LF4 B;  2IJK A;  2LW7 A;  3CJH A;  3N2K A;  1AJN A;  4LCU C;  1ZWI C;  1NU1 H;  1XMO B;  3ICX A;  1AI5 A;  3N2G A;  3MHS C;  4RUE A;  4FMT A;  2YUA A;  1PKX A;  4I7Z B;  4JGS A;  3FX7 A;  1B04 A;  1KYO F;  1PNL A;  1BCC H;  2QA4 V;  3E8H A;  3N27 A;  5TIS Z;  3DC6 A;  2BE3 A;  1AB3 A;  2XAH A;  3F7V C;  5JVD A;  2H94 A;  2WLH A;  2Q68 A;  4TWK A;  3ZHQ A;  1VQ4 V;  1JQ0 A;  1MSD A;  4WBN B;  4X65 B;  1BL8 A;  4UV8 A;  2WLI B;  1K33 A;  2R9A A;  3ASN B;  1Q81 W;  4YIO A;  2HVK C;  4LFC B;  1OCZ C;  3SPC A;  1XBL A;  4LFC O;  3SYQ A;  1U97 A;  5H9C A;  5BR8 B;  1UPG A;  3SJQ C;  3MAQ A;  4PA9 A;  5IWA B;  3T1C A;  1TUB A;  1EZJ A;  3JAK A;  1J5E O;  3AG1 B;  1QHT A;  4LNU B;  5KA5 A;  3CCM V;  4PHZ A;  3AG2 C;  1B06 A;  1H8H G;  1RM1 B;  2QM7 A;  4D7T A;  4IHJ B;  2OIG A;  4DV6 O;  2IJI A;  3OR7 C;  2EIL B;  4KHP B;  4IL6 Z;  2ZM6 B;  3ASN C;  3SYC A;  4WFH A;  2F23 A;  2HFE C;  3ZRW A;  1TAE A;  3K03 A;  4I9Q A;  2EJ7 A;  3G6B A;  4CBC A;  2X0L A;  2YS8 A;  2YEV B;  2QTO A;  4PEL A;  3A0B Z;  1VQ6 V;  3BFR A;  5IJ9 A;  1K3E A;  2RCV A;  1KC8 W;  2A06 H;  1KB9 F;  3AG4 C;  4OPH A;  1VQP V;  1FFT B;  3ABK C;  1M57 B;  4DK1 A;  4X20 B;  1KKD A;  1EN5 A;  2CTR A;  1SF9 A;  3GVM A;  1JOY A;  3OE7 G;  2A0L A;  4J7K A;  2P90 A;  4O4I A;  1QNM A;  2QKA A;  2ETN A;  4FM2 A;  4P30 A;  4X8A A;  1GAX A;  3H01 A;  1H2S B;  4MW3 A;  4MVR A;  4X64 B;  2CDY A;  2P5O A;  3CRA A;  4DO2 A;  1S3J A;  3LSU A;  3GWO A;  4JI4 B;  1BQZ A;  5KHG A;  4DR7 O;  1F23 A;  4DUY O;  3BCC H;  1Q6U A;  5LMN O;  1N32 B;  3E22 A;  4PDR A;  4X1I B;  3UQ8 A;  1XL6 A;  4O2B B;  5EIB C;  3BA9 A;  2VS0 A;  1NVP D;  2Y69 C;  4A5U B;  4R50 A;  1N34 B;  5B1A C;  1OCR B;  2IH3 C;  2ZKO A;  1XNR O;  2F1M A;  1SQG A;  1FYJ A;  3JAL B;  3C3S A;  4RQF A;  1G4Y B;  5LYJ A;  4DV2 B;  4UCO A;  3J81 N;  4DRX B;  2MK3 A;  3ZCC A;  1HNZ B;  2DN9 A;  3OM3 B;  3A0R A;  4TV8 A;  2BTQ A;  1NQT A;  1Q90 D;  3JAS A;  4LWS B;  3TET A;  4K35 A;  2EIJ B;  3OTF A;  3QNE A;  1CP9 A;  1XOU A;  1YJN V;  3AG3 C;  1VQM V;  2QWO B;  5FLX N;  2Q9L A;  3F5T A;  4NXM O;  3QF7 A;  1N0J A;  1R6N A;  2QM8 A;  1VF7 A;  4NR1 A;  5C8Y A;  2A7W A;  3ZMT A;  5E1A C;  1DGS A;  3B77 A;  4CS3 A;  3T1Y O;  1MOF A;  1YXB A;  3K5N A;  2JEX A;  3W7X A;  1AJQ A;  4U3J A;  3JYC A;  4Q6G A;  4DV7 B;  1Y67 A;  4ZI7 A;  1GMG A;  4KXR A;  1HDJ A;  2PZS A;  1BQ0 A;  3G71 V;  3CSX A;  4JI1 B;  3VQV A;  2HR3 A;  1RSO B;  4CH5 A;  3FAV B;  1V54 C;  5L3F A;  4G28 B;  4EFE A;  3ABL C;  2YI9 A;  3K06 A;  4MVO A;  3ASO C;  3FFQ A;  3CHX A;  2HKO A;  3AK2 A;  3CRQ A;  4RAI A;  4JYA O;  1L8D A;  4XDL A;  3L73 H;  3W7W A;  3M7M X;  3UCS C;  3UM7 A;  5J2U A;  3THO A;  5JJJ B;  4X1K A;  3SYA A;  1AP5 A;  5LP6 A;  1ROP A;  4QPJ A;  2YID A;  2JK5 C;  3ABL B;  4FLW A;  3SPH A;  2WLL B;  1PV0 A;  2OTL V;  4MW8 A;  3U10 A;  2UU9 O;  3IC9 A;  5LBQ A;  2UU9 B;  2ZE6 A;  3B4S A;  4B3R O;  3A8T A;  1SKV A;  2R9R B;  1N33 B;  4DUZ B;  1Q82 W;  4DR3 B;  3OMA B;  5CA0 A;  2EIN B;  2HLD G;  1YHQ V;  1XNQ B;  4WFF A;  5FPO A;  2UXB B;  5LP6 B;  2NN4 A;  1S5H C;  1Q7Y W;  5DN6 G;  2XHB A;  1XUQ A;  4J10 A;  1Q5O A;  1SQF A;  2B1G A;  2ZNI A;  2CTQ A;  4I4T A;  4I5S A;  4DR6 B;  3HKE B;  3K5L A;  4EEQ A;  2UUA B;  1FXK C;  5LHG A;  1YVW A;  2WA4 A;  1PL0 A;  4NXN B;  3IAY A;  1P84 F;  1QVG U;  1S5L Z;  1K4C C;  2IH1 C;  4XDK A;  2ZDI C;  2LP7 A;  4LF5 O;  1J5E B;  2ZR3 A;  4DW0 A;  1KEC A;  2Y48 A;  1W0J G;  1KUQ A;  3OD4 A;  4BIZ A;  5C8Y B;  1AJP A;  2OTJ V;  2UXX A;  3JD0 A;  4JI6 B;  4JYY A;  4JTC B;  4TT3 G;  2A79 B;  3L9D A;  1GN4 A;  3JAS B;  2FYU H;  1GN6 A;  4LWS A;  4QE9 A;  3W7T A;  4TQF A;  4JTA B;  3I55 V;  1GRJ A;  2AZ2 A;  1GH6 A;  1H2K A;  2ZIN A;  2VQE B;  3OTO B;  1SA0 A;  3KCX A;  4I0X A;  2LFR A;  3L72 H;  3DXR B;  4I9W A;  2KG7 B;  1ARO P;  5AG2 A;  1V9P A;  3AEI A;  4OPA A;  1OCZ B;  4MVS A;  4JAU A;  3H1J H;  4DV4 B;  4JI5 O;  3W7S A;  4UVB A;  4X88 A;  1HR0 O;  1P4R A;  2X6A A;  2GSM B;  4HYO A;  3AK3 A;  4I50 B;  4E4E A;  4X1I A;  5B5E Z;  3E22 B;  2ARH A;  2YEV A;  4IYI A;  2Q5Z A;  3HPL C;  2FB5 A;  4YJ3 B;  4JI8 O;  3UT5 B;  4CH4 A;  2WLL A;  3IGA C;  3ZRW B;  3CD6 V;  5J2T B;  3CC2 V;  3JAM N;  3A0H Z;  1JVM A;  4LF8 O;  5GW7 A;  1CPY A;  2Q0A A;  2CAZ C;  4X64 O;  1WNS A;  3OEH G;  1PP9 H;  2WA3 A;  4R6Z A;  1QLE B;  1Y74 A;  5H5N A;  4RWU A;  4BIO A;  1UFI A;  2KKW A;  1SZX A;  1VP7 A;  4X20 A;  4AQY B;  2ZQM A;  2Q8V A;  3KG2 A;  1ENV A;  4FVM A;  1FAF A;  2Y0P A;  1IXM A;  3K0D A;  1N36 O;  1D5A A;  2QJ1 A;  2VQF B;  4JI1 O;  4FFK A;  4C7U A;  2QGN A;  4UXN A;  2CTP A;  1M5I A;  1AI6 A;  5L3D A;  2RN9 A;  3FB6 C;  4FFB A;  3BAA A;  1W2B U;  3LDC A;  3CC4 V;  4TUY A;  4PA7 A;  3HKD B;  2E74 B;  1WA8 B;  2W0X A;  3WB0 A;  1HW7 A;  5LHH A;  1AR4 A;  1K97 A;  4BW9 A;  4CS4 A;  3ZN1 A;  1S77 D;  3OGC C;  3BPZ A;  4Z1M G;  4JI7 B;  4TV9 B;  1P7G A;  5LA6 A;  4HAM A;  2B1I A;  4YY3 O;  4DR7 B;  3JAT B;  4WFB V;  3T4D A;  2PYL A;  1US6 A;  1MNG A;  2CUG A;  5LMN B;  4EB6 B;  3JCU Z;  1XMQ O;  3ZN0 A;  3RYI A;  3T4Z A;  4J11 A;  1VQ5 V;  1N33 O;  4BIU A;  3HR0 A;  1SZT A;  4TV8 B;  3ZRX A;  3APO A;  4JI3 O;  1SER A;  1ZX3 A;  2P22 C;  3RFR A;  2VWJ A;  4ZBM A;  2Q0O C;  2LFS A;  4DRX A;  3S3W A;  2EUL A;  3IJ4 A;  1FXK B;  4JI0 B;  5HFM A;  1NJI W;  3OAA G;  3L75 H;  3T1Y B;  2ILM A;  4DV7 O;  3R65 A;  1QU7 A;  2N04 A;  4TV9 A;  4DR6 O;  5IYZ B;  4F4L A;  3WFV A;  5LHI A;  3AG3 B;  4AI8 A;  4J7J A;  1VQ8 V;  2CK3 G;  2ZCE A;  1YF2 A;  3ZHS A;  2WLI A;  3RVY A;  1OZ0 A;  4FM0 A;  3HKC B;  4G2K A;  4FFB B;  1XDC A;  4LF9 O;  3B8M A;  3T1H O;  5HFL A;  3RYC B;  1SS3 A;  3APQ A;  2R9I A;  1E1R G;  2QM4 A;  3RVZ A;  5KUM A;  4JI6 O;  2EIK C;  4D7S A;  1NTZ H;  1NH2 D;  1IX9 A;  5C93 A;  5EC1 C;  3NXS A;  3JSN A;  3UKM A;  2JVD A;  2Q69 A;  1Q86 W;  4DR1 B;  3ZHT A;  1FXK A;  4I4T B;  4DR1 O;  1H2L A;  1VMG A;  3OTO O;  4ABM A;  1GN2 A;  2P06 A;  3FD9 A;  1ZL8 B;  5LL6 Y;  1H2N A;  3C90 A;  4H44 B;  5EIB D;  3RYI B;  4IIJ B;  4RQE A;  4U7O A;  4EB6 A;  1IBM B;  1YI2 V;  2WAM A;  1SQQ H;  2PYJ A;  2UUB O;  3ZMS A;  1YEW A;  5LA6 B;  5K1P A;  4I50 A;  1Q8I A;  1F7Y A;  2QR4 A;  2ADP A;  3CRC A;  2ZXW B;  2UXD B;  1V55 B;  4RUF A;  5B3S B;  2WWW A;  1QBZ A;  1TVK A;  1AP6 A;  2P67 A;  4Z2W A;  4B3T O;  2JIZ G;  3ABK B;  4FJC C;  4YHH B;  3DXR A;  4O2A B;  1S72 V;  3ZRV A;  1XHZ A;  1XMO O;  3K57 A;  3P3N A;  2FTK A;  2Y4U A;  3LDE A;  1QR9 A;  3L70 H;  1TA8 A;  1JJ2 U;  2EIJ C;  3RYC A;  2KG7 A;  2F4V O;  4WCE V;  3HKB B;  1O9H A;  4X65 O;  4X1Y A;  1LNQ A;  4PDM A;  2YXL A;  4UVA A;  1U96 A;  1JCH A;  1EFR G;  4GUN A;  2PY5 A;  2EIL C;  2M7W A;  3X2Q B;  2XND G;  2E5L O;  3PJS K;  2V4D A;  2OCH A;  1Y4M A;  4ZOL B;  5IT9 N;  2PTM A;  3J7A U;  5B1A B;  4N21 A;  2EIM B;  1RM1 C;  2GBO A;  3AG2 B;  5EYP B;  3N2G B;  3AG1 C;  1R3I C;  4GLX A;  2PGG A;  1SQP H;  3P30 A;  4O4H B;  2GHY A;  3CYO A;  5LGT A;  1YIT V;  4P2Z A;  4FLZ A;  5IE9 A;  3SYO A;  4K8X A;  2ZT9 B;  1Q3E A;  1T5E A;  4MVU A;  4DV0 O;  2PF4 E;  3GWK C;  5CBG A;  3LNM B;  1HP8 A;  3FB5 C;  5JCO C;  4UCU A;  4K0K B;  3G67 A;  2L35 A;  4B7E A;  4DV3 O;  4B3R B;  5B1N A;  1M93 A;  2YDE A;  3D3I A;  1HNW O;  1BS3 A;  1WLE A;  5KHH A;  2DWD C;  2O57 A;  5FPR A;  1SA0 B;  1IBK O;  3IFX A;  2UXC B;  2UXC O;  1NTK H;  2AXT Z;  1NI8 A;  1URF A;  3RYH B;  2LW1 A;  1QLE C;  3K59 A;  3G4S V;  4DW1 A;  1K5S A;  2YIB D;  3ETQ A;  1WJZ A;  4DV4 O;  1IUR A;  3U11 A;  1PNK A;  1FD9 A;  2ODM A;  1OHH G;  2P6J A;  1HNX O;  4J9Z B;  3EHB B;  3CCL V;  5LXT A;  3LSQ A;  4PA6 A;  1GKF A;  4D6T H;  2A9H A;  1JFF A;  3RYF A;  5BMV B;  2Z3Y A;  4NXN O;  2AGA A;  5KHK A;  3CRM A;  3OGI B;  1BSM A;  4JAA A;  2EIN C;  2B5U A;  4LF9 B;  3K9A A;  1WB7 A;  5ITZ A;  1OV9 A;  3P32 A;  4KL1 A;  2AHZ A;  2P4V A;  4UB8 Z;  3SJA C;  2EZO A;  2HHH O;  1AR5 A;  1MG1 A;  4GKJ B;  3OMN B;  2WSS G;  4YXW G;  5LXT B;  3K58 A;  1QCE A;  3BEH A;  3K9S A;  1VQL V;  4JI2 O;  4J41 A;  3H1H H;  5DED A;  2JS5 A;  3TJT A;  1SQB H;  2E75 B;  4K3A A;  3CCR V;  4ZI7 B;  4B3S B;  2DYS B;  2JGD B;  1NS1 A;  2EIM C;  4NB5 A;  1M56 C;  2CGN A;  3DC5 A;  4GX5 A;  5EC2 C;  4GT1 A;  1V54 B;  2W6J G;  4GX2 A;  5D5Q A;  4DV2 O;  3CCV V;  1MMM A;  1GM9 A;  2ZE8 A;  1HR0 B;  1XHX A;  1QLN A;  3B40 A;  4X1K B;  3KKY A;  4CC6 A;  1FKA O;  2BOC C;  4AIL C;  1SET A;  2DQ3 A;  1D5N A;  4GZR B;  1J95 A;  3VQW A;  3KZI Z;  4IHJ A;  3ZBH A;  1LUV A;  1JJO A;  5KLV H;  1DF5 A;  2M6Y A;  1N8R W;  4K8Z A;  4UV9 A;  3H1I H;  1IBL O;  4X62 B;  1Z2G A;  4X62 O;  2JJ1 G;  2LGQ A;  2B9Z A;  3JAR A;  3E86 A;  1IXB A;  4ZKI A;  3F7Y C;  2K1E A;  4P9O A;  1WP8 A;  3QVN A;  3T1H B;  1JR9 A;  2RDC A;  4JAV A;  4O2B A;  5EZY B;  1VQN V;  2QTS A;  1V55 C;  5B3S C;  3L74 H;  2DWE C;  2RMK B;  1K4D C;  1LUW A;  4GKK B;  3IC7 A;  2YXH A;  1EZV H;  5EYP A;  2Q4P A;  4W4K A;  2X7R B;  1L0N H;  4I55 A;  4MTF A;  4QIW F;  3EFF K;  4PDV A;  1N34 O;  2Z0A A;  5LGU A;  1NR7 A;  1KQS U;  1DLB A;  3I5D A;  4B7K A;  5IY5 C;  4X1Y B;  1XEQ A;  3E2E A;  1OCR C;  2AZ0 A;  1GM7 A;  2YI8 A;  2X6C A;  1H8E G;  1H2G A;  1Q43 A;  1YDX A;  4ZHQ B;  2Y69 B;  1OCC C;  3RWR D;  3JD3 A;  1G1X B;  5ITZ B;  2GTS A;  2UUB B;  2YSU B;  4YIP A;  2Q7H A;  3K0G A;  4DYL A;  2ATK C;  3JAR B;  4DR2 B;  3ABU A;  1G6U A;  2IM9 A;  3SJC C;  5DM6 V;  1KP2 A;  3Q4H B;  3LDD A;  5KAI Z;  4Q20 A;  3FB8 C;  1VF6 C;  2EBO A;  2QWP B;  4O2A A;  1PM9 A;  1S0V A;  3OMI B;  3JAL A;  1ZAU A;  3BA8 A;  3SGI A;  4PJ0 Z;  4HZ3 A;  4LBE C;  3JSL A;  2OT5 A;  3ZED A;  3E8B A;  1I08 A;  1W59 A;  5B66 Z;  3ABM B;  3ZMU A;  4NTW A;  4XBF A;  2HEP A;  3CCQ V;  3SPG A;  3VQY A;  4TQD A;  3RYH A;  3K08 A;  4N23 A;  2BCC H;  1M57 C;  5LMU B;  4DV5 B;  2GUZ A;  2G38 A;  4R8C A;  5H6R A;  3MD0 A;  1KP3 A;  3QTC A;  2ZE5 A;  2XAG A;  2FKX A;  2NR5 A;  2E3C A;  2V7Q G;  2XAF A;  4DR5 B;  5CA1 B;  1VEW A;  1MZE A;  2RNB A;  2BSK B;  4FPP A;  3B2E E;  3H9V A;  3CCS V;  5J9P C;  1RSO A;  4FIP C;  4JV5 B;  1KU9 A;  2IU0 A;  3SYP A;  3K04 A;  5KX5 B;  2VRZ A;  3O65 A;  4PA3 A;  3QO5 A;  2PI4 A;  4KP4 A;  5KMG B;  1NT2 B;  3H1L H;  5KHI A;  1FXH A;  3ZRS A;  1YTF B;  1R73 A;  1E1Q G;  1QVF U;  2YIA A;  5KA6 A;  1R3L C;  2CE4 A;  2CTW A;  5GON A;  2YC0 A;  5B1O A;  4KFM A;  2OCC B;  4F6E A;  1Y66 A;  1M56 B;  3JCZ A;  1K5Q A;  3OFN G;  1K8A W;  5CBH A;  4DV1 B;  2HG5 C;  4WFE A;  4UUJ C;  3TXQ A;  5JVD B;  4QGP A;  4IIJ A;  1IBK B;  1THZ A;  2ZDI A;  1D2D A;  2E5L B;  1I5X A;  2BTQ B;  3C3T A;  1N0N A;  3RBZ A;  4NYK A;  2HP8 A;  2R72 A;  3MHH C;  1ORQ C;  3JAW A;  4G27 B;  2WLK A;  5LGN A;  4OX9 O;  5IJ0 A;  1QQC A;  4B3M O;  3CJH B;  3SPJ A;  4FLY A;  1K34 A;  2LQT A;  3RGB A;  4TOI A;  4DV0 B;  3CWB H;  3BY6 A;  5FNV B;  1YZB A;  2RQ6 A;  1QR8 A;  5DEC A;  3W7U A;  4LFA O;  5JQG A;  4ZOL A;  4K0K O;  2NNU A;  1YCI A;  4LF8 B;  1OJH A;  1MZF A;  3AG4 B;  3E35 A;  3CB2 A;  3BRC A;  3JD1 A;  5GTI Z;  2XAJ A;  2KB1 A;  3HKC A;  1I94 O;  4LH7 A;  3ZX6 A;  1SRY A;  1I94 B;  2QWQ B;  2QWN B;  4H0L B;  4GKJ O;  3RN4 A;  1VAR A;  2F93 B;  3OR6 C;  2Q7E A;  3K5O A;  4JI2 B;  1N32 O;  3RW0 A;  3ETG A;  5CA3 A;  4MVQ A;  4J9Y B;  3CP1 A;  5KHJ A;  1XRE A;  4Z1V A;  2VQF O;  4IGG A;  3AK1 A;  5KMG A;  1HNX B;  3HKB A;  3B8N A;  2XAQ A;  3N2K B;  2JRI A;  1GN3 A;  4CZZ A;  2KQX A;  2DW4 A;  1WB8 A;  2ZE7 A;  3G6E V;  5EK0 A;  2LGW A;  3CMA V;  4BWA A;  1M90 W;  2QDO A;  4JI5 B;  4ICG A;  4DK0 A;  5IJ9 B;  1S76 D;  4O4L B;  2XTA A;  3DSQ A;  1BE3 H;  1ZSP A;  4RO2 A;  3CXC U;  2OCC C;  3UT5 A;  1B3Q A;  4DV6 B;  1G8M A;  1JMK C;  1AR1 B;  3QO7 A;  5L3B A;  1VIB A;  5H6Q A;  1K92 A;  2IJJ A;  5L3C A;  3S3X A;  2UUC O;  3F5W C;  5LOV A;  1FS0 G;  3ETD A;  5JWP A;  1JPX A;  1FFX A;  2CGO A;  1WA8 A;  2AHY A;  4JYC A;  3CME V;  2OIE A;  4LF7 O;  1MA1 A;  4MVM A;  3VBB A;  1L1F A;  3MDS A;  2ZIM A;  1JA8 A;  4UCT A;  4GKK O;  4I0X B;  2MW2 B;  1Y76 B;  1ZL8 A;  5A9G A;  2IU3 A;  3M99 B;  4ZIB A;  4DR5 O;  2Q6A A;  1AI4 A;  1R3J C;  4GX0 A;  4PV1 B;  4CC5 A;  2PUS A;  4JI8 B;  2JS3 A;  5CBF A;  1WPB A;  4PI2 A;  4OGQ B;  4MTO A;  3ZJZ A;  3CEI A;  4IT5 A;  4DXW A;  1ZUQ A;  1SQV H;  3ABM C;  1RFY A;  5KUK A;  2ZIO A;  2P4K A;  3H1K H;  3JD2 A;  3QO8 A;  1VQO V;  5E79 Z;  1RP3 B;  4JYA B;  4O4J B;  5CB4 B;  3D36 A;  2AW9 A;  1BGY H;  3D8C A;  5IYZ A;  3ZS8 C;  4GCZ A;  4PDL A;  5D5P A;  1JX9 A;  5B1B B;  2HHH B;  4JI4 O;  4X89 A;  3E8G A;  2DJV A;  4LFB B;  2CH7 A;  2QWR B;  5KX5 A;  1L0L H;  3EVK A;  4MS2 A;  3R66 A;  4WFA V;  2DE0 X;  4JAS A;  2N05 A;  2W0F C;  4DUZ O;  1OCC B;  5FL7 G;  4LF6 O;  5FNV A;  1XL4 A;  3ASO B;  3ZHR A;  1EN4 A;  1FJG B;  1Y76 A;  2BSK A;  5IY5 B;  3O9O A;  4FZ0 A;  1IBM O;  3WG7 B;  4UCS A;  3DTU B;  3JAW B;  1YIJ V;  2ADQ B;  3JAT A;  2W6I G;  1IDS A;  3I56 V;  4YJ2 A;  4FLT A;  2UUA O;  1FXV A;  1CXZ B;  1GO3 F;  2BOB C;  1MAB G;  5CA0 B;  2KSD A;  4JTD B;  3LNN A;  4JV5 O;  3HKD A;  1YTF D;  1NH2 B;  1VQK V;  1XI1 A;  2DYR C;  5H2F Z;  5K1X A;  2Y4T A;  4JI3 B;  2F95 B;  5GTH Z;  4NXM B;  5JCO A;  2H3O A;  3UO3 A;  1XNQ O;  1VF5 B;  3SPI A;  3ABT A;  1WAZ A;  5EBW C;  5J2U B;  2F4V B;  4JI0 O;  4NTX A;  1VF6 A;  4OXS A;  1S5J A;  4ZHQ A;  3ZHU A;  1ZLZ A;  5JJN B;  1Y74 B;  3VQX A;  1Z5W A;  5BXZ A;  1KD1 W;  1BMF G;  2Q7G A;  3QG5 A;  3WG7 C;  4X66 O;  2GUZ B;  3BHP A;  4CH6 A;  4PD4 F;  3UO2 A;  1IVS A;  3WU2 Z;  4ASU G;  4PA4 A;  1Z5V A;  2DOS A;  5J2T A;  5BMV A;  1OCO C;  4UCV A;  1W0K G;  1RPR A;  4U3J B;  1PPJ H;  4F6R A;  2VWK A;  1P7B A;  4QE7 A;  3FYI B;  1DF4 A;  3TCU A;  5IWA O;  4LF5 B;  2YIC A;  5JH7 B;  4CH3 A;  3AG7 A;  4UVC A;  3J80 N;  5BY1 A;  3CCU V;  3STL C;  1H2M A;  2ITC C;  3TK1 A;  1NKD A;  1WPX A;  1E79 G;  4YJ2 B;  1NR1 A;  3JD4 A;  4E2L A;  4QJF B;  4U7N A;  4MTG A;  4YJ3 A;  3HKE A;  1NVP B;  3K5M A;  3K79 A;  2UUC B;  3NR7 A;  1HNW B;  4DR3 O;  3Q4H A;  4HNA A;  3ZMZ A;  4JF3 A;  3SR2 C;  1VQ7 V;  5A2Q N;  1GM8 A;  1EM1 A;  1AVM A;  2HJD A;  2JJ2 G;  4KUM A;  3WB2 A;  4R7C A;  4IYH A;  2XAS A;  3ML0 A;  1M1K W;  1LR1 A;  4LH6 A;  4O4H A;  2ITD C;  2ZNJ A;  2JGD A;  5IYD O;  3FB7 C;  4LR3 A;  1SC5 B;  3ETE A;  4UB6 Z;  4B3T B;  3OUF A;  4FK5 C;  3SJB C;  4L87 A;  1COW G;  3BAB A;  5CB4 A;  1BHA A;  4EKW A;  1F4M A;  3HB3 B;  2OYQ A;  1O9G A;  3M8A A;  4F6R B;  3E89 A;  2LO1 A;  1EBO A;  1ZTE A;  5EZY A;  4H13 B;  4KHP O;  1KMI Z;  4AQY O;  1SES A;  3PN1 A;  3SDL A;  3K3W A;  3LSS A;  4MTX A;  2XT9 A;  4DR4 O;  3STZ C;  4DR4 B;  1YJW V;  4LF6 B;  4MSW C;  2VQE O;  4HNA B;  4WFG A;  2R70 A;  1OCO B;  3E8F A;  3CX5 F;  1R3K C;  1F51 A;  4JZG A;  1KKC A;  2E76 B;  2UXN A;  3T2M A;  2ZD9 A;  2BTO A;  1HNZ O;  1X4T A;  4X9Q A;  3EXA A;  5IYB O;  1Y6X A;  3TXS A;  4UFZ A;  4OX9 B;  2FML A;  4JI7 O;  5KAF Z;  2A3Q A;  2QEX V;  2HVJ C;  1R6T A;  2LJ2 A;  4HBN A;  3D3Q A;  1BZK A;  2NLJ C;  2QKC A;  1XMQ B;  2ZM6 O;  2FL4 A;  3ZMV A;  4FLU A;  4LF4 O;  2QE7 G;  2X6B A;  1PL4 A;  4LFA B;  3RT3 C;  4UCR A;  3CC7 V;  1DTO A;  4DV3 B;  4J7Z A;  2DQ0 A;  2F43 G;  1VQ9 V;  5CMU A;  4JPR A;  2IW5 A;  1Q6H A;  4PI0 A;  3KCY A;  1R6K A;  4WF9 V;  3CCJ V;  4O4I B;  5CN0 A;  2L6L A;  3L71 H;  4MVZ A;  1TGO A;  1IZ3 A;  4LNU A;  4QNH B;  5LP6 C;  2CH7 B;  4LC1 A;  1TUB B;  2C2A A;  2HJF C;  4NVP A;  4LFB O;  2H8P C;  1AI7 A;  3FAV A;  2JDI G;  2QSA A;  3BVO A;  1MSW D;  1YJ9 V;  1H38 A;  4X66 B;  4I55 B;  1I5Y A;  1K7D A;  1N36 B;  3E83 A;  3CXH F;  1FJG O;  1XIL A;  5F2V O;  1BT8 A; 
#chains in the Genus database with same CATH homology
 2QKS A;  5B1A B;  4BW5 A;  3K06 A;  4N21 A;  5EK0 A;  3G6E V;  2EIM B;  4MVO A;  1RM1 C;  3ASO C;  3FYE B;  3AG2 B;  2HKO A;  3CMA V;  2PI5 A;  1GK9 A;  1M90 W;  3AG1 C;  4RAI A;  1R3I C;  4H33 A;  4XDL A;  3P30 A;  3W7W A;  3UM7 A;  2GHY A;  3CYO A;  1S76 D;  3GB7 C;  5LGT A;  1YIT V;  5BZB A;  1HWY A;  4P2Z A;  4RO2 A;  3SYA A;  1ROP A;  4QPJ A;  3CXC U;  3SYO A;  1RPO A;  2OCC C;  2JK5 C;  3ABL B;  3X2Q C;  4MVU A;  3SPH A;  1G8M A;  2WLL B;  4MT8 A;  2OTL V;  5CBG A;  3LNM B;  5B1B C;  2WLJ A;  1AR1 B;  3QO7 A;  5L3B A;  3FB5 C;  4MW8 A;  2IJH A;  5L3E A;  4QPK A;  5LBQ A;  5H6Q A;  1K92 A;  2IJJ A;  5L3C A;  2R9R B;  3F5W C;  3FKS G;  5B1N A;  1FS0 G;  3CCE V;  3ETD A;  1Q82 W;  3D3I A;  1WLE A;  3OMA B;  1JPX A;  2DWD C;  2EIN B;  3OEE G;  2HLD G;  3IFX A;  2AHY A;  4JYC A;  1YHQ V;  3CME V;  2WPD G;  2Z5U A;  4WFF A;  4XDJ A;  4MVM A;  1QLE C;  1S5H C;  2EZP A;  3VBB A;  1Q7Y W;  1L1F A;  3G4S V;  1UJW B;  5DN6 G;  4TSF G;  1K5S A;  1PNK A;  2IU3 A;  2B1G A;  3M99 B;  4BAY A;  2DYR B;  1OHH G;  2Q6A A;  1AI4 A;  1R3J C;  4GX0 A;  4I5S A;  2P6J A;  1K9M W;  4J9Z B;  3VOU A;  3EHB B;  1FXK C;  3CCL V;  5LHG A;  2EJR A;  4JYB A;  2ZXW C;  3LSQ A;  4PA6 A;  3LUT B;  1PD3 A;  5CBF A;  1GKF A;  4MTO A;  3ZJZ A;  5EBL C;  2A9H A;  4DXW A;  1PL0 A;  2Z3Y A;  3OW2 U;  2P7T C;  1QVG U;  3ABM C;  2JEU A;  1K4C C;  5KUK A;  2IH1 C;  3JD2 A;  3QO8 A;  4XDK A;  2EIN C;  1VQO V;  2B5U A;  1YSC A;  3K9A A;  3D36 A;  3P32 A;  2ZDI C;  2LP7 A;  2WLM A;  1F4N A;  5IYC O;  2AHZ A;  2ZR3 A;  3OUS A;  2EZO A;  1KEC A;  4GCZ A;  1CEZ A;  4PDL A;  2Y48 A;  1W0J G;  1JX9 A;  1MG1 A;  5B1B B;  4BIZ A;  4X89 A;  3E8G A;  1AJP A;  3OMN B;  2WSS G;  2OTJ V;  2UXX A;  3JD0 A;  4YXW G;  4JTC B;  3CPW U;  1QCE A;  3BEH A;  4TT3 G;  2A79 B;  4H37 A;  1PNM A;  1VQL V;  3DGE A;  4QE9 A;  4P9P A;  3W7T A;  4MS2 A;  5L3G A;  4WFA V;  2DYS C;  1B6Q A;  4JAS A;  4JTA B;  3ZIA G;  3I55 V;  3CCR V;  1BHB A;  2W0F C;  1OCC B;  5FL7 G;  4GX1 A;  2DYS B;  1XL4 A;  3ASO B;  2EIM C;  2LFR A;  2ZR2 A;  1M56 C;  2WLN A;  5EBM C;  4I9W A;  5IY5 B;  1ARO P;  3AEI A;  4GX5 A;  1GTO A;  2EIK B;  1OCZ B;  2Q67 A;  5EC2 C;  4GT1 A;  4MVS A;  1V54 B;  4JAU A;  2W6J G;  2V1D A;  4GX2 A;  5IDJ A;  2D3O W;  3WG7 B;  3W7S A;  4UVB A;  3DTU B;  1TUE B;  3CCV V;  4X88 A;  1K73 W;  4LP8 A;  1YIJ V;  1GM9 A;  1P4R A;  2W6I G;  2X6A A;  2GSM B;  4HYO A;  1QLN A;  3I56 V;  2YEV A;  1M9N A;  2BOC C;  3HPL C;  1NBM G;  1FXV A;  1SET A;  1GO3 F;  2DQ3 A;  1J95 A;  2BOB C;  1MAB G;  2WLL A;  2XOK G;  3IGA C;  4JTD B;  1DF5 A;  1N8R W;  3ZRW B;  4UV9 A;  3CD6 V;  2IJK A;  1YTF D;  3CC2 V;  2JJ1 G;  1NH2 B;  1VQK V;  3E86 A;  2DYR C;  1JVM A;  4ZKI A;  5GW7 A;  1AJN A;  1CPY A;  3F7Y C;  2K1E A;  4P9O A;  4LCU C;  1ZWI C;  1AI5 A;  3MHS C;  4RUE A;  4FMT A;  3SPI A;  1PKX A;  3ABT A;  3OEH G;  4JAV A;  4JGS A;  1VQN V;  5EBW C;  4R6Z A;  1V55 C;  5B3S C;  1QLE B;  1PNL A;  2DWE C;  2QA4 V;  3E8H A;  1K4D C;  3IC7 A;  2ZQM A;  4OXS A;  2XAH A;  3F7V C;  3KG2 A;  2H94 A;  2WLH A;  2Q68 A;  4TWK A;  1ENV A;  1VQ4 V;  2X7R B;  1JQ0 A;  1BMF G;  1KD1 W;  4MTF A;  1IXM A;  1BL8 A;  4QIW F;  3K0D A;  3EFF K;  4UV8 A;  3WG7 C;  2WLI B;  1K33 A;  4PDV A;  3ASN B;  4UXN A;  1Q81 W;  5LGU A;  1AI6 A;  1NR7 A;  1KQS U;  2HVK C;  5L3D A;  3FB6 C;  1OCZ C;  3SPC A;  1DLB A;  3SYQ A;  1W2B U;  3LDC A;  4ASU G;  3CC4 V;  4PA4 A;  5IY5 C;  4PA7 A;  3E2E A;  1OCO C;  1OCR C;  1W0K G;  5H9C A;  1RPR A;  1GM7 A;  5LHH A;  3SJQ C;  2X6C A;  1H8E G;  1H2G A;  1K97 A;  1P7B A;  4QE7 A;  3FYI B;  4PA9 A;  2Y69 B;  1DF4 A;  1OCC C;  3TCU A;  3ZN1 A;  3T1C A;  1S77 D;  3JD3 A;  1EZJ A;  3OGC C;  2YSU B;  3AG1 B;  5KA5 A;  3CCM V;  3K0G A;  4Z1M G;  3AG2 C;  1H8H G;  2ATK C;  1RM1 B;  2QM7 A;  4UVC A;  4HAM A;  3ABU A;  2B1I A;  3CCU V;  3STL C;  2ITC C;  3TK1 A;  1NKD A;  1WPX A;  4WFB V;  1E79 G;  3T4D A;  2IJI A;  3OR7 C;  5DM6 V;  2EIL B;  1KP2 A;  3LDD A;  1NR1 A;  3JD4 A;  3ZN0 A;  4E2L A;  3ASN C;  3T4Z A;  4MTG A;  4Q20 A;  3FB8 C;  2EBO A;  4U7N A;  3SYC A;  4QJF B;  1NVP B;  4WFH A;  1VQ5 V;  3OMI B;  1S0V A;  3K79 A;  4BIU A;  2HFE C;  1SZT A;  4HZ3 A;  3ZRW A;  3ZRX A;  3K03 A;  4LBE C;  1SER A;  2OT5 A;  3E8B A;  4ZBM A;  4CBC A;  2LFS A;  2X0L A;  3ABM B;  3ZMZ A;  3ZMU A;  4JF3 A;  1VQ7 V;  2YEV B;  4XBF A;  2QTO A;  1GM8 A;  4PEL A;  3SPG A;  3CCQ V;  3K08 A;  1VQ6 V;  4N23 A;  1FXK B;  5HFM A;  1K3E A;  2JJ2 G;  1NJI W;  3OAA G;  1M57 C;  4KUM A;  4R7C A;  1KC8 W;  2XAS A;  4R8C A;  5H6R A;  3ML0 A;  3MD0 A;  3AG4 C;  1KP3 A;  3R65 A;  2XAG A;  1M1K W;  2V7Q G;  2XAF A;  4F4L A;  3WFV A;  5LHI A;  1VQP V;  1FFT B;  3ABK C;  1M57 B;  1KKD A;  4FPP A;  2ITD C;  3AG3 B;  3CCS V;  1VQ8 V;  5J9P C;  2CK3 G;  4FIP C;  5IYD O;  1JOY A;  3OE7 G;  3FB7 C;  2WLI A;  2A0L A;  3ETE A;  3RVY A;  1OZ0 A;  2P90 A;  3OUF A;  4G2K A;  4FK5 C;  4L87 A;  2IU0 A;  3SYP A;  1COW G;  3K04 A;  4P30 A;  4X8A A;  1BHA A;  3H01 A;  3B8M A;  4EKW A;  1F4M A;  3HB3 B;  4PA3 A;  3QO5 A;  4MW3 A;  4MVR A;  2PI4 A;  4KP4 A;  1FXH A;  3ZRS A;  1YTF B;  1R73 A;  5HFL A;  1E1Q G;  4DO2 A;  1QVF U;  5KA6 A;  1R3L C;  1S3J A;  3E89 A;  3GWO A;  2R9I A;  1EBO A;  1E1R G;  3RVZ A;  5KUM A;  2EIK C;  1F23 A;  5B1O A;  4KFM A;  2OCC B;  5C93 A;  1NH2 D;  5EC1 C;  3NXS A;  3UKM A;  1Y66 A;  1M56 B;  2Q69 A;  1Q86 W;  1SES A;  1FXK A;  3JCZ A;  4PDR A;  3K3W A;  1K5Q A;  3OFN G;  1K8A W;  3LSS A;  5CBH A;  1XL6 A;  4MTX A;  3STZ C;  2HG5 C;  4WFE A;  4UUJ C;  1YJW V;  1NVP D;  2Y69 C;  4MSW C;  4R50 A;  4WFG A;  5B1A C;  1OCO B;  1OCR B;  2IH3 C;  3E8F A;  1THZ A;  2ZDI A;  1R3K C;  4RQF A;  1G4Y B;  1I5X A;  1F51 A;  2UXN A;  3RBZ A;  3T2M A;  4RQE A;  4U7O A;  2ZD9 A;  1YI2 V;  3MHH C;  1ORQ C;  2WAM A;  2MK3 A;  3ZCC A;  4G27 B;  2WLK A;  5LGN A;  3ZMS A;  5IYB O;  3OM3 B;  3A0R A;  1NQT A;  3SPJ A;  1K34 A;  3TET A;  2QEX V;  2HVJ C;  2EIJ B;  3BY6 A;  2NLJ C;  3QNE A;  1CP9 A;  2ZXW B;  1V55 B;  4RUF A;  5B3S B;  2WWW A;  1QBZ A;  1YJN V;  3ZMV A;  2P67 A;  3AG3 C;  1QR8 A;  3W7U A;  2QE7 G;  2X6B A;  2JIZ G;  3ABK B;  4FJC C;  2NNU A;  3CC7 V;  1DTO A;  1VQM V;  1S72 V;  2DQ0 A;  2F43 G;  3ZRV A;  3AG4 B;  3E35 A;  1VQ9 V;  5CMU A;  3JD1 A;  4JPR A;  2IW5 A;  1R6N A;  2QM8 A;  2XAJ A;  2KB1 A;  1R6K A;  4WF9 V;  3CCJ V;  5CN0 A;  2FTK A;  1SRY A;  3LDE A;  1QR9 A;  4MVZ A;  1JJ2 U;  2EIJ C;  4QNH B;  4LC1 A;  2HJF C;  2C2A A;  3ZMT A;  3OR6 C;  2H8P C;  5E1A C;  4WCE V;  3B77 A;  1AI7 A;  1MOF A;  3RW0 A;  3ETG A;  5CA3 A;  2JEX A;  3W7X A;  1AJQ A;  2JDI G;  3JYC A;  4MVQ A;  4J9Y B;  3CP1 A;  1MSW D;  1YJ9 V;  1H38 A;  1GMG A;  1I5Y A;  1K7D A;  3G71 V;  1LNQ A;  4PDM A;  3E83 A;  4UVA A;  1JCH A;  2HR3 A;  3B8N A;  2XAQ A;  1V54 C;  1EFR G;  5L3F A;  4G28 B;  2EIL C;  4CZZ A;  2M7W A;  3ABL C;  3X2Q B;  2XND G;  3PJS K;  2DW4 A;  1Y4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...