4WFFD

Human traak k+ channel in a k+ bound nonconductive conformation
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
211
structure length
211
Chain Sequence
QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSNSPPTFGAGAKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wffD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wffD01
1P4LB 1V7ML 5AAWA 4AZ8A 4DGVL 3L9RB 4Z8FL 1KYOK 3GSXB 5T3XE 3EYUH 1UXWA 3C60C 4MQ7B 1AD9B 3FQXA 3RL1B 3UYOD 4Z7OE 1BWMA 2DMCA 3U9PL 2NY4B 2UZIL 1I1AB 2XKUA 3OL2A 2OTUA 2FBJH 4XWGL 3MLZL 1CFQB 2IBGA 4NWTL 2VH5L 3PHQB 5DUPH 1G9NH 1YEGH 2HN7A 1F5WA 1W72B 1SBSL 3KPSA 3C2SA 2NY3C 4ZOAA 4PJCE 5CJXA 3IDJA 2GT9A 1LO3L 5EZIH 4P9MH 1EHLL 2WAHA 1Y0LB 4MB3A 2AJUH 3C9NB 5FFLA 4PYGA 2EXWC 3MOBL 4OF5A 3ZHKA 4XCCH 3G6JF 2VR4A 3KWWA 4YZFF 5C9JA 1NSNL 4LAJH 5ICXB 1NGZA 4N0CC 1HCFX 4FQIL 1JPFB 1LEKA 1TJIL 1MFCH 3WYRA 3IXAB 4ZFGH 3FOLB 1ZA3A 1E6OH 1MCBA 1T21A 1A9EB 3MV7E 2WUBH 3SBWC 3VRJB 2X4QA 3BH9A 4G6AD 3LKOB 2DM7A 5JZ7D 5JPMB 1KOAA 2EDFA 5K9KB 2FSEA 4IOIB 2F54E 3BISA 1S9WB 3IB4A 3CFJA 4UINH 1NAML 4UB0H 3IJHA 5F7DB 3RHWK 5IVXB 4K7FA 4LNRA 5DJYA 4HX1B 4NZRL 3AUVA 1RU9H 1NMAL 1ZVSA 1T03H 4WIQA 4YFDB 5B8CC 2WBJA 3HS0A 4S1SL 1C08B 2VLME 3WFZA 4GMSL 1MJ8H 4ZOBA 4P2RA 3GEWB 4UOW0 3L5WB 2Y7QA 4UOJA 4JY5L 4HK0A 4P3CL 4JRYB 1AO7D 4YXKH 3NABH 2A2QT 5A1AA 1DSFH 1MJUH 4PGBA 3WIIL 4HWEH 3TNMA 1VERA 5JORA 5C07D 4YBLC 4YE4L 1H5BB 2NY6C 3L3OB 3MA7B 1SEQH 5D71H 2I60H 1RHHB 3UC0H 5MI0B 4KRPD 4U0QB 2DQUH 5CEZH 5I18L 3QDGD 2ZPKL 3VH8G 4Z7VB 4MDIB 2D31A 1IKFH 3EJYC 2X41A 2APTA 3I2CL 3STZA 1VFAA 3RZWA 4HIJA 4WI5A 4RA3A 4Z7WF 1IAKB 4FP8L 1I9RH 4HFUL 1ULVA 4NN6B 6FABH 4OCXH 3V7AG 1HHJB 4RGNE 4GAJL 1Z0MA 3DLQR 3RGVB 4F7PA 1PVHA 3DIFB 1JK8B 3P4MA 4BK4A 1ED3B 4R26H 4DVBA 3JXAA 5DURB 3U1SH 1NJ9A 1WTGT 3SDCB 5LGJB 2ERJC 4H0IA 4XHQA 1OAUL 1IAIM 2ZG3A 1YUHB 4IRSA 4HD9A 4WI3A 5AYQA 5T1LA 4MA1C 5SWSB 5EOTA 1PG7H 2F15A 2E9WA 2FDBP 4QOKD 4BM7A 1M7IB 2P7TB 3T0EA 3D3VE 5DYOA 1TJGL 3NCFB 3SO3B 4U1LB 4MJ6A 4NQVB 3HC3H 3MRCB 3R8QA 4NT6A 1DUZB 3JZ7A 2NY2D 4PJ8D 5BJTB 4TRPH 1KLGA 2KPNA 3QPQC 4MNGB 2AK4E 4FQPA 2W91A 2IPUG 5DRXA 1J05B 1S9YA 5ILTL 4QTIL 5B4MD 3LQMA 4MD0B 5B38G 1ZANH 1NANH 2DL2A 4LVNC 4ZS7H 1S7SA 3QUMB 4JLRA 1U58A 2HRLA 2BHZA 1JYXA 4KPHL 2GITA 4PUBL 2F58L 3L5JA 3R1GL 3T2NL 4UBDD 2OR8A 5EO1A 3MCLH 1S7TB 3O45B 2BDNH 2A9MH 3REWB 4K94L 4OD1H 3ZKSD 3MODL 3GO1H 5AZEL 1A64A 2RAMA 2NQCA 3HI1A 4AJ0A 3MV9B 1S5IH 4GRMA 5DQDH 3G5XB 2E7LA 4UQ2A 3VXRD 1AXIB 3DRTB 3T8XB 3UDWA 4B50A 5KTEL 3HG1B 5ID0A 5D6DC 1NEZG 2VRAA 3OAYH 1IAII 5JHLL 4X80L 4GQ9H 1NFDF 1ZLVH 2B0SL 4L3CA 2WP3T 3FQUA 3H7BB 1NL0H 1QEWA 2PUQT 3TJEH 2P8LB 4QWWD 4U7MA 5HHPA 3MLSL 5DJCB 5CKAA 4U7KA 4HDIB 5HYJD 1ORQA 1AIFA 2NPLX 5DWUH 1AHWA 1RK0B 3VXUD 5JA9A 1ZT1A 4N9GB 3LPFA 2XZCL 4V1DB 5BVPL 3MJ8B 1JP5A 1MY7A 1FVEB 1IGCL 4CVUA 5AUMB 1HH9B 1INQB 4L9DA 1EEZA 4Q9QH 3IJSA 4JB9L 4C58B 3H3KA 5C0AD 2Z31D 4MXWL 4YGVB 3HNTH 1O5DT 4EKXA 3E2HC 2VDLH 3ZTNL 1RMFL 1F4WL 4NM8L 1T0NB 4FQXC 3KYKL 4I8DA 3VXMB 3UP1A 4M93C 3F8UB 3ILPB 4OI9A 3VXNB 3LY6A 4WFFD 2KUTA 5CJBA 3UBXB 4PJ9C 2Q8AH 3KS0H 4AYFA 4F7EB 4QRRB 3GM0A 4PLNC 4J12A 5TE4L 3OGCB 3V4VH 3T2OA 3P4NA 1YPZE 3LQAC 2EYTA 1OF2A 3WMSA 5DF0A 5L8JB 3B5HA 4UU9B 2L4OA 1KBGL 4OF3A 4DZ8A 2BVPA 2HA1A 3NCBB 1S7QA 3PABB 4N90E 5HYSG 4TUOA 4IRZL 2V2XB 1B0WA 4UILH 1LO2H 2GTZA 1F6LL 3HE7B 5D7JD 2DDQL 4CDGC 1UXSA 3ARRA 5KJRL 1A6WL 5LQBL 4M6MH 5DMGC 4JHAH 1F90H 1FNHA 5DK2B 3DNKA 2B1HL 3ZKQD 4LIQE 2Z35A 3F6IA 1H8OA 3ULVL 1UCBH 1EZVX 3TZVD 1UXWB 4ODUB 2PXYA 2V5SA 4X7SL 4NM4H 3HZMB 5DT1H 4LCYB 3K74B 3DARA 2E9BA 2OTUB 1P4IL 1X9QA 1MVUB 3FZUD 1YEEL 5C0DA 4K7PX 4F9PC 2VDMH 3BP6A 1A6UL 3B8YA 2HN7B 3NCEB 4FTVD 1AQDA 3T0WA 1FFOA 1DQTA 5DMJB 4J3WA 15C8H 3GSNH 4J3XA 1KNOA 4V2CB 5GS1C 4XP5L 4X6CA 3AS3A 4M43L 1XGQA 4PR5A 2WWKO 1FGVH 3IDJB 1EEQA 2GT9B 3QWRA 3BESR 4J3TA 3EBAA 4PFEA 1X4YA 4F7CA 4K2UL 1XF4A 4GBXC 5F9OH 3RBGA 5KS9E 4TTGA 1HDMA 3QI9C 4PLJD 2VQTA 2YA0A 2DKUA 5TDNB 4Y4KA 3KWWB 1QVOA 3QCTL 4WI8A 1D9KA 4KAQH 3O6FB 3K3QA 1T7YA 1C1EL 1NGZB 1LEKB 3KPSD 5ICZB 4OGAC 3LQAH 4QGYA 2BY3A 4XTRD 5FYKH 2ITDB 4D0BA 2EDKA 3BH9B 1UH4A 4PJDE 2R0KL 3ZMRA 3B83A 5ITFA 3QNYA 4ZPTB 5GRVK 4OJFL 3CFJB 3V9FA 3KAAA 3F7YA 4LGSB 3W9DA 1D6EA 4HIXH 1JV5B 3IJHB 3D69A 3PL6D 4LNRB 5DJYB 3DXAA 5HHNA 2VLJB 1ZVSB 5J57B 4G9FE 3NPZB 4U2YA 1UM6H 4MJIE 3VW3L 2EYRA 2Y7QB 4WI6A 2A77L 4HK0B 4FQHA 3TT3H 5HHQA 1U8OA 5EBMA 3TNMB 3N0PB 3T3MF 3GSRB 2PCPA 4I2XE 3HE6A 1GGIL 3SKOA 1WC7B 4NNPH 4FZEL 2OK0L 5KSVB 4BZ1H 1Y6KR 5GRVL 4AEIH 2EKSA 1DBBL 2ESVA 1BM3H 4EI6B 4ESKA 2D31B 5ESQB 1M6OA 3VRIA 3MCG1 3OJ2C 4KROD 2R0LH 3OAZH 5TFSH 2FEDC 4HIJB 2WBJD 1AD0A 3DMMD 1YNKL 3LHPH 4LSPL 4P2RD 4R6UA 5L88L 1SQ2N 4ZAKC 1NCWH 3ULSA 1NEUA 4F7PB 4P3DA 4TYUA 2AQ1A 3P4MB 3MZTA 2P47B 3VWKA 2GCYB 4DVBB 4PP1C 5C09E 4CJ0A 1EVTC 2MQCA 4Y4FD 3WHXB 5DD0L 4HK3N 3A6BH 5J13C 3P40A 3U0WL 3BPLB 4LL9A 4JFQB 1CE6A 5GGRY 4JRXA 3MBEC 4KMTL 2DYPA 5D93B 5F97E 2DQFA 4ZFFA 3V4UL 2V9RA 5EOTB 3RWCA 5JA8B 4EUPG 5E9DE 1SJHA 2WLZA 1S7XA 2X09A 4M8VA 4GMTH 2CJUH 5DYOB 3QIWC 2X42A 4W4NA 2JJVA 3K2UH 3V5HA 43C9A 1OW0A 4ERSL 2IFFH 3OKLA 3WD5H 2RIKA 2QTEA 5GJTH 1CD9B 4JKMA 2HLFC 4CMHC 1SY6A 2UUDH 3SDDD 4IIQC 3FQTA 4HQQL 4WHYG 2VL5A 3OX8B 1DN0A 1S9YB 5SX5K 3T3PE 2W65A 3RTQA 5I30L 1DFBL 5IMKA 2CDFA 2P5ED 5T1LD 1S7SB 4JLRB 2MNUA 1ZXQA 5AG8A 3SCMD 2GITB 3AXLA 1R0AL 4R8WL 3DGCR 1I4FA 1YQVH 5IESL 4OLUL 4M03A 5CZXD 5EO1B 4MNQE 4U4BA 4C59B 3MQIA 5IWLA 1C5BL 5LG1A 4OLYH 1R5IB 3MGAA 1AJ7H 4L29A 3HI1B 4LLUA 4JFFA 1H3XA 1U3JA 3STLB 1UT9A 1NGPH 4I5BA 4P2OB 2Y06H 4UQ2B 5HGAA 1S5HA 1SBBA 4PJHA 2R8SL 3EJZC 2YD4A 2DB8A 3QBTB 4G7YL 1J8HE 4LLVA 1T83C 3GRWH 4HUUA 5FGBC 5ID0B 4J6RL 1I8KA 2NTFB 4G6ML 3T0AA 3RU8L 2QJDA 4BQ8A 2FHFA 5TE6L 2OMBA 5JDJA 4L3CB 3TYGH 1INDL 3FQUB 4RFOL 3C6SA 5DJAA 1HEZA 4YHMH 1WWWX 3QWQB 2QADB 3I6KA 3S4SB 5BO1H 1QEWB 2IG2L 1Y6MR 4Z76B 4HGWA 5CUSL 5I2IA 4HIEB 1CK0H 1V8HA 5F8QC 4C56B 1ORQB 1AIFB 5I74C 4NWUL 1AHWB 4HH8A 1ZMYA 1ZT1B 4WUUD 3CMOL 2CR6A 3NH7H 4LU5L 3ZKXC 1WWBX 3MYZA 1EO7A 1MCSA 5D7IF 4Y4HC 3WFEL 3DBXA 1OB1A 1RZKL 4JREC 4K7PH 3VG9C 1EEZB 3QDAA 3SKJL 3IJSB 4N8CH 5C8JA 5DD3L 4NYLA 3MJ7A 5T1KA 3VWJA 3KPRE 5FUCE 3LB6C 3ME0A 4HJ0C 5CGYC 3T65B 3OGOE 3M8OL 2VB5A 1N59A 3NZHL 4L8SC 3WIFA 4I0PA 2GYSA 2A6IA 2IBBA 1H0DA 1BD2A 2IANA 4JO4L 4OFPA 1N26A 3BGAA 4QT5A 3WFDL 3RIAF 5GGVL 3KPMA 2IPTH 1BHGA 4OM1H 1KULA 3PV6B 3BEVB 2EDOA 3P4NB 4P4KA 5FA3A 3SDAC 5CD3A 3OKNB 4A2LA 5IW1B 1JGEA 2E8ZA 5ADPL 4DZ8B 2BVPB 4B41A 3O2VH 1UWEL 1WSST 2F53D 4UIMA 2GK0A 4GRWB 4QEGA 1YEHH 1P84K 3KNBA 3O3EB 2OL3L 2R9HC 4FXGA 5TDPA 1CFSA 2D7TL 3SKUD 3QHFL 5CMAA 3L3KA 5LBSH 4GG6A 2H45A 3VMPA 1KFAL 3PWNB 3EJJX 3X13B 2V7NB 2NY0B 1TPXB 1KCSL 2EDQA 4ONHA 1RIUL 1F3RB 4WU7A 1MREL 4NQDE 2BXZA 3DVNA 4P5TD 4DK3A 5E8EA 2GFBA 1EMTL 4HS8L 1JZ6A 4Y2OA 3GIVB 1TTGA 3LIZH 1N7MH 4NKIH 4PJIF 4ZDHA 4ELMA 2D0HA 2BJML 5CIPA 2XN9E 1J88A 4PBWD 5C0DB 5IROC 3LS4H 2NY4C 1G7QB 1AQDB 1I1AC 4D9LH 1FFOB 3RGHA 3IXTA 5E2UH 4X6CB 2RGSA 2OS7A 3I3EA 3MRBB 1XGQB 3P9WB 4RAVA 2FEEL 1JZ4A 5CILH 3LRSA 1FPTH 5JHDE 1Q72L 1GZQA 4XB7A 3FO0L 3MMEB 1X44A 1XF4B 4G6AC 2WUCL 2PXYD 2DLFH 2RB8A 4B53A 5J6GA 5JZ7C 5I0DA 2HG5A 4QXUL 4HZLA 4OZHB 1SY6L 3EUUA 4NO2A 1GPOL 2BY1A 4WI7A 4HUWA 3EDEA 3ESVF 4Y4KB 5F6IB 1QVOB 2R4SL 2CR3A 1M7DA 4F37F 3JWDL 3UTZB 5IHZA 2QSCH 3IFOA 4KV5E 5CKGA 4PJFA 4RIRA 5KZCB 3MLVL 4XC3H 3OKOA 4WJ5A 1UADC 1HH6A 2PKDA 4CMMA 5I15L 1FNSL 3M17A 1E4WH 1HILA 1GVIA 8FABA 2VXVL 3KYAA 2VLLA 4CKVX 5TQ0H 5ITFB 2EC9T 3QNYB 4LCIH 4Y19B 1BOGA 1KN4L 3F7YB 4G9DB 1D6EB 5HD8D 3UTPD 3W9DB 1BIHA 5D9SA 3D69B 5D1XA 3SE4C 3DXAB 2C1PA 3VH8A 1FNGA 4DKEL 35C8H 1D9KD 2VC2H 1ETZB 1OGAA 4M6AA 4JFEE 1T80A 3QQ9C 1BQHB 1MLBA 3A6CH 4KDWA 5DVMA 2EYRB 2J8OA 2ED7A 4S0TD 1H3GA 3ZE2E 5K33A 1A1MA 4YXHL 1VADB 5HHQB 3TPUB 4L4VA 1U8OB 3F5WA 3TN0A 5EBMB 4BFIB 1VB9A 5D72L 1RUAL 2X4NA 2PCPB 5I8OH 3H7LA 2AJYH 4X9IA 2BERA 4R4NC 5GRYA 3QEQE 2EKSB 2XA8H 4L3AA 2ESVB 5HSFA 3MR9A 1JPST 4PJ7E 5EO9A 1SMOA 5MI0C 4LASH 1M6OB 2R23A 3BDBA 4QXGL 5FECB 5MERA 1CDUA 1U6AH 4WHDA 4POYA 3DROA 4J8RA 3UJIH 4NFDA 4JDTL 3TC9A 1QR1A 4MX7B 4PRIA 3ULSB 5D5MA 4I18A 2HFTA 2E5EA 3O4LB 4PS4L 2DI7A 4PJEA 4IOFD 3RNKB 3UO1H 3PGFL 3VWKB 5LWYH 1AGFA 1IT9H 3RGVC 4F57L 2X70A 2CKBB 2A73A 5FYJU 1U8JA 2VSCA 2NXYB 1DBAL 3PHSA 3NVQA 2AEWA 2XV6B 1D5IL 4ZFFB 5F96H 3S5LB 3RWCB 4LRNH 1OGTB 2Q76A 4XVUC 4G8FA 1EJ6A 4HUVA 1T5WA 3O6LL 1G6RA 1CG9A 3ZYOA 4NUGL 3ILQC 2EXYC 4M7JL 3U7YH 2GUOA 3I50L 3WJJA 2ENYA 2CIKA 4FZ8H 5FGCB 5BW7C 1N6UA 4WY7H 4OZIB 2IH1B 3FQTB 4D94A 4E42A 4KKCC 2VL5B 1YECH 1DN0B 4JRXD 3SGJC 2W65B 3C6LD 3RTQB 5CJOL 2CDFB 5EU7C 4DEPB 1MCHA 1MFAL 4O58H 5DK3A 1B4JH 3HUJA 1D5ZA 4OGYH 2KDGA 3FKUS 1I4FB 5EOCJ 3GJFA 4XNUH 2B2XH 1CF8H 3RVWD 4OIIH 5JW3L 5CINH 4QWWC 1WF5A 2AERT 1D5XA 4JFFB 2B4CL 5C0CE 4I5BB 2ATPA 3SE8H 3RZCA 2R2BA 4PJHB 1CBVL 3NA9H 4WW2A 3U7AA 4JM2D 4HUUB 3V0WL 1I8KB 3FT3A 2OSLA 1G1YA 2NMSA 3C6SB 5DJAB 1HEZB 3RWJA 2QBWA 4Y5VA 2Z31C 3E1F1 4U49A 4IEFB 1OHQA 3TA3A 3QIBA 1V7MH 3MRRA 4HGWB 3ARPA 4DGVH 5I2IB 4Z8FH 4NOFA 5GRZA 1JGUL 5J1AA 3GZKA 2YUVA 1LK3L 3U9PH 1ADQA 4NQEE 4XBEL 2UZIH 3DBXB 1OB1B 4YH6A 4XWGH 3MLZH 3LCYA 4NWTH 2VH5H 4MAYC 5E2WL 1BBJB 2OXHA 4XNXL 5C8JB 4D9QE 5F3HA 4NYLB 5DHYB 1SBSH 4F33A 5T1KB 4TNWK 1I8LC 3VWJB 2E7BA 3SDXE 3BZEA 4IHOA 3GNML 4GW1A 4J4PC 1ZOXA 3D5OF 4AIZB 2BFVL 1LO3H 3WIFB 4I0PB 5D7JC 2XQYG 4OFYD 1EHLH 1TZIA 2A6IB 1H0DB 1BD2B 1UACL 2IANB 1Z5LA 3HAEG 3SGEI 3U36B 3MOBH 1J1XL 3KPMB 3GSVB 4QHKJ 4P4KB 5FA3B 1NSNH 3VDBA 3RUGA 1FV1B 4LHUG 1JWUA 4JQXC 4FQIH 4ZSOE 3WS6A 5A2JH 1TJIH 2GK0B 3MJ6A 4WFED 4QRPE 4OI8A 3KNBB 1P7KA 4FXGB 3V5KA 4W6WB 2BRRL 1CFSB 1T89C 4OV6F 3MV8E 4LLMA 3PGDA 1LEGA 3HE7C 3L3KB 4ENED 4GG6B 2CGRL 5IHUL 5E2JA 4KXZH 5T33L 1CDIA 4Y2DD 5ESVA 2DLGA 4KVCL 4LPYA 2DQGL 4LVHB 3LKPA 4WU7B 4HPYL 1ZSDA 4P49A 4L3EE 1NAMH 4W68A 1WWCA 3DVNB 1YN6A 1AGCA 3PWLB 1QRND 5D7KD 5E8EB 4NZRH 5H37H 1NMAH 1MFNA 2GFBB 5EOQL 3NCYS 5F93C 4NRYA 4S1SH 3A67L 4HV8A 5IR1B 4GMSH 4S2SA 4DK6A 4PV9B 5CIPB 4JY5H 4P3CH 5HHOD 2MWCA 3WUWG 3WXWL 4C4KO 3WIIH 2RHEA 3IXTB 2XRAL 4YE4H 3U0TB 3W5MA 4RAVB 4M3KB 1NMBL 1XCTB 5EUOA 4S1DD 5EZLA 5I18H 4DKDC 1GZQB 5EO0A 4G3YL 4XTRC 2ZPKH 1QSED 4Y8AA 3GMMA 5GIRA 5CJXC 5TQ2L 4RGOL 1RIVL 2D0GA 1JJUA 2YN3A 3PWPA 3V0VA 1T66D 3I2CH 3O3DA 4TSCL 3K80A 3NCCB 4FP8H 4HFUH 2P5WD 4NJAL 3CZFA 1M7DB 2VLKE 5IHZB 1YMMD 4GAJH 3PHOA 4HMEA 3KGRA 5IMMA 3IFOB 3RQ3A 1LGVA 4RIRB 2J4WL 3OKOB 1NDMB 2IMNA 1HH6B 1DL7L 1XGTA 2OZ4L 3HFML 4JG0L 4PJAF 1WZ1L 1D7FA 8FABB 3VFGL 4YR6B 3QO1A 2VLLB 2VQ1A 3CIQA 1OAUH 3CX2A 2CH8A 4EXPX 1I7ZA 3SJVA 3BAEL 5I1IL 2X1PA 4DKAA 1BOGB 2X4PB 1NBYB 3VE0A 5D9SB 5D1XB 2C1PB 3VH8B 5J0BA 2J8UA 1OGAB 1TJGH 1YA5A 3DV6A 1MLBB 4XAKE 4HC1A 1EV2E 4KROC 2HFEB 3D18A 2WBJC 3P30L 4NDMA 1A1MB 1K4CA 3DMMC 4U1IA 5D7LA 4L4VB 3F5WB 2Y5EA 1FNEA 3MREA 2NX5A 2DQEL 4E41A 2XNAA 3QJFB 5ILTH 4QTIH 1BJ8A 1ADQL 3MR9B 5D2LA 1MCWW 4KPHH 5EO9B 2HVJB 4PUBH 2F58H 2R23B 5IHBA 5MERB 5JXAL 3R1GH 3T2NH 3DROB 4K94H 4J8RB 1JFQL 3FRUA 2H8PA 3BX7C 1XF3B 2WWKT 3MODH 3NFNA 3U4BL 3WFHA 4XCFL 2YK1L 4TVPD 5AZEH 4HWBA 1QR1B 3DI2B 4PRIB 5D5MB 1SEBA 4I18B 1K6QL 4H0HB 1S7WA 2OJEB 5J3HD 1AO7B 4PJEB 5KTEH 1DN2A 5F9WB 1BJ1J 4NO0A 1AGFB 5JHLH 2YS4A 5C07B 4X80H 3ULVC 2YKLL 4WWKA 3QQ3A 2B0SH 3PP3K 5GSRA 5ISZE 1XH3B 1NGYA 3VXSA 1U93B 4JRYE 1IMHC 4CJ1A 5GRWA 5HGHB 1WEJL 3MLSH 4HIIB 4EUPH 2Z8SA 2I25N 4AH2A 1KIRA 3BPLC 3BZFA 4LP4A 4IRSC 4G8FB 4UUJA 2XZCH 5BVPH 2YPLE 1T5WB 4WI2A 1IGCH 1G6RB 1CG9B 4QHMB 2R1XA 3T0EC 4JB9H 4XT1C 2V2TA 1QUNA 2ZUQB 2GUOB 4N0UE 4Z0XB 4MXWH 3BJLA 4KJWD 2CIKB 4WHYH 5KOVC 3ZTNH 1RMFH 1F4WH 4NM8H 5B39G 3KYKH 5KSAA 2B1AL 2ICWI 2UYLA 2Z93A 3E6HA 1PZUB 3O8XA 1JI2A 5DRWB 3HUJB 4X6DE 5TE4H 3GJFB 4N8PA 1L0QA 1A6AA 1EEUA 4JKPL 4ODVL 5H35A 1OSPL 5KSBF 5DDHA 1D5XB 1T1ZA 4ONGL 3V6OA 2ICWA 5JMRA 1FC2D 1KBGH 3UJTL 5CP7A 3QSKB 3RZCB 2R2BB 3LV3B 2FATL 4IRZH 5HGGS 1NGXB 2VDPL 3ZTJG 4IRJD 2NY2B 2N56A 4LSSL 1WBZA 2DDQH 2E7LC 1RZIB 3FT3B 5F1NB 4A6YL 4ODBD 5L2KA 5KJRH 1A6WH 1KCVL 5LQBH 3UPRB 3UDWC 1DQQB 3RWJB 4Z7NF 2B1HH 3TA3B 6CGTA 3QIBB 2WSKA 3MRRB 4UDUA 5FKAA 5IFAL 3JTTA 4MNGE 3ULVH 1MI5E 1ZEAL 2YBRB 4KHTL 1IJ9A 1BFOA 3K8MA 4PGCB 4X7SH 3VFSB 4U1JA 4XCEA 3DETD 1EFXA 2ZCLL 3VFNB 5IVXF 1P4IH 5GGSY 3FONA 5HYQB 1NBVL 1YEEH 1W0VA 1A6UH 5DRZA 3IDNB 4U1HB 5F3HB 4F33B 1O7SA 2XOTA 3G6JA 4XP5H 3BZEB 1UM4L 4M43H 4RBPK 4GW1B 1GOFA 5F7KC 2BVYA 1DANU 2M26A 2IQ9L 4NKMA 4HC1L 1G7LA 3HG1E 4GW5A 3VXPA 2E8YA 4K2UH 1TZIB 4WENB 1M05A 1S7RA 1Z5LB 1U41A 2GK2A 4XVSL 3FOMB 4LOUC 2VKXA 4WTWA 2VJXA 5GS2D 1TQCB 1ACYL 3KR3L 2YN5A 4Z7VF 3MLXL 2GW5A 3N1PC 2VUOA 3QCTH 5F9JB 3OG6B 3UTQA 4PTUA 5GGQL 5ETUA 2A6KA 1C1EH 1JWUB 4N8VA 3HR5B 2DM3A 2M2DA 3MRPA 3CFKB 2JF1A 4I9WE 4V1DE 1VEMA 1XCQA 4OZGA 1BQSA 3V5KB 5MHSD 4RCAA 3PQYA 4HJJL 2R39A 4CNIB 4LLMB 2R0KH 4WDIA 2ADFL 5DQJA 1LEGB 1PSKL 4HWBL 1NC4D 1IAOB 3GBML 2B20A 4KMQA 5ESVB 1I7TA 2FCBA 3JV4A 3LKPB 4OJFH 4Q2ZA 4XNYL 1ZSDB 2GJ6A 3I02B 2YR3A 4UV4L 4GXVL 4FABL 4KY1L 3VXME 2B5IC 3TBSA 2NY0C 3RAJL 1TPXC 4OBSA 1DUYB 2DLHA 4JN1L 3BHBB 4AM0A 4HV8B 3VW3H 2PXYC 1R6VA 1I1YA 3RWDA 5HY9B 5CBEA 1FIGL 3C5ZD 2A77H 4QXTB 4KKAC 2W1NA 1U8IB 5D1ZD 3FJTA 1HWHB 2Y23A 3G5VA 3L3IB 2HTKC 3W9EA 1GGIH 1FL3A 3FN3A 4FZEH 3ROLB 3SQBA 2OK0H 4RMRA 5EUOB 1DBBH 4OLZL 5IOPA 3EHBD 4KJPC 4POZD 4R7NA 3V4PL 3T1FA 3PWPB 3TZVB 3O3DB 3WNMA 4PJCA 1G0YR 3SQOL 1AXSB 1UGNA 1YNKH 3JWOC 4LSPH 2OQJA 1JZ7A 1RK1A 5L88H 1QSFE 1N4XL 1UKTA 1CDHA 2JB5L 4CBPA 3PP4L 4OCRL 1XEDA 1RUQL 3CFBB 3PHOB 2HT3D 4PD4J 1D9KC 4CU6A 2YRLA 2OJZL 4F8TA 4X8JB 5DD0H 1KCLA 5I71B 1GZPA 2NNAB 3QO1B 3U0WH 1VACA 2QKIB 2VQ1B 5I66B 4G80B 4KMTH 1WLHA 4ZTOL 2VERN 2V17L 2DICA 3QDJD 1RZKC 3V4UH 3MV7A 4U3XA 4YX2L 1FE8L 4BQCA 1TTFA 4JPWL 2X89A 3FFCE 3MRFA 4MA7L 2J8UB 5E6ID 3QG7L 3MXWL 1J0KA 1RD6A 4KC3B 2F54A 3V95A 5LJYH 3UX9B 3JUZA 1TITA 5GGTA 4ERSH 4YHNA 3ARSA 3EDKA 5KVGL 4NDMB 1K4CB 5L2JA 5J6HA 3NIGE 4U1IB 3SO5A 4PRHE 1FNEB 3RHWF 3MREB 1NBQA 3QXUA 1ZS8A 4HQQH 2NX5B 5FGSA 4E41B 2XNAB 1V5JA 4P48A 1U8PA 5I30H 1DFBH 4PRNA 3ET9F 4EXKA 1WIUA 3HE6C 5D2LB 3GHEL 4R0LB 2HKFL 4QRTB 1R0AH 4R8WH 1K3IA 5IESH 3FB7A 3FHQA 4GOSA 4OLUH 1P2CA 5HHME 4OFVA 5KVFL 1B0GA 2H8PB 1C5BH 3WFHB 2DAVA 1KCRL 4KI5C 3TH4T 1LQSR 4JFDE 1SEBB 5INDA 2R8SH 1S7WB 4G7YH 2VLJE 1RV6X 4JPIA 4J6RH 4G6MH 2PTVA 4ZMAT 1J0ZA 4OZFA 4U0RC 3RU8H 5SX5H 5TE6H 1DEEA 2YUWA 4NZDA 3QG6B 3QQ3B 4WWKB 3K0WA 1INDH 1I3GL 3QWOA 4RFOH 1ONQA 1NGYB 3SDYL 3VXSB 3VWKC 3KPPA 2NY1D 2IG2H 3B9KA 1G7MA 4MZ3A 5CUSH 3OSKA 3MUHL 1FYTE 2DJSA 2A38A 4AH2B 1KIRB 3BZFB 5CGTA 4NWUH 2A1WL 3WFBL 1U92B 3CMOH 3MRGA 4LU5H 4FQ1L 1F3JA 4Y16A 2H2SD 2JIXD 3GSQA 4Q74A 3WFEH 1RZKH 3BGFB 3SKJH 3S96B 1TJHL 2V2TB 3QNZA 5DD3H 4NO0D 2ZUUA 1KIPA 1I3RA 3D3VA 3QH3A 2Q86A 5JLZB 1OW0C 1KENL 4AIOA 2Q6WA 2BNQE 5C3LD 4OZ4A 3M8OH 5KVMC 3WSQL 2NZ9C 3NZHH 2UYLB 3E6HB 4JM2C 1T22A 3Q48A 3GMOB 3O8XB 3TIDA 3D39D 5TH2A 1CLCA 4JO4H 3JWDC 5L8KB 1XGUB 5T3XL 1CICA 3WFDH 4DEPC 2AK4A 4EJ1C 5GGVH 3RNQB 1FCCA 1A6AB 2IADA 3OV6A 4LLDA 5H35B 3C8HA 2HMIC 1PZ5A 5C08D 5DDHB 1T1ZB 1DANT 3ZSTA 2ICWB 1JWMA 5GGRA 2W92A 5ADPH 5IWLC 4U7SA 3CFDB 4NFCA 1UWEH 4L4TE 3THML 1MF2L 3P0VL 5IG7A 4X4ZA 5EN2A 5CEXA 4DZBB 3MV11 2P49B 2AEIT 1WBZB 2BNRD 2OL3H 1LP9E 2EIZA 3WDHA 5FCSH 1LO0L 2P44B 1DBKL 5J8OA 2D7TH 5KSAD 3AY4A 5L2KB 3QHFH 3ESUF 5BMFL 1JBJA 3LKSB 1KFAH 2P5EB 2WBWB 1KCSH 1A4JA 5FUZL 1RIUH 1A6ZA 1JPTL 1NDGA 2VOTA 1MREH 3NIFF 4UDUB 4QY8A 4AK1A 2R29L 5DS8A 4WWID 1BFOB 2DRUA 2CLRB 2P45B 1EMTH 4HS8H 2AKRB 4U1JB 4XCEB 5F6HI 1OP5K 1EFXB 1K4DB 3HAEA 4NQCE 3U30C 2ZP0T 1IM9D 2BJMH 4WFHE 3UZVB 3FONB 1UEMA 4K8RC 1PAMA 2VISA 4LSRL 1W0VB 5DRZB 2XPGA 4UOW1 4LHUA 1RJLB 4JO1L 4BKLB 3B5GA 3LVEA 1FH5L 4F7MA 4X5LA 1Q72H 3VWJC 2J1KA 3FO0H 1Z0NA 1G7LB 4GAGL 3O3UN 3VXPB 1G7HA 3CNKA 1JVKA 4PRDB 3VI3E 2X44D 1M05B 1S7RB 2WUCH 3Q1SL 2MTPA 4QXUH 4I0PC 5KVDL 4ENEC 1SY6H 1GPOH 2ZOKB 3OQ3B 3MO1A 2R4SH 4YDIL 3DX8A 3UTQB 4KRMB 3JWDH 4C56E 3H9SE 4ODWA 5ETUB 2AS5M 2A6KB 4P4KC 4MWFA 2C26A 4O2EA 1MHEA 3MRPB 3PV7A 3MLVH 1JRHI 3NCJL 1XCQB 4OZGB 2BNUA 2JK5B 3MJGX 4OF7A 5I15H 5D1QA 1FNSH 3HC4L 1YPZA 3X11A 1P7QA 3PQYB 3ULVF 2VXVH 4WDIB 5DQJB 4NHCL 4LDEB 4H8WL 4I1NB 4D2NA 4PLKC 2VITA 2E7CA 3BP5A 1I7TB 3BPOB 3JV4B 2H3NA 5I1CL 4Q2ZB 1KN4H 4OCYL 1GXEA 2FYYA 4U31A 1FQ9C 5CBAA 5K9OA 4LLYA 1K8IA 4DKEH 4S1DC 2H32B 4J3VA 5HHVL 5I76B 2FIKB 4HUNB 3R0NA 4RSVA 4UNTA 4MZ2A 3KHOA 5C0EA 4YXHH 3CSYA 3JV6B 1KLUA 2VWEE 5D72H 1RUAH 3G5VB 3UTTB 5IB2A 4X4ME 1FL3B 5JW5A 1HSAB 1TNMA 1KACB 3M1BA 2XZZA 2ZSVA 1EAPA 2B4CC 4QXGH 2X9XA 4R7NB 3T1FB 4P5TB 5CJQL 4ZD3L 4JVUA 4KGLA 4PJCB 4YBHA 2LU7A 1IM3A 5CWSA 1S8DB 1RK1B 4JDTH 1HXYA 4ODTL 1FGNL 5K9JL 3PGCB 3ZT5A 2YD5A 5HI5C 1SJEB 5T3XD 5KS9A 4PS4H 1FFQA 2Q3AA 4TTDC 4QTHA 4Z7UB 3BUYB 3PGFH 4K3HA 4JR9L 4F57H 1UA6L 2H9GA 4ZXBA 1GZPB 1HQRA 1VACB 1DBAH 2EDLA 3V8OA 2HH0L 3U9UA 3OHXA 1P5VA 1D5IH 3SGDH 1EXUB 1QBLL 3KJ6L 2DBJA 3MV7B 4C83B 4PJDA 3I3BA 3HB3D 3MRFB 1A14L 3QULB 3O6LH 3B43A 5FYKE 2J8HA 2F54B 3LKNB 1A6TA 4NUGH 3MNZA 5D1XC 5F21B 2VQUA 5JIPA 4OAWB 2DLTA 2J6EL 4OZHE 4YHNB 4M7JH 5I1HL 1GJIA 3I50H 5L2JB 5J6HB 4NJ9L 3QNXA 5DZNA 5D96B 4DUXA 5E1HB 3HZYA 4G9FA 3PIQB 1JWSB 3GFUA 3UCRA 1ZS8B 32C2A 5D2NE 4UI2A 4MJIA 5J3HC 1U8PB 3TN0C 5CJOH 1U91A 1JZ5A 4PRNB 5I1LA 2VZOA 1MFAH 1Q0YL 3IAPA 3EYFA 4PB0L 3ARFD 3FB7B 4TSAL 1P2CB 3ZDXE 3KPOA 4I2XA 1BFTA 4AY0A 5JW3H 3S88L 4OD3L 4HPOL 4Y19E 4M00A 1AGEB 1HK6A 1ZT7A 4LCUA 2B4CH 3ECBA 3WO4B 1A2YA 4WI4A 1A7RL 5CP3H 3SKNA 2EDDA 1JTOA 3PXHA 1CBVH 3VD5A 5EU3B 2ZCKL 4QHUB 3V0WH 4I18C 1U8LA 4CN6A 2QQQA 3HPLA 1KTDA 1CGXA 1DP0A 3QWOB 5DGRA 3BJ91 4GRWF 3B2UD 3TBVB 1YJDL 5F9WC 2EO1A 3KG5A 4HMDA 1JYNA 3B9KB 1G7MB 2EE2A 3MUY1 4KJWC 4NZUL 1VENA 3AU1A 7CGTA 5IP4A 4GLRI 1CD1A 5DFWH 3KXFE 3G6DL 3Q0HA 4JZOB 1OSZA 1C16A 3ZT6A 5C09A 5DJ8B 1Q0XL 3ARGD 1QSVA 2FLBT 3IAGC 1JGUH 3MNVA 3MRGB 4I48A 1LK3H 1R3KA 1FC1A 4Y16B 1Q94A 3BQUA 2X4UA 4XBEH 4PRAA 4WFGD 2KKQA 2W0FB 2W07A 4U6YB 1U8QB 5FM5O 1IC7L 5D8JL 1RIHL 4J3UA 3QNZB 1WTLA 5E2WH 4XNXH 4NPYA 5E9DA 4M4PA 1I3RB 3D3VB 2Q86B 3SE3A 4KZDL 4G6KL 3D85B 3FQRB 4G8IB 3GNMH 4X99A 4G8EA 4RGND 4WEUD 3WJJC 3O4LE 4G6FB 4OZ4B 1H3WM 1N5YL 2BFVH 4Q9RL 1I85A 4FG6D 2DIJA 2ARJQ 4LIQL 1T22B 3TIDB 4X6CF 3QEHA 1KJ2L 1UACH 3WNKA 3CPLA 3QYCA 1CICB 4WTXA 1J1XH 5J56B 2BVUA 3G5YA 2IADB 2HJKA 1PZ5B 2GSIA 3CFEA 5GGRB 1JWMB 3ZTJH 3WCYA 5IG7B 2GI7A 2WWMD 2SEBB 3IDYC 4JCMA 4MNQA 4RAUA 3DETC 2VLRA 3CK0L 2BRRH 3RZCC 3FCTA 4WW2C 3IGAA 5DVNA 2PYEE 2CGRH 3M45A 5IHUH 3SGKA 3JV5A 5T33H 4KVCH 3QO0A 2DQGH 3V6BR 1J8HA 1A6ZB 4HPYH 3QR2A 4QY8B 2AK4D 4OZIE 4PJXB 4Y5VC 2PO6D 4MAUL 5DS8B 3TA3C 4MS8C 5EOQH 4GS7B 3FFDA 4ZUSA 2Y5TA 3HAEB 2P8PA 3A67H 4IS6B 5T5FL 2Y6SD 4HSQA 1I7RA 5JW4R 4EN3D 3LN4A 3WXWH 2XPGB 1I75A 4NBZB 1E0OB 1DQJB 2XRAH 4LHUB 2YXFA 3QXWA 3BD4A 1NMBH 1FNFA 4HWNA 1WIPA 1F58L 4F7MB 3MUGA 4FFWC 1UH3A 5JXEA 4G3YH 3K2MC 2CUIA 2I9LA 2B8OT 1G7HB 3MSPA 1BFVL 5TQ2H 3RVXC 4RGOH 1RIVH 3QXDB 3R4DA 3O41A 2F8XC 2C3VA 3KPRA 3OF6A 4TSCH 4I3RL 1JUFA 3IDIA 1FJ1A 5JDSB 4FFYL 4AT6A 4NJAH 3MO1B 5IVNA 4KI5F 1TQCC 1N64L 2YPVL 1MCWM 4MWFB 4O2EB 4OFDA 1MHEB 3ZKNC 2J4WH 1NUGA 2QV2A 5EBLA 3CLEL 2BNUB 1DL7H 5D1QB 1G0DA 1OL0A 1YPZB 3ISWA 2OZ4H 3HFMH 4JG0H 3WS6C 1P7QB 4E5XA 1WZ1H 1KGCE 1EFQA 5DJZA 3VFGH 5BRZB 3WUWB 4NUJA 4H1LG 2XG5A 5CLTA 3QUZD 2VITB 5IEHB 1OAZL 4PJGE 3BAEH 5I1IH 2H3NB 4LRIA 3RWHB 3BUTA 4LFHD 2HLAA 3CUPA 4HIHA 1L0YA 5CBAB 2R1WA 1HCVA 4LLYB 5DC4B 4R2GB 3W0WE 2KL6A 3U79A 1IQWL 2LVEA 1IC5L 4KU1A 3RIAK 1XR8A 2DKSA 1MRCL 4WV1A 4NQDA 3P9LA 3TH2T 4NO5B 3P30H 5C0EB 4ZS6D 3CSYB 2FD6L 1KLUB 4F15B 1JGLL 3N85L 3S98A 1CXIA 2DQEH 5GS2H 4M9OA 2HT3C 1HHGA 4Z7QF 1ADQH 1EO8L 3HLAA 5JW5B 4M6NL 2XN9A 2FH6A 4PJ5D 4OZIF 2ZSVB 2XXMB 5B3JE 4X0KB 5JXAH 5MENB 4Q58C 4WTZG 4NRZA 4P2QE 1JFQH 2VDQL 2Y07L 4MQXD 1A3LL 4UV7L 1IM3B 2R0ZL 1RULL 3U4BH 4XCFH 2YK1H 5FYLL 4G7VL 3LPGA 1HXYB 3AS0A 3UTSE 2R4RL 1UB6A 2EH8L 4PY8J 4Y5XA 4RZCB 5C70A 5SX4I 5JQHC 5KS9B 1K6QH 3BPCA 4QTHB 4JEGB 4P46A 5IGXL 1BOYA 1VEOA 3DYPA 4EI5D 3B2VL 2YKLH 4APQA 2HJFA 4LVOC 4PJHF 2H9GB 4LFHG 4ZXBB 1T0MA 1WEJH 5I16A 3U9UB 4R3SA 5I71C 3AREA 3FN0L 3H2WA 2NTSP 1U0QA 2F5AL 2NW3A 4X4XB 1CL7L 2Z0BA 1A3RL 4PJDB 4UT9L 1QLFB 3S6CA 4P2CG 4GUPA 2BCKB 1X5JA 3MNZB 5FHBL 5ITBL 1YMMB 3FTGA 5IBTL 1MCOL 2VE6A 4LDOB 2DN7A 4ELKA 3HZVB 3PP3H 5SX4H 3HZYB 3C60D 4G9FB 3QUYA 4JFEA 32C2B 3BWAA 5DFTA 3W11C 1YY8B 1OP9A 4MJIB 1CDGA 2B1AH 3KPLA 1UYWL 1U91B 1REIA 5I1LB 1ZA6A 2C7UB 5CEZD 3LRGA 3EYFB 4FA8A 3DO3A 3INUL 4DKFL 3VI4F 1MFDL 3KPOB 4I2XB 2NY1C 1YN7A 1KTLA 3QUKA 1WZMA 2BC4B 3QEQA 4JKPH 4ODVH 1OSPH 1U95A 1ZT7B 3QIUA 4LCUB 4ONGH 5EU6D 2MJWA 4G5ZL 3UJTH 4PJ7A 3SKNB 3R06B 2FATH 2EXWD 2VDPH 2UZYB 4LSSH 3ZE0E 5J1SC 25C8L 2B39A 2AJ3A 2H2SC 5FGRA 1SYSB 1UVQA 1U8LB 4WO4A 5C0IB 4A6YH 1FRGL 1MWAA 1KCVH 1KTDB 1QFHA 3HPLB 3VMNA 2QQKL 4OB5L 4B7IA 3WKML 4JDVA 3V7AE 5T5NF 5EG6C 3AU1B 4RMTA 4GKZA 1KB5A 5B39B 1CD1B 5IFAH 5DQ9A 1ZEAH 1OSZB 1C16B 1TQBB 4GG6F 2MQ3A 4KHTH 3L5XL 4HKBA 4XBPB 1R3KB 2ZCLH 1Q94B 3BQUB 2X4UB 4IOSD 2IALA 2ADGB 1LMKA 3DWTA 1UJ3A 1YNTB 4XRCA 1KPVA 1NBVH 5J4MA 5SWZD 2ZOLB 1GOHA 5E5MA 2UVEA 3C5JA 4D0DA 4UDTA 4NPYB 4RRPA 5E9DB 4ELMF 1ZVYA 3QQNA 3RWFA 1A7NL 3TM6A 4X9GA 4LSTL 1UM4H 3LH2L 4X99B 4G8EB 1AO7E 3ZL4L 5I1JL 2IQ9H 4W81A 1MEXL 4HC1H 4H26B 1QD0A 3BWUC 5C09D 5C0RL 2I07A 5C07E 1WZKA 5KSAC 4XVSH 3CPLB 4TSBL 4KK5C 1CFBA 1ACYH 2NY6D 3K1KC 3KR3H 3IKCA 4P99A 2J7LA 3BO8B 3G5YB 3MLXH 3QDGE 5BV7B 3NPSC 3MBXL 4MD5A 2HJLB 2GSIB 5GGQH 4RISL 1FBIL 4MA3A 4P23A 3BKML 1BJMA 3EJYD 3V6OC 3I85A 4RBPH 4MNQB 1V7NL 4RAUB 1EHNA 2JJTC 4Q6YA 5FYLD 1EZVY 1YNLL 5IJVA 4HJJH 4YBQD 3RVTD 3FCTB 4U1MA 4ODSL 2ADFH 3IGAB 4PJFF 3JVGC 1II4E 1PSKH 5C0CA 4HWBH 1FYHB 3GBMH 1CLZL 5F1KC 4X5WA 3GM8A 3RY4A 2COQA 3H6JA 3MCKB 4RX4D 1BZQK 4OUOA 4UV4H 4XNYH 3TV3L 4GXVH 4FABH 1EGJA 2AV7A 5DVOA 4KY1H 1CTNA 4NC0B 3RAJH 4POUB 5EIIA 1AR2A 3CCHA 4JN1H 3RP1A 2W0KA 2Y5TB 2P8PB 2VXSL 1FIGH 4QOKE 1CVRA 1I7RB 1CGTA 1NBZA 3WKNA 2VLRD 3HN3A 5F1IA 4JY4A 4JDZB 1P7HL 2BVQB 3MUGB 1VFBA 4OLZH 4M8QB 3S7GA 4H25A 4L8BA 3GSWA 1R3JA 3V4PH 3GSUA 4ZYKA 2C3VB 2OLDA 3QPQD 4M1DL 3SDXA 2XTJC 1MH5B 3IDIB 3MXVL 1FJ1B 3SQOH 3NOIA 4TNWF 4AT6B 2I27N 3F12A 1NCCL 1N4XH 2JB5H 4AEHL 3PP4H 5F7HA 3WHE1 1TZHA 4OCRH 3B9AA 1RUQH 4BUGA 1WV7T 4X9HA 2YA1A 4OD2B 3LEVL 1UKQA 2AV1A 5EBLB 2OJZH 1Q9KA 2Z92A 5TJWK 1NMCC 1CGUA 4ONFL 5FDWA 3QP3A 4E5XB 5D5MF 2BY2A 5K9QG 5DJZB 4PJEF 3VXRE 1HE7A 3VFWB 5F88A 1ZGLB 4NUJB 2MKLC 2F5BL 3QAZC 4ZSOA 5GGSA 1WFTA 3IS0X 3LEYL 1F4HA 4ZTOH 4JO2L 2V17H 1WZLA 2I24N 3KPRD 4QRPA 5EPMA 2HLAB 2AXGA 4YX2H 2R1WB 1FE8H 4QXWA 4JFYA 3MV8A 4JPWH 1HIML 3EFFA 3Q2CA 4MA7H 3ZSSA 1MWAL 3QG7H 4YPGA 3MXWH 3LDBB 3TIEB 1UWXK 5E8NA 4CGTA 1XR8B 1FVCB 1HSBA 1K3ZA 2BXYA 3CVHA 3QQ4A 4WV1B 4NQDB 4L3EA 5KVGH 1SM3L 5HDLA 3NIDF 4HEPG 1CS6A 4G42A 2V2WA 5EOCL 3S8WA 4JN2A 4U1GC 2P1YA 5E8OB 3HLAB 5C0AE 1ZLUK 1CDJA 4Y1AB 3GHEH 3FQNA 2HKFH 2JKXA 2R15A 2PTTA 1IEHA 5E4EC 3EKCA 5EC2B 5KVFH 2LABA 5E95B 1E27A 1G1CA 4FQXD 5BS0D 4UAOC 3MPCA 3HUJF 5JHDB 2YRZA 1KCRH 5K93A 1UB6B 1JF1A 3F7RA 4Y5XB 4PJ9D 3O9WA 3BPCB 1JZ3A 4NZJA 1WFNA 2UY6A 5GXBB 4P46B 1MAJA 4KWUA 3VDCA 3AAZA 1I3GH 1DE4A 4XP9L 2VLKA 3SDYH 2XN9D 4WW2F 1DBJL 3GSXA 3NMEA 4GG8A 5I16B 4FN0A 3OMZA 3AREB 4KKBC 2PN5A 2NY5C 2X1QA 4YK4C 2NW3B 2A1WH 4X8XA 3WFBH 1J12A 1FO0A 3FT4A 3PHQA 3TFKC 4UT6L 4FQ1H 4GUPB 5KW9L 5K59F 2FJGB 3RVVC 3ARFC 3FTGB 3TESA 1TJHH 4F3FA 4ELKB 1OLZA 1EGJL 3EYVA 3BIAX 1OTTD 3QUYB 1KENH 4N1EA 4I3SL 1M4KA 2F8OA 3KPLB 4YNYA 5IBLD 3WSQH 4EVNB 2XZAL 1QBAA 4OM0L 4LBEB 2V5YA 5HVWA 5T3XH 4XI5C 3B2UC 3GMQA 4XPGL 3TLRA 3RDTB 1YN7B 1KTLB 1JPFA 3QUKB 4OBRA 3KPQB 2CRIA 3QEQB 5E6IB 1U95B 4WI9A 3QIUB 1M71A 4O9HL 2BVEA 3FOLA 1QLEL 1A9EA 4PJ7B 4GBXD 3VRJA 3ARGC 3THMH 1MF2H 3P0VH 3QI9D 2C1OA 4PRPD 4HS6A 4H8WC 2HT2C 3CDGA 3WO4C 2A6JA 1LO0H 2ATKB 1DBKH 1UVQB 4WO4B 3GI8L 3KDMB 1ROWA 5BMFH 3MROA 4GH7B 1LVEA 4JDVB 4HX1A 4AIXA 1JHLL 5FUZH 1JPTH 4OGAD 4GKZB 1KB5B 5E6YA 4RGNC 4LCWD 2R29H 1C08A 3B9KC 1GRWA 4X6EB 4O02L 4JRYA 5AAMA 3TWCL 3N06B 4RMQA 5T1MA 1IFHL 2VZ3A 1UJ3B 2YEZA 4XRCB 4CU8A 1KPVB 1SJVA 3QCVL 4LSRH 5D6CA 4GRLB 2J88L 3MA7A 4Y16C 5E5MB 3C5JB 4KTEL 4D0DB 4UDTB 4GQPH 1UWGL 3KYOA 1XGPB 1UG9A 1QA9B 4MJ2A 4MYWB 2YPLA 4JO1H 4MDIA 4OFIA 3MGTA 1FH5H 3FB8B 2NYYD 4DUVA 3AROA 3Q6FB 4GAGH 4JPKL 4N0UA 2I07B 3Q1SH 5EUOF 1RSFA 3BSZL 4YHPA 1OP5H 5KVDH 4HMCA 3IKCB 3MJ9L 5KAQF 1IAMA 2EC8A 3DIFA 1CICC 4PB9L 4YDIH 5ACLA 1L9NA 4MA3B 2FO4B 4P23B 3IVKA 3SPVA 1EEYA 2Q87A 4GAYA 1A1NA 3SDCA 5L0QB 1U42A 5LGJA 1X5XA 4X6DA 3NCJH 1G9MC 1VGKA 3DVGA 4F2MA 1ZKAA 4MDJA 5E1AA 3HC4H 5IJVB 1U3HA 3O11B 3TVMB 2VL4A 4J2XA 1QRKA 4U1MB 4RFNB 5C0CB 4NHCH 4ZAKD 4XMPL 3AY4C 2P7TA 2P48B 4UMGA 4X5WB 5I1CH 3LRHA 2NR6C 3KLDA 1TXKA 4MGXA 4OCYH 4BK5A 4YJZL 3HTLX 4PP1D 3MRCA 2XWJA 4EDXB 4OZFH 5EIIB 2NZIA 5HHVH 4YDLB 5C08B 3MBED 4MNGA 1MI5A 2J8UF 2OR9L 1NBZB 2EKJA 3P3YA 2JCCB 4MD0A 2W38A 5F1IB 1RZJC 1DVFD 4JY4B 1J1OL 2R0WL 3QUMA 1QFWI 1T6WA 4BSVA 1IE5A 2YPKB 4NQEB 1CQYA 5LKNA 3K4ZA 5ACZB 1W72L 3O45A 4S10A 5DK0B 5EORL 4L8BB 1YEJL 1MHCA 1R3JB 2HLFD 3GSUB 5M95B 4H1LA 5CJQH 1JF5A 4C57C 4ZD3H 4UNUA 3SDXB 5IUSA 5DR5L 3OR6A 5JPNA 4F9LA 2P5EE 4LMQI 4TUKL 5D2LF 5F7UA 5HGBA 3F12B 4HJGA 2GAZA 4ODTH 3DRTA 1HHIB 1OWWA 4ZUUA 1FGNH 3T8XA 3TO2B 5K9JH 2Q7NA 2W9EL 3HG1A 1TZHB 5B21A 4P9HL 2H26B 4G43B 3ZYZA 2NXZD 3QDMD 3TCLA 1Q9KB 2Z92B 4JR9H 2P8LA 5FDWB 4AMKL 1QR4A 1HWGB 1UA6H 4M9PA 5DJCA 2IGFL 5F88B 4OCMC 1P69B 3T2QA 4KMLB 4ZS6C 5GGSB 2HH0H 1RK0A 3EJZD 5I9QC 4V1DA 4QRPB 3MJ8A 4LLQA 1QBLH 1FVEA 3KJ6H 1INQA 1OVZA 1CYGA 4KHXL 4JFYB 3MV8B 1A14H 4BFEA 5T1DL 5E8NB 3F7QA 4KQ4L 4XP6L 4YGVA 3F7PC 5IW6A 2APBA 4WTZA 2O93L 1HSBB 1GGYA 2P46B 3CVHB 3QQ4B 2J6EH 5I1HH 2LTQB 4WUUE 4KUZL 1QLRA 4M61A 4MJ5B 4NJ9H 3VXMA 4XC1L 4G42B 2V2WB 3VXNA 2X5PA 1FIEA 4RMWA 3RJDA 1RUPL 4G8GB 4Y4HD 3UBXA 1UZ6E 1UENA 1CTOA 1Q0YH 3FQNB 5CZVL 2PTTB 4PB0H 1ORSB 2A83A 2YOCA 3WNNA 4TSAH 3VFVA 4XPTL 3LB6D 4HJ0D 1E27B 4P4RA 4W4OA 3S88H 4OD3H 4HPOH 2V2XA 3TJHC 1ZGLP 1JF1B 4P0DA 4L3ED 1T2QL 5CHNA 1A7RH 5I1GL 1QHPA 5DD1L 5TGBA 5HDBF 2ZCKH 2X4SA 5DK2A 3ARBA 5JR1L 1QSFA 1DE4B 3O81A 2VLKB 4HKZA 3KLSA 2F53E 1YJDH 1D5MA 2XTLA 3OTTA 4ODUA 4GG8B 4OSUL 3IDMA 4NZUH 3UTTE 1A7BA 3HZMA 4ZXBC 3G6DH 4LCYA 2X7LA 2R9HD 3D25A 2X1XR 3DX9A 5BZWB 1Q0XH 3PG2A 5DC9B 1MVUA 1K85A 2AJZB 1FO0B 3FT4B 2Z8VC 4PV8A 3RI5F 3O9WD 3V79C 2DOCA 2VZUA 3RFZC 1IC7H 3MYJB 5D8JH 1RIHH 3BZ4B 3MGOB 4F3FB 4HXBL 1I8IA 2CD0A 3EYVB 2Y4SA 2V5MA 3FFCA 4G6KH 4L9LA 4LSQL 1OM3L 4KZDH 1B2WL 3RIFF 4YHYB 1N5YH 4PLOB 4Y88A 4Q9RH 4LK4A 4YNYB 4Z7UE 3RBSA 1S9XB 4LIQH 5TDNA 2O61A 3ARDA 4K71B 4EOWL 1KJ2H 2NY4D 5E5RB 1I1AD 2EE3A 4TUJA 3GGWA 4NC1E 4PRHA 3O6FA 3GMQB 2UY7A 2MCG1 5F1SA 3OKMA 5C86A 3QUML 2EDWA 1AKJB 4GJTB 5ICZA 1CN4A 3EOAB 1M71B 4X5XA 2P43B 1JNJA 4QRQA 1QPXA 5FM5M 1NGQL 4OQTL 3SOBL 2ITDA 5DTFB 2C1OB 4HULB 4HS6B 5JNYA 4WNQB 3CDGB 1QNZL 3JWNC 2DKMA 2A6JB 3CK0H 4ZPTA 5DMKA 2XI9A 4CDHA 3MROB 4JFDA 4BSJA 5IFJA 1JV5A 4OZGF 4NCC2 5E6ZA 3VA2C 3OKDB 2OI9C 5I8CA 4NKOA 2VLJA 1R3LA 1BECA 2D0FA 4MAUH 3IRZA 2CDEA 2PW1A 4U05A 2CPCA 2VXUL 4PD4K 5ISZB 3X12B 1TQBC 2J3SA 5T5FH 5E99L 5T1MB 1P5UA 1Q1JL 2YEZB 3GSRA 5FA4A 1FYTA 5D6CB 1WC7A 3BQUC 5KSVA 3TO4A 1NCTA 3KYOB 4EI6A 1F8TL 2YPLB 4PJBE 2DWDA 3K7UA 3GB7A 3QQ9D 5ESQA 3MGTB 1F58H 5IQ9A 1F45A 4GKOA 5TF0A 3SE3C 4DUWA 2VZTA 3KJ4C 2YUZA 3WE6B 1RZ8A 4Z7OF 1BFVH 4N0UB 3FT2A 2O5YL 4NIKB 4YBQC 3RVTC 1I85C 4FQJL 5CZKA 4I3RH 4YHPB 2BNQA 1DQML 4ZNEE 4FFYH 4ZUVB 4R4ND 5C0JB 5EH1A 3WXVL 1IGTB 5I0ZA 2GCYA 3QFJB 1X5FA 4PJCF 1N64H 1NANI 2YPVH 3SPVB 3IVKB 2Y72A 1EEYB 1YYLL 3WHXA 4GAYB 3T4AB 1A1NB 2GJJA 5CEYA 3EZ8A 2ENSA 3KVQA 4X6DB 3CLEH 3RX5A 1VGKB 3DVGB 4RQQB 1YY9C 4JFQA 4F2MB 4MDJB 5E1AB 1WT5A 4LHJB 1U3HB 1IC4L 3QUXB 5TDOA 1SYVB 3OXSA 4NBYB 5FB8A 4L4TA 4YHKL 4S1RL 1OAZH 4NN7B 2DTML 2AVGA 1NFIA 1LP9A 4HLJA 4F7TA 4ZFZB 3SGKC 1YEIL 1BIIB 3VRLE 4HWUA 3RGVD 2XWJB 1F2QA 5IVOA 4RA0C 1IQWH 3P4OB 1QBML 1ITBB 1IC5H 5DURD 1MVFA 2EEDA 2VDRL 5M94B 1RUKL 1NAKL 4P59L 3HRZA 1XF5A 3SDCD 1MRCH 4RMVA 3EDJA 1MI5B 3VFOA 3STBA 3OX8A 4ZTPL 2FD6H 4XVUD 3HA0A 2AJSL 1JGLH 3N85H 4DTGL 3MOQA 5SWSD 4BSVB 1XR9A 2X1OA 4MCYA 4LQ1A 2KQNA 4NQCA 3ILQD 1EO8H 4HG4J 4M6NH 1CGSL 5EZJA 2EXYD 4U3HA 3MOAL 2VDNL 2FX7L 5LXGL 1BBDL 4KK9C 3REVB 3CAFA 1MHCB 1R5IA 4LSVL 4H1LB 4Z78A 5JXEC 1X5IA 3ROOA 4LP5A 3STLA 4JRXE 4P2OA 3OR6B 1X5HA 2VDQH 2Y07H 4KKCD 1A3LH 2BSSA 4UV7H 5F71A 5JPNB 2R0ZH 3HKFA 1RULH 5HGBB 1G6VK 2F8VA 5HXMA 5FYLH 4G7VH 4HJGB 2GAZB 4P57B 2R4RH 2N1KA 4ZUUB 5FUCC 1XAUA 4PJXE 2EH8H 2NTFA 1VHPA 3G04A 4K55A 5J11C 1IILE 3OR7A 2ORBL 1IGIL 3TCLB 3S4SA 5IGXH 5JIIA 4JFPA 4QF1B 3B2VH 4Z76A 3MLTB 5KN5A 2WV3A 4LKXA 4HIEA 4PG2A 4C56A 3CJJA 5DEGA 5J7CC 1NUNB 1ODAA 3T0DA 5I75C 3MV9D 2C3WA 4LLQB 3FN0H 4NHUA 5BCAA 1HHHB 2F5AH 2IEPA 1CL7H 1ZWIA 1A3RH 4KJQC 4UT9H 1K8DB 1MPAL 3UYRL 1CLOL 3HG1D 4RGMB 43CAA 1J5OL 4ZO6A 4BJLA 5JTWA 5IW6B 5FHBH 1KV3A 5ITBH 5IBTH 1MCOH 3TEUA 3QRFM 2W0PA 3LDBC 3ZDYE 4MXVE 3T65A 1QLRB 4M61B 3U4EB 5E2TL 3LS5L 5DMIL 5INCA 1XIWA 4DN3L 3WNLA 1UYWH 2VMFA 1BEYL 2ARWA 4I9WD 1MIML 4MAYD 4V1DD 1JNNL 4KGJA 4MCZA 4ZFOA 4IMLA 3PV6A 3BEVA 1KUMA 3I6LD 4XMKL 4OTXL 3OKNA 5EIVA 3INUH 1N8ZB 2A83B 4DKFH 5IW1A 4HWZB 3AVEA 5BRZE 1MFDH 3VFVB 1FL5A 5BVJA 4J4PD 2R2EA 4X4MA 4P4RB 4IDLA 2DQTL 1HXMB 4PGDA 2CDGB 3O3EA 4G5ZH 1U3ZA 1RVFL 4O2FB 5CHNB 5LGKA 1FLRL 5C1MB 2RCSL 3VXMD 5TGBB 2FX8L 5F6HJ 2X4SB 25C8H 5C71A 1ERNA 3NGBC 2YMXL 3PWNA 3MFGB 3ARBB 4Y5XC 3X13A 1WBXB 2V7NA 1RZGA 2V9TA 3GSNA 4QRRD 3HI5L 1QSFB 4ODHL 2QQKH 2EDYA 4HKZB 3QT2A 4P46C 4OB5H 3WKMH 4WFEE 1D5MB 2OCFD 4TNVF 5ENWB 1F4AA 3IDMB 4APQC 2ICES 5E56A 3BZDA 2D7QA 4J3SA 2JE8A 3GIVA 1OTTC 5H37G 5E2VL 1A6VL 2X7LB 3CD4A 3D25B 3DX9B 3L5XH 4PGJA 1MQKL 1TLKA 5IBLC 1BX2A 3AREC 3ZKMD 3HE7D 1IEAA 2JELL 4RMUA 1NCNA 5I8EA 1G7QA 2HRPL 5C0BB 4PV8B 5IKCA 4JHBA 4PRBB 5MENE 5D7KE 1QRNE 3MRBA 1H3VA 2YD6A 1I8IB 2R2CA 2FL5B 3WDIA 1A7NH 3FFCB 3MMEA 3OWEA 2D7NA 4L9LB 3LH2H 4LSTH 4MMXC 4EI5B 2IAMA 1NC2A 4JO3L 2HAZA 5HHOE 1WGOA 3ZL4H 5I1JH 4PY7B 1MEXH 4OZHA 2O61B 1U9KA 5DA0B 5IFHL 5C0RH 3ARDB 5FOJA 4H0GA 4TUJB 4Z5RB 3GGWB 4PRHB 4TSBH 3UTZA 3K81A 2OR7A 3DGGA 4U1NA 5D2NA 3OKMB 5GS0C 2CO7B 1RZFL 5KANG 1QSEE 4BYHA 1HINL 3MBXH 4WRLA 1ES0B 4X5XB 4QRQB 3BN9D 4FQQA 4RISH 1FBIH 3BKMH 4JHZA 5JNYB 4R97B 2J5LC 3QIUC 5HHMB 2P5WE 1V7NH 2EYSA 2CXKA 2GEEA 3C60B 1YNLH 3BKJL 5DMKB 4Y19A 1YMME 1ZLWK 4ODSH 1VESA 4G9DA 4JFDB 5IFJB 2HVKA 1CLZH 4WO4C 4OUUB 1JGVL 1YPZF 5I8CB 4NKOB 2GTWA 1T3FA 1ETZA 1R3LB 3C87A 3O6FD 3TV3H 3WNPA 4OLXL 3O4OC 3KPNB 2NY3B 1BQHA 2CDEB 3DV4B 2PW1B 2AAVA 4YHIA 4U6TA 2NYYC 2Z8WC 1E6JL 3D2UA 1VADA 2VXSH 3TPUA 3MRLA 3LQZB 1GC1C 4BFIA 1P1ZA 1XGRA 5FA4B 1FYTB 3KXFA 2D7PA 1M7XA 1IAIL 2GQHA 3TO4B 1X3DA 2Z91B 3ZHDA 1BVZA 2APXA 2QSTA 4XPBL 4LDLB 4DGYL 2DWDB 1TVBB 3GB7B 3ZE1E 5GGVY 1BLNA 4EBQL 1N2RA 2NLJB 3JSSA 5CSGA 4X4YA 5FECA 1UQSA 5IQ9B 2VLJD 4MD4A 2V7HA 1RZ8B 2N7AA 4KTDL 3FT2B 4GXUN 5IB1A 1KIQA 5C6WH 4M4RA 1CXLA 2XQBL 1FZMB 3EOTL 1MAKA 4MX7A 4M1DH 4FNLL 3MXVH 2BNQB 1N3NA 3O4LA 4U6XB 1NCCH 4ODXA 3RNKA 1J0YA 5IV2A 4AEHH 4PPTA 3W82A 1MNUL 3G9AB 1W0YT 3TBTB 4NNYA 2CKBA 5SWZB 1FORL 5CEYB 3LEVH 4DFIA 2Q3ZA 4TVPE 1NCUA 4P23C 4ONFH 5ICYA 1F6AA 2D2OA 5D7IB 5KS9F 3D6GA 5TDOB 5L0QC 3OXSB 2JJUA 1VFOA 5F44A 4ONOA 4Y89A 3S5LA 2F5BH 5FB8B 1OGTA 1T7XA 4L4TB 3LEYH 1CLYL 4JO2H 2LU4A 1DVFC 4RFNC 1NFIB 3FAXA 5C0GA 1KB9K 1LP9B 9CGTA 4F7TB 5I1DA 4YBLB 3ULVD 2NY6B 1ZHNA 2JJWA 3IF1A 1HIMH 2PYEA 1MIEL 1MWAH 7FABL 1NLBL 1A7OL 2Q7YB 3BYTA 1D6VL 3HRZB 1XF5B 4Z6AT 4PJDF 5DHVH 3VFOB 4OZIA 2IH1A 2DQDL 1SM3H 1Y6NR 3IDGB 4JRWA 4IRSD 5EOCH 3GRWA 1XR9B 4MCYB 2JB6A 4NQCB 1MLCA 1WISA 3ORJA 4TQEL 3T0ED 3V2AR 2NXZC 3LEXA 1IQDA 1NCBL 2WP3O 5EZJB 2CSPA 1DJSA 4JZJA 3ALWA 4ZQKA 3CU7A 4MLIA 4Z78B 2OMNA 3ROOB 1PGRB 3ZDZE 3EIFA 1UWXH 2BSSB 5LCVL 2AQ3A 5FXCH 4MMZC 2ERJB 1M1SA 1B88A 2VIRB 3JWOL 2BVOB 3MLWL 4DQOL 3G04B 1LD9B 5GPRA 3RJQB 2ZNXA 3GBLA 3OR7B 3NTCL 4JFPB 3CFCL 2BSED 2LAGB 2YRPA 2ZWLT 3QIWA 5KN5B 4WFHD 1ZLUH 4XP9H 1OQXA 1MJ7L 3FRPG 4LKXB 3H9SB 1DBJH 3CLFL 5DEGB 4XZUB 4PY8I 3LN5A 4YEFA 5IM7B 3T04D 5DJ2A 2JLLA 5EUKB 4NHUB 4P2OD 1IL1B 1KC5L 4QRSA 1ZWIB 4OFKA 4UT6H 43CAB 1BBJA 2D9QB 4LVNB 5KW9H 4HGMA 4LEOB 5DHYA 3VGBA 5E0QA 4Z77B 5KBNC 2QADD 3ARZA 4X7TB 3FAWA 4J23A 4AIZA 1Y18A 3EZJB 3OXRA 1EGJH 2VSDA 1CU4L 5CGMA 3W0WA 5CJ5A 4HXAL 2LTQC 3WUZA 3BDYL 2QQNL 5INCB 3QHZL 4I3SH 1XIWB 3U36A 5GRJL 1CVSC 4ZFOB 1DBML 1MUJB 2XZAH 4MCZB 3GSVA 4IMLB 4OM0H 1T83A 3F58L 4FXLA 5FGBA 2EDRA 4RDQG 4XPGH 1FL5B 1FV1A 4HBCL 5BVJB 2R2EB 1B4RA 3IU4L 3A0OA 4HKXA 4PGDB 4O9HH 1QLEH 5F8RC 1I3VA 1P53A 2O5XL 4YC2B 4LOUD 4X7CC 3T3PF 1KTKE 1OWRM 3DI3B 4ORGA 4P2QA 3O9WC 3GI8H 1RZGB 3GSNB 4HCRA 3UTSA 5CFHA 3PWLA 2YHGA 3MLPA 1JHLH 5I19L 5MHSE 1KJ3L 2AI0L 2CKBL 3FO9A 5FM8A 1RJYA 1DQDL 4YQXL 5IR1A 1J86A 1OLLA 1OY3B 1BX2B 1S78D 3OAUL 4PV9A 4CAGA 4EQ2A 4Y1AE 4O02H 4LPTA 1CT8A 1IEAB 3BOVA 5I8EB 3TWCH 1E28B 1IFHH 5IKCB 5FV1L 5FF6B 1BZ7A 3O3AB 4NBXB 1AC0A 3QCVH 3U0TA 1F42A 1FFNA 2CIIB 2J88H 1ZLSL 2DWEA 4KTEH 1U8HB 1XCTA 4PGZA 3RUGE 1H3PL 1UWGH 5JO5A 2NY0D 2C3XA 4HEME 5H94A 4U2ZA 4L4JA 3UTOA 1PX3A 3I6GB 2IAMB 3RVUC 4LLWA 1NC2B 3BT2L 1S3KL 4YXLL 2QLVB 4N1HB 4NC2B 5B3NA 2H1PL 2G60L 4RFEA 5E00B 4JPKH 4JHWL 4KKAD 4YHYC 4WGWB 4YUEL 3DHMA 2BMKA 3BSZH 1YDPB 2E7HA 4ORZC 2HTKD 3ULUE 3RPIA 1AE6L 3DGGB 3MRHA 4P9HC 4U1NB 4XNMB 5D2NB 3MJ9H 3U6RA 2EE9A 4PB9H 4X6FB 3B6SA 1NDMA 4FQQB 4KJPD 1FSKB 1UFUA 4QNPE 1T20A 3QWRD 2RFXB 3CC5A 4YR6A 2EYSB 4KRNA 4J3OC 5L6YL 4QCIB 3DURA 5CSBA 3BD5A 2X4PA 1NBYA 4XMPH 1F02I 4P3WA 2HVKB 4Y4KD 1A7QL 5IROA 2QHLA 2GTWB 1T3FB 5IB5A 3OB8A 1F4YL 3IFNL 5I6XB 4YHIB 5KZCD 2ARJA 4KK8D 1NKRA 2HFEA 3WL9B 5EZOL 4BA8A 3WLWC 3DVIA 2F74B 3D2UB 3MRLB 3QDJE 2HKHL 4TOYL 1TTUA 3GKWL 1P1ZB 5GSVB 1XGRB 1VA9A 3KXFB 2OR9H 4K8RL 3QJFA 4Y19D 3MRNB 1J1OH 2R0WH 1H5BC 2XWTA 2A0LC 3MV01 5C7XL 2HVJA 1B0RB 1BLNB 1N2RB 3DXAD 4X4YB 2GY7B 1UQSB 1W72H 4MD4B 2V7HB 5EORH 1PX4A 5DUBA 4D9RD 1XF3A 1YEJH 5IB1B 1KIQB 3EYQC 2E27L 1JTPA 5DR5H 1BJ1H 2OP4L 4TUKH 1N3NB 4M5ZL 2YSSB 2OJEA 4NN6C 4NGHL 5BZDA 1AO7A 1T7VA 4ODXB 3WIHA 2W9EH 5IV2B 1MCQA 3HE6D 1I9JL 1WCBB 5C07A 4NNYB 4P9HH 1XH3A 2ESVD 4LVEA 1U93A 3FQWB 1HI6A 4OLVL 4HKJA 3BRGC 5HGHA 2HFFA 3QDGA 4AMKH 5ICYB 1F6AB 1FAKT 1W0WA 3SDCC 4KI5D 4HIIA 2IGFH 1H8NA 5B38A 1U3HC 3WLBA 1QPPA 1MCJA 3HC0A 5C0GB 2UWEE 5I1DB 2JJSC 1KJVB 2CRYA 4QHMA 4NN7C 4KHXH 1KJMB 1QYGL 1ZHNB 4KV5F 3IF1B 3VWKD 2PYEB 2DBLL 5T1DH 1J9CT 3SO3C 4HCRL 1FAIL 4Z0XA 3K46A 4KQ4H 1L7IL 4XP6H 2YD9A 1JZ2A 1NQBA 2CRZA 1LNUA 4KUZH 1KCKA 3H9ZA 5FOBA 3H9HA 1SJXA 4XC1H 2DYPD 1NEZA 1N0XL 1RUPH 3X3FL 4H20L 5DRWA 2JB6B 4ZO8A 1MLCB 3HHRB 4ZAKB 4O00A 2H2PD 1JHKL 4QOKA 4HBQA 3LEXB 1IQDB 5CZVH 3CH8A 4JZJB 2IQAB 4ZQKB 1DLHB 1WFOA 3V5DB 5I8KL 4XPTH 4C54A 1RURL 3LV3A 5CAYB 3ZE2F 1NGXA 1HOCB 5FV2A 2FJFA 3D39E 2NZ9D 4PJ8A 1UB5A 4NO3B 2RR3A 4EEEA 1T2QH 4BFBD 2XKNA 4F9LC 1RZIA 5I1GH 5F1NA 4OKDA 5DD1H 3RTQD 3UPRA 1MCCA 1DQQA 4D0CA 1OTSC 5C08E 4PJ7F 3QIWB 5C3TA 5JR1H 5ALBL 5MEQB 3CX5J 3QCUL 3Q5YA 2HMID 3I3DA 1K9TA 5FDYA 2YBRA 1FHGA 3G6AA 2DM2A 2V9QA 1WAAE 3LN5B 4OSUH 2BNRE 2JCCE 4MJ4A 1CD0A 1A21A 5DJ2B 4PGCA 4JFFD 5F1OB 3VFSA 1BQUA 2WINA 3VFNA 4QRSB 2AXJA 5HYQA 3VXRA 5IBUB 3CDFA 2EZ0D 3IDNA 4U1HA 4PJGB 3WEXB 5AG9A 1NUFA 4KXZI 4V2BA 5HYSA 1MCLA 3BKCL 4HXBH 4RWYL 1Y18B 3OXRB 4JQIL 3UYPA 3W0WB 2PETA 1QBBA 4LSQH 1OM3H 2WANA 1BMGA 1B2WH 5HYIA 4F58L 3FOMA 3L3DA 4FQCL 4XB8A 3TPKA 3GHBL 4K8RD 3S3JA 4EOWH 4LPWA 2W60A 5F9JA 4D8PB 4FMKA 5LAXA 5HI3D 1KG0B 1FP5A 3BGMA 4LGPB 1NAMA 1GYAA 3HR5A 3QXAB 3QUMH 1JIBA 5DVLA 1A6PA 3CFKA 5T1KD 4HKXB 5C0AA 3VWJD 1NGQH 4OQTH 2QR0B 2IPUK 4W4OC 3SOBH 2DD8L 3KHQA 4YIQA 1UH2A 4CNIA 3H0TA 5CD5C 5I74B 1QNZH 3ZKMC 4ORGB 5EWIL 4JG1L 4I0PD 4P2QB 1IAOA 1JGDB 2J2ZA 1BD2D 2IAND 3ZKXB 2ADJA 3ZYJA 2UZXB 1QQDA 3UTSB 4Y4HB 2OTPA 2YWZA 4MQTB 2PR4L 3I02A 4JREB 1FZOA 1PG7X 3FO1A 1TDQA 2DF3A 4P4KD 3WIHL 3J7HA 5KANI 3L3JB 4YZFE 1NLDL 3K8LA 1DUYA 3W2DL 3BHBA 1AQKL 3FO9B 2HTLC 4G8GE 1RJYB 4HUKB 4XP1L 4G6JL 5HY9A 2VXUH 5FHAL 5T3ZL 4QXTA 1CT8B 1Z6JT 1U8IA 4PLKD 1A1OA 4L8SB 3TH3T 3CMGA 4O51A 5D7JA 5E99H 1Q1JH 5ANME 1T1YA 2CQVA 3SKMA 1BZ7B 3L3IA 2BZDA 4HGKC 1FFNB 1N5AA 2DWEB 3ROLA 3F6LA 5JO5B 3EDDA 1OT2A 3GJFK 1G6RL 1PYWA 5H94B 5EU5B 3AFLA 3SDAB 2CXGA 1F8TH 3BN9C 4JFHD 3NN8B 1IGJA 2X9WA 4LLWB 3QEUA 4U6HB 4KFZC 3TZVA 4JQXA 4RFEB 4L9LC 2YZ8A 1AXSA 5SV3A 2O5YH 4XH2B 1KT2B 1BFSA 5HVGB 4DCQB 2BMKB 4FQJH 5EBWB 2VN7A 3RPIB 1CE1L 1TVHA 1DQMH 3MRHB 3ARDC 4M7LL 3CFBA 3U6RB 4FQ2L 3WXVH 3LKQA 5FAAA 2VR5A 4F8QA 3O6FC 4M6OL 3B6SB 2LE9A 3SDXF 4X8JA 4Z95L 1YYLH 1T20B 2ZUSA 3BDXA 3GMRB 3GUTA 3CC5B 2NNAA 5I17A 1A4KB 2AW2A 2BSRB 2QKIA 5I66A 1PKQE 3CZJA 4G80A 1IC4H 1FVDA 3DURB 4R97C 2IFGA 4Z18A 1XF2B 5HI5D 3Q3GA 4KUCF 5AEAA 4YHKH 1LEIA 4S1RH 4AG4L 2DTMH 4Z7WE 1MHHA 3T2PA 4TTDD 4CADA 1G0XA 5FM4A 5IB5B 1ZHLA 5T5NG 4YAQA 2BHYA 2AGJL 3MACL 5EA0L 1YEIH 3ES6B 5IJKA 5C2BL 2ARJB 2L7UA 4R90L 3S35L 3NZ8A 1QBMH 5DD6B 5FYJE 2VDRH 2ZJSL 3L7EB 1RUKH 1NAKH 4P59H 4XGZA 4GO6B 5J9PA 4H5SA 1BAFL 1T4KA 1A7PL 4LSUL 4ZTPH 1IZKA 2AJSH 4K3DL 2J12B 4DTGH 2XWTB 4R0LA 5KSBB 4JY6B 4QRTA 1PQZA 3P4LA 3TO4C 5D1XD 1UC6A 4JAMA 3PL6A 3VFUB 5J1TC 1CGSH 2ED9A 1OGAD 4YFLI 2WIMA 2VDNH 2FX7H 2ZCHL 3MOAH 5DUBB 5LXGH 1BBDH 5EU4A 2Z9TA 2EH7L 1OPGL 5FUOL 4LSVH 4M1CC 2BY0A 3VFTA 4EUPA 4DW2L 5BXFB 4WW1A 1HYSC 2VAJA 1CR9L 2LU3A 5DUML 5E7BA 4L4VD 5BZDB 3TN0D 4DOHE 1GGBL 1D5BA 1S9VA 1JYVA 4M5YL 3QG6A 1TCRA 2HT4C 5HI4C 4YDVA 2X05A 2ORBH 2DI8A 4KRPB 1IGIH 1CIUA 1HI6B 3FL7A 4HKJB 4M7ZB 3MUJA 2HFFB 3GK8L 3QDGB 4JVWA 2Z4QA 4PTTA 1W0WB 2V5TA 3BP4B 1IEBB 1V3KA 5B38B 1WT5C 5HJ3A 3WLBB 1U92A 3HC0B 5D93C 3DMMA 2AQ2A 1KPRA 3ZLQC 4PRID 1C7TA 1J87A 1I1RA 3S96A 3UYRH 1MPAH 1CLOH 3GMPA 1J5OH 2D03L 1N0LA 2AEPL 4XPHL 3U0PB 1GHFL 5HBBA 1NFDE 2VXTL 5JLZA 2P4AB 1RQ5A 4Y4FA 1LNUB 2ZG1A 2VDKL 2N7BA 4TULL 4OF0A 3KYNA 5FOBB 3H9HB 5D7SL 5E2TH 5T3ZD 1NEZB 4WFGE 1JHTB 3LS5H 4U6VL 3GMOA 3QFJE 1EHAA 5DMIH 3L1OL 4DN3H 1XGUA 1BEYH 1YEDA 1ZHBA 2GJZA 1MIMH 4QOKB 1JNNH 3O2DA 3RNQA 4NNXA 2DL9A 3VFRA 4M3JA 1WQVT 4ZO9A 4XMKH 4OTXH 3FRPA 4KKLC 4MLSA 3G5ZA 2AXFA 4I3GA 3VCLB 3CFDA 2DQTH 4N5ED 2FJFB 4PJ8B 1UB5B 4DZBA 4GFTB 4P2OC 1RVFH 2XKNB 3SDDA 1FLRH 4Q9CA 2RCSH 1KPUB 3QDHA 3VGHA 2FX8H 1I7UB 3LKSA 4D0CB 5CLWA 4X6BA 2YMXH 2P5EA 3IS1X 1YMHA 4MNHA 3HI5H 4ODHH 1RJCA 3SCMA 3U2SA 2QADC 3G6AB 5C6TL 2CLRA 4ZOEA 2AKRA 4PG2C 3RRQA 3U4AA 1T2JA 1K4DA 5E2VH 1A6VH 2WINB 2BOBB 3RZCD 2EIBA 4LLAA 1AHWC 3W39A 1FCGA 1MQKH 3VXRB 5IK3A 2JELH 4MB5A 2ZSWA 5GZOC 2HRPH 1WWAX 3TP4A 1V3MA 1J18A 5GHWL 2ZUWA 1VSCA 1RJLA 4BKLA 5HYSB 5DFVC 1J7VR 3OKKB 4XCYA 3TA3D 3QIBD 4MS8D 1HHKA 4JJ5A 4PRDA 4JO3H 5F89B 4K07A 4DFHA 3L3DB 1XFPA 5HYJB 5HDQL 3DOSA 3WJLA 3VXUB 1MQ8A 4WUUA 5F70A 5IFHH 2ZOKA 2W60B 1XIWC 4UTAL 2ILLA 1NFKA 4LMQE 4OV5A 2QL1A 5LAXB 3BGMB 1P9MA 1NAMB 1RZFH 4UTBL 1HINH 2VWEC 2IBZX 4FFWD 4XNQB 4NZTL 5C0AB 2Z31B 4HAFA 1AFVL 1QHOA 5FK9B 3V6ZB 2JK5A 2P8MA 2K7PA 1GAFL 3RVXD 4YIQB 1JPGA 1S78C 2W0LA 3H0TB 4XBGA 5DJDA 2CLVB 4HS3A 3BKJH 5JMOC 2ADJB 4YC2C 3VG0L 3P77A 1QQDB 3E3QE 3GBNL 5DZOA 1MCNA 1FZOB 1OD9A 4X6DF 4LQFL 4OKVA 3KYMA 4MAYB 3FO1B 3S97C 1JGVH 3ZHLA 3OG4B 2H32A 3ZKND 1EAJA 1U8NA 4OLXH 1X5AA 5I76A 1F3DH 2FIKA 2YD7A 3WV0A 3BPNB 1AC6A 2FLRT 5EB9A 3DUHA 3E8UL 4JQVA 2G2RA 4OIBA 2F53A 3VXTA 1E6JH 4XAWL 1A1OB 3JV6A 4O51B 2E9JA 3CSBA 4XHJC 5D7JB 5FEBA 2E7MA 1T1YB 3SKMB 3UTTA 1WK0A 1IAIH 1N5AB 2X4TA 5C0NC 3UPAA 4M48L 1ZLWH 1PYWB 1HSAA 3I75B 2FB4L 4MVBD 4XPBH 4DGYH 1IGJB 3QEUB 4KQ3L 1MCEA 4EBQH 4P5TA 2DIBA 3MRIB 5DJ0A 1DCLA 2H6PA 3LN9A 2IAMC 4KTDH 1S8DA 1INEL 1QFUL 3PWJA 5IMLB 2XQBH 1EJOL 3EOTH 1AGBB 3NFSL 4YWGL 3PGCA 4FNLH 4JANA 1TVHB 4FFVC 1SJEA 1TETL 4Y4KC 1CXFA 5F6IC 4WEBL 4PJ5E 3LKQB 4Z7UA 4FTVB 3BUYA 3T77A 3T3ME 2C4XA 3P2TA 3O6KL 5IB4B 4EQ3A 5D2NC 1MNUH 1EPFA 3O2DL 3F7VA 1L9MA 1FORH 4KK8C 3RI5K 1J0HA 1GGTA 3GUTB 1IKNA 5I17B 1FSKC 5HVFB 5C0FA 4K3EL 5C0BE 1FVDB 3PWPD 1AR1D 1EXUA 4GRWH 4JFXA 4C83A 4HK3J 3Q3GB 3MLYL 1S9KC 3T0VA 3FQXB 3I9GL 4MXQC 1LEIB 3RIFK 1CLYH 1MHHB 4CADB 2YWYA 1DTUA 1ZHLB 1D3CA 1KELL 5FO7A 3QULA 4YAQB 5DRNA 1ACZA 2NY7L 3LKNA 1NCAL 4OF8A 2AEQL 4OAWA 5H2BA 4CUCA 1L0XA 1PJ9A 5F7NC 5F7FA 1MIEH 3KPSB 7FABH 1GIGL 1A7OH 1NLBH 3NZ8B 4CL7A 5I6XC 1D6VH 4XGZB 5DHXB 1BREA 5J9PB 4H5SB 3PIQA 1JWSA 1T4KB 3HNVL 2DQDH 1KLFA 2FNBA 3SJVD 3EDFA 5HGDA 1PQZB 2MCPL 2LQRA 4TQEH 4JAMB 3T4YA 1ZT4A 3PL6B 5C9JB 1NCBH 2ID5A 5EU4B 1QOKA 1AGEA 3VFTB 4EUPB 4PJBA 3W11D 4GKSA 4WW1B 5LCVH 5D7LD 5A40E 2UVFA 2BK8A 1ZA3B 3MRQA 1T21B 5EU3A 5CEZE 3JWOH 4OGXL 1CGWA