4WFFD

Human traak k+ channel in a k+ bound nonconductive conformation
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
211
structure length
211
Chain Sequence
QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSNSPPTFGAGAKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 52
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wffD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wffD01
4M6AA 1YZZA 1I9EA 5FGBC 2E7LA 3G08B 4JJ5A 4XBPA 2MQ0A 1IAOB 4XCYB 4QNPE 1J05A 2CUIA 4XMPL 4KKCC 1NL0L 1SEBA 2HKFL 4G6KL 4PGBB 2EDJA 4X6FB 4CUCA 4P46A 2V17L 3HUJE 3X11A 3DBXB 3GDBA 1FN4B 4K3DH 5DDHA 4FFVC 3DX7A 3U6RB 3WIHA 4KV5F 4IBLT 4XBGB 1BX2B 1F3DJ 4UB0L 2WIIB 1VESA 3FFCB 3H42H 2MSPA 5C0AE 3BRFA 1NAKL 1CXKA 1C12A 1XIWD 3IS1X 1A6WL 2CDGA 1KEGL 3O3EB 2NW3A 1GPOH 3ULVL 3B2VL 2VUOA 1I1CA 4GFTB 3OJDA 1ACYL 4JHAH 4Y1AA 3OJMB 4GQ9L 1A6AA 1G7PB 2VLRD 3O4OB 3VWKC 4J4PA 3EOTH 2NCMA 4J1UB 5DJAA 2YK1H 5CSZB 3BRDA 2V9QA 5FA3A 1IE5A 1NDMA 3GHBH 4ZYKA 1PZUB 1MJ8H 1P84K 2V7HB 5IK3A 5J1TC 1CL7I 1IEAA 2HLAB 1P6FA 4PJHA 4XB7A 2A9MH 3L3OB 4UIKH 4BFIB 3QH3B 3BKCL 2IFGA 3VH8G 3ARDB 4XCNA 1DUZB 2R15A 2FO4B 3OJVC 4Z7OF 5F6HJ 1CGYA 3KS0H 3QDJA 5L2KE 2BSTB 3C8DA 5FYLH 4K9EL 3L5XL 3BWAB 3GNMH 3TYGH 3MOAL 1TMCB 3TO2A 2QTEA 1QSFB 3WCYA 3CLFH 1VPOH 2CKBH 5EU7C 1UZ8A 3QUXB 1A47A 1U91A 3CSBA 5L2JB 4X8JA 5D2LE 1D5XB 4MD0A 3QIWC 3ARED 5D1QA 4IRSB 1UXWB 1Z3GL 2DTML 2XWJA 3Q2CA 5EH1A 5HHMD 2VQ1B 4P5TC 4F2MA 1KNOB 4JM2A 4JVWA 3PP4H 4YDKH 2COQA 3P30L 3LZFL 4QY8B 4L9LB 5ID1A 2R56H 5TQ0L 1CDBA 2VDML 4JRXB 4FQJH 4GW1B 3O11B 5C0RH 4QKXB 3BJ91 4OAWB 2OQJB 5DC0A 5T5FL 4CVUA 1E4XI 4OGYL 2MPAL 1XGQB 3SE9H 3UXFA 5FM5M 2IQAB 3MRFB 4NNPL 3VFVB 2WUCL 1F11A 4P2RD 5I75C 4NZRH 4NO3B 4KTEH 1CXLA 5IFAH 4U1IB 1U8QB 3ORJA 5HYEA 2JELH 2H6PB 1JI1A 1MCBA 1E4WH 2OZ4L 1UADC 3O6LL 1LVEA 1QTYT 2DAVA 4PGDB 5GGSY 1EUTA 2EIEA 1IL1B 3DETC 1QBLH 1U8PB 4PJ5A 4Q6IC 5F1IB 4UV7L 1EV2E 1WZ1H 2BC4A 4KQ4L 3OAUH 4K3JH 5F44A 5IVXA 3EOAA 4IDJH 4ZTOH 4YFEA 4XWGH 3PQYE 1T66D 2FECI 3IGAA 5JQ6H 1KXQE 3HI1A 4OZHA 1FNFA 4EIZC 3VFTA 3LQAH 3U0PA 3CC5B 3ULUE 4Z0XB 1OAYH 1WJ3A 3RU8L 4N1HB 1CE1L 2PUQT 4D2NA 5KSAB 4DEPC 1NEZA 2DLFL 2YPLB 2ZUQC 4C54A 2P5WE 4KFZC 3TIDA 6FABH 2IH1A 3TPKA 1AQKH 4MDIA 1MFBL 1KIPB 2ICWB 1CK0H 3THMH 4P2OB 3TN0C 4ELKA 4UT6H 4M7LL 2WBKA 5GJTL 4YFLI 2Q7NA 1OAXL 3IXTB 4PRPA 4YPGB 5SV3A 4Y8AA 1RY7B 1RZGB 3IB4A 2DJUA 1NCDH 3HE7D 1NCCH 3NH7H 4F7CB 5IEHA 5FYKH 3ARGB 1JYWA 3UPCA 1U8KA 5ID0B 4LU5H 2B7DT 4IJ3C 4G3YH 5B21A 3MRMB 5EO9A 5CHNA 2BRRH 2Z8WC 3WFCL 3EYFB 2X4SB 4L8DB 2AKRA 2ARWA 4XVUD 1S9WB 4F58L 2E7MA 1DQJB 1QLFA 3KXFD 3D9AL 2H32H 4TVPE 1T4KA 1ZT1A 3CFCH 4GG8A 1S7RA 5BVJA 2R0KL 1S7QA 3P9LA 2DRUA 3P9MB 25C8L 4QYOB 2YUZA 4OI9A 1PX4A 3KJ4B 3N0PB 4FZEH 2E6JA 3L3GB 2QEJA 3DUHA 5A2JH 1TPXB 2ARJA 3P11H 4JHWL 3K4AA 1U92B 4OIIH 3EOBA 4QCIA 4O5LL 4BH8A 1V5JA 3BQUD 4MMZC 4OD3L 4HF5L 4M5ZL 1QRND 3ZDZF 3O4LD 1OP9A 4Z6AT 4E42B 4CU6A 4ONGL 1C08B 1V7MH 2IADB 4HIXH 3VXPB 3DO7A 1A0QL 1CU4H 5AG8A 4QHKI 3KVQA 4YR6B 1MHCB 1JPTL 12E8H 1E27A 1MREH 1DN0B 3FO9B 2IAND 4KTDL 4WIQA 4GRLC 4YIQB 1BBDH 2CK0L 5D2NB 5EZLB 3H9HA 3T3ME 3WLWC 4FQXC 1FYTD 5DUMH 3O0RL 1ZLWK 2GT9B 2X44D 3QBTB 4Y4FC 4N9GB 4U6HA 1DBJH 3TO4C 4JM4H 3QB7C 1AGCB 3S88H 5I1GH 3K81A 2V2WA 1KPRA 2WLYA 3LH2L 1AR1D 3PWJB 5MEOA 1U8NA 1VACB 2BVOA 4U0QB 3DX8B 2Y36L 4PJAF 3EGSB 4MSWA 5JTWA 1E28B 3X3FL 4RMQA 3QUMB 5H35B 1ZA3A 4L4TD 1YEEL 2YMXL 1P7QA 4YWGH 3FOMB 3RRQA 1TTUA 4X7TB 1JI2A 3ZYOA 4P9HH 2O5XH 5HHQA 2VRAA 3B6SB 1JFQL 3OR6A 4HWNA 3BDXA 3WEXB 5ICYB 4RWYL 5KSUA 5B38A 1UXSA 3IKCB 3QUYD 3MRDA 4HZLB 1VFMA 1BQUA 4R97C 1DZBA 5GQBA 1XH3B 5FYJU 3RVVD 3T4AB 1R24B 3BGMB 4N0UB 3GSVB 5JXAH 1BEYH 2XIDA 2VC2H 2W92A 3SE3A 1MWAB 3MGOB 1ZLSL 1FBIH 5CWSA 1SJXA 4TQEH 4Z7WE 4RFEA 1J0KA 3KPRA 5FUOL 2M2DA 1ZVHA 4KMTL 3P0VL 3DYOA 4U1HA 3ZDYE 2PW2B 4ZOCA 1INDL 1N4XH 4MGXA 5EB9A 2ZG1A 4NN7C 1NKRA 4WHTA 3CUPA 4N8VG 1MIEL 5DHYB 3FOLB 3R0MA 1MWAL 3VMOA 1I8MB 3KLHC 5FO9A 4MNQB 4N90D 1EXUA 3D39A 2CDFB 3WHE1 5IJVA 3LRSB 3B9KD 4JZJC 1S7SA 5D93B 2X4RA 5I73C 3U7WH 1FGVH 3G6JB 1T80A 4OIAA 2B4CL 1E0OB 3B9DA 1H3VA 5KSVB 1BWWA 4LIQE 4G6JH 2ATPB 4R4NC 1JF1B 2Z31B 3PDOB 3MFGB 1LK2B 1IBGH 3OR7B 1QLEL 4X99B 3K1DA 3P4OB 4QRPE 5JOPD 4I0PB 1CZ8H 2VZ3A 1MI5E 4NQEB 4JFYA 4QRSB 2OM5A 5TH2A 4O00A 4U05A 4JN1H 4Z0BL 4L5FL 4TSCL 4HG4J 1I1YA 5IM7A 1G6RB 1OQOA 1CQYA 2FL5A 4S1RH 2XQBL 4WUUA 3KPQA 3P77A 3T0XA 1HXYA 1OOAA 3D48R 4LSVL 1S3KH 2CK2A 1WCBB 1GC1L 2EH7H 3MNZA 4UQ3B 5C08E 5MENA 3BIBX 2ADIA 2BNUA 3AC0A 1G6RL 2R8SH 1MAKA 4P3DB 2VAAB 1ZT4A 3HNSL 2NNAA 4NQDB 2XPGA 3MRPB 4YHKH 3KS0J 2WIMA 2HVKA 3O9WD 3VFUA 4X6DB 4BYHA 4IRJA 1AQDA 1IGTA 1H3WM 4X9BA 2VDOL 5DD6B 4P23D 5IW3A 4TUOB 3VW3L 5ACMA 2WAHA 4NQXA 4OCYL 4XMKL 1UM6H 4AM0A 1AE6H 4AK1A 5K9OB 3GBMH 4ZUVB 5DJYB 3MLXL 4YO0B 2ZOLA 4IOIA 4ZTPL 4PJHF 1XR9A 3PHQB 2NXYC 4NQCD 5KS9F 5JW3H 4KKCD 3VG9B 4ZFFA 2HH0L 1K4CA 2NXZD 1CIDA 1D5MB 1NGYA 1JNLL 1D6EB 2GTWB 5JOFA 5LQBL 1T20A 3P3YA 2HN7A 2BSSB 1MPAH 5FYKE 3S34H 4HWBA 4EUPH 4FFVD 3HZMB 4NDMB 1YECH 1NC4D 1I7UA 1L7IL 1PLGL 1PYWB 3KR3L 1FRGL 2DS4A 2FIKB 1JWSB 4ODSH 2GCYA 2C26A 2J1KA 3T2NH 2RGSA 3OTTA 2VLRB 4ZOEA 2AABL 5F7UA 2YSSB 1MRDL 3F65A 3QULB 2FD6H 3VGBA 1EFQA 3AS3A 4JM2F 3NFNB 1BQHB 1AHWB 4OCWL 1FLRL 4OFPA 5CILL 4NM4L 4HSQA 4R7DA 4ODUB 2YD2A 5HYFA 4R2GD 3RY5A 2I27N 2VERN 3KLAA 4WFFD 1DUYB 4D9QE 3S98A 1R3IH 3QUZC 3A67H 4F7TA 4U1LB 2CXKA 1S7XB 3JBG7 4GW5A 1S9XA 4ZS6C 2DDQH 5B3JE 4W81A 3CVHB 3VXNB 4OLWL 4URTB 2R23A 1TLKA 1ZGLM 4LVOC 4JY5L 1KIRB 5I76B 1ZT7B 5SWSE 2QQQA 5HYQB 3AREB 2A0LC 3HR5A 5C0BE 4YXHH 3E1F1 5HHMB 2XNAA 2QLVB 3L3DB 4GAJL 4M7KH 3C09C 3FHQA 1IEBB 2PO6D 3CVHL 3ZDXF 3MNVA 4ENEC 5HYIA 3SCMA 2VZ1A 1U8OB 2APVA 1CFNA 2VZSA 4GKSB 5IVXF 1UB5B 1OB1B 2DBLH 4P5TD 3CPLB 4DVRH 3PV6A 2GSIB 1X4YA 2DL2A 1INQA 3GIZH 3KJ6L 2XTLA 5D1ZD 5HDBF 1X5FA 3LRHA 3LD8C 2HFGH 3QT2A 1KPUB 4FHBD 3KYNB 2N56A 1SYSB 4LSQL 4Q9CA 4QRRA 2VZUA 3C6SA 4MQSB 4UT7L 2VAJA 3FL7A 4G9FE 2HJFB 1PKOA 4G8GD 3NZ8B 4FMKA 3LSOA 4P2RB 4WTWA 5F7MC 4NC2B 2Y9RT 1WBZB 3MLYH 5MEQA 1VEOA 3NZHL 4M9OA 5ESVA 1DP0A 4U49A 4LPCA 5DMGD 4MQ7B 1JGDA 4OFVA 5CEZD 2YR3A 3K7UA 3NTCL 1N7MH 1NAMB 4ODVH 2J4WL 4O02H 4HIIB 2JIXD 1OY3B 1OWRM 3EDEA 4WGWB 5I71C 2OMBA 3PF2A 1D5BB 2WNGA 4YHLL 2CLRB 3SKMB 4HCRH 5JMOC 2YPVL 2GUOA 3H3KA 4W4OC 4CADB 2LU4A 1N64L 4Q9BA 1A4JB 2A38A 4LCCB 2MQ3A 1J0ZA 3RWFA 3PGCA 1T2XA 4UQ2A 3BWUC 3AMLA 3MFFA 4MA7H 1DQDL 4NZJA 3EYOA 3HNVL 4LSPL 2ZPKH 3QA3B 1F3RB 2XZAL 4K94H 1CGUA 4JR9L 2X9YA 3UP1A 3V4PL 4PJIE 3HE7B 3VXRB 3RI5F 3GSWA 4L1HA 5HJ3A 3S3JA 2UVFA 5HPMA 3RY6A 1CICC 4C55A 3VFWB 4MCZB 1CDUA 2ZG2A 3KXFB 3PWPA 5I1CH 4D3CL 4K07A 4OFIA 4NT6B 3ROOA 3LV3B 1EHLL 4WCYH 3RIFK 4JY6B 1N2RB 2Z91A 2DMKA 2CRIA 3CJJA 4LKXA 3AROA 4RMRA 5E0QA 5FCUL 5D70L 5DHXB 5FUCE 4YHYB 2BFVL 3DPBA 1A7NL 1TCRA 3MLUH 3T0EA 2YC1B 4HPOH 2KL6A 4NZTL 1J7VR 5AWNH 1WIOA 2DQJL 2A6JB 5JZ7C 1B0GB 2QR0A 4ZNEA 3UJJH 4AIOA 3ZKXC 1I85A 3GSUA 2BVEA 3VDAA 5DD1L 4IOSD 4X6CB 1IGCL 1CLCA 3BQUB 3S97C 4OLYL 1QRNB 1FNSL 4HZAA 4YDLB 3O4LB 5C9JB 5D7IE 3F7YB 5HI3D 1DLHA 1GHFL 3W0WE 3BOVA 1KN2L 2EE3A 4XVSL 1BZ9B 2FRGP 3Q5OA 1ZA6B 4KGLA 1YN6A 5C0CD 3U0TB 5CD5C 1E4XL 1EO7A 1FC1A 4XT1C 5FV1L 4OQTL 5I66B 4XP9L 2QSCL 4MJIA 2FJHB 2IANB 3MRKA 2E9IA 3U4BH 1HDMB 4WEUD 5GGQH 5ITFB 2XV6B 1P1ZB 2F54E 1OGAE 1S78C 3BKJL 2CKBA 1R5IA 1FYTB 3OKDB 4PLNC 5ITBH 3U9PL 3QFDB 2GJ6D 4BA8A 4WW1B 5K9JH 3O2WL 15C8H 5AZEH 4KRPD 5FAAA 4PUBL 3U7YH 3TVMA 4D9RE 2J8UB 5MEPB 3TO4D 4PBWD 3PIQB 5C6TH 4QXTB 1X7QB 3ZKMD 4IMKA 4RNRB 3K8LA 4OCXL 4XNUL 1BD2A 2IAMC 1C5CH 2QJDA 4L4TB 1MHHB 2VKWA 3KAAA 2QADC 2G2RB 4PTUA 5KBNC 3MSPA 3S3PA 1A6ZA 3UDWA 3VFRA 4WW2C 1M6OB 3DX9A 5HHPA 3DXAE 5CGMA 1P69B 2XKNB 1CDIA 3KPPB 4R7NB 4P46D 4JRYA 1W0WA 5K33A 1J8HE 4KVCH 4RMWA 1EIBA 1PEWA 3QUYB 2MCG1 3NAAH 3I6GA 3S35L 4HUUB 3ECBA 3GSXB 3E6FA 3NCYS 1M4KA 3DURB 3IJHB 1BJ1H 3LQMA 2R4SH 4GBXA 4OT1L 1BMGA 4P3CH 4JO1H 1MFNA 2OTUA 5DRZB 3BP4B 2ZUYA 3QEQA 1A3RH 1FP5A 1NCAH 2FGWH 1OSZB 2J6EL 4V1DD 2XTJE 4Z76B 1KJ2B 4LLVA 1INEL 5BZDB 1KV3A 1J86A 1XGTB 3MLZL 3I3EA 2FEDC 5DMJB 5HI5C 3SBWC 4Y1AD 1MCQA 3CXHK 2J12B 1ORQA 2P8LA 4J4PD 5HHOE 4NNYA 1KJ2L 4FN0A 3VXSB 4M4PA 1TTGA 3FHAA 4PLJC 2RFXB 3B8SA 4NSKA 2GY7B 3B9KB 2DYPA 3WMSA 3NBNA 3KLHD 3FB5A 3HMWH 3L95B 1MH5B 1NL0H 3Q3GA 4F9LC 3VXTA 4G6KH 2YUXA 3TNNA 2V17H 1F4HA 1I9RH 4M48L 4GS7B 4NNXA 5FXCH 4EVNA 3QDJD 1MCNA 3IDGB 3L1OH 5FGCE 5HGDB 4CU8A 4KZDL 3B2UC 3BW9B 2Z35A 4R4ND 4X80L 3WUWA 3BRGC 3U82B 1AJ7H 4UOJA 4JAMB 4YHNB 4AEHL 3RNQA 5KN5B 4PLKC 3VGAC 4UB0H 4AEFA 4GXVL 5E1AB 1ITBB 4MAUL 5E94A 1JE6A 1NAKH 1A6WH 1BJ8A 3ULVH 4OZFB 2OR7A 2OR9L 5M94B 5F89B 3TT1L 1YMMA 3GB7B 5B8CA 1LP9A 4GQ9H 1W0VB 4JM2D 3AFLA 5E6IB 4OKDA 1RUMH 3KYOB 2IMNA 3MCLL 5SWZD 3SKOB 3M17A 4LVNC 3O9WB 1BFVL 1BQHG 3PWUB 4JFEE 2IBGA 3VXME 1IGIH 1SJHA 4P23B 4UNUA 1FIGL 1Q0XL 3BKCH 5T3ZH 3ILPB 4K7PH 4FABL 3I6LD 3VRJA 4P5MB 4R96A 2IPTL 4R3SA 1KC5L 5CJQL 1N3NB 1ED3B 2GSGA 2YS4A 4NQCB 3FO0H 1FVEA 1AXTH 3CK0H 4U1MA 5JPNB 2VR5A 4AT6B 2NXZB 2A6DA 4H25A 1FNLA 2F74B 3RZCA 4JB9L 3A6BL 3HZVA 4F80A 4OF0A 4JPWH 3RI5K 3E2HB 3OHXB 4LF3B 1MVUA 2UWEA 2NLJB 5CP3A 3AS2A 4PJGE 5FDWB 1NC4B 4PJ5D 1H5BA 5EOTB 2DTMH 2QSQA 4G7VL 3S4SA 3SJVA 3C2SA 5TF0A 2CD0A 2VH5L 2FNBA 3BT2H 4DFHA 3W39A 4RMTA 5L9DL 3LZFH 2R0ZH 5TQ0H 3FQTA 4OFDA 5FCSH 2DWEB 3D0VA 5DRNB 4AEIL 1U2CA 5IQ9A 5SV4A 5D6CB 4Y4KB 3NFPB 4K23L 1QYGH 5CLTA 1IAII 1X4ZA 4F7PA 4ONHA 4BELD 1U3HA 1K8IB 2Y5TB 3WJJC 2BOBA 5DT1H 2MPAH 3DHJA 4R2GB 1G7JB 2G5BB 4EI5B 3GGWA 4LCYA 5CJ8A 5I1JL 1G9MC 4PRPD 4LAQH 4UV4L 2NW2A 4PJCE 1QACA 5E1HB 1DL7H 2OZ4H 4ZUWB 2ITCA 3F7VB 4PRDB 2VUYA 2AXFA 4APQA 3H9YA 3QUZD 1A6PA 3X14A 3BD4A 3C87A 3NIFF 4I4WA 5EIQA 3HRZA 2ZCKH 2KQMA 4ZS6D 3CX5K 1JZ2A 1CD0A 3MMEA 5DJXA 3TZVA 3X13A 5L8KB 1LEKB 4QRQA 4DKFL 3DSNA 1O7VA 3VXOA 2NTSP 2PO6B 2R1YA 3V6OE 4IHOA 4Q2ZB 2A0LD 3UJTH 3RU8H 1T5WA 4MX7B 1HHIA 3RJDA 2DD8L 1JP5A 4P5TB 1B3JA 1CLYL 4YAQA 1AXSB 1R3HA 2CGRL 4XPHL 3SKJL 2OL3B 2DLFH 4I3RH 3W5MA 4DUXA 2W0LA 1UH2A 5D1ZB 4G5ZH 3EYQC 1MFBH 5JHDE 1XF2B 3CSYB 3OKMB 1KLGB 2DQDL 4S1QH 3V8OA 4M7LH 4MHHI 5GISL 5GJTH 1RUPH 2X4OB 3HKFA 2OCFD 1OAXH 2ERJC 1JHTA 4M8QA 1HHHB 5IVZB 4G8GB 4PGCA 5EN2B 2DQEH 1I8IA 3B43A 1FNHA 2R29L 1DEDA 5A43C 4FA8A 1ZSDA 1NBZA 3I85A 5EO1B 1RMFL 5GGTL 3WFCH 3OX8B 4F58H 2PYEA 2AK4A 1DANU 1IQDA 5I75B 1OP3H 4ZD3L 3D9AH 1LE9B 5LAXB 1PY9A 3JV4B 1IQWL 4X8XA 1P9MA 3P73A 2NZ9D 1GGBL 3AXLB 2JE8A 4JQVC 2R0KH 1HKLL 2J5LB 3GI9L 3Q48A 1KUMA 4NRXA 1QLRA 4O9HL 2ESVA 4XH2A 5HYSA 5CEZL 2G75A 1TIUA 4J3UA 4NQUA 1ZHBA 3Q5TA 3P4MA 4TNVF 1IM9A 4O5LH 4OD3H 3KPLA 5GRUH 1CD1B 4L4VA 4NRYA 4RBPK 3QDGE 2VISA 1BGXH 2X2YA 4ONGH 1KGCE 1P7QD 3LKRA 4DQOL 4WHCA 5LG1A 4DEPB 4MS8C 1CIUA 1A0QH 1REIA 1SM3L 3AAZA 4ISVA 1MCPL 4F33B 1CFVL 3MRCA 4LNRB 1JPTH 2XZCL 1D3CA 2J8HA 3CIQA 2BVUA 3PABA 1ROWA 2B39A 4KTDH 4WNQB 4ZO7A 3PP3K 1FL5B 1I1AC 2CK0H 4Z78B 3G5YA 1I3RA 3BP6B 3GFUA 1S7WB 2HVJA 1QVOA 1U8HB 3O0RH 1WBYA 4AIZB 4EUPA 2ITDA 3GMPB 5FKPB 4XHJD 1MCOL 3T65B 5GGSB 3KPRD 2Z4QA 4PJAB 3P0GB 2P8PA 3LQAC 5CCKL 2D7TL 1DQML 3JV0A 1K5NA 5KVDH 4QRUA 1K85A 1W0YT 2Y36H 3ULVE 4YZFE 4UT9H 3FZUC 1IM3B 4HIHB 3J8F7 3HTLX 3X3FH 4UINL 1JPGA 4TSAL 3EHBC 5H94A 1BHGA 3IDMA 1YEEH 2YMXH 3D39D 5E8PB 1VERA 5GS2D 3FFCE 5JZ7D 1EUUA 5AUMA 5K9QG 3RWGA 4FNLL 1AGBB 5IV2B 1BJ1J 3R06A 4TOYH 3RWCA 1PKQA 1ITCA 1JFQH 2AEQH 4NRZA 5C0CB 3L7EB 1RHFA 5J9PA 3C2AH 4HFWA 1FDLH 4FXLA 3GMNA 4RWYH 4P5KA 1FVCB 4DWHA 5DYOB 4BK5A 3UEZA 1GGYA 2YBRA 4WO4C 4WGVB 2VN4A 5KANI 4O2CA 1C5DA 5I8CB 3WJLC 2FJFA 5C0DA 4OGZA 1KTDA 2N7AA 4KXZI 4PB0L 1ZLSH 3RWHA 3TLRA 1UVQB 3MJ7B 4F57L 4WUUD 2GJ6B 4XPGL 3WKNA 3P0VH 2VL5A 5H2BA 2MNUA 5FECB 5FGRA 3QQ4B 4GMSL 2Y25A 1BVZA 2FDBP 5FOBA 1INDH 4KRPB 4HPYH 5MEND 4YHZL 1MIEH 1T6VN 4I9WD 1CTNA 1JJUA 1JNNL 4ZUUB 1NMBH 5INDB 2ZP0T 3IFOA 3DRTB 1QSFE 2BNQA 2FWOA 1GOGA 2A6IB 3ZL4H 5LBSH 3O3AB 1AP2B 2JJTC 3IAGC 3V6FA 2PW1A 5IKCA 1HHGA 2B4CH 4W68A 1J05B 3IJYA 1B90A 3BZ4A 4I5BB 5BQ7A 2DM7A 1SEBB 2QADD 3V52L 3PWLA 1QLEH 4P46B 3STLA 4UI2A 1HHKA 3X11B 1WK0A 3DGCR 2EIDA 2EDTA 5DDHB 1MHEA 3V8CA 1OAKL 3DX7B 5E8NA 4JRXE 1MNUH 5IB1A 3O41A 4L5FH 4TSCH 3AS0A 4L3AA 3PHSA 5L7XL 4KHXL 3GM0A 3SO3C 4M3JA 4M43L 4V1DB 4LSVH 3QDAA 4OZFG 3WNKA 2X89A 5C0NC 1GC1H 1C12B 1NBQA 5JW4N 3GMRA 4M7JL 1UJ3C 4JPKL 5IIEA 2CDGB 4HCRA 1RJZA 3WIHL 5ETUA 1G6RH 3OJDB 1EO8L 4J3TA 4M1CD 3ZT6A 4Y1AB 1HE7A 5J13C 3HNSH 1A6AB 5C2BL 3CDFA 4NC1E 5FHAL 5DJAB 1U3HC 2FEDD 1PEZA 2AXJA 5HI5D 2KQNA 4OFKA 5FA3B 4C57C 3VGFA 1VADA 1NDMB 3B5GA 3BH9A 3GSRA 4GXUM 1LP9F 4AL8L 5IK3B 5F7DA 1IEAB 3KPNA 5FDYA 4P9HC 4PJHB 4IM8A 4XMKH 4PLJD 4XMLH 3QHFH 2LV4A 2BY3A 3WIIL 4PJ9C 4XCNB 5I73B 4ZTPH 4OTXL 4XAKD 2HH0H 1BBJB 3QDJB 5C09D 2DQGL 2MHAA 3SQBA 2VIRA 1B6DA 1JNLH 3EO0A 3H9SA 8FABA 3ZE0F 5I1EL 1Q72L 4LPUA 5BOZG 1BLNA 1EERB 5IEKA 3TO2B 1RULH 1U8JA 4MD4A 2YPLE 1MCRA 2GJJA 2XACC 1C8PA 1G7MA 1JGVL 2E8YA 2R0WH 1UZ8B 3TZVC 5LWYL 1U91B 3QIBC 1L7IH 4WJ5A 5K59E 3BZEA 1DSFL 5HI4C 4MD0B 1FJ1A 1FRGH 2PTTA 5D1QB 3LKSA 3FFDA 2XWJB 4S10A 2UWEF 5MHSE 4F2MB 1W8NA 1TFHA 1HI6A 4JM2B 5F8RC 2I60L 3SCMD 2AABH 3TA3A 5ID1B 3V2AR 4H88H 3FO1B 1IGML 4NHUA 1IILE 5F9OH 1BQLL 3W9DA 2QQKL 4KU1A 3O6MH 1ZHKA 4QWWC 4M62H 4PJFA 2Y07H 4TNVK 5HHXH 1XMWA 3VI4F 3MV7A 4HDIA 3F58L 1JPSL 1T2QL 3CVIL 4NWUL 4QRRD 1J0IA 1F11B 2X4PA 2FH6A 3EBAA 3FCTA 3QCTL 4H1LA 1D7FA 1DQQA 2NR6C 4LLDB 5HHNA 5IFHL 4OLWH 3C9NA 5DMKA 4KJPC 4POUB 1F6LL 5FO8A 4KKBD 3MRHA 3N9GL 4LPWA 1FFQA 4RGOH 4PJ5B 2BC4B 5EIVA 5IVXB 3EOAB 4GAJH 1ZOXA 2AJYL 3IGAB 1J0YA 3ILQD 4BKLA 4CN1A 3CVHH 1JRHH 2LTQC 3PXHA 4J6RL 3HI1B 4OZHB 3GSNH 3Q6FA 4TRPH 5ESQA 3VFTB 1YYLH 4XNXL 3U0PB 4UTAL 3QQNA 4XNMA 1JPFA 5GSRA 3FQUB 5D2NE 3KJ6H 4GKNA 2Q86A 1NEZB 1NFIB 4PJ7E 2FB4H 5T1MA 4J3OC 1KCLA 2IH1B 3PE9A 4MDIB 1AH1A 4RRPA 3V5KA 4JDVA 5HVFB 1GGUA 4ELKB 2X70A 2IPUK 1I4FA 3BPLC 4L3CA 4PRPB 5C1MB 2EDRA 5IEHB 5BMFL 5FYJH 1U8KB 3NZHH 3BPNC 2ZSVA 1V3KA 2XN9A 5EO9B 4UOW0 5CHNB 2ZCLL 3NTCH 3EO9L 1JWUA 2AKRB 2J4WH 5K93A 1A9BA 2W65A 3MXWL 1QLFB 3PWPD 3OZ9H 3HC4L 1T4KB 1ZT1B 2VXQH 4YHLH 4GG8B 1MJUL 4KGJA 2YPVH 1S7RB 5GHWL 5BVJB 4N0FA 4QTIH 1S7QB 3P9LB 1N64H 4KVNL 1CDCA 1NCWH 4LVOB 3VA2C 1NBVH 3DARA 4NN6C 3T0ED 5I1IL 1MF2L 1FFPA 1UWGL 2ARJB 4RQQA 4FQCH 3QCUL 4LSPH 4N0UE 2H1PL 4WV1A 4FXGA 5AAWA 1ZGLA 4N0RA 3EOBB 3O45A 4QCIB 4BH8B 2PKDA 4XGZA 5CJBA 4ZAKA 2XZAH 2IGFH 4WFGE 3KNBA 4KDTA 1CL7H 2QL1A 4PJDA 1PBYA 3V4PH 3ARUA 1YEHL 5E8DL 3EYQD 3LEVL 5FM4A 2EEDA 3DO7B 1N6QL 4ZQKA 5F9AC 3DNKA 2XTJC 3QNXA 3HC0A 5EO0A 3X17A 1JWMA 1IGJA 3ET9F 5FYLD 4KUCF 1E27B 4MJID 4RFOL 1A7RL 3WO4B 5KAQF 2OXHA 3ZTNL 4D3CH 2ZUWA 3H9HB 3G6JE 3NIGE 4Q9RH 1FORL 2Z93A 5BVPL 4OCSL 1C1EL 2DQTL 3FMGH 3K1KC 4U6HB 3TBTA 4TUJA 5FCUH 2BFVH 2V2WB 1A7NH 1KPRB 2DICA 3RTQA 4B53A 5EC1A 1ETZB 4H8WL 5L2KA 1U8NB 2CO7B 2W9LA 4LLYA 1UJTA 4NQEE 4NZTH 3TVMD 2BVOB 4PY8J 5GJSH 2DQJH 5ACLA 1RZKH 4HJJH 4RX4D 3WSQH 2D9QB 4MSWB 5EU5B 1IGCH 4KROD 4OLYH 1ZA3B 1FNSH 1URLA 4FMFA 1GHFH 1P7QB 4Y7MA 3MRRA 5LGKA 5B22A 1E6JH 5JW5A 4OF5A 5IHBA 5DFVD 4XVSH 1IAIL 3O2VH 2VSCA 5GRZA 1G84A 5HHQB 3GJFA 4KKNA 1E4XH 3A0OA 3OR6B 1U0QA 3SKNA 4JRYD 4OQTH 4LHQB 4XP9H 3K4ZA 2QSCH 5KSUB 4L9DA 5B38B 1UXSB 4NQDE 1P2CA 2HRLA 4FFZL 5GSVA 1G9NC 3SDXA 1OTSC 2AQ1A 3MRDB 3BN9C 3RPIA 3VFPA 1WEJL 4KRMB 1T6WA 5AZ2H 5ANMA 5F88A 1OM3H 3HB3C 3RL2A 4YXKL 3U9PH 3IXAA 5EU3A 4HUXA 1I1AD 5CWSB 3JWDL 4RFEB 4X83A 2F9BT 1T83C 3KPRB 2DQIH 4JRWA 4XP1H 4KH2A 4LFHD 1BFSA 4PUBH 4LRIC 2PETA 5I8EB 4JEGB 4TPRL 1F2XK 4DOHB 3VXQA 4WHTB 3CUPB 3I9GL 4LHJB 1GYAA 4NUJA 2QSTA 3C08L 3NVQA 5FO9B 4BH7A 4OCXH 2ZG3A 4XNUH 1EXUB 4EBQL 2D31A 4K8RH 4D94A 2Z8RA 3D39B 4EKXA 3QPXH 5IJVB 4QHNA 4Z77A 1G6VK 2DYPD 1JN6A 4ODHL 1S7SB 2X4RB 3UYPA 3EHBD 4YBLC 3WLBB 4WRLA 5I16A 5D5MA 1QSED 4XWOC 1MJ7H 1EK3A 4MJ5B 4WFHD 4YBHA 2P49B 2VLRE 4HC1H 4Y4HC 1F8TL 3RDTA 5DWUL 3S35H 1NGXB 1VEPA 2CR6A 4JFYB 2VR4A 5IBTL 1CGSL 4N5EC 2XOTA 4OT1H 1A21A 2XWBA 5I15L 5IM7B 1I1YB 2P5WA 4WTZA 2J6EH 2FL5B 4F37F 1EHAA 2PYFA 4WUUB 3KPQB 3P77B 1HXYB 4WI8A 1EFXA 1NJ9A 3MLZH 3SQOL 3C60A 3MNZB 4C56A 1AI1L 5MENB 1PY4A 2ADIB 4KRNA 2BNUB 5T1DL 4NP4L 1OLZA 1KJ2H 1ZT4B 2D03L 2NNAB 2Y4SA 4IS6A 2XPGB 3NCBB 5CAYB 5CZXC 4PBXA 5JHLL 2HVKB 3RQ3A 3VFUB 4NZUL 1AQDB 1IGTB 2Y6SC 5J89A 3VMNA 1HXMA 1YEIL 2AJUL 4L8CA 4MYWB 4PR5A 4NQXB 4AM0B 5HHME 4LMQI 4S2SA 4M48H 1DFBH 1IAKA 2ZOLB 4IOIB 3H7BA 2NY7H 4KZDH 3RWEA 2Q7YA 1RIVL 2AK1L 4JPIA 1K4CB 4X80H 3RZCD 1NGYB 1HIML 4NQSA 4U3HA 5KTEL 3WUZA 3EYVA 2EYSA 5JOFB 1T20B 5ALCL 3QXAA 4GXVH 2HN7B 3JWOL 5ALBH 3VMPA 1RURL 3ARPA 4X4ZA 1JYXA 4LPYA 4RA3A 1I7UB 2OR9H 3LIZL 2VB5A 3VJ6A 1PG7X 1W8OA 1X5LA 2VLKE 2GFBA 4P2RE 1YJDC 1C7SA 4FQ1L 4LSRH 3SJVD 4LQFL 2GCYB 5CEXA 4QHLA 3VFSA 2Z0BA 4IMLA 4NKIH 5C0ND 4HWBL 4BQ9A 3MCLH 3OF6A 2GJZA 1B88A 4RISL 1OAZL 4IOFD 1YUHA 4OZFH 3QDMA 1RZ7H 1KFAH 1BFVH 2NY1D 3RUGE 4KK5D 1FIGH 1Q0XH 5DMIL 1U3HD 5GGUA 4FABH 4N8PA 4R0LC 4R7DB 1E6OL 4PJ8A 3JWNC 1KC5H 5TFSH 5CJQH 4HX1A 2ED7A 4HUMB 3KLAB 5D4QA 1BIIA 3C5JA 2FZ3A 2ZNXA 1Q9OA 2FJGA 4PJFF 5J11C 4HT1H 5LGHL 1CG9A 5E2UL 2YA2A 4F7TB 4JB9H 3TT3L 3T0WA 5TF1L 2K1MA 3Q6GL 4GW5B 1S9XB 4X4YA 2Y1VA 2XYCA 5D71L 4APQD 4HK3N 2R23B 3CFJA 4JDZA 4Z18A 4UIMA 4XTRD 4Y5XA 3I6KA 4DZ8A 4EZMA 2E5EA 1JF6A 1OW0C 3HR5B 3TZVD 2XNAB 1NLBH 3UYOD 3LN4A 2VABA 1UEYA 4MA3A 2ZSWA 3OXRA 3MNVB 2HMIC 1QFOA 3SCMB 3WXVH 2C1OA 1CFNB 3HNTL 1KYOJ 4AEIH 3REVA 4LSTL 4M61A 5IHZA 3PV6B 3O8XA 1NEZG 4Q58C 1INQB 4JY4A 4XC1L 1RU9L 2WBJA 2CKNA 3DUSA 3F6LA 4NKQB 4K7PY 1KN4L 4LVNB 1EEYA 1MLCA 2J88H 3T0BA 4QRRB 5I1JH 4QWWD 1I8KA 3C6SB 5JIHA 4CMHB 1GH7A 4DCQA 5IOPA 4UV4H 3LSOB 4HKXA 3E3QE 4PGZA 3BKYL 3IDXL 3CFBA 5MEQB 2AGJL 5ESVB 4LLWA 2AK4D 2WW8A 3WFDH 4X6CE 1JGDB 2AEPL 4P48A 5GGVY 1QRNE 3FQRA 1JGLL 5IT2H 3O4LE 1CGWA 3ULVC 2HT4D 3IU4L 1P84J 3RX7A 1X5XA 4LK4A 3FRPA 3AY4C 5MP6L 3X3GL 4YDIL 2GUOB 2ESVD 1V8HA 4NJAH 4QT5A 3HI6L 3JUYA 2D0FA 4XPFL 1IGFL 4EXKA 2IANE 3PGCB 1EGJH 3E8UH 4UQ2B 2CGRH 3MFFB 4Y88A 1IM9D 3EYOB 2ICEA 1NGWA 5E08L 1FYTE 3O4OC 5ELIA 5CZVL 4MA8L 5F3BA 1RV6X 32C2A 2EO9A 2P5EA 2E9BA 3OPZH 1MCIA 3V7AG 4KUCD 4K9EC 2VXSH 3C8KA 1MCFA 1QUNA 5C08A 5DLML 1KB5A 2J8UE 4YHIA 4GO6B 1LMKA 3R1GL 3ARDC 3TBYA 1RHHA 1OHQA 2ADFL 3GSWB 1OF2A 4PJDF 3RA7H 5HJ3B 1HYSC 4L4TE 5HPMB 3VDCA 4F3FA 1IQWH 3PWPB 3P2TA 5C6WH 3ROOB 5M95B 3GKWH 4JFHD 2IALA 4HXAL 3H9ZA 5DVNA 4XCEA 1CN4A 1QPPA 3GI9H 4NCDA 2Z91B 1N0XL 1T89A 3QUXC 1W2KT 4LKXB 1XGPA 4RMUA 1TCRB 5C92A 4LCUA 1K8DA 3T0EB 3N50A 3VXUA 4KTYA 2B2XL 4IRSC 2LAAA 2QR0B 1PW3A 1HSAA 5CIPH 4L9LC 5BV7H 5FFLA 3GUTA 1X5GA 2B1AH 2ORBL 1DLHB 3K80A 3VE0A 4UBDD 3RDTC 1RIHH 3GKZA 1SM3H 1MCPH 1YN6B 2YXMA 3RBGA 3OWEA 5EUOA 4G9DA 1OT1A 5B38G 2H9GA 1MJ8L 4KI5E 4N90E 4MJIB 1IC7H 3N1GC 3MRKB 4TYUA 3DRQA 2CR3A 3W81A 2OSLA 4QF1A 2FBJL 2M26A 2UUDH 3DV6A 2CKBB 4GJTB 5JXEA 1R5IB 3C60C 4GAFB 5K9KA 3U0WL 1Q0YH 4KKLD 1WWCA 3SDXF 1KLFA 5CCKH 1G7QA 4KV5E 1DQMH 3EOYG 4HWZA 1IKNC 3MV8D 3TYGL 3K8KA 4TULH 4LDEB 5JOPE 2BSRA 3CLFL 2AW2A 4QEGA 3TVMB 3ZE2F 3BUYA 4LQ1A 5JIPA 3WD5H 3FONA 5J8OA 4XNYH 3ZLQC 3EYUH 4PLOB 2BNQD 2DBJA 4XP4L 1ZVYA 5DFTA 4BSJA 4KROB 2APWA 1BD2B 5I30H 1DANT 2H8PA 5CBEA 1Y6KR 3MRLA 3QQ3A 3TBWB 1A6ZB 1ZK9A 3VFRB 1KIQA 5KSAC 5SX5H 2CRMA 3PP4L 5SWSA 3DX9B 4HUWA 5M7QA 2R56L 4JRYB 1W0WB 4P2OC 2E9JA 3EW3B 2F15A 5E5MA 4XXCA 1AGDA 3I6GB 4LGPB 5D5MF 3V6ZA 3ECBB 3E6FB 3ARGC 1MFAL 1GRWA 5HPOA 1XF4A 3QEUA 4GBXB 4Z7OE 4PB0H 35C8H 3SE9L 3V0VA 2OTUB 2EIZA 5A2IH 1DCLA 4Q9QL 4XPGH 1I1AB 3U1SH 4LLVB 3LPGA 3MA9H 2X89D 4GMSH 3H6JA 1HINL 1OP5K 4XZUA 3AGVA 5BW7C 1WBXB 1Y18A 4X7CC 4NQCE 4PYGA 4G8IB 1JNNH 3GSNA 1ORQB 5C2UB 2P8LB 4LVEA 5GS1A 4NNYB 4HIEA 1G7IA 1QBLL 3KJ4C 3MLRL 1WZ1L 3OAUL 4HUNB 4NSKB 3SKUD 2DYPB 4XWGL 4QHKJ 1ULVA 4JGJA 4KY1H 5C3TA 3FB5B 1FL3A 5A3IC 1B4JH 3Q3GB 3LQAL 3VXTB 2E6PA 2VLJA 3RVTC 3TNNB 1QSEB 3EJYC 3UO1H 1UZ6F 3MUZ1 4NNXB 3OGCA 4Z7QF 1UCBL 1OAKH 1J10A 2XKSA 3H9SD 1RJLA 2Z35B 4XWOD 1U8MA 3WUWB 5ICZA 5DURD 5AAMA 3THML 4M9PA 3RNQB 5L7XH 4KHXH 1FCGA 5TDOB 3X12A 3MBEA 3MZTA 5J57B 4FQ2L 5F7YC 1HHJB 5E94B 4R9HA 1AGEA 4N5ED 1NCDL 1NCCL 3NH7L 5D2NC 4OB5L 2HFFA 4WFFE 1CFQA 3KYAA 4G3YL 2B20A 1EO8H 1YMMB 3HZYA 5B8CB 1LP9B 4XI5D 3KPOA 1XFPA 4K3EL 4FG6C 2XY1A 4BUGA 3TA3D 3Q1SH 2H41A 3PV7A 2EDKA 3M17B 4AL8H 1D6VH 5D6DC 1M7XA 1A5FL 5F7HA 1SJHB 3LRGA 4JGUA 3GBLA 1G1CA 1BM3L 2FYYB 3MV7D 5EU7E 3WIIH 4FZEL 3VRJB 4R96B 2K3TA 4R3SB 4ERSL 1XF3A 3F5WA 2AJ3A 4PD4K 3P11L 2DQGH 2GSGB 5E95B 4L3EE 1FVEB 4U1MB 2YZ1A 5FO7A 1EH9A 1Q72H 2A6DB 2E27H 4H25B 3RVWD 3RZCB 3BO8B 3ZHDA 3GK8L 3WS6A 3HZVB 2ARJQ 2FX9H 1V7ML 1JGVH 5FHBL 5LWYH 2A9NH 1MVUB 2UWEB 5DJ2A 3DI2B 4EQ2A 2VDPL 1H5BB 1U3JA 4G8GE 12E8L 2ADJA 3S4SB 3SDYL 3SO3B 5IG7A 3SJVB 3HMXH 4W4NA 5FM8A 1ZHNB 2I60H 1BBDL 2FEEI 3W39B 1MCCA 1FZMA 5F21B 1JNHA 2OLDA 3FQTB 5CEZE 1EEZA 3C5ZA 4LP5A 1YEGH 2F54A 1BQLH 1OGAA 2NY1B 5IQ9B 4DW2H 4OLVH 4JM4L 2B4CC 4F7PB 4HXBL 4ONHB 1U3HB 2DI9A 4QTHA 2ZUXA 3F58H 1JPSH 2BOBB 4NWUH 3GI8H 3UAJC 3GGWB 4LCYB 3SGJA 5D93C 5FB8A 3MLVL 4PRHA 3TCLA 1UB6A 3G6AA 4XP5H 4E9LA 2K7PA 5L0QB 2NTFA 4GKOA 4YHMH 4GAYA 3KWWA 2FGZA 3O81A 4H5SA 2XN9D 3D6GA 4YWGL 5IFHH 2ITCB 3ZDYF 3D3VD 2AXFB 4APQB 1DN2A 4WDIA 1GC1C 3X14B 3MYZA 3BKML 2RIKA 3OMZA 2F8XC 3GJFK 4I4WB 3HRZB 1PQZA 3RX8A 5EU4A 3TYFA 3DXAA 5I1LA 4XCCH 3MJ9H 3W11D 3MMEB 5DJXB 3TZVB 1A1NA 3UTTA 3X13B 1G0YR 1FG9C 1RZIA 2VXVH 4QRQB 3C5SA 3VXOB 2R1YB 1A7QL 4IHOB 4UTAH 4Q0XL 3QXDA 5GRVK 3BEWA 3CFDB 4M00A 1BZQK 1BEYL 1T5WB 4QLRA 4X7FC 1HHIB 5E8OA 2D9CA 1WZKA 4TQEL 2RJMA 5IJKA 4PFEA 1R3HB 3U7AA 5JR1L 1XGYH 1F02I 1SJEA 2V5YA 2BDNL 2DLGA 4ZAKD 1MCJA 1N4XL 5CS7A 1YEFH 3QZWA 4PJAE 4YC2C 3BAEL 3VGEA 1JHTB 3HI5H 4FXKA 4NFCA 4M8QB 4M7ZB 4LAJH 2D7QA 5ERWA 4XRCA 4PGCB 3I50H 5BMFH 1I8IB 4U1NA 5DJDA 4JKPL 4HC1A 4J8RA 1ZSDB 1NBZB 3VWJA 2DB8A 2L4OA 2ZCLH 1X5YA 5J3HD 2GTZA 3EO9H 5GZOD 2PYEB 2AK4B 1FGVL 3VG9C 2DIBA 3HC4H 1Q9KA 3VA6A 3QO0A 3BD5A 2QHRL 3CDYA 5HBBA 1U93A 3P73B 1MJUH 5GRJL 3CU1A 3QNYA 4ZUSA 2EXWC 2C9AA 5GHWH 4TTDD 4U1GB 4NRXB 1QLRB 2ESVB 4XH2B 4WI2A 5HYSB 2GW5A 3WXWL 5DEZA 3RTQD 2G75B 3QUKA 4JN1L 5L2KD 5I1IH 1MF2H 2QQNH 1UWGH 3IJSB 3SGKA 3UTQA 3P4MB 3MGTA 1FV1A 5JNYA 3QCUH 2H1PH 1IM9B 1I7TA 1MEXL 5BJTA 1NC2D 3KPLB 2EE2A 3WNLA 4CL7A 2ZKHL 4L4VB 4NRYB 3SDDA 2GJ6E 5J0BA 1QFUH 2VISB 1RFDH 3LKRB 4JFOA 4DGVH 3HR6A 3CSPA 5T3ZD 5IROC 2WP3O 4JQXA 1JYNA 1K3IA 4CMMA 4XXCC 1N6QH 4CU7A 3AAZB 4ISVB 4HFUH 3MRCB 4CJ0A 2X4TA 3V5HA 1RIUH 4RFOH 3PABB 1A7RH 1QQDA 3INUH 3N85H 1GZPA 3FRUA 3ZTNH 1U41A 2DI7A 3KYKH 5IW6A 2P45B 3G5YB 1I3RB 1UM6L 3BPNB 1AE6L 2HVJB 4JFEA 4WEMB 3VXMA 1QVOB 5EUOF 1WBYB 1QZ1A 2LU7A 5BVPH 3SGEI 4EUPB 2ITDB 2X1XR 2DQTH 4I8DA 2MFNA 4HEME 1HILA 2HKHH 1I7ZA 4HQQH 2Z4QB 5EZJA 2YN3A 1F2QA 2P8PB 1VB9A 4H8WH 1B0WA 3P0YH 1K5NB 3FN0L 4QRUB 4FTVA 5L8LB 3AREC 3S34L 4OKVA 4EIGB 1LEGA 2I24N 3W9EA 1AXIB 1JPGB 2RBLA 5E2TH 4NN6B 3IDMB 4OM0H 4FFWC 5T3XL 3C6LA 4X7SL 4V1DE 3RGVC 3EDFA 5HYJA 5AUMB 3D25A 4PJGA 3RWGB 2EKJA 4CKVX 1IAIH 2F5AH 3R06B 2JJWA 3RWCB 1PKQB 1BF2A 5JO5A 1KXVC 3CU7A 5J9PB 4Y1AE 1IEHA 3GMNB 4P5KB 2QV2A 3RDTD 2E9WA 1JK8A 3D1MC 2YBRB 1WEJH 5HGHA 2VWEE 3P4NA 3V7MA 4O2CB 4U1JA 5I8OL 1A4KA 1C5DB 4K71B 4CVZA 1L9MA 1AKJA 2QHLA 2FJFB 5C0DB 4MZ3A 4PJHE 3DLQR 1KTDB 1ZWIA 5KS9E 4MQXC 2P5WD 3RWHB 3JWDH 1EJ6A 4I18A 1KLUA 3IF1A 3NACL 4R4BB 4LFHG 2VL5B 3A67L 5H2BB 3C60D 3MV8B 1SMOA 4C56D 5FOBB 5JW4Q 2QQLL 1MOEA 3QDJE 1QRKA 3G9VA 4POZD 5T1KA 1BF8A 2DDQL 1WAAA 2PXYA 4OCRH 3IFOB 2VXTL 2XRAL 3BP7A 5EZOH 2BNQB 1UA6H 4EBQH 1MFEL 4LCCC 2W38A 1ZANL 3Q5YA 4PRAA 5EOCH 1J11A 3V6FB 1RK0A 2FH8A 4M7KL 4WI4A 5IKCB 3E6HA 3LPFA 3CD4A 1HHGB 3IJYB 4DJMA 5BQ7B 1X5ZA 3TBVA 3PWLB 1T0NA 5IUSA 3RVXD 4DVRL 1HHKB 3WS6C 5DWUH 4EOWH 1U42A 3UTSA 1GGTA 5DGRA 5SWZE 1T03L 1MHEB 5A2KH 3WUWG 1CGSH 4HUKB 5E8NB 3HE7C 5IB1B 3O41B 1AD0A 5I15H 1AC0A 1XEDA 2OMNA 2KH2B 4QOKA 1T04B 1T7ZA 3ARRA 5KSBA 3I6LE 3ARGD 5HVHC 3SQOH 3F7PC 4CBPA 1H8NA 3GMRB 1MRFH 5KVFL 5IIEB 1ZLVK 1RJZB 5ETUB 2UVEA 5T1DH 1RVFL 4NP4H 1HH6A 4Z9KB 2MCPL 3OF6D 2D03H 4O02L 1EGJA 1UM5H 3WFZA 2FATL 4YHYC 2H3NA 1B2WL 4RBPH 3QDMD 3BPOC 1VADB 4NZUH 3BH9B 3E3QC 3GSRB 4HCRL 4YGVA 5F7DB 3ZDXE 3KPNB 4PJ5E 5D7JA 1F45A 4LARL 5IVXE 4PJ8D 2OJZL 3CH8A 4YDLC 3SE8L 4MA7L 2DN7A 3BI9X 1RIVH 2AK1H 1DE4A 4NO2A 5HDBE 2JK5A 5IMKA 2AJSH 2F53E 2OYPA 1YYML 2MHAB 3PP3H 4X6BA 1XZ0A 4XP6H 2VIRB 5IVOA 5J1AA 1HIMH 2ZPKL 3EO0B 3H9SB 2MWCA 8FABB 2R1XA 3MQIA 1F4YH 3MO1A 1BLNB 3ESVF 5DURB 5IEKB 5IBLC 1U8JB 4K94L 4MD4B 1FZOA 3I84A 3ARSA 4ODWA 3GIVA 1G7MB 4U1KA 1RUQH 3O3BA 5CINH 1QHPA 3LIZH 4GUPB 4WJ5B 2R9HC 2NYYD 3BZEB 1F3JA 1FQ9C 2AJVH 3S4SG 4PRPE 1FJ1B 1OTTD 4NKMA 3LKSB 3FFDB 5IJKC 1HI6B 5LXGL 3HFMH 1GL4B 4RISH 3D85A 1OAZH 2E7HA 4U6VL 3TA3B 3WN5A 1VENA 2JB6A 2Z8SA 3AS1A 4NHUB 5KZCD 1Z9MA 3O8XD 4PRIA 3S8WA 3GSQA 3W9DB 4M6NH 5CIPA 1ZHKB 4FG6D 4PJFB 2V5MA 1E6OH 2ZUSA 3MV7B 1FAIL 3ARBA 4HDIB 4PGBA 2R4RH 1FZKA 4R26H 1CGVA 3VWJC 2NY2D 4J23A 3KDMA 5LGHH 3UJJL 5F71A 3W2DL 2X4PB 3BPCA 2Y72A 1V7NL 3FCTB 1U2HA 1RZFH 3UCRA 4H1LB 3TT3H 1DQQB 3BISA 4NO5A 4BQ8A 3Q6GH 3CXHJ 5D71H 2WZPD 1U3YA 4XC3L 5HHNB 3C9NB 3QUYC 5DMKB 4L1DA 4XAWL 3CZJA 1GIGH 2NX5A 5FO8B 4PJXA 2KUTA 3MRHB 5IGXL 4KXZH 2N1KA 2D0HA 5DK0B 2G9HA 3ULSA 3QI9A 4BKLB 4WI7A 5GGQL 3M8OL 3Q6FB 4NKDA 5ESQB 3V4VL 3OKEA 3TP4A 4ZFOA 3HC3L 3FO2A 5DJCB 3O6FA 4XNMB 1JPFB 3SDDC 5GSRB 4HLZH 2WP3T 3EJJX 3NCMA 4GKNB 2VZOA 1RU9H 3FT2A 3L3IA 15C8L 1T7YA 3O2DH 2VDQH 2AXGA 5D1XA 3QH3A 5E4IA 4HLJA 5A16A 2VQUA 4TNWK 5T1MB 3U30B 3CFEA 2KBGA 3F62A 4TN9A 1NCBH 2P5ED 3V5KB 4JDVB 3U7YL 3MJGX 4FFYH 3MRBA 2X70B 3DX6A 4MNQD 1I4FB 3SE4C 4L3CB 5C08D 1SBSL 3IDXH 2XA3A 3PDGA 3KHOA 4HS6A 1C5CL 2AGJH 1UM4L 3HN3A 2ZSVB 3QEGH 2XN9B 4GS7C 2AEPH 5J11B 3BGFB 1JWUB 2W1NA 1A9BB 4OLZL 2W65B 5ENWA 4ZOAA 4YFLF 5ESAA 3X3GH 5HGBA 4ZFGL 4N0FB 5HYSG 1PSKL 4LVHB 3DIFA 3HI6H 4EJ1C 5F1SA 4XPFH 1UYWL 2R4SL 1FFNB 3B4NA 4QY8A 3ZO0A 3VXUD 1NCAL 2FGWL 5FM5O 1IT9L 1FFPB 5F97E 3VD9A 5E08H 4C4KT 4RQQB 5CZVH 1N6UA 1EHXA 5E6IC 2VE6A 4WV1B 4FXGB 1ZGLB 3O45B 2JTDA 2C3XA 4XGZB 3CH1A 3I2CL 4ZAKB 3KPRE 4UNTA 3H0TA 3O9WC 3KNBB 5KAQG 4PJDB 2NY3D 4P23C 5E8EA 4DOHE 5KVEL 4ZQKB 3H8NA 5EO0B 3QNXB 4AH2A 3WNPA 1JWMB 3G5ZA 1IGJB 1FYHB 1NDGA 4ETQA 2XT1B 4MA1C 4LCWA 3HMWL 1KCVH 4KI1A 4N8CH 1FNEA 1G0XA 4I18C 2NXZC 2A73A 2Q8BL 3EFDL 2XQYG 2K7QA 4EUPG 4HXAH 5JXED 4JKMA 3QQ9D 2Z93B 1I9RL 1KYOK 3E2HC 1N0XH 2AEWA 1MRCL 1BFTA 2XXMB 3L1OL 1P7KA 1ND0A 3TBTB 3NCFB 4TUJB 4DFIA 2IQ9H 3NA9L 3RTQB 5EC1B 2EXWD 1AJ7L 4FOMA 3MJ6A 5L2KB 4LLYB 4E41A 2B2XH 4U3XA 3I02B 3S7GA 1QR4A 1Q94A 1NC2B 3DVIA 4WUUE 2MKWA 4H26A 1JYVA 1U6AH 1TXKA 2B5IC 1RK1A 2ORBH 2FX7H 4G8EA 3QIUA 3SY0A 2HA1A 3SGDI 3MRRB 2V9RA 1FO0L 4Y4KC 5JW5B 1U3ZA 1QBMH 3PWVA 2W0PA 4X9HA 3ZYIA 4RMSA 1RUML 3CX5J 4M6OH 5MENE 5D72L 4BQBA 3GJFB 4I9WE 1F4XH 5J4MA 2MKLC 3MNWB 4KK6D 4QXGH 2R39A 4R2GC 3SKNB 1D5ZB 4EI5C 4PJGF 3MRMA 1X5IA 3M45A 3T8XA 1IGIL 1P2CB 5GSVB 3SDXB 5T3ZL 1T3FA 2Q6WA 2FBJH 3VFPB 4K7PL 1KJMA 4JFQA 3U0WH 5ANMB 5F88B 3RL2B 1JMZA 1RI8A 5AEAA 3QYCA 3IXAB 5EU3B 4Z7VA 1Z2KA 2A77H 4M8VA 3FO0L 3CK0L 1AXTL 2Z92A 4NKOA 4BQCA 1Z9SA 5EOCJ 4OCMC 4CN4A 3HMXA 2BZDA 4JPWL 3PJSA 1Q9LA 1V3JA 4NUJB 1T1WA 4XP4H 5GGVL 5DQDL 5AD0A 2PO6C 4BH7B 4LOUD 2D31B 3QDHA 1SYVA 1WAAF 4QHNB 4Z77B 1JN6B 2DMBA 3BT2L 4LKCA 4CJ1A 4FFWD 5D1ZC 5DQ9A 5D5MB 2IBBA 2R0ZL 2VLJD 5IMLA 1NBYA 3RGVD 4RDQF 1RJCA 4KHTH 5GRYA 2L7JA 5IHUL 3RDTB 1KJ3L 1QYGL 1I7RA 3T0VA 5FYJD 4QXWA 3QISA 1MFAH 3QG6A 5DT1L 1U58A 2XWBB 5EOQH 4PJ7A 4Q9QH 2WBWB 1QNZL 2I9TA 3MBED 2C1PA 2CQVA 2P5WB 3KYMB 5DMGC 1L0YA 4LAQL 5SWQA 1FFOB 2YD1A 1EFXB 5E99H 1HINH 2ADGA 1NJ9B 5E6YA 3ULUL 2AXHA 3MJ9A 3C60B 4C56B 3BIAX 4MQXD 4J3WA 4RAHA 4CVXA 4XAKE 5C09E 1DL7L 2F58H 2HWZH 2J5LC 5KSBF 6CGTA 3VGGA 1FGNL 1IZJA 4E5XA 4HUVA 3MLRH 1EEQA 3GO1L 2ZCKL 4IS6B 4LEXH 2HT3D 2AQ3A 3WO3B 2CJUH 2JJSA 1KXTB 3T2QA 4L8CB 3L3KA 4PR5B 1F90L 3B6SA 3FQNA 3HA0A 3UJTL 4AQ1B 4S2SB 1ZE3C 3V4UL 2EDXA 3H7BB 1UCBH 3MUGA 3RWEB 1F58H 2M1KA 2Q7YB 4I3RL 4JPIB 3OKOB 4HZLA 2DTSA 4G5ZL 3VRIA 5FYKU 1DEEB 4NQSB 1SVZA 3EYVB 2EYSB 4P2CG 4W70A 4S1QL 2DIAA 5JMRA 1QFHA 4MNHA 3D0LA 1LNUB 3QXAB 1RUPL 4FQ2H 3MGOA 1QFPA 2OTWA 3TESA 1F6AA 4OB5H 3QI9C 3VXRD 2DQEL 3PL6A 3DGGA 3VJ6B 5DD3L 3ETBF 5CJOL 1H3XA 3STZA 2ZZUT 5CEXB 4QHLB 3U2SA 3VFSB 4IMLB 3NIFE 1J1PH 4K3EH 3UMTA 5IB3A 2GJZB 3TBSA 1R0AL 1YUHB 2CDEA 3QDMB 3C5ZD 1KEMH 4B5EA 3G5XA 1A5FH 3GBNL 4MNGA 3KHQA 1CLZL 5CKGA 4BSWA 4QRTA 2Q87A 5GGUB 1BM3H 4MLSA 1OAQH 1DBAL 3MTRA 3AM8C 5F6IB 1U9KA 5EBLA 4PJ8B 4ERSH 2V7NA 4P4KA 2WUBL 4L29A 4HX1B 5HI3C 1BIIB 4TSBL 3C5JB 2FZ3B 3UTOA 4OFYA 5F3HB 2C3WA 1Q9OB 2EECA 2FJGB 4P2YA 4PRHD 4Q6YA 2CIIA 4H1LG 1CG9B 4JFDA 5GRUL 3MLPA 1SJVA 4D8PA 4GKZA 3GK8H 1BGXL 4MB4A 4LGRB 5GZNC 1WWAX 4X4YB 5FHBH 4JO2L 2APXA 1GJIA 1AY1L 2BY0A 4YH6A 4CDHA 3CFJB 2VDPH 2H2PC 4PG2C 2UZIH 4JDZB 5IBLD 4UIMB 5CJXA 4Y5XB 3I6KB 4X0KA 4G80B 4DZ8B 3SDYH 3DXAD 1T7VA 4XVJH 4U1SA 5KVMC 3ES6A 3UTTD 3LN4B 3WFEL 2VABB 1MSPA 2R9HD 4MA3B 2EC9T 4ZODA 4PJXF 4YFDB 2ZSWB 5CD3A 3OXRB 5CP3H 4JFPA 2C1OB 1PG7W 4KRPC 5IWLA 1HOCA 3REVB 3T3PE 4M61B 5IHZB 2X05A 5KZCB 3PWPE 1K3ZA 3O8XB 4HXBH 4K8RD 1WLHA 4JY4B 3ZE1F 2WBJB 3DUSB 3ZKMC 4RGND 4RRPG 2DKMA 5KVDL 1MLCB 3MLVH 3MLSL 2W07A 2E7LC 4UT9L 1I8KB 2NY2B 3PHQA 4DCQB 1HZHL 5IOPB 3G5VB 1VFOA 3T0EE 4HKXB 1TVDA 3CFBB 1D6EA 3S3SA 4P46C 3VWJD 1BOGA 4I48A 4LLWB 1HH9A 4MCYA 1AO7E 3HZMA 5H37G 2IFFH 4TOYL 3BKMH 3FQRB 4U3CA 3ISWA 2AEQL 2VDNH 1XIWA 3C2AL 5DA4A 1FDLL 2WWKO 4I2XA 4EN3A 1VKXA 5L88L 4JREC 4JANA 2FBOJ 4I3SH 2JJVA 1A7QH 5F9WB 1ZAGA 4QT5B 1LDPL 5FYLE 5F7EL 4Q0XH 2ZWLT 4MJIE 2H45A 4L8SA 3B83A 1WITA 3UTPD 1N5YH 3N1MC 3QIUC 5JR1H 2ICEB 1NGWB 5ISZA 2BVYA 4J4PC 5F1KC 1DR9A 4ZPVA 2BDNH 5F3BB 3SDDD 32C2B 4HPYL 4YXLH 2P5EB 2VWEC 3BAEH 1JBJA 5F7NC 1NMBL 3QWOA 4IDLA 3UZVB 3C8KB 4LLAA 3V79C 5C0IA 5C08B 1RUKL 3VXSD 4JKPH 3ZL4L 1KB5B 5LJYH 4YHIB 5LBSL 2P47B 1TJIL 3LEYH 2V6HA 3TBYB 1RHHB 1S7XA 3BMVA 3STBA 1OF2B 1JNJA 4M3KB 1M7IA 1X3DA 4M5YL 1IKFL 3SPVA 2HFEA 4M03A 4MB3A 1K2DA 2QHRH 4DVBA 1L6XA 4F3FB 4JFED 4UUJA 5JOEA 5GRJH 4LEOA 1KB5L 2IALB 4XCEB 5HYQA 3CFKA 5DHVA 5TDNA 2XZQL 5I1AB 3HE6A 4HULB 1NANI 1JGEA 1I8LA 4Q7DA 3WXWH 4JRYE 1LD9A 2Y7QA 4HV8A 5BXFB 5DO2D 1MNUL 3RIFF 1S5HA 1A1MA 5J7CC 5EWIL 4FTVD 3ARWA 4LCUB 5D1QC 1K8DB 1PD6A 3VXUB 3DVGA 2CRZA 5T5NF 4RMVA 1MEXH 4JM2C 4OF7A 3RL1A 2ZKHH 1HSAB 2O26U 4ZXBA 1OLLA 2BHUA 4OD2A 1SYSA 3GUTB 3P40A 5HYJD 4U7MA 5E6ID 4PGJA 1LDSA 1P4IH 4OUOA 3VE0B 1HWGB 2NY3B 3WNOA 5I0ZA 2VLKA 3CDGA 4ZSOA 1MCDA 4IIQA 1RD6A 5JW4R 4YC2B 5HVGB 2X1PA 3FN3A 5EUOB 3QNZA 4G9DB 4WHYH 1WFUA 2H9GB 3LVEA 3L5WA 1V05A 4J3XA 1PDKA 3DRQB 3LKPA 2X7LB 3RUGA 4XMLL 2OSLB 3QHFL 4QF1B 1IFHL 3HS0A 5EFIA 1AKJD 3DV6B 5FF6A 4NC0B 5HTSA 3TV3L 3DO3A 5K9KB 3KLDA 2O93L 1QSEE 3IAPA 4JDTH 3NN8A 1G7QB 4WFHE 4HWZB 3MRQA 3FN0H 5T1KD 2BSRB 1RULL 4Z7VF 1YY9D 3WHXA 3BUYB 2PXYD 3FONB 5D8JL 4LRNH 3BIKA 2R0WL 2JJSC 2GITA 5T3XH 4X7SH 5JA9A 5JQHC 2H8PB 3RWIA 1VFBA 5CBEB 4PREA 5EUKA 3MRLB 3QQ3B 1F4WL 2O5ZH 1KIQB 1D9KA 1UACL 5SWSB 3DECA 4HUWB 3D87B 1JV5A 2PNDA 1JZ6A 4LLQA 3S35X 4H88L 4WTXA 4Y4KD 5F9OL 2SEBA 2HRPH 3UTSD 5E5MB 2OI9B 3O6ML 1YDPA 1QFWM 4M62L 2CSPA 2Y07L 1AGDB 1UCTA 2EDLA 5HHXL 5I8OH 3V6ZB 3K2UH 1DVFA 4EI5D 1XF4B 3QEUB 3PL6C 3V0VB 4WTZG 2EIZB 4NOFA 4QOKD 2K9UA 3T77A 1II4E 2Q76A 1B0RA 3NACH 4PJEA 1NFDA 2FCBA 3ZE0E 4M6ML 4G42A 5CUSH 3GMMB 4DAGH 2QQLH 3KPTA 4HJ0C 2GIYA 1Y18B 4PJ7F 1AFVH 2HLFC 1TTFA 2IBZX 4KKAC 3GSNB 3WFHA 2VXTH 1BVLA 2XRAH 2GK2A 3L7FA 2UUDK 1MFEH 3DWTA 4NGHL 4NYLA 3MLWH 1ZANH 3MREA 5GS1B 4HIEB 1G7IB 4X6CA 4RGOL 4ODTH 4P3WA 5C9JA 2UWEE 4PY7B 3O2DA 3F6IA 2W9DH 2C3VA 1WTLA 1P7HL 1OD7A 1JRHL 5D7JD 1FL3B 3H7LA 3GSNL 1MLBA 4GH7B 4TRPL 3PGFH 1VGEH 3GRWA 1YYLL 2VLJB 3SJVE 2YRPA 3RGVB 5ADOL 3AB0B 4OZHF 4I77H 1T03H 3VI4E 3OGCB 1YEKH 4GLRI 3RWJA 5IF0A 3JTSA 2FB4L 1RJLB 1U8MB 2X5PA 5ICZB 2GEEA 3EJZD 5I19L 1IC4H 3FT4A 5SX5K 5C3LD 3OKNA 3X12B 3MBEB 3WO4C 3EIFA 1AGEB 2YRZA 4H8WC 1V3LA 5KVFH 2HFFB 2DQFA 5FYJL 1CFQB 3LKQA 2NZ9C 5MEPA 1RVFH 3HZYB 3QP3A 5DZOA 1GGIL 2MCPH 1SQ2N 1A3QA 4QXTA 3EYSH 3KPOB 2FATH 3BYTA 3OZ9L 2AS5M 3D85D 1B2WH 2VXQL 2UY7A 2R69H 2PN5A 3T1FA 3U83A 2XKUA 4PRID 2OP4H 1RZ8A 4QTIL 5BRZA 1ADQH 4X98A 4LARH 1B9ZA 4PBVC 4DN3L 1NCWL 1NBVL 2XKNA 5HD8D 3ARBD 1G7HA 2OJZH 3SE8H 3L6FA 5F7FA 1XF3B 3F5WB 2AJ3B 5DJ0A 5C71A 2XY2A 4MXQC 4YK4C 1YYMH 4FQCL 5FK9A 1UQSB 4H0GA 2WWKT 4FQPA 4OUUA 3F8UB 2IGFL 2NY5H 2IJ0C 3JWDC 1WC7A 1CL7L 4UNVA 5C7XL 2IF7A 1KF9B 2UZYB 1LK3H 3KPMA 1KSRA 2X4UA 5DJ2B 2NX5D 1J88A 1MQ8A 4P59H 3LB6D 2NY0D 3MCKB 1QBBA 4BFEA 4IRZL 1ZHLA 4P57A 5ABDE 5JW4M 5F72S 4XHJC 5IG7B 2ADJB 5DA0B 3SE3C 4GG6A 1FG2B 3QI9D 5HVHB 4XHQA 2XICA 5LXGH 2DLHA 2PTVA 3AUVA 2Y23A 2CIKA 4U6VH 1FZMB 2AK4E 1JNHB 1UEMA 4XNQA 4Q9RL 1EEZB 3ARTA 3O6FD 2AV7A 2FX8L 3C5ZB 3PHOA 3LY6A 2F54B 5ADPH 2QSVA 1GVIA 3BVNA 3FMGL 4OI8A 3DVFA 3MV9A 3OB0K 5D1XD 3MRIA 4QTHB 1FAIH 4C83A 5IESL 3OBAA 2WWMC 2MQCA 3BPOB 4F15B 5I2IA 4ELMA 2ESVE 5GJSL 2ICWI 1RZKL 1XF1A 4HJJL 4XVTL 5FB8B 3W2DH 1V7NH 3WSQL 4PRHB 1UB6B 3G6AB 4U31A 3BP5A 2NTFB 2DQUH 4GAYB 3KWWB 2BSED 5DTFA 4JAMA 3BJLA 4X7EC 3JUZA 5BS0A 4XC3H 4H5SB 4U2YA 2A2QT 1E6JL 3BX7C 2YKLL 5DJZA 4XAWH 4Y5VA 5E2VH 1NGZA 2WK2A 3O2VL 4ODBD 3HE6C 1TDQA 4D0CA 5IGXH 3FRPG 4H0IA 3T04D 3L5JA 1OP5H 5GZND 4H1LH 1P4BL 1PQZB 1VEMA 1E4JA 5DVMA 5EU4B 3TYFB 1ZGLP 4UAOC 3MR9A 3DXAB 5I1LB 1X5AA 4HGWA 1PGRB 4JLRA 2WQ8A 1W0VA 2H2PD 1A1NB 3M8OH 1L9NA 5DGQA 3UTTB 1RZIB 1WT5A 5AZ2L 3V4VH 2FR4A 3C5SB 1OM3L 1JHLH 3HC3H 3QXDB 3BEWB 3BEVA 1KULA 5E8OB 5DI8A 3S36L 3ZYJA 3GMQA 4ZDHA 5E7BA 2DQIL 4XP1L 2JCCA 4HK3J 4JFHE 5HHVH 2M8XA 2MJWA 1I1RA 2BNRA 4RGNB 1SJEB 2LFGA 5FGBA 3QZWB 1MFDL 4IRJC 4U7SA 5HY9A 2FECL 1TJGH 1SBSH 4N1EA 4FXKB 4NQCA 3H3PL 4XRCB 1ES0A 4U1NB 5DJDB 4K8RL 1UM4H 3JWOC 1LO2L 4YNYA 3QPXL 4J8RB 3VWJB 1KCUH 2GTZB 1CXFA 3RBSA 3HG1A 3S37X 1CDJA 4LCWD 4OLZH 3VD4A 3ZSTA 1Q9KB 3QO0B 1D5IL 4WU7A 1U93B 5IFJA 1MJ7L 1ZEAL 3QNYB 4ZUSB 4HC1L 3E0GA 1PKQE 4ZFGH 1T0MA 1PSKH 4RSVA 3G9AB 1HQRA 1WFTA 1H9VA 1UYWH 5H37H 2XWTA 1H0DA 2EDNA 3QUKB 4LHUA 4HHAA 5FGCB 4CGTA 2B1HH 4E41D 4JG1L 5DD5H 1IT9H 3Q0HA 4PYHA 3UTQB 3B3IA 3MROA 4M1CC 1KACB 3MGTB 1FV1B 3EAKA 5JNYB 4PB9L 3VWKA 1I7TB 2Y5TA 1WIPA 5BJTB 1FCCA 3I2CH 3SDDB 4OM1L 4ODXA 3OQ3B 3QIUD 4JFOB 4NBZB 3MV8E 4OD1H 4CMMB 1XCTA 2JF1A 4N0CD 2ICES 1QSVA 5KVEH 4R6UA 1Q38A 1DVFC 3QEHA 2HFTA 4MXVE 1EVUA 1CLOL 2BNQE 2X4TB 3V5HB 1WSST 1QQDB 2CLZA 3FRUB 1Z5LA 3VI3F 2Q8BH 3EFDH 5IW6B 3TJHD 4JFEB 3VXMB 1DFBL 5C86A 1MRCH 5SX4I 2NY7L 2EYTA 4HBQA 5E5RB 1HILB 1I7ZB 3RUGF 4YE4H 3NA9H 5EZJB 1MUJA 4MJ4A 1DJSA 2BP3A 1H15A 2EKSA 3QIWA 3TFKD 4L3EA 1CGTA 4FTVB 5INCA 5C07A 1NEUA 4HS3A 4P5TA 4OKVB 5ALBL 3RIAK 1LEGB 3VGDA 4AZ8A 3W9EB 2JLLA 2X9WA 2R1WA 5C0FA 2RCSH 3EUUA 3SCMC 3QRFM 5D1QD 3BDYL 5HYJB 4LSRL 1FO0H 3D25B 4PJGB 1A7BA 4NKIL 4BJLA 3BUTA 1NGPL 5D72H 1T1XA 2GAZA 5JO5B 3RHWF 2C4FU 1Q1JL 1J5OL 1RZ7L 1KFAL 4HWEL 5E2WL 1FNAA 1NGQL 4CMHC 1JK8B 1TZIA 5HGHB 3P4NB 5LAXA 4U1JB 2JIXA 1A4KB 4CVZB 3GJFH 3MACH 1AKJB 5TFSL 4U4BA 4PTTB 1LO3H 3AXLA 4MA1B 5ACZA 1A9EA 4HT1L 4I18B 2I26N 5GGRA 5BO1H 1KLUB 3IF1B 3NGBC 4KQ3H 4KKBC 4Q6IA 4FQIH 4FQQA 5T1KB 9CGTA 3H9SE 4PJEF 5GGVH 1NFDF 2PXYB 4X5WB 4ZPTA 5DQDH 3ILQC 3NABL 3BP7B 5LVEA 3WDIA 3DV4A 1J0HA 4I13B 4PRAB 3ZMRA 1NLBL 1RK0B 4HKBA 3E6HB 1LO5A 1B6UA 3S96A 1W72A 5JUEL 2HTKD 2IH3A 2B5IB 3WXVL 3TBVB 1MFCL 3TN0A 5CSBA 5IHUH 2DM3A 2CLVA 1KJ3H 2D7NA 2AERT 2CH8A 3UTSB 1R6VA 3T0DA 1BVKA 1AD0B 3IRZA 5D96B 5F1OB 2J88L 1QNZH 4PJFE 2D4DA 3LS4H 3QWRA 4QOKB 5J6HA 1M71A 1ZKAA 3MV7E 5KSBB 1FIEA 3I3BA 3ULUH 3RY6C 3WV0A 2DM2A 3PL6D 3TH4T 3WL9A 1QSZA 3WFDL 4PJBA 1FGNH 5F9DC 1HH6B 5IT2L 4P4RA 3HAEH 4HJ0D 2KZ1B 3GO1H 4I0CC 3BFOA 1V3MA 2HLFD 4GSDH 5DJ8A 2RB8A 2H3NB 4KKAD 4CNIA 3FN9A 1FHGA 3T0EC 4YGVB 3WFBL 3RNKA 1G0DA 3CZFA 3SO5A 5D7JB 1I85C 4NJAL 1J8KA 1F90H 2J7LA 1H3TA 3LDBB 1EEUA 3UC0L 1EAPA 1EGJL 4P4KD 4G43A 4AEEA 3E8UL 5F7WC 3V4UH 4FQLL 3IU3A 5DZNA 4OFYD 1DE4B 2HJKA 4NO2B 2JK5B 1S5IL 3JV6B 5IMKB 4TVPH 4JQIH 4X6BB 4JFDD 5J1AB 4MAYA 3FQWA 2R1XB 4K2UH 3MODH 3WHE0 3MO1B 5I8KL 1EZVX 4UTBL 3OPZL 4WUKL 1HNGA 1FZOB 1Q8MA 1DBML 2VXSL 4ODWB 3GIVB 1ORSA 4GRLA 2I9LA 3AMKA 4U1KB 3IKKA 4H20L 4BSVB 5IMOB 2O61A 2E7BA 3DSFH 3O3BB 1T22A 4FQXA 1K9TA 5I74C 5E9DA 5DD3H 2IMMA 1F3JB 4U6YA 3SGEH 5CJOH 1OL0A 4NKMB 4Y4FA 2ED8A 3RA7L 1LEIA 2KDGA 3TO4A 3L3JA 1XAUA 5E5UB 1YPZA 4M1DL 2IPKA 1OARL 5B4MD 2XN9E 1Q9WA 3D85B 1R0AH 3GKWL 4NM8H 5CBAA 3D3VE 3WN5B 5IVNA 4GG6F 3OAZK 3TVMC 3GBNH 2JB6B 1CLZH 5DUBA 4PRIB 3GSQB 2A83A 43C9A 5CIPB 5J06A 4KI5F 3QAZB 3KPSA 1DBAH 3ZTJH 5H8DA 1KG0A 4KROC 1S7TA 5BCAA 5BV7B 4OZIA 4I5BA 4IMKC 5F1NA 4OGAC 4Z7UA 3ZSSA 2WUBH 3ARBB 4HH9A 4P2QA 5JORA 5IB2A 1FZKB 1CFSA 4TSBH 1P53A 1A7PL 4WY7H 3UDWC 4B7LA 3KDMB 5DFVC 1G9MH 2H26A 3BPCB 4HJGA 1CDYA 5DQJA 3AU1A 4XCFH 3OJ2C 1DTUA 2W60A 4NO5B 4GRMA 4NJ9L 4ELMF 5BV7L 3U48A 4MXQD 2B1AL 1VGKA 4FP8L 4JO2H 5FKAA 3ARQA 1OD9A 3TJEH 1AY1H 1ZLUK 1RIHL 4V1DA 1P5VA 4F7MA 4PPTA 2NX5B 4PJXB 2DKUA 4PRNA 2NY0B 4GBXC 4X9IA 4PJDE 4Y19A 4EN3D 2G9HB 1IC7L 4YDVA 3ULSB 3WFEH 4KDWA 3QI9B 2YN5A 1OSPH 4ZS7H 4OI7A 4NKDB 2VLMD 3OKEB 3UZEA 4ZFOB 3FO2B 3O6FB 1Q0YL 5CGYC 1QR1A 3FT2B 3L3IB 2YA0A 1NFKA 2A6KB 5ISZD 5KS9A 2AXGB 5D1XB 5A16B 3CFEB 3QZWG 4TULL 3TNMA 4JZJA 3MLSH 1YA5A 1KB9K 1MCWW 3WD5L 3MRBB 4XNYL 4ZFOL 3DX6B 2HP4A 1HZHH 3EYUL 4A2MA 1KPVA 1BBJA 1R3LA 2JCCF 2XFXA 2EYRA 2WWMD 2BOCA 2XG4A 2VDRL 4HS6B 1NPUA 4OJFL 3HPJA 5I30L 2C5DC 3RHWK 1XF5A 4KK9D 1WVZA 5F96H 2Q1EA 5FV2A 2YD9A 4LLUA 4Z7NF 5TPWL 3FQXA 5GGRY 5D7KD 5ENWB 5T3ZE 3L5HA 3ESUF 5ESAB 5L88H 3UROR 1ZLVH 1N5AA 1A6VL 5HGBB 1UKTA 5FEBA 1PG7H 3HE6D 4IEFB 1HWHB 1LDPH 3DIFB 5F7EH 1CYGA 3RVUC 5SWZA 4PD4J 35C8L 2O5YL 3HPLA 3SDXE 5JA8B 3FO1A 3TGXA 4X4MA 1Z9LA 4RCAA 5B8CC 2ZNWA 3UPRA 5TGBA 3U1SL 4LIQH 5ANME 3VD3A 3MA9L 4WU5A 2VE6B 4S1DD 4U6XA 4G7YL 4ZXBD 3ZE2E 3CH1B 2QKIA 2Q8AL 3H0TB 1KTLA 4OZGA 5E8EB 1RUKH 3L9RA 2VLKD 3NMEA 1TJIH 2NPLX 5L6YH 1FH5H 1I75A 1JZ8A 1QEWA 5DFWH 4AH2B 1G7LA 4IRJD 3G5ZB 4ETQB 1NDGB 4JJ5B 4XBPB 4OLUH 5A1AA 4M5YH 4LLDA 1IKFH 4TUKL 4KY1L 4LCWB 4Y0GA 1FNEB 1B4JL 3O6KH 3EO1A 1Z6JT 2B0SL 2A73B 3RZCC 1KB5H 1LE5A 3UO1L 3DHMA 3MA7A 2XZQH 5D5ME 2JJUA 1ZXQA 4KMLB 1P7KB 1ND0B 1SY6H 2DQHH 3VFOA 1TVBA 2EEBA 4HK0A 5F93C 3K0WA 5EWIH 3DJ9A 1H5BC 2F53A 1AD9A 4JREB 4XPAL 4E41B 3FQUA 4O58H 1BAFH 3D2UA 5EIIA 2AJXH 4LNVA 1JZ3A 5EZIL 1NFIA 4KDVA 2NW3B 1Q94B 4H26B 4LSUL 1ADQA 4IOFC 1RK1B 4G8EB 3QIUB 3SY0B 2NY1C 3UBXA 4KK5C 1D9KD 1MVFA 3PWVB 4C56E 2DLTA 1TVHA 4LSSH 5K9QI 1JTTA 3Q1SL 2AI0L 5GS0D 2EZ0C 4ZYKB 1D6VL 1M7DA 1S9VA 3T8XB 2Y5EA 4GMTH 3UTZA 1N8ZA 4OSUL 1A14H 3QUZA 1NKOA 1T3FB 2Q6WB 1IFHH 1YEDA 3S5LA 5L0QC 4DK3A 1DVFD 3TV3H 1KJMB 1UZ6E 4LCIL 1TNMA 4JFQB 5KJRH 1HQ4A 4Z7QE 5D9SA 3NFSL 5E4EB 4Z7VB 1R3KA 4APQC 1J1OL 2Z92B 4NKOB 3QFJA 2E27L 2DKSA 4ALAH 4YEFA 2GI7A 4OBSA 1MAMH 2YPKA 4XTRC 4X9FA 2FX9L 3IYLW 3HRPA 5E00A 5I1DA 5D8JH 3PJSB 1Q9LB 2A9NL 1T1WB 4F7EA 3IVKA 4X8JB 5AD0B 4GRWF 2PF6A 1TCMA 3JTTA 4RDQG 3WIFA 1SYVB 1DBKH 1F4WH 3O3DA 1LO4H 3MYJA 3HMXL 1UACH 4LKCB 2P1YA 5DQ9B 2BMKA 3DI3B 5IMLB 1TQBC 1NBYB 2EXYD 2F5BH 3PUCA 4MAYC 4RA0C 1YEGL 4YQXH 4DW2L 1O0VA 4OLVL 1FE8L 4MD5A 1A8JH 4M7ZC 1I7RB 3QDME 1CDHA 3QG6B 5D7LA 3GI8L 2BRQA 1U58B 4PJ7B 4NPYA 2I9TB 2C1PB 3OGOE 5CZKA 5CJ5A 4M6MH 5DC4B 5SWQB 4XP5L 2VLLA 1QBAA 2ADGB 4YHML 2HT4C 4DZBA 1OQXA 1ETZA 1P9MC 4CVXB 43CAA 3VRLF 1T7XA 3VGHA 4U1GC 4W4OA 4J3SA 4NGHH 3T2PA 3HZKA 3SN6N 4JN2A 3NOIA 5EU5A 4E5XB 5EA0L 4HUVB 4XPTL 3OKKA 1YNKH 1YEJL 4ACPA 3LMJL 4XCCL 3MJ9L 1YQVL 4JFFA 4PJBF 5DD0H 2UYLA 5BRZD 1NSNL 4ZFZA 2VXVL 1EZVY 2DI8A 3L3KB 1LO0L 3R0NA 4OV5A 5ADOH 3FQNB 4OZ4A 1JMXA 3QUML 3N1FC 5I9QB 1OAUL 1JL8A 1DLFH 3MUGB 4O2EA 4E0RA 3TIDB 1XGYL 5DJ6A 3VRIB 3L5IA 3PDDA 5I19H 1YEFL 3HLAA 4MNHB 3D0LB 3QRGL 3HI5L 5EU6A 2OTWB 1CICA 1BIHA 1F6AB 2BX5A 3UPAA 3I50L 5LGJA 3V0AC 5IBUB 3PL6B 3DGGB 1QKZL 5C8JA 3OL2A 5I8EA 3BE1H 5DEFA 3VG0L 4YUEH 1GGIH 4LSDA 3STZB 5TJWK 1JIBA 2HAZA 3U2SB 4DK6A 5IB3B 4KI5D 1NMCB 4HD9A 1U95A 3TBSB 4Y16A 2VKXA 4AMKL 3MOQA 5I1KL 2CDEB 3G5XB 4RAVA 4MNGB 1YPZF 3HUJA 4DN3H 4UU9A 3MV9D 3WLBA 4BSWB 4QRTB 2GKIA 3IT8D 5FA4A 1I9IL 3DOSA 1EVTC 5EBLB 2QQNL 2V7NB 4P4KB 4L29B 3D69A 4MJ5A 3W82A 2CMRL 3OAYH 3SGDH 1GXEA 1FSKB 1NGXA 4UBDC 3QG7L 4OZIF 2CIIB 1P4LA 4HIJA 4JFDB 4Z7UF 1OVZA 4D8PB 5C0AA 4GKZB 2V2TA 1QFUL 1RFDL 5BS0D 5C7XH 4DGVL 3CLEH 4NN5B 1ONQA 3WBDA 2W9EH 3MGAA 3OG4B 4HS8L 5J6GA 2P5EE 4NZDA 2MTPA 3M1BA 4IRZH 2V2XA 4K71C 1FNGA 2XI9A 4HFUL 3DTXA 4MNQE 4X0KB 5E70A 4GAGL 1RIUL 3ARYA 4YEEA 3INUL 1U8LA 3N85L 1C5BH 5GPRA 4KKLC 4U1SB 1J9CT 3ES6B 2NQCA 3KYKL 1KELH 1FAKT 5CD3B 4JFPB 4PRBA 3VCLA 2FX8H 1HOCB 2D4FA 4R90L 2HKHL 4JJHA 4HQQL 4DGYL 5IESH 1N0LA