4WFFE

Human traak k+ channel in a k+ bound nonconductive conformation
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
211
Chain Sequence
EVQLQQSGPELVKPGASMKTSCKVSGYSFTGYIMNWVKQRHGKNLEWIGLINPNTGYTTYNQKFKGKATLTVDKSSSTAYMELLSLTSEDSAIYYCTRGNYVFDYWGQGTTLTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
total genus 48
structure length 211
sequence length 217
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wffE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wffE02
5CAYB 1IGCL 4XCNA 4PRPB 5I1IH 2FECI 4XPFH 4M7ZC 1DSFH 3FOLA 4JVWA 4JO2L 3VJ6A 3P77B 1QR4A 1NDMA 4OFIA 5CGTA 4OIIL 3LEYL 4JAMA 1KG0B 4JLRA 5FKPA 4WDIB 2VRAA 1FV1B 2ZUSA 4JDTL 4YBQD 3EYOA 4O4YH 4OF8A 3MUY1 4PRPE 4NKDA 5DJ0B 2Q3ZA 5DO2C 5F8RC 3NIDE 5T1LB 4JQVA 3UPRB 5IB2B 2NW2B 2R2EB 4UNUA 2AEPL 4L3EA 1D5XA 2RJMA 4R8WL 5MI0B 3KPNA 5I71B 2OR7A 2B0SH 4NSKA 1AQDA 1YECH 3E2HB 2EDKA 1FZMA 2Y36H 4P46D 4G5ZH 3AU1A 2UY7A 5MERB 1AR1D 4XCCH 4UB0L 3BGMB 4KMQA 5EOTA 1CGSL 1T1WA 5D6DA 3LEVL 5F7WC 4YHLH 5I8EA 4PTUA 2OK0L 3T04D 5C0IA 2DWDB 5DR5L 3V7MA 3IDYB 4N8CH 3KYOB 3PWLB 3FMGL 2X41A 1VKXA 2VISB 5CIPA 2O5ZL 4NBXB 2XN9E 3D2UA 4QRQB 3HUJA 4GJTB 2HFEA 4OLXH 2BVPA 4YK4B 5E8EB 5IKCA 4PB0H 2K1MA 1Z0MA 3CFEA 4AEHH 1OF2A 1HWGB 2XQBL 4Y5YB 2UYLB 2FR4A 1FL3B 5EOTB 2RB8A 3RQ3A 1W8NA 1ND0B 1BFVH 1RJYB 1WQVT 2E7CA 4PJBE 3MRMB 1NSNH 4PLKD 5H35A 1A7OL 4RX4A 1E4XH 2YSSA 4P2QA 1P4BL 1CGYA 1VPOL 3RBSA 1G7HB 1U8KA 2ZOLB 1CK0L 3ZKXB 1MCJA 5D2NE 4MGXA 3CZJA 1OT1A 2HVKB 3Q2CA 1CFNB 4DGIL 4EI6B 4NZJA 4DGIH 2NR6C 3I2CH 3CD4A 3ZE2F 1QSEB 3IKKA 3IJYA 4Z76B 2BNQE 3FOLB 4KAQH 2ZCLL 5MENA 3W9EB 3KHOA 1F4HA 4IRSC 5GSRB 2HT3C 1FL6B 4Y1AB 4OQ1A 2XQYG 4ODSH 4KDTA 3UYOD 1QBMH 1OGAE 5I8CA 1I7TA 4LRIC 4NN5B 1NL0H 4QY8B 4BZ2H 2IC2A 4X6CF 5J1SC 4MJ6B 3CX5J 5H37H 3NA9L 3UTSE 3X3FL 4OV5A 3QXDB 1WWAX 3Q5TA 1YDPA 1T4KB 5F88B 4E42B 1ZA6B 2F54D 3MPCA 4I9WD 2OI9B 1G9MH 1FNSL 1U3HC 5HY9B 4LSUL 2CH8A 3WN5C 1BAFL 3BGAA 5E2UH 3SEPA 3KYAA 1K8IA 1OP5K 1A4JB 3NCJL 1OSPL 2ZUWA 4N0FA 5JHDE 2QR0A 3MRRB 4GXUN 3MV9A 2ENSA 3C6LC 4HQQH 4EXPX 3GEWB 1YMME 2X89A 5GS3A 2HLFC 1EEQA 2B2XL 3MLSH 3RIFK 4GMTH 3M8OH 3O9WC 1L6ZA 1N26A 1V05A 3OKDB 3TA3C 5I76A 4U1JB 1G7QB 3UBXB 2EYRB 1IGIH 2B7DT 3WEXB 5HPMB 4PJIE 3TN0D 5IBLD 1FZOB 2XKUA 3VFTA 3WE6A 4F9PA 1TJGH 4P3CH 1QBML 2PTTB 1LO0H 5ANMA 4ZFOB 1CFQA 4LDEB 1JWUA 4K2UL 5HYQA 5D1ZA 4XCEA 3WBDA 4J3SA 2BNRA 3F5WA 4LL9A 3SGJC 1EHAA 3MLXH 4W6XB 1FFRA 2KUTA 1JVKA 2BRQA 4HWBA 3HS0B 4XNYL 1DVFA 2YD3A 5F3HA 4OM1L 3KPRB 3QUMH 3QZWA 4JO3L 3SJVB 1MVUB 1IC5H 1KIRB 5JA9A 2XNAB 3VWKC 1MAML 5E8PB 1EGJH 4DZBA 5L2JA 4XPHL 4JRXA 3SPVA 5JW3H 3AMKA 2Q8BH 5CJOL 5B38A 3HTLX 1T1WB 1EFXB 4CU8A 2I26N 3UMTA 5D8JH 4M6AA 3HI5H 3GSQB 2P5WD 2AK1L 5D5MB 1DQDH 4XMKH 4GRLA 3TA3D 3MXVL 3HZMB 3VGDA 4X4YB 2ATPA 5DF0A 4LKCB 5IROA 3WKNA 4M7LL 4F7CA 2CIIB 5I74B 4LOUC 4IS6A 5I8KL 3WJLA 4ONHA 4XP5L 2J8HA 1YNTA 4OLXL 3O6LH 1P6FA 1G6RA 5D5MF 2CD0A 2ZOKB 3SHSA 2FX7H 4OD3L 4YHOL 1NMBL 1D5BA 5FYJH 5H37G 5EU4A 5GJSL 3MV8A 4RFNB 5DD3H 3QXWA 1IILE 4YEFA 1NCCH 5EU7E 5JOFA 3KPSD 1U0QA 4ZAKD 5GGUB 3VFUA 1W2KT 5D70L 5LBSH 5FF6B 1UH4A 2LVCA 2H3NB 2B0SL 3U46A 3BD4A 4NQXB 2BRRH 2Y5TB 1LE9B 1JE6A 3A6CL 1OAKL 4JFOB 4WUUA 4DKEH 3VMPA 4YDLB 3V5HA 3ROOB 1S7XA 1WZ1L 3S34H 2HA1A 1BJ8A 3RKDD 1YYLL 4Y4FB 4XAWL 4RNRA 4RAUA 5C0JA 3IJYB 2E27H 3IFOA 4XMPH 5K9QG 3TA3B 1KJ2H 1BD2B 5DC4B 4CL7A 3KXFD 2OR9H 4HKXA 5LWYH 5J1TC 2VN4A 1DANU 3FO1A 1RZJC 1HZHL 4FQXD 1FFOB 5FYLL 4LF3B 4LVNB 5T1KD 2CLRA 4HCRA 3TJEL 1F90L 4R4FH 3QIUA 2FD6H 3CVIH 2EDTA 3GB7B 3L5HA 5EO9A 5FUZL 5I30H 1G1YA 5IHBA 3RNKB 4WFED 1Z9OA 1XF5A 1HQ4A 5E8DL 4JJHA 4KI5D 3VG9B 3O6KL 4KJPD 2PTTA 5D7SL 1UA6L 3RVVC 2NCMA 3OKOA 5C0BA 1HOCB 1MFEL 1ZHKA 5ACMA 4GRLC 4NN7B 2IMMA 1A6WL 3A6BH 1HSAB 5ITFB 3I50L 1HWHB 3A6OA 3D0VA 1RK0A 2C9AA 5EC1B 3RVUD 2VLKE 5C09B 3QEUB 1RZ8B 4YFLI 3AMLA 3T0EB 3EO9H 5TE7L 1PY9A 1KPUB 5IB5A 1XGTA 2BNUA 4ZMAT 4PTUB 2AS5M 1G6RL 1EHNA 1I75A 3NIFE 4LSVH 2QSVA 4QYOA 5I30L 4R4FL 2OZ4H 4ZD3H 4MXVE 4OFPA 3I6KB 4OZ4A 5KW9L 1CXFA 3KXFE 4JZOB 4YBQC 5EO1B 3WUWG 5IVXB 4K3DH 2AK4D 2DQEH 3SGEH 1I4FA 1UEYA 2X7LB 3IDIB 3ILQC 3PJSA 3BEWA 3ZYZA 2YMXL 3WFHB 1I3VA 5EIIB 1DUYB 2D2OA 1A6UL 3GHBH 5FYKH 5JUEH 3N9GH 5F9AC 3BJ91 3GI8H 5A2FA 2NY0B 1CR9H 3MLVH 5DQDH 4FFWD 2V2XB 4JAMB 1I9IH 5BW7C 3S4SA 4DGYL 4F7EA 2BVOA 4WW1A 5FAAA 4HUVA 1UXWA 3V8CA 4OZIB 4MA7H 2DDQL 3KPPB 5D70H 4EI6A 3SQOH 2GW5A 5I1LB 4BSWB 3UTZA 4M62H 1Q0XH 1NFDE 4N8CL 2CLVA 3UPAA 3LKRA 1VGKB 4CW1B 1EA9C 2VN7A 4PLJC 3K1DA 3SDDC 4FP8H 4RMUA 1GHFL 3BE1L 2B1AH 5DS8B 5CGYD 4Z0BL 5AYUL 5FHBL 1RZKL 5SWSA 4GQ9H 4TQEL 1V7NL 3VRIA 3GRWL 4KWUA 1H3GA 1YECL 2IJ0C 4M7JL 3G04A 4KU1A 1HH9B 1L9NA 3D3VA 3TGXA 4IOFC 3D39A 2R2HA 2ZWLT 4FTVB 3EOTL 3H3KA 2OXHA 2P5EE 3IJSB 4E0RA 3VGAC 2BSRB 3PHSA 4NZUL 5F89A 1WIPA 5B21A 1A7QL 4DGVH 1UG9A 4GBXD 4R97C 1CE1L 3OB0H 4U1NB 3CH1A 3RZCC 3O3DB 3VD7A 3PWLA 1F4AA 1IEAA 4NPYB 3VH8B 5FYLE 4H8WL 4JM4H 3T77A 1JZ2A 1JK8A 3O41B 4N0UA 4NHCL 1YQVL 4M9OA 3ULVC 4KJWC 4X5XB 1FVEB 2ZJSL 1EGJL 2F53A 4PJHE 1I9JL 2YK1H 4XVSL 1OARH 4F7MB 4EBQH 1A3QA 5E6IC 4KK8C 5FO7B 5J9PB 4OZIF 4MD0A 2N56A 4NRZA 1MHHB 2R0LL 5FM4A 1R3JA 3T2OA 3V6OA 4KK6D 1ADQL 2A38A 2ITDA 1J7VR 3K7UA 1AH1A 5HHOD 2V2TB 2FEEI 4X4ZA 1RK1B 3QDJE 4HJGA 5TDNA 5TE4L 3S36H 1MJ8L 1Z3GL 1PAMA 3AXLA 5CJ5A 2JKXA 2HT2C 1T22A 3BPNB 2R1WB 3BRFA 3CLFL 5JIKA 2L7JA 2BFVL 4KZDL 1D7FA 3FONB 3C60A 4ISVB 4LVOC 3QDGB 1T2JA 1QYGL 3SY0B 2HYMA 4KKCD 1AXTL 4KH2A 2PKDA 4ETQA 1KEML 4HH9A 5DMKA 1A7NH 1OLLA 4QRSA 2EYSB 3C08H 3MFFA 4HUXB 1ETZA 2IBZY 3C08L 3MMEA 4YR6B 2B8OT 3VFVB 2KZWA 2QQLH 5L7XH 3U0TB 4RGMB 1NGZB 1EDQA 5DA4A 3JV6A 5E5MB 3RRQA 3DYPA 3UX9B 3P4OA 4C56A 3L3HA 3H0TB 3U4EA 5HHXL 4OB5H 4R4NC 1RHFA 2ADGB 5EU5B 4PIRF 3RVXC 1EAPB 4LGRB 3G5YB 5A16B 3IFNL 1E6OH 5E8PA 2CDEA 3ULUD 3P4LA 3B2UD 2W59A 2XXMB 2A6DA 3FO2B 3V7AG 3VXMD 5EU6B 3MLZL 1MJ8H 1MI5E 1ZK9A 5C07A 5SWZB 1JPFB 3IDGB 3ZLQC 4QCIB 4ZSOB 4QHLB 4PJFE 4ZFZA 3SCMA 5HD8D 4CVXA 5CEYB 3BRDA 1JHTA 5GGQL 2WSKA 4R26L 1A9BA 5C86A 2X4RA 1A6TB 4KUCF 4KI5E 1KJ2B 4R7DA 1YEGH 5J89A 4PGDA 5GS2H 1CGUA 5BV7B 2V5YA 3SGDH 5EBMB 5J11C 1RD6A 3F7YA 4J12A 4EIGB 5DURD 5I9QB 4Q2ZB 4Q97A 5J06A 5DRZB 3O3BA 8FABB 1YEKH 3RBGA 4P49A 4HXBH 3U0PA 3TEUA 1WTLA 2J5LB 1SEQL 4ETQB 4TULL 4OD1H 3QSKB 4JN1L 2LE9A 4LLDB 1CS6A 3MGOA 1NMAL 5F7LB 2AEQH 3V5KA 4YHMH 3G6JB 4YJZL 4XNQA 5KSUB 2H45A 2APBA 4EDXB 4APQC 5ISZD 4HK3N 3NFSL 4FA8A 4WI9A 3RY6C 4M43H 1FLRH 4EDWH 4DK6A 3T3PF 5IHZA 2ERJB 2C1OB 5GGRA 4LU5L 1JF1A 3DHJA 5FYJD 1PYWB 1J05B 3MV7A 4HHAA 2D3VA 4C56D 1FVCA 4WTXA 4JZJB 3OL2A 1T20B 4S0TD 1CE6B 4Z7NF 5DQJA 4F33A 4LKCA 1EH9A 2XWTB 4HGWB 4WHYH 1IKFL 2YZ8A 2VLJA 1CLOL 1JNHA 1QPXA 2MSPA 2VH5L 1B0GA 4M62L 2OJZL 4PR5A 4X5XA 5C8JB 1EBPA 2PYED 2DDQH 3WCYA 4AL8L 1R5WB 1NGWB 2JK5B 3HG1A 4PJXF 3U0WH 2Y6SD 1FIGH 5DT1H 5IB5B 3HUJE 1VFBB 3NGBC 3P3YA 1Q0XL 5E7FA 1U8NA 2VZUA 5HDLA 2JELH 1C5BL 2W07A 2YUVA 4MWFB 3PDOA 4U6XA 3V0AC 2E7LA 1NFIB 5HHVH 3MC0A 1K3IA 3ARED 5GS0D 3TVMB 1FRGL 4F57H 3W2DL 5JHLH 3LS5L 1VADB 5D7JB 3V79C 3PNWA 1LO4L 4ZUWA 1EVUA 2E6QA 5DI8B 2V9QA 2J7LA 3HFML 5EU3A 2C4FU 3DGGA 1HDMB 4U6YB 1IZJA 2Q20A 2R1YB 1JNNH 3T2QA 4NQEE 3F7VB 4ODWA 1S9WA 7FABH 3DVNB 2GCYB 3BI9X 3CCHB 4MVBD 3WKMH 3QULB 4PJGE 4OF5A 2FJFA 3MX0A 4PTTB 4HUNB 4LVHC 2GJ6E 1H3XA 2YXMA 3TT1H 3LHPH 4WFHD 1GGBL 3WXWH 2FX8L 2VLRB 3VXRE 3ZKXC 2CLRB 2CKBB 3DSFH 1H0DA 3BISA 1KEGL 2XTJE 1VFOA 4FXKB 2P5WB 2YK1L 4WFFD 5GGQH 1YMMB 2R15A 3RAJL 4PS4H 3VG9C 5HYEA 1OGAA 1DBML 4M8QB 4Z7UB 1QD0A 1AI1L 1S7RB 1AY1L 2EXWD 4G3YL 4XMKL 1UA6H 4MD5B 5L88H 1YN6B 3DX9B 3BZEA 1KBGL 3D3VD 3FCTB 3NFNB 3TJHD 1UJTA 2QHLA 3ZSSA 3GJFA 5D6CB 5JO5B 5C9JA 1FG9C 2WM0A 2FO4A 1TLKA 4RA3A 4G6KL 2HJKA 5CD3B 5DQJB 5EIIA 4Q0XH 3B9VA 1AGCB 4G8FA 3J8F7 1QSFD 4YBHA 3EYQC 2DKSA 2MCPH 1WUNT 1FAKT 4LPWA 3RA7H 2XQYK 5D7IB 2A6JA 3SDDB 4Y2DA 4X7FC 4JM2F 4DJMA 1NKOA 2PYFB 4JCLA 3NA4A 2AAVA 1T80A 4BJLA 2BNQB 2K3TA 3G6DH 3G6AB 4U1IA 2VLKB 1HH6B 1CCZA 5BOPA 4X9HA 4M61A 4Y16C 5LGKA 5J6HB 4XWGL 4FFYH 2GSIA 4LLVA 5J56B 4HKZA 1EK3A 3ULSA 4LLMA 1KB5A 1FGNL 1CICC 3S3JA 4PGBA 3EJZC 4I48A 4WFFE 2JIXB 2JB5L 3FTGB 2MMXA 4ESKA 2DQUL 3IAQA 4Y4KC 2XKNB 1FNGB 3MTRA 4NO2B 5JDJA 4PJHB 6CGTA 1OSPH 4K8RC 1EZVX 4P5TD 4Y5XA 5DR5H 2P8LB 4EKXA 2IBBA 3RX7A 5DVMA 3WO4B 2E5EA 5C0GA 3VXSA 3OKMA 5L2KD 4WV1A 1H15B 4F9LC 3PP3K 1OD9A 3LPFA 4PBWD 3ZTNH 1INQB 3QUZA 4HG4K 3EJZD 1YJDL 4PJ9B 4QHMB 1A14H 2F54B 4HJJH 5DD0L 1RUPH 4UTAL 2PO6B 4X5WB 3MRPB 3VRLF 4I4WA 1MUJA 3RGVD 1B9ZA 3FB7A 5F89B 4HUUB 4YHIB 4P9MH 4TRPL 4MB3A 4X7DC 3MRDB 2IPKA 4XCFL 3IXAB 5D93B 3P9MA 1JYNA 2DQHH 4FTVA 4JR9H 2DI8A 4FFZH 3BPCB 4GAJL 4UT7H 2I5YL 3X12A 2H8PB 2VE6B 2DICA 2N7BA 3EGSB 3ROOA 3MA9L 5FCUH 2V2WA 4DOHB 2VITA 1QLFA 3VD3A 5CZVL 4F3FA 3L95B 2K9UA 5C7XL 3FT2B 1S3KH 1MHEA 3MRJA 1U3JA 2B1HH 2XFXB 3M07A 2J6EH 1PX3A 4Q9RH 3GSXB 4L29B 1UACL 4JQXA 1OY3B 3HPLA 1DQDL 3BD3A 1WFNA 3BE1H 1T22B 4I0KA 4RGMC 4QF1B 2V9RA 5FOBA 5EZJA 1H3WM 1Y18B 1KSRA 1QACA 3OJDB 3O11A 2IG2H 2QLVB 4WTZG 4YFEA 1IEBA 2EKSA 4BQ8A 2V2TA 1MRCH 3UYRH 2LU4A 4Y2DC 2B5IB 4G80A 4MA7L 2ZOKA 4FABL 4MD0B 1MPAL 8CGTA 1FORH 4L9LB 3SKJH 3CPLB 5CMAB 5IB1A 4WI7A 5L2KA 5D7LA 3VXQB 2XWTA 1H3TA 1NEZA 2PTVA 3VH8G 4YUEL 2OSLB 4NQVA 1LO3H 5INCB 3OAZH 4FXLA 4MNQA 5ID1B 4NCC2 1FYTB 1MWAB 3IAPA 3KAAA 3N9GL 1JPSH 3GBLA 4KRLB 4D9RD 4DFIA 3RWFB 4XWGH 3O2VH 3BXNA 4OB5L 3PP4L 3BP7B 2LU7A 1QR1A 4OLWH 4M9PA 1LGVA 5F96L 3G6JA 3MCLL 5BV7C 1MCEA 4NO0B 3S35H 3TBWA 4ACPA 5KG9A 1LP9B 2XN9D 1OAUL 1YPZA 3TO2B 2EDDA 2ESVD 2BOCA 4JFEE 2R69L 1XGQA 2F74B 1RK0B 5EC1A 4I3SL 3ZYIA 5DRZA 2H8PA 2VE6A 5F9JA 3V52H 3HE6A 2MCG1 1FZJB 4L3ED 2HT4D 3O2VL 5GZND 3LD8C 3QULA 1AXTH 3HNVL 3CAFA 1AGEA 3HC0B 4PJAE 5D7JC 2ARJA 3ZT5A 4HLJA 1JTPA 3MLRL 1M7IA 3BX7C 5GRVK 1CFVH 1FJ1A 3AAZA 1CL7I 3VFMB 1T0NA 4YHYC 1AO7B 1AY1H 1UC6A 5E08H 1XR8A 2V7HB 1YEKL 1Y0LB 3ZE0F 1U8PA 1PGRB 5IW6B 1NBVH 3H7BB 4OF3A 3OKKB 1FFQA 4N5ED 4U6TA 5SWZA 1LEKA 2MFNA 2A6DB 3FO2A 2NQCA 1I1AC 1SEBA 1I7UB 3ARBB 3JV5A 1UH2A 4LSPH 3WIHL 1M05B 2A74B 2DM3A 4M5YL 4KROB 1VEMA 4NWTL 4X6DB 1FYTA 2GTWA 4PY8J 3MRRA 4PRID 2DLFH 35C8H 4FNLL 3LOWA 3SJVD 2AJYH 4X0KA 5DJZB 3VCLA 3LRGA 5T5NG 4JHWL 2BSSA 2R2EA 3CFDB 4HGWA 3B8SA 3GJEB 5CJQL 3ZZ1A 5HHPB 3BT2L 2AJUH 1ZWIA 3VDAA 3W82A 2BZDA 3D48R 3AY4C 2WZPD 2Y9RT 3CPLA 5CMAA 5IB1B 4ZUSB 3FRUA 4L5FL 4J3UA 2YPKB 1EMTL 2XQBH 4YHZH 3VFOA 1SY6L 4MDJA 4PRBB 1KELL 5I1GH 1N59A 3CX2A 5JNYB 1R3HB 2Y06H 1MH5A 2IANB 2VUOA 4JFQB 1IAIL 2HWZH 4JEGB 1AQKL 1FDLH 3UJJL 3A67L 3RTQD 3WIIH 5FM5M 4QOKD 1BJ1H 3IDMB 5JR1H 4F7PB 4KGLA 3DV6A 2NTSP 4HULB 3O3BB 9CGTA 5JR1L 1QYGH 2G2RB 4KK9D 4WENB 2D7MA 4OAWB 4B0MM 2NZ9C 1FFPA 4KHXL 3KNBA 5DRNA 1BGXH 2VR9A 3U30B 4WTZA 1KELH 5EBLB 1FZJA 4YHZL 2QQNL 1I9EA 4M43L 1RZ7L 1JPGB 4OCRH 5J6GA 2LU3A 5KVFH 4JHAL 2BCKA 1KACB 1YEIL 4JGMA 2P7TB 3OSKA 3TO4A 4C4KT 4GO6B 5D7JA 4HKJA 1J1PL 3H9HA 4IMKA 3IGAB 3FB5B 4LRIA 3OKKA 4TULH 5C9KA 1IM9D 1EFXA 5ECJE 1JP5A 3MOAH 5E2WH 1JN6A 3SE9H 3MLWL 3QUZB 4JFHD 5C0EA 4GT7A 3GM0A 5FUCE 2RFXA 3VE0A 1INDL 2AK1H 5KZCB 1T0NB 2O5XH 4LSTL 2OTWB 5HJ3A 1I85A 5IK3A 4F80A 2VLLA 5ISZA 3H9SA 3RWIB 1SJXA 5ABDE 1QSVA 4U33A 1ONQB 3BZDA 4YHNA 1FLTX 3O2DL 1G7MB 3VGEA 4NJ9H 4I3RH 5K59F 1U8OB 1A7QH 4MHHG 1R3KA 4GG6B 3OF6A 1IQWL 1GPOL 1Y6KR 1P7QD 2EDLA 1B6DA 1Q1JL 3R06A 4HG4J 3GSVB 2I07A 4R4BB 3GI9H 2Q7YA 3P0YL 3QUXC 5AAWA 2PYFA 5FK9A 1K5NA 2YBRA 2A9NL 1EEYA 3E3QC 3T2NH 3RU8H 4YXHH 1Z2KA 2CPCA 3DLQR 4MDJB 2WP3T 1C1EH 3RZCB 1KLGA 1IEHA 2SEBA 1MREL 3E6HA 5HGGS 1MCKA 4PBVC 3PE9A 4IRZL 3LPWA 1QRKA 5HGDA 5JO5A 3KLHD 5I17B 4AEIL 1FL5B 2DJSA 1KFAL 4GW1B 4ONFH 1IBGL 4U6VH 2X1QA 4RIRB 4J6RH 2LTQB 5FYLH 3UTSB 3DX8B 4OLEA 4KJYA 2BXZA 3MBXL 3OR7B 4FXGA 5GJTL 1ZS8A 5KVGL 4JZOA 5HJ3B 5LQBL 1MF2H 1N5AB 3V8OA 3L6FA 3JWOL 4ZO9A 3MRPA 3MOBH 4M3JA 2PXYB 1N8ZA 1P69B 2WUBL 3SKJL 4WO4B 4HIIA 1ZHLB 2VNCA 4JFFE 1F8TH 1DVFC 4LCYA 1OGTB 2AV1A 5FUOH 3U7WH 2FJHB 3WNPA 3L7EB 1MWAH 1MFNA 1QEWA 3VMOA 1DQQA 3MV7D 5GQBA 4LEXH 3WFCH 4WW2F 5C6TH 4I3GA 5HHNB 4BH8A 4RFEA 4HIXL 3TYFA 1AGEB 2H32H 2BXYA 3HC0A 3HAEH 4J4PA 1A9BB 2DAVA 1J0HA 5EO0A 4D0BA 1QSFA 1MUJB 4CN4A 2QHRH 1VPOH 2EIZA 5D7KD 4NCDA 1LD9A 5C7XH 1LE5A 4IRJD 2X42A 4QRSB 2JE8A 3X14A 3BO8A 3D18A 4RCAA 3T8XB 5FA4A 3L5XL 5BVJB 4OD2A 4OZIA 3C60B 3WDJA 4Y4KD 3K81A 3OKMB 5D7JD 4TTGA 4ZUVA 1WITA 1XGPA 3IFLH 4QRQA 1SJEB 1V8HA 3CDGA 4MDIB 3RAJH 5IMOB 3X17A 4UUJB 2E9BA 5FYKE 4XRCA 2X4UA 3GMRA 2VB5A 3DO3A 4UAOC 3U4EB 4RMVA 4Y5XB 3RWCB 4WHYG 2H26A 2W60B 3QFJB 5L6YL 3MRBA 1CN4A 3F6IA 3AM8A 2OSLA 4NQVB 5INCA 3VI3F 4UT9H 1NC4A 2FHFA 3LN5A 3NZ8A 3CMOL 3PWPE 4Z95L 1RJLA 1BBDH 2H2PC 5EWIL 3WLWD 1W0VA 3T4AB 1IKNC 5I8OH 1ZHBA 3DI2B 4JO3H 4XPAH 3L5WA 1CDUA 4CDHA 3VFGH 2W1NA 4LSQL 3BEVA 4MJIA 2DQTL 1UZ6E 5SX5H 3MR9B 1JCKA 4OQTA 5IMMA 1PZ5B 4UU9A 5F97E 3TJHC 2BDNL 5C09D 5JPMB 1FVDA 5LXGH 1EJOH 3MLZH 3RL2A 3DMMB 3MCG1 3R06B 3SE3A 3VU2A 3Q6GH 2BHUA 4HIJA 5EU4B 4PRHA 3BVNA 4FQQA 4V2CB 5F7EH 2YD6A 1RJZA 3N1MC 5DK2B 5EIVA 1N6UA 2NY5C 1LK2A 4PG2C 4RFEB 1ZKAA 2NNAA 3CZFA 5I1DA 1C08B 5EFIA 3QQ3A 3ZKMD 3ZTJG 4PJDB 3WFBL 1BIHA 3HE6B 1NJ9A 1C7TA 4BH7A 3O8XC 3HNSH 4XC3H 3BQUD 4EI5B 1D5MB 1HK6A 1X5FA 4FQIH 2IQAA 4LSRL 2DJ4A 5EU6A 3HZMA 2HJLB 2GFBA 4ZUWB 1IAOB 3NN8A 1KLUB 1YMMA 4G9FA 1ZVYA 3CDYA 3NCJH 4NUGH 2R29L 4BSWA 3TIDA 4PV9A 5TQ0H 4F15B 1KTRL 3BT2H 1BD2A 1TMCB 5ADPL 3V4PH 1HHHA 1KCRH 4G9DA 3OJVC 2AJYL 3C6SA 3D0LA 2ZSVB 1GYAA 4BZ2L 3AU1B 5MERA 1JMXA 4P57A 4MAYD 5GS1C 3ZDYF 3GSOA 2F5BH 4QRRA 2FEDC 5ENWA 4UILH 4JFXA 1QBAA 3JXAA 2IAMC 3IDUA 3ZDZE 2IBGA 1GZQA 2YPLB 4IOIB 1XAUA 4FG6C 3O6FB 5T1MA 5B3JE 4GSDH 4K2UH 4GFTB 1MH5B 4PGZA 5CD5D 4JQVC 1KYOJ 3KG5A 3U30C 3HLAB 1F13A 4IOSD 2Y07H 3SKUD 1NDGB 4HLZH 3DYMA 1P53A 1MCPL 5J13C 1KJVA 4PRHE 1MCDA 1WCBB 5SV4A 4EUPH 5DUBB 3UAJC 1IGIL 5ESQA 1QFWL 3IU4H 5MP6L 5D2NB 5HGHA 4CU6A 1KCLA 5HHXH 5HY9A 6FABL 1I7RB 3HMXH 1GZQB 1OAKH 3VFWB 4IS6B 4WEBH 2W9EL 3SN6N 2ZUQB 2O5ZH 4N0RA 1KJ2A 3JUYA 4PV8B 2DD8H 1U9KA 3OPZH 4K9EH 4RBPH 1Q9OA 1SJEA 3UZQA 3EYSL 4Z7WA 2Z8WC 3IGAA 1SY6A 2EH7L 2J8UA 2VZVA 2A77L 2ED9A 4JRYD 3KPOA 4KJQD 4WU7A 2Z0BA 5CEZH 4RGNB 2DBLL 3SDAB 3T09A 3HAEG 3CU7A 4O2CB 3IVKB 3BMVA 1R5VA 2BSTA 2MJWA 5IBLC 2HVKA 1QO3A 5MHSD 4BQ6A 1WISA 2EXWC 1KN4L 1WEJL 4U1SB 4MXQD 4M6NH 4S11A 1UB5B 4PJ7E 1NCAL 1VCAA 1Q9KA 4I0PC 1B2WL 4NFCA 3NFSH 5FGCB 5CEZD 3FN0L 3P4MA 4BZ1H 2X4PB 1WWCA 2XTJD 4FQXC 3I75B 5E95B 1CTNA 4OIIH 3SCMB 1TVBA 5E70A 4OLZH 1CD1B 5I1IL 3C5JB 5EFIB 3DGGB 3OKDA 4U6YA 3U6RB 2A0LD 4PJBF 3VMNA 1CG9B 4KZEH 1U58A 1YQVH 3Q6FA 3RKDC 2D4FA 4XBPA 5T3ZD 3TNNA 1BX2A 3DRQB 1BF8A 4FMFA 1A7RH 3C2AL 3TBSB 5FF6A 2ESVB 1RU9H 2CMRL 2VDPL 4N8VG 4N0FB 2CKNA 4TUKL 4OCLC 3WLBB 3KHQA 3L7FB 5E2WL 3S36X 1JF6A 1FH5H 2CQVA 2P43B 4HZLA 1FYHB 5KVEH 5ADOH 1YEHH 3D69B 5L2KE 3IS1X 2R9HD 3DTXA 2CRIA 4P5MA 1IVLA 4W4NA 5ICZB 1MJJA 4ZAKC 5I17A 4L9LC 2DRUA 2WUBH 2DOCA 1A6WH 4JFDB 4QRTB 4C59B 5AZ2L 3UJTH 5T1KA 5IP4A 2EKJA 1I7TB 3TH2T 2YD2A 4J4PC 2OLDA 4NM4H 25C8H 5LQBH 1MCSA 2VLJE 3QA3B 4R7NB 4K94C 1KIQB 1BVLA 3BIKA 5T3ZH 1QFWI 3TIEA 2NX5B 5J3HC 4HV8B 4JPVL 1RZIB 4XC1H 2E9IA 3L3KB 4LDLB 4JRXB 3TCLA 1NEZG 5C0CD 3FT2A 1DJSA 2XZQL 1D5ZB 1L0XA 1I1YA 3JUZA 4PJAA 5MEQB 5I1EL 3QZWB 2XWBB 3KPRA 3NPSC 3QEQD 5AUMB 5FYKU 3HMXL 4TSBL 4QHKJ 3BZ4B 4FFVC 4UDUB 1FZKB 1QUNA 1ZHKB 2VDNL 4J8RA 2YRLA 1KIPA 5JMRA 3QDMA 1A7PL 2EC9T 4OLUL 4XB8A 4QKXB 3LSOA 2Q3AA 3UYPA 1BIIB 2YMXH 4DZ8A 1T83C 3QJFA 4RAVA 1RSFA 5D5MA 2PO6A 2EYTA 4X5WA 3ULVH 2P5EA 1G7JA 1S7UB 3NFPB 1YA5A 3MNVB 3GM8A 5HHOE 3MNWB 1U8JB 1HE7A 3SDYH 4GAYB 3ROLB 5EO9B 5F9OL 1TTFA 1ZT1B 4AENB 2AK4A 4GBXB 4UQ3A 4MYWB 3EJJX 1U8HB 4WO4A 1XEDA 4PRPD 3S37H 1A0QL 4GW5B 5SWSE 4W6YB 3HN3A 3O9WD 4QNPF 4XCEB 1KUMA 4YXHL 3RU8L 3OWEA 4PG2A 3D3VE 3KNBB 5GGTH 5KS9F 4PJDF 1LDPH 5CZVH 5I73C 2OCFD 3NAAH 1WK0A 4NBZB 4HLZG 3HNTH 4S2SB 2XT1B 1S3KL 5BS0D 4LCIH 4PGBB 4Z8FH 3EOTH 2A9ML 3KPSB 1IQWH 3S37X 1J9CT 4ODXB 3GJFK 2KKQA 2APFA 3RWDA 4WDIA 3EYVB 2RCSH 1MCQA 2P4AB 3I6KA 2UVEA 5DD6B 5EOCJ 4UZGA 3ARGA 4XXDA 5DD5H 1BQLH 3W9DB 5EZLA 1A1NA 2AJSH 3VFUB 1PZ5A 3O6FC 2VXTL 4D9QD 1J8HE 2AI0H 4I2XB 4KI5F 4HS6A 3T1WA 4Y88A 3MV8B 4LLWA 5EN2A 3JWOC 2ITDB 1UCBH 1KJMB 3QI9D 2KBGA 2FH8A 4XMPL 1GIGH 1MHHA 3O0RH 2VLJD 4LCCA 1IC5L 4AG4L 2OP4L 4N9OB 3ARDD 4ZQKB 1G6RB 4QGTA 4QRRB 2Z8SA 2NR6D 1TZHB 2IMNA 1A6PA 5HHVL 1RV6X 4L4TE 4HFUH 4HUUA 1J88A 2UZIH 5GRXG 5DTFB 3U36B 1WFUA 2NY1D 3VXUA 2R1XA 2VLRD 4NYLA 4NJAH 2FR4B 2ORBH 4KTYA 2EDXA 4JFED 2H9GA 5TFSH 3B5HA 5HGBA 3PWUA 1VERA 1YNKH 5EWIH 5CUSH 1IEAB 4NPYA 5DMGD 2XPGA 2BP3A 1NMCC 1D9KB 3QB7C 4RWHA 4RISL 3H9SE 1IT9H 4X6CA 4ODBD 5AD0B 4CDGC 2D0HA 5GGVY 3MRLB 5C07E 5CWSB 1F2QA 1H3PL 4A6YB 1BD2D 1FN4A 1P7QA 2BCKB 5DFVC 3ZYOA 2AKRB 3AS2A 3BUYA 1A1MB 3PGCB 5GZOD 3T4YB 3VWJA 1KNOB 1VSCA 1AQDB 3I02B 1FG2A 3PGFL 5DJCB 1DEDA 2CDGA 5FM8A 5DJXB 4GAJH 4UT7L 2J6EA 4HPYL 1G6RH 2BC4A 4QOKB 3TYGH 3LKRB 3RWEA 5F9WB 4Y4HD 4JDZB 5EOQH 2XRAL 5LAXB 4YZFF 5C0AD 5BQ7A 1T7VA 4O2CA 1DBKL 3U2SA 4PJ5E 3TA3A 3P11H 1CDYA 4XVTL 3TIEB 3FAXA 2JJVA 3KYNA 5EC2A 2CIKB 4P3DA 1CQYA 3CXDL 4OTXL 3SOBH 1S8DA 1AIFB 3PWNB 5F88A 4E42A 4GXVH 3SO3B 4I5BB 3RKPA 5IVZB 1EO7A 3SDYL 5EPMA 3U9PH 5T1LD 4HXAH 2XYCA 5C6WH 2YR3A 4QXUL 43CAB 3MO1B 3DOSA 3MREA 5F96H 1D9KD 1EVTC 2X1XR 4ZS7H 1GVIA 2GYSA 4FQXA 4OZGF 1GGCH 1T7ZA 3IDNA 4EJ1C 4PRAA 1RI8A 4TOYL 5L8LB 5IVXA 3O4LE 2GJJA 3SGEI 1HZHH 1BFVL 4HS6B 5ICYB 2F5AL 5DJZA 2O5YL 2NLJA 3GSQA 4LCWD 3TLRA 2XZQH 4YE4H 4LOUD 3QIWA 2A74A 4ZUVB 1RZJL 4DCQA 3MRQB 3QQNA 4HCRH 3UTQB 4QHUA 3U0PB 5B4MD 1U2HA 3OR6B 4ODTH 5GSVB 5E00A 5FDYA 1CFNA 4P23C 3MJ7A 3ZDYE 1D5IL 3IDXL 2VLRE 3NABL 3GKZA 4WY7H 1SHMA 3RWEB 3SE3C 1NUGA 1ZT7B 4ODUB 4UQ2B 4IM8A 5LBSL 1U8PB 3F5WB 5C08D 5T3ZL 3TNMB 5HYQB 4G8GB 3LEVH 2DMKA 4GXVL 4PJBB 4U1GB 4WUKH 3H9YA 3KWWB 4UOW0 4Y0GA 4RGNC 4ONGL 4NC1E 4YGVB 5F9JB 3D39E 5IUSA 5B38B 1T1ZB 1FN4B 1FIEA 1K6QL 4GRWE 3SDAA 1VFMA 4WI2A 4GBXA 3LEXA 4HIIB 4KVCL 4OBSA 4BSVA 1KN2L 5DVKA 1BQHB 1MLCA 5DFTA 2IGFL 1QHPA 2PXYC 4FQ2L 3S5LB 4P2CG 3C9NB 5HDBE 1CTOA 3VFSB 1QRND 2QSCL 3TN0C 3GRWA 4H0GA 4TUJB 1UWXH 2UZXB 5ADOL 1JWSB 4J3XA 5I8EB 1IAKB 4UTBH 3OR7A 5CP7A 2XZZA 1ROWA 3GHEH 3QG7L 4JVUA 3C6LD 2EYSA 2LV4A 2QJDA 2BY1A 2IH1A 4Y16A 5EPMB 4L3EB 5EULV 3FONA 3MCKA 3MQIA 3L3KA 4N1HB 1KLGB 2IAMD 3QIWB 4OLZL 1JPTL 4OZIE 2W0LA 1YEGL 4LIQE 4YDKL 4OM1H 1RUKL 1MCIA 4HV8A 1N6VA 4DKFL 3U2SB 2AGJH 4P2RE 2QQKH 5D7KE 5IBTL 1S5IL 3QA3A 4Q2ZA 1UYWL 1RIUL 1QLRB 3MRNB 4EN3A 3DHMA 5IG7B 1U8KB 2XICA 4XX1E 4HWZB 4UAOB 1CFTB 4MJ4A 4XB7A 1S9XB 3MBED 4LK4A 1ZV5A 1Y6NR 3F7QA 1U8OA 3OGCA 4ZUSA 1IL1A 2P24B 1CFSA 4WJ5A 5CIPH 3MJGX 3GMQA 1AIFA 5HHPA 1A1MA 3PGCA 4P9HC 3P0GB 2EICA 1A4KB 2DQJL 1NLBH 4X4YA 3QO1B 4NRYA 4KXZH 1QNZL 1MCHA 2IPKB 4C57C 1TCRA 5BO1H 2VZSA 4YK4C 4H5SA 2XIDA 5IW1A 4MJIE 2DBJA 5EU6E 3CXHJ 5MP6H 3CIQA 4WFGD 3JBG7 3M1BB 1U8HA 2VSDA 2AJUL 3QIBD 5FIEA 1XF4A 4M3KB 3KYKL 4RAVB 5E1AA 5FCSH 5GRJL 1ORQB 2NY2C 2E7BA 4DN3L 5DJDB 1MI5A 3WN5B 5FB8A 3DJ9A 4X99B 2H41A 3EHBD 2A9NH 4X8JA 1SEQH 5KOMC 3QUXB 1O7SA 32C2B 1S7WB 4RQQB 5IBTH 3V6FA 1KIPB 1MCCA 3RUGB 5IIEB 2AJZA 1PKQB 3QJFB 1I7ZA 3BUYB 4H88H 4AT6A 1A3RH 3T0BA 4KJQC 1S9VA 5ESVA 2DLFL 3JVGC 3CLEH 3WIHH 4NNXB 3S3SA 1JGDB 1JV5A 1J5OH 3FQNB 2FB4L 2OL3B 4HK0A 4OJFH 4XH2A 4RGND 1DQLH 3RL2B 3PDOB 3KYMA 1RY7B 1W72L 4I2XA 2H32A 2UWEE 4MAYA 4U7MA 4NQDE 5E4EB 1YNLL 5DGRA 5GRWA 2ATKA 2IF7A 4FS0A 4CVZA 2FGWL 5F44A 1Y6MR 4H1LB 3PWPD 3GSWA 4KRPC 3AROA 3L3OA 3QDJB 3DPBA 3RWDB 1UB6B 3RDTB 3ZSTA 5F21B 2JJSC 2VC2H 3UAJD 5DJAA 4YC2B 2NY0C 2BSED 1HNFA 5DMIL 4FFZL 4V1DA 5HYJA 5I1AB 1UM6L 4UBDC 3GIZL 2EDYA 2JCCA 4FQ1L 3MO1A 5ENWB 1HILA 5D9SB 5DHYA 3EW3B 2AABH 4LCUA 4M7JH 1S78D 4XNXL 5CBEA 3TH4T 4LHUB 4L9LA 2PW1A 4LRNL 3BRGC 3RWCA 3T0WA 4YAQB 1T89C 4JM2B 3P30L 5HI5D 2B1AL 4N68A 1SQ2N 2GY5A 2P8PA 4QRPD 4Q6IB 4M7KH 3V0VB 1XGPB 4CJ0A 4HBQA 3PWJB 2GK0A 3P9LB 3BP4B 4R3SA 4MAYC 4LIQL 7FABL 5HI3C 2FECL 2O26U 4PRIA 1U8LA 1X5LA 5GS1A 4GMSL 1SBSH 4NRXB 3DVIA 1MPAH 1CICB 2YEZA 3HPLB 1A21A 1X7QB 2QL1A 4X6EA 1UENA 3VXSD 4NBYB 1DQJA 1H0DB 4F2MA 3DWTA 15C8L 5C3LD 3QUYB 3KLAB 4XVJH 5EUOF 3EFFA 2AJZB 3SDXE 1HQ4B 3MLPA 5M94B 1NQBA 3QUXA 4M1CD 5ILTL 4QTHB 3UBXA 4PJGF 2J8OA 4ZO7A 1P7QB 1S9WB 1BPVA 1XGQB 4BFEA 3ELAT 5B39A 1H8NA 1F00I 2VYRE 4XPBL 5HGAB 2W65B 4NC1C 1GGCL 1NFDB 1ZGLB 5DRXB 1BZ7A 5C0AB 2B4CL 3PDDA 4F7EB 2IPUG 3MLUL 4RMTA 4JFPA 4P2OD 4GRWB 3WFDL 2OXGA 1Z9MA 4H1LH 4L3AA 1INEH 4LSVL 1JGUL 3H2WA 5DD5L 1U8NB 2H2SD 2PW1B 4HW6A 2QKIB 1BM3H 4Y4FA 1IMHC 5C92A 1IRAY 2I5YH 4E5XB 1O0VA 4P4KA 3L5XH 2NY4C 3I85A 3P0VH 3MREB 5ICXB 2I9TB 1FZMB 2HP4A 4XXCC 3ZKSD 2AEQL 5E24E 1RJLB 4JANB 3ARTA 3NAAL 2WINB 3QDGA 4MQXD 4K7PH 1XR9B 5AYUH 2EDBA 3PWNA 1UZ8A 3DXAA 3ISWA 3LH2H 3ZL4H 4PRHB 4NFDA 2P5ED 4KQ4L 1B4RA 2Q86A 2CIKA 4P3DB 1KB5B 1AR1C 3QO0A 5LGJB 4NGHH 3SKNA 5DEFA 3O8XB 5C0FA 3GMRB 4DUVA 4XVJL 1KIUA 3DI3B 5JNYA 3K80A 5KVMC 2GTZA 5F70A 5CEXA 3JTTB 4ODTL 1OQXA 1U58B 3HZKA 2LVEA 2YPKA 2AXGA 1IGMH 1FGNH 5B8CB 3QDME 4HUMB 1CD0A 1F97A 3E6FA 4YQXH 3FO9B 3O9WA 2ADIA 1F3DJ 1IT9L 4P57B 3PDGA 3S3PA 2ZCHL 1MJJB 1OW0A 2WMPA 3QBTB 3K2UL 4K94H 4KMTL 4RQQA 3V6FB 4RSVA 3RNKA 2W0PA 4G9DB 1MCLA 1S7TA 3CFEB 1DN0A 3RHWF 1D6VL 4OZFG 1LEIB 5DUMH 2FJGB 5E9DD 5E2JA 1G0DA 1AC0A 1CL7L 1U8MA 3U1SL 5E6YA 1FNSH 1FORL 1MFBL 1D6EA 4RRPG 1NCUA 5E8NB 5EZIL 4JY6B 3BWUC 5DK0B 4AL8H 2IAMB 3S9DB 3RVTD 4Y4HA 1G0XA 5JIPA 4HWEL 4LSDA 2B20A 5F7DA 5C0GB 2VH5H 4NKIH 3LS4L 4JY4B 3G5VA 4JM4L 5INDA 5D96B 5IBUB 4S1QH 1L0YA 3P11L 3FHQA 1LNUA 4D8PA 4YDJA 3OGCB 5F72S 3CLFH 2FJGA 4HPOL 2PYEA 4Z7VA 4ZFGH 5JXED 2IQAB 2IFFL 2LABA 5I1DB 1YNLH 3TBYB 2J6EL 4PS4L 3OHXA 4DGVL 3HKFA 1FAIH 1NGZA 5HYSB 1NUFA 1QHOA 2R2CA 1NJ9B 4OKDA 4H20L 3HA0A 2GT9B 2VAJA 2DQGH 5GPRA 1KCSL 1J1OL 2W92A 1KCSH 3QEHA 5HGDB 5IFJA 1HSBA 2VDMH 4FZ8H 5JZ7C 2DQIH 5I1HH 2DM4A 4E41A 1FH5L 1NDGA 5IT2H 4L8SB 3MV9B 3NCYP 3S4SB 3QNXA 1NSNL 1Q9OB 1I8LC 1RPQA 2ZJSH 5C1MB 3LMJL 4ODHL 3DX7A 1UFUA 4NM8L 5T1MB 4YPJA 1UM4L 5HHQA 5D1XD 3VXUD 3L1OH 1RFDL 2E8YA 3HR6A 2DWEA 4A2LA 1XCQA 3EYFA 2Z9TA 4ZS6C 4JGUA 5T3XH 1ZXQA 5GRJH 4TVPL 4H25B 1L7TL 2YOCA 1MAMH 1VDGA 5I19H 2GJ6D 5DHVB 4PJCB 1DLFH 3QEGH 2D31B 5JQ6L 3CSPA 1MAJA 2FHBA 1T0MB 2YD8A 4U6HA 5SWQA 3X11B 1SJVA 4JO1L 4CMMB 3W9EA 4OCRL 2WWMC 2HVJA 1CZ8H 1ZLSH 5L2JB 4GLRI 3CUPB 4P3CL 2FZ3A 3IU3A 4XNZB 3S35X 2RFXB 1ZE3C 1NFKA 4NZTL 3O45A 2ZCHH 2QSTA 3BESR 4OBRA 3S97C 4FP8L 4X6DF 1FCCA 4MD4A 1AGFB 1YYML 3QUMA 3TFKD 4HS8H 2EDOA 4L8DB 1V3LA 2YD9A 3TM6A 3JSSA 2MPAL 5GGRY 4EDWL 7CGTA 1DQQB 4L8BB 1MFAL 4F8QA 3U79A 2R4SL 4M6ML 1JRHL 3DVNA 4AZ8A 4F58H 4JVPA 1QSFE 3N06B 2IPTH 4UINH 1YEEL 4M7LH 2VR5A 5ESAB 5GS0H 4MLSA 3MRLA 1XH3B 3TBVA 4PJIB 4UIMB 1NC4D 5JIHA 3KS0J 3PNWB 2FDBP 3M1BA 2FJHA 3BQUC 1NCBL 1KGCE 1ED3B 5FA3A 5IFHL 1A0QH 4MA3B 4WV1C 4OGXH 5DEGA 5T5NF 2F8OA 2BHYA 4QRRD 4X9BA 3S37L 1HHKA 1ZHLA 1KULA 2IAMA 1BBJB 1KIQA 1B4JH 4BYHA 1U95A 4IMLB 4Z7QF 3QDGD 3HG1B 4BM7A 4MXQC 5DQ9B 2AP2A 1ZHBB 4M5ZL 1EHXA 3SDAD 4EBQL 1DBMH 4Y4KA 4RRPA 4TVPE 4KROC 2VDQH 1LEIA 2K7PA 1MWAL 3O4LA 4OIAA 3TN0A 3IYLW 1J87A 1HILB 5D9SA 2EDHA 2DTML 4JG1L 5I8CB 1A7OH 2H3NA 5IFHH 1IM9A 1EFXD 1YN7B 1HKLL 4KRMB 1A9EB 3SKOB 1FV1A 1F3JA 3MOAL 3RY5A 1I1FB 4W4OA 2NXZB 5BVPL 3S34L 4NN5C 5BRZA 1CE1H 5IJKC 4APQB 4Y19E 3I9GH 3VJ6B 1QLEL 3E1F1 4L8SA 3S6CA 2XZAH 4EVNA 4JPIB 1BOGB 2P5WE 4PB0L 3SDCD 2IBZX 1MRDL 5CBAB 1JIBA 1QFOA 4TTDC 1LMKA 2NY6D 1Z0NA 1IBGH 1U6AH 1X5XA 1BHGA 3OKLB 3QUYD 1BGXL 1JZ5A 1F5WA 1G9EA 1R3KB 4JKWA 4Y5YA 2WINA 5TH2A 1HOCA 2C3XA 3U0WL 1OAXH 4MCZA 4PJGB 5HYSG 1WAAA 3JZ7A 3WMSA 3VFSA 4FG6D 2XWJB 5K9QI 3KPMA 5IV2B 5AD0A 4D0DA 4O2FB 4WNQA 3I3DA 2AEPH 4G5ZL 5E9DE 5C0BE 3OG4B 4XGZB 4JFYB 4PJ9A 5FM5O 2VLLB 4JZJC 2Y25A 1IGFL 1AE6L 3Q6GL 1WBYB 5JXEA 2C3GA 5IJKA 3T0VA 5C2BL 4HFUL 1NUNB 1DCLA 5LXGL 1U3HB 2FL5B 1JN6B 5GGTA 4PG9A 1CXHA 3JWNC 4KK5D 3VFGL 1WJ3A 4GS7B 1N5AA 1G7IB 4NQSA 3GGWB 4MNHB 2NXZD 1MCPH 2HFGH 4G8GA 1J86A 2E6PA 2Z93A 2J5LC 4P2QE 2I60H 2R4RH 4LCCB 3G04B 1GAFL 1IARB 5FGCE 5I2IB 1U36A 1C5CH 4XPBH 3U9UB 2EIEA 4GW1A 4GKZA 4DVBB 3KLAA 3GMLB 5E00B 1L7IH 4Z6AT 5ILTH 4XNYH 1QFPA 2FIKB 5KAQF 2ADJA 4DCQB 3E6HB 4QO1A 3DBXA 4HIHA 2NY5L 2E7LC 3JTTA 1F6AB 4XCFH 1UWGL 3N0PB 4K71B 1NC2B 1NAMB 15C8H 2CKBL 3WD5L 2A1WH 1ZVSB 1JGLL 2VL5A 4LASL 4XZUB 1PD6A 2V7NB 3HC4L 4XPGL 4OFDA 4UI2A 2I07B 1HCVA 2Q86B 3IDNB 4EOWH 5ALBL 1I8IA 3HE6C 1TZIB 3QEQB 3RPIB 2F19L 4D3CL 5ADPH 2MOVA 1RUPL 5JW4Q 1FNEB 3RP1A 1T5XA 5DVNA 1FL5A 1RQ5A 3T0ED 1RIVH 3QIUC 2I9TA 2X5PA 4KUCD 4YHPA 1ZLSL 2HKHL 1YC7A 1HXYB 4PGCB 3PJSB 1HIML 3VXNA 2H2PD 1KXTB 1BBJA 2UZIL 4XP1L 3F58L 2IALA 4LMQE 3WV0A 4UMGA 4OLWL 2AQ2A 1U91A 1WGOA 1DZBA 3NCFB 4P2RA 4CGTA 1KEMH 3Q5YA 4Q6YA 4DFHA 2VOTA 1XR8B 3GHBL 4UOJA 5JUEL 3SO3C 4Y4FD 4TNWK 1H15A 5D1QA 3NCYS 3OX8B 1U8IB 4FQLH 4RFOH 3ARFA 1IGML 1TCMA 3G08B 3MRFB 5BMFL 4NHUB 1JHKH 3HMWL 3D9AL 3MLSL 1R0AL 1EERB 1LQSR 1AJ7H 3QQ4A 2FJFB 1P1ZA 4X4ME 2VDOH 2WW8A 5MEQA 5SWSB 1KV3A 2D03H 5BZWB 4ZD3L 1O7VA 1GXEA 2VXSH 5D1ZC 2GSGA 3T3ME 4ZOCA 2CXKA 2YD4A 5FHAH 5KJRL 4JRXE 4UQ2A 2YZ1A 2CLVB 2ZPKH 4J23A 4WU7B 1NCWL 1J0IA 2ILLA 1JRHI 3ZL4L 1HI6A 1KTLA 3BP4A 5I15L 3PXHA 1D6EB 3DSNA 4XBGB 5E2TH 3MLTB 3L5WB 4OSUL 2GUOA 5A3ID 1NL0L 5DJ6B 1MFDH 3KLSA 1ACYL 3QI9B 4JFDA 2PW2B 4QRTA 1ZLUH 2JLLA 5I0ZA 1JFQH 4NO2A 4WFGE 1EUTA 5DVLA 3VGBA 2Q8AH 4DAGH 3B3IA 4OUUA 3FMGH 2VZTA 1CU4L 5EZIH 5C2UB 3VFVA 1JHLL 5DZLA 3CFDA 4LPXA 1UADC 3Q0HA 4FZEH 4Q9CA 3L3IA 1T5XB 3WFDH 3BZFA 2JB6B 4UV7L 4JN2A 4HD9A 4QEGA 4J3WA 5D71L 4KZEL 3P77A 4UUJA 1ES0B 1A8JH 4MNGB 5F1IB 1NC2A 4WWKA 1ZT4A 4XMLH 3N85H 4BUGA 1XF2A 4BQ9A 1KF9B 2P48B 3MLWH 5FA4B 4OLYH 3U6RA 4LEXL 3RL1A 1G7PA 3HUJF 3WFCL 1X3DA 4IBLT 3WL9A 3B6SA 3KPQA 4HJGB 5CSZA 5TDNB 3ZT7A 4JRXD 2V2WB 5JXAH 5HD8C 1CDIA 3WNMA 3WHXB 5KS9E 4MA1C 3L3JA 3X12B 2Y23A 3HI6L 2VSCA 4PYHA 3FQNA 5D93C 3ZHKA 1BZ9A 2BSSB 3LIZL 1JWMA 1DSFL 3QCUL 3FB8B 4I0CC 2ZUYA 3QQ4B 4NGHL 3K46A 4HK3J 3PHOB 1FIGL 1Q9LB 2HJFB 2P44B 4NHUA 4KKBC 5DJ6A 3GI8L 4N8VB 2EH7H 3UZVB 4JG0L 3K3QA 3O41A 1J1XL 4OD3H 4X99A 4NNPH 4QXWA 1P4IL 1U3YA 4POYA 2MHAB 2XA3A 3OTTA 1MCRA 1AGFA 3MNVA 4FZ8L 3S5LA 2VJXA 1U93A 5L6YH 1BQHA 3H9HB 4KQ3L 5C0AA 1KLUA 2P8LA 5F7YC 1TCRB 1P5UA 1MREH 4KKCC 2ED7A 2PCPA 1KXVC 4NN6B 1Q94A 3ZDXE 1FPTH 3VGFA 2WWKT 3HPJA 1RZGB 4R0LA 3EFFB 4JO2H 1JNHB 2DIJA 1BVKB 1GGTA 3CZFB 1D5ZA 1DLHA 2M1KA 1RZKC 4HSQA 3WE6B 1IAIM 4KK6C 1DUZA 1JBJA 1FVCB 4JFFB 3WHXA 5D7SH 4MLIA 4GRWH 1FCGA 5E6ID 3DXAE 4OGAC 2IADB 3RL1B 4GOSA 5BRZB 5C6TL 2XTLA 1BOGA 1CGVA 3SE8H 3QO0B 3NPSB 1J5OL 1H5BA 3FQTA 1TJGL 2KZ1B 4RX4D 3V5DB 1J8HA 3MRJB 3IFNH 3O6ML 3WFEL 4GG6A 3BZFB 4R97B 3V2AR 1HHJB 2FYYB 1WC7A 4XCYB 3TT3H 5A2LH 4Y5VB 2APXA 5TGBB 2EZ0D 3W81A 5IQ9B 5E94B 1TENA 5CKAA 3D0LB 3G9AB 4BKLA 3HFMH 1OAXL 3AM8C 1A47A 1A7PH 4F7CB 3MV7B 5ISZB 3KYKH 4PJ8A 1T2QL 4JRWA 4NUGL 1YYLH 3MRIB 4NJAL 3NCMA 3HHRB 1JHTB 3DECA 3V4VL 1OL0A 3IDYC 4N0CD 1E4WL 1MNUL 4UOW1 1QSEE 4Y1AA 2DLHA 4HUWA 5C0RH 3ILPB 4CVZB 1IQDA 1N4XL 3BFOA 4HIHB 3CFJA 5BXFA 3ARQA 2A73B 3D2UD 1YZZA 2NTFB 3GSNB 1GIGL 2CLZA 2PETA 4NM4L 4X6CE 4GG8A 1G6VK 2OJZH 3C60D 1CD1A 3RZWA 2FEEL 4JFYA 4ZUTB 4QTHA 4K3JL 4JDZA 3UJIH 1PBYA 4B50A 4XPGH 5FO8A 3QUZC 4G8EB 1SYSA 3ARDA 1PKQE 1WBXA 4I18B 4X98B 3RVTC 3MRHB 4OT1L 3ULUC 3MGTA 4NNXA 1YY9C 1A6AA 4JPKL 2AGJL 3RY6A 1B0RA 2Y7QA 4U7KA 4D8PB 3K8LA 3L3JB 4YX2L 2EC8A 3IDMA 4M48H 2Z4QB 4E41E 4LCYB 3C5ZD 2FL5A 2CLZB 2KL6A 2R56L 1G7PB 1EO8H 1ZGLM 3QUKA 3W0WD 1HHGA 4JY6A 1BBDL 2VERN 5KSAD 2ICWA 3L3DA 4UBDD 2IALB 5BJTB 3L6FB 3PWVB 3X11A 3C2SA 3H0TA 3HRZA 3ARWA 3PWUB 4TTDD 2VQ1A 5C0IB 2DQDL 3NOIA 3P2TA 1RAMA 3I6LE 5ELIA 4Y16D 1OP3H 3BPOC 4Y5VA 1ZSDA 4DQOL 3FOMB 1HQRA 4HFWB 4Q9BA 3LKPB 1UVQA 3WNLA 3BZEB 1EHLH 4NQXA 5E6IA 1CE6A 4ZOAA 4NO0D 1J8HB 2ICEA 3LKSA 3EYQD 1J05A 2R0ZL 2QEJA 4GRLD 4YHLL 1URLA 4FQIL 4LQFL 4LVHB 3DX6A 1HI6B 5K33A 1FGVH 1N64L 4G43A 3KPLB 3EYUH 1FFNB 1PW3A 1I9RH 1VESA 4MAYB 3O0RL 4G6ML 3JTSA 4MMXC 1K4DA 5C09A 3ULVD 3DRQA 3EOBB 4ORGB 1V7MH 4XCNB 5EIQA 2R2BA 3GBMH 4WUUE 4WW2C 3FFCB 5FXCH 1XH3A 3EKCA 3OHXB 4R8WH 3IDJB 2EEAA 3FB6A 4P2QB 3LKOB 5J7CC 4A6YL 3EZJB 4O4YL 3I02A 2JF1A 4HEME 1EHLL 3DUSA 4HGKC 3P73B 4PLOB 4LU5H 2HKFH 1VGEL 2ZG1A 2C4FT 5JOPE 3F7VA 4HX1B 5GS2D 4N9GB 5EA0H 3TBTB 3B2VL 3OXSB 4ZPTA 1XMWA 1S7SA 4IRJB 3RUGE 1E27A 1WBZB 4U7SA 1CIDA 4QHLA 4R6UA 4ZFZB 4FZEL 1WFOA 1AP2A 2CR3A 3S36L 5DUPH 4C83B 5KW9H 2AK4E 4PRIB 1F42A 5DFWH 2YPLD 3GIVB 4PJFA 3HB3D 2BERA 4XNZC 3LQMA 3UTOA 3BAEH 4W81A 1BP3B 2DQCH 2ZCLH 2VLMD 3W5MA 1T1ZA 4WVRA 4ZO8A 1RJCA 4NQTA 3L3GA 4XBEH 5HHMB 1IFHH 5I6XB 3ZHDA 5MEPB 3V95A 2ADIB 1HHJA 3AS1A 4UV4L 5CILL 2OBGA 1ZLWH 2AXGB 3C6LB 3P0YH 1MRFH 1CLYL 1WIUA 1ZT7A 3V4PL 3HNVH 5IB4B 5D7LE 4X7TB 1JF1B 4LLWB 1F58L 1CFVL 5HHQB 2HTLD 1MCBA 2C1OA 1EJ6A 4ETYA 3DURA 1QRNB 1DL7H 2GK0B 5HPOA 4GH7B 1NGWA 2JK5A 4OZFB 5I1EH 3MROB 1KTDA 1QKZL 3PGFH 3S88L 1F90H 3PHQA 5HDOA 3S4SG 4U6HB 5SWQB 3BH9A 1WEJH 4UIKL 5FUZH 4B7IA 1A9EA 3K8KA 3TZVC 4IHOA 4IOIA 4CADB 1YJDH 3HPJB 4NCC1 1TVHA 4PFEA 4TUOA 4RMWA 5TF1H 4X6BB 4YDLC 1OSZB 1SYVB 1JPSL 3LKNB 3QXAA 5E9DA 1CDBA 3PV7A 4NO3B 2YPVL 3T65A 2OTUA 2FCBA 4GUPB 4WI4A 2WBJD 5KVDH 3GSRA 4JY4A 4DKFH 1JZ3A 3KYNB 3ARBA 2EDRA 2EH8H 2V5SA 4BFIA 5C71A 4EUPA 1BJMA 2AJVL 5TDOB 4ZG1A 4KJPC 3PG2A 4WEUD 4YDVB 2GAZB 4S1SL 1IZKA 3D25B 4BK4A 3DO7B 3VWKA 2R39A 3NIGE 4JFEA 3RWJA 5JOPD 2XWJA 2CKBA 2EIBA 2BC4B 2Y5EA 5CLTA 5DD1H 3LMJH 4ODHH 4Q9RL 3NACL 1MIML 1WBXB 1UWEL 4OGZA 1HH9A 5F8QC 4FTVD 1RFDH 2ZUVA 4P46A 4XVUD 5TPWL 3VXRA 1PDKA 2C3VB 2ZG3A 4G42A 4MCYA 5INDB 1QPPA 2C5DC 1X9QA 3DIFA 3WEXA 2BNRD 5HPMA 1H8SA 4R4ND 4J3VA 1CU4H 3WL9B 5GSVA 3TYGL 1T83A 3OMZA 1MHPL 1UQSB 1ORQA 4ZYKB 4NUJB 1ZANH 2DI7A 1IE5A 2E7HA 2F53D 2YA1A 5I1HL 1T66D 3RWJB 5JW4R 4ORGA 5DRWB 1MJ7L 1FLRL 4ZPVB 5EU5A 4C55A 3BKCH 4OCXH 4FQCH 1B3JA 5E2VL 1JGEB 3WHE0 1A4JA 2D7OA 3VXTB 1UWEH 4ONGH 4J7RA 3BEVB 1RK1A 1AO7D 3NACH 4OFYD 4CNIB 3QCTL 5IEKB 4CMMA 3SDXF 3ZTNL 4ODVH 3GMQB 1S7XB 2G5BB 4KKAC 1RUQH 4I77L 3EFDL 4YIQA 4V1DE 1FNHA 2FB4H 5DK3A 1ZSDB 3VGAB 3UTTA 3KXFB 4EI5C 4JFZH 3SQOL 2X2YA 3GBNL 4I2XE 3L3OB 3QDJA 4AMKH 1D3CA 1NAML 1V3MA 3ESUF 3H42L 4H88L 2A2QT 4QYOB 3WXWL 3E3QE 1X44A 1EIBA 2PTUA 1UB6A 3RDTA 5EBWB 2OR9L 5LWYL 1T2XA 4DW2H 5DLML 1YMMD 1EXUB 4JPWL 6FABH 4LIQH 4E41B 5GZOC 1QG3A 3N85L 4GMTL 5DFVD 5ITFA 4KHXH 3LEXB 4UNVA 4FQHB 4PRIE 3ULVE 4JKPH 1LO4H 2H32B 5KSVA 3QEUA 4YDIH 1VGEH 1VFAA 5LJYH 3RIAF 1ZA3B 5GHWL 3D3VB 1ONQA 4GKOA 4LP5A 1Q72L 1ZGLP 4OZGB 4LSSL 1S9YA 3WNNA 4U0QB 5DMJB 4PGDB 3P9MB 1XZ0A 4GBXC 4HC1A 4LLAA 1RUML 1PX4A 2VXQH 2QKIA 2HG5A 4QHKI 5F3BB 4LDOB 3QIUB 3TNMA 1WF5A 1ODAA 2A9MH 4CJ1A 4Z78A 1OAYH 2F54A 3BIBX 1A7NL 1U41A 3GMOB 4M1CC 4HJ0D 3BPNC 4NRXA 4OI8A 1N0LA 4P46C 4YNYB 1DEEB 1QBBA 2Y1VA 5SWZD 1YUHB 2B5IC 5L9DH 2JJWA 2DWDA 2N7AA 4RNRB 2AK4B 1MFEH 2YRPA 2NY1B 3QI9C 4O9HL 1CDJA 5MEOB 5IMKB 5D2LF 1NEZB 1C12B 1CFSB 1X4YA 5KAQG 2APWA 4JCMA 5TH2B 1BZ9B 1GZPA 4MJ5A 3ARRA 2FX8H 3V0WL 3I2CL 1RUAH 1WWBX 4J8RB 1GH7A 3UTTE 2BJMH 4P5TB 4X6BA 1N7ML 2EKSB 1FBIL 1KJMA 2XWBA 1QQDA 1PY4A 1S9XA 5HI5C 1A22B 3MXWH 3RY4A 3EZ8A 5ACZB 2UUDH 4NHCH 4Z7OE 3CJJA 1H3VA 5EU7C 2GTZB 3DV4A 3WKML 2X4QB 3H3PL 3ARFC 1T03H 4APQA 2Q6WB 3ILQD 2F15A 2JCCF 3BKML 4DKDC 3AREB 2NX5A 1A1OB 4GXUM 4I0PA 4LPCA 1CDHA 3FRUB 2NY0D 1CXIA 3RGVB 1Z6JT 5LKNA 1J1PH 2Q7YB 1GRWA 2GITB 1R5IB 1EV2E 1T21A 4DOHE 4LARL 3L9RA 4GRMB 4LLQA 3LQZA 3UEZA 3WSQL 4KFZC 2R0KH 3ZT6A 2YWYA 2B39A 1I4FB 3C8HA 2HT2D 4X8XA 1WT5C 4JANA 3GGWA 4Z7UF 3U7YH 4UDTA 3ARVA 1SM3L 2GTWB 3KLDA 1F45A 3GSWB 3TWCL 4M4PA 5B38G 4D9RE 1OTUC 1CIUA 1BWWA 3PL6D 3EYUL 2CO7B 1MHCA 1X5GA 4MQXC 1CQKA 2J8UE 4KK8D 5C0AE 1YPZF 3REWB 1PFCA 4OCWL 5DEGB 3BH8B 3H7BA 1SJHB 1IAIH 2HWZL 4WNQB 2CGRL 3GMOA 4MX7A 1D9KA 3EHBC 4D9QE 5K9OB 4ENED 2RR3A 4ZXBA 1FJ1B 4LARH 2CK0H 4PJ7A 4HBCL 4Y1AD 4RAUB 5C0JB 2BFVH 3FQUA 4OZHB 5ERWA 5JORB 3JWDH 5BVPH 5E5RB 1H8OA 1MOEA 1P2CA 5D4QA 3RZCD 2IPUK 1G7LA 4P59L 4XNUL 4P46B 1KCVH 1YEDB 2ZKHL 5KS9B 4LLMB 4O2EA 3UO1H 1DBAH 1TZHA 1CWVA 2DJUA 4D9LL 3TYFB 4PJXE 1QA9A 5D8JL 5IGXH 2EEBA 3LB6D 2BNRE 3B4NA 4GSDL 1JUFB 2UVFA 4NT6A 2VKWA 4JM2C 2DL2A 2NY1C 3GK8L 2N1KA 1A6VH 1A6VL 1N3NA 3ZDZF 1UCTA 3DYOA 3E8UL 4H0IA 1WFTA 4KY1H 4LKXB 3PABA 1NBVL 3MBEC 3VXNB 4KTEL 1R3HA 4LNVA 4PRPA 1KPVA 3HCVA 4V2BA 3UTPE 3UO1L 4G7VH 5FGRA 3QISA 2BY2A 2X1PA 1OCWH 2D31A 5HI3D 3LS4H 2VLJB 1HEZA 4PRDA 4NC0B 1M6OB 3V52L 4Y89A 3C87A 2NW2A 4MD5A 2YC1B 3PWPA 4PJEB 4AIOA 4Z7WF 3MJ9L 3BPLB 3MLRH 1FNFA 3QXDA 4N0UB 43CAA 4MMZC 4AEEA 4Y1AE 1YEEH 5KVFL 4IDJH 2A0LC 2BVUA 4M8QA 4Z7UA 4D94A 3MA7A 2IQ9H 1MCWM 4LLYA 4N1EA 1LO5A 1AKJA 5GHWH 1Z5LA 4CUCA 3RIAK 3MJ6A 3OG6B 4QWWD 3MLTA 3JWDC 3ES6A 1VFUA 5DRXA 3MZTA 1R3LA 1GHFH 4GAGH 1QSEA 5K93A 3B5TA 5IFJB 5ESAA 1S7QA 3MBEA 1C1EL 1XIWA 1YNTB 4G7YL 3X14B 1Z3GH 5I9QC 1EGJA 1J0JA 5IB4A 1G7JB 1S7UA 4M1DH 1DDHA 1S7VB 3STLA 5I18L 2PXYD 1IKNA 3VDBA 3LS5H 3CFBB 3QP3A 4Y2OA 4OCYL 2RGSA 2ORBL 2YSSB 1CFQB 3QUYA 1T1YB 2BDNH 1A6TA 1F4XL 3BDYL 1REIA 3EO0A 3ARDB 4I18A 2QQKL 3VWJC 4QXUH 3DMMD 4KC3B 3RVUC 4MX7B 5I19L 3S96B 4WFEE 2MCPL 3P40A 1NGXA 2BMKB 4TUKH 4YDVA 1BMGA 1NC2D 3GBNH 4BQBA 4UQ3B 4RFNC 5D72H 5BXFB 2VABB 4JFHE 5C0EB 3IJHB 3CMOH 5BS0A 3TIDB 3Q1SL 4FFVD 4K3DL 1XGUA 5HHMD 3F8UB 4PP1C 2HMIC 1UM4H 4H8WH 2NLJB 1KCVL 2ZKHH 3NH7L 2E6JA 4PD4J 4ERSL 2NYYC 4UDTB 2DQFA 4WRLA 1PG7W 4R7NA 3LVEA 3HC4H 3HAEB 4I1NB 1PLGH 2HLFD 4NZRH 4ELME 3BPOB 3GO1L 1W0WB 4HHAB 1M7XA 3DUSB 3P73A 4WHTA 4YHML 2F58H 3QH3A 2J4WH 5F9WC 1MFDL 1JTOA 1S7QB 3MBEB 5H94A 2QADC 1X4XA 4R2GB 3REVB 2H1PL 3AGVA 1TETL 4N0YH 4XPTL 4BUHA 2Z31A 5JW4N 3ULUF 1GGBH 2VLKA 3RZCA 3QNZA 4EI5D 5EUKB 3OKNA 3NH7H 4P4RB 2VDRH 3T3PE 4LCWB 4O51B 3FJTA 3O8XA 5C0FB 4LLYB 5EBWA 4IJ3C 4KPHL 3PABB 3ZMRA 3KVQA 5E8DH 4EQ2A 1DQMH 1UM5L 3IXTA 2GT9A 1QRNE 4P4KC 5CD3A 2VIRB 4PJCE 4ZTPL 5GRUH 4LHQB 3ARPA 5H94B 3TVMC 2G75B 3L95A 3VDCA 4PJ9C 1NH6A 1HYSD 4PRDB 1C16A 2C1PA 1MQKL 3MACL 2APVA 1LNUB 1FHGA 1C12A 5IR1B 5CEYA 4P2OA 2C4XA 5FYKL 3ULUL 5D1QD 1CR9L 3MLVL 4QHNB 4ZSOE 2BK8A 2UUDK 4C54A 4QTIL 1IGTB 3G6JE 4Y8DC 5HBBA 1ZTXL 2Z8RA 4X9GA 5IJVA 2W91A 2ZUUA 4KUZH 4ZTOL 4XRCB 3DNKA 1UJ3A 1XGUB 3NCBB 1P7KA 3WO3B 4QHMA 5CZKA 5KVGH 5HHOB 2PO6C 4YO0B 3QHTC 1WBYA 1KIRA 4I0PD 4OF7A 2XZCL 1MRCL 1A4KA 2VXUH 1XZ0B 4IRZH 4CVUA 5CHNB 3QHFH 3SE8L 2VDML 3DVFA 3C5SB 5FECA 1UM5H 1JZ7A 2EIZB 3G5ZA 1FZKA 1F6FB 4D0DB 2VMFA 1J1OH 2C3WA 4JJ5B 4OFYA 1KBGH 3W0WE 1AO7A 3E6FB 1T1YA 5I15H 4QNPE 1U3ZA 4HIEB 1AHWA 4POZD 4OSUH 1AD9A 3MUZ1 1KT2A 4NO5A 2MNUA 4PJDE 3MV9D 2AERT 1EO5A 1NBQA 5L9DL 3UTZB 4IIQC 5CIPB 2QHRL 3RGVA 3GI9L 1RZIA 1JNLH 2G60L 3LPGA 4XX1G 1FPTL 4HWUA 2VXUL 3KPOB 4X80L 1AI1H 2Q6WA 2GSIB 2BVOB 4WW1B 1R5WA 5KTEL 1CF8H 3OKNB 4F37K 3CLEL 2VDQL 1IFHL 2DTSA 2Z31B 3CK0H 3TZVD 3WIHA 1H3PH 4P23D 3O6FA 4FQLL 1A14L 4HJJL 2OJEA 2HH0H 3WFBH 4G8GD 4WWKD 1KPRB 4P5TA 1NLDH 4XAWH 3RWGB 4I13B 3QFJD 4NQCA 1VEPA 4CADA 1TIUA 4NNYA 4WGWB 3Q5OA 2DQFB 1J11A 1A3LL 3CVHA 2VQ1B 5ICZA 5E4IA 3SE9L 4D0CB 4PJ5B 5TDPA 3VW3H 4K23H 3ARGB 4NQUA 3AB0B 3TNNB 1H5BB 3FQTB 3LZFH 1CXLA 3GBML 4J6RL 1UKQA 2JB5H 2QQLL 1IGJB 4WCYH 1CLZH 1MFCH 3B83A 3DVGB 4A6YH 3QUZD 4AG4H 3O2WL 4MJ2A 4R4BA 2OTPA 1M71A 3HS0A 4NOFA 2FH6A 5DD3L 3GSXA 2HT3D 2X9XA 4IRSD 2KQNA 4PBXA 4ZYKA 4KQ4H 4LQFH 5C0BB 1AD0A 1DE4B 3R1GH 4F3FB 5C0ND 5T3XD 3W0WA 2G5RA 5IT2L 4OUOA 3CDCA 5CINH 4EOWL 2YKLH 5IOPA 3U7YL 4FQPA 5TE4H 1ZEAH 3C5SA 4J3TA 4QCIA 4U2ZA 1KB9J 3AS3A 4K7PY 3VA6A 5I16A 4FQ1H 1A64A 1OF2B 3IS0X 1U8IA 2WUCH 5KSBF 2CDFB 1EMTH 4LHUG 3UTQA 3WSQH 3OX8A 4YHIA 4XHQA 2X4OB 1TFHA 4F9LA 5T5FH 1RURL 4PLKC 3CC5A 5IBUG 3FO1B 4JR9L 3UXFA 1ZLUK 4ORZC 1LWRA 2WV3A 3TCXA 2P5EB 3I3BA 1Z5LB 3I84A 1INQA 4P9ML 1YY8B 4HKJB 3T65B 1FFNA 3NN8B 1IAOA 3KPLA 3H3PH 2VAAA 3LSOB 2WANA 3DX6B 5E5MA 4WV1B 3QWOA 3EOYG 4L4TB 4ZUUA 5E4EC 1XIWC 5CILH 5E9DB 4XGZA 3RWGA 4HWEH 1QBLL 4YLQT 4YHPB 2WK2A 4OV5B 1OM3H 3INUL 5ISZE 1HQRB 3QUXD 1HHIB 5SX5K 4Y8AA 3F7RA 3GK8H 2DQCL 3QDAA 2VXSL 3VXME 4PPTA 4YBLB 2IANE 4CNIA 2EE3A 1F4XH 3BDYH 2Q76A 4J4PD 12E8H 1TQBB 5IQ7L 4H20H 2R8SL 1O5DT 2NY3C 3IAGC 4HEPG 1DBJL 2VDNH 4LCWA 4O58H 5E08L 3KPSE 4XXDB 4U1MA 3ARDC 1DFBL 5F1IA 1NBYB 2HLAB 4PUBH 1RMFH 4KDWA 2IPTL 1T7WA 4UINL 1YEJH 5DO2D 4NUJA 2W0FA 3O2DA 1CG9A 3TV3L 4JN2B 1WTGT 4K07A 2ADJB 4X7SL 3W39A 2A6KB 4HDIA 2PR4H 3A67H 2CGRH 3AS0A 3QXVA 2F53B 4YIQB 4FOMA 2A6IB 5ETUB 3WIFA 4KXZI 2D9CA 5E99H 3QYCA 1J8KA 5JTWA 1U2CA 4IDJL 1A2YB 1P5VA 5KSAC 5FECB 2XZAL 5BO1L 4IRSB 3Q3GB 2Z93B 5FYLD 1T66C 2X4PA 3QFJA 2OK0H 4LPYA 4M1GL 3MUJA 1MJUH 3C5ZC 1QFHA 3ECBB 25C8L 1MVFA 1UB5A 4YDJB 4S1RH 3MCLH 2VZ1A 4K7PL 4OZHE 5T33H 1QO3B 5D1XA 4PGEA 1N5YH 4X6DA 3HG1E 4XBGA 3QNYB 2ICWB 3L3DB 4ODSL 2HRPH 5EBGA 5L88L 2XTJC 3GIVA 4OZFH 4GRWF 5C08B 2R0WH 1F02I 3LKQB 5E8NA 3C5JA 3VD9A 1OPGH 4TSAL 1YEHL 3GSRB 4WI8A 4M7ZB 5DYOB 3O6MH 3BJLA 4KTEH 2MKLC 1Q9LA 2HJFA 4K8RL 3KPRD 3HE7B 4MQ7B 5ANMB 4ZFOA 4FABH 4U3HA 4Y5YC 2F53E 4NDMB 1WWWX 2LAGB 3BW9B 3ALXA 1MCOH 4HX1A 3LKOA 1TJHH 1OB1A 3FFCD 4L4TD 3NIDF 4XVTH 4MXWH 3DX8A 2F5BL 3QIWD 4KPHH 2IEPA 1OSZA 3WJLC 3U0TA 2KH2B 1DBAL 3VWKB 4R2GD 2XRAH 4NKOA 4B5EA 5EN2B 4B41A 3NVQA 3WJJA 4LCCC 3LH2L 1LP9F 4XPTH 2VDKL 3SCMD 4O5LH 4O51A 1X6NA 2NX5E 3GHEL 4HBCH 2J4WL 2DYPA 4HKBB 1T7XA 2GJZB 3JWDL 3PQYD 3HC3H 2OMBA 5JPMA 2YUXA 3M17B 4CMHB 3EYVA 1JRHH 2F8XC 2YN3A 4LP4A 3W11C 4LHUA 2MTPA 4KVCH 1AXSA 1QQDB 4TVSa 4P9HH 1RIHH 5GGSA 1E4XI 1NC4B 4L8CB 5DJYB 1AGCA 1K6QH 3DROB 3VFPB 3MUGA 1TVHB 4TUOB 5TF0A 3AY4A 1TITA 2QSQA 1BFSA 5J4MA 5HDQL 4S1QL 5MEPA 2RAMA 1T04A 2ICWJ 3QFJE 4Z7VF 5IVZA 3N1QC 4Z77B 4PP2A 3Q48A 1I3RA 4GW5A 1UJ3C 2Y72A 2J1KA 5HTSA 2FLRT 3FAWA 4E5XA 5LGHL 4G9FE 3ULUH 3B9KB 4U49A 5J8OA 2D7NA 3WS3A 1IGYB 4GW4B 3KR3L 3CDGB 4MDIA 4Q74A 1DVFB 2DD8L 1NGPL 4YGAB 4NKQB 4YDKH 3TH3T 4AIXA 4QOKA 4QRUA 4R90L 3X13A 3VD5A 5HSFA 4YFDB 1TJIH 4DZ8B 1C8PA 1A6AB 4XPAL 1E28A 3RHWK 1L9MA 3HB3C 3GMPB 4JPWH 1P1ZB 1DBJH 1FZOA 2HFFB 3LN9A 1BEYH 1QFWM 3VRJA 3STZA 4K3EH 3MZGB 1OB1B 1DQLL 3MGTB 4JGJA 1NMBH 4NZDA 2ZNXA 1PEWA 2Y07L 1HN1A 5K9OA 2DKMA 1BFOA 2WQ8A 3UDWC 4JFZL 4ZAKA 2BX5A 3IRZA 2XV6B 4ZUTA 4RMSA 1PZUB 4BK5A 3O8XD 2QR0B 2QSCH 1NANH 2UV3A 3B6SB 3KPQB 3QQ9D 5CSZB 4UU9B 3TP4A 3OAYH 4PD4K 4G6KH 1K3ZA 2Z31D 5DK0A 5DMIH 1I8MA 2YA2A 3L5IA 5D6DC 3AVEA 2HVJB 4KK9C 4Y2DD 1A5FH 4PJHF 3UTSA 2BVQB 1OW0C 3EJYD 5T3ZE 3AB0C 4CBPA 3ABZA 1GL4B 2X4NA 1DN0B 1CFTA 3BKCL 4K3JH 4OCXL 4PJ8B 1FNGA 4XP9H 3UJIL 4G3YH 2CO6B 3QXAB 3C09C 3RI5K 3FTGA 5I74C 1FFPB 3UC0L 5ITBL 5IEKA 3IT8D 2RBLA 3VG0L 3FT4A 4FHBD 4NJ9L 2W0KA 3BN3B 3HRPA 2OJEB 3BD5A 2R4SH 4M6MH 1AXSB 4XWOC 4WY7L 3ULVL 1MFAH 3QHFL 4NQDB 1ZEAL 1JGEA 3G5XB 1N3NB 4U1GC 1KJVB 1ZOXA 4DUXA 2EDQA 4AJ0A 3W9DA 1Q72H 4LVNC 5GRVL 2VDOL 3VD4A 1ZTXH 2BNQA 3DURB 5CJBA 4QOKE 1YYMH 4Y16B 4K94L 3H6JA 3FOMA 1A6ZB 1QLFB 1OTTD 5KS9A 4W6WB 1AKJD 3GMLA 5CJXA 3FT4B 2PNDA 4S2SA 5I1KH 1J18A 5E03A 5F1OB 2LFGA 4YFLF 3HAEA 3MBXH 1LDSA 2PCPB 2DQTH 3MNZA 3TN0B 1M7IB 2X4SA 4GRLB 5KSBA 5B3NA 3W2DH 5JHLL 4R0LB 4U6VL 4FQJH 4Y4KB 1KFAH 4HXAL 2UY6A 5E2UL 2HTKC 2NZIA 2VABA 3LDBB 4PG9B 1NBZB 2XPGB 2MHAA 3GUTA 2F54E 4I9WE 3R0MA 2D7PA 4GKNA 5HDQH 5HVHB 1U93B 2VXTH 3BKYH 5F7FA 4FXKA 1Y0LA 2AI0L 4G7VL 3DETC 4UIKH 4WFHE 4ZPTB 2X4OA 4PV8A 2FX7L 4N9GA 3VXRD 4ZFOL 1NGQH 3JV6B 4QT5A 4N8VA 1KB5L 4PGJA 1X4ZA 3O3EB 3Q3GA 2J3SA 5IROC 5ID1A 3FFCE 3BZ4A 3NCCB 1T3FA 5D2LA 4LLQB 2GEEA 1WSST 1JGUH 3OJMB 3WIFB 3HZYB 4XPFL 5L8JB 5DSCA 1JWMB 3PP3H 3HI5L 3ZDXF 3MV8E 1GOFA 1KG0A 1BWMA 1YPZB 3TO2A 5K59E 1R3LB 2ZSWA 1VGKA 5J6HA 3TT1L 4K7FB 1K4DB 1FBIH 4NO0A 3QIUD 4KHTH 4DN4L 4XNUH 1X5JA 5BS0E 2EZ0C 3G5XA 2GI7A 2E9WA 3SGJA 3PQYE 4M5YH 3GMNB 3CUPA 1LEGB 5AAMA 2FBJL 1IM3A 4JHZA 4M6OL 5C2BH 1MEXH 4LSPL 3HE6D 2P8PB 2EH8L 1CLZL 1MFCL 1WCQA 1PJ9A 2OX5A 4KV5F 5EUOE 3BAEL 1E0OB 5E6IB 2AJXL 4PRNA 2C3HA 4TSAH 5D7LB 3VXQA 1RZ7H 3GJFB 4PJCA 3OV6A 4X0KB 2DBLH 5KSBE 4GLRH 3DTXB 3VFNA 1QZ1A 1DQTA 1S8DB 2NXYC 2JCCB 2V5MA 1P7HL 4LBEA 4DN3H 1G9MC 5HYJB 3U4AA 3B2VH 1XCQB 3EYFB 3IFPB 5D2NC 1IAKA 1LEGA 5GIRB 3MOBL 3DX7B 2X44D 3QI9A 1DEEA 4I8DA 1OLZA 5FOBB 1ZT1A 1LEKB 4NWUH 1M05A 1MJUL 5DZOA 1X5ZA 1B0WA 3S88H 2W9DL 3QIBA 4OD2B 4R96B 2BSRA 1PQZB 5HGAA 1KLFA 1AO7E 5H35B 3B9KC 1DL7L 2Z4QA 3V4VH 4BFGA 3EGSA 1T3FB 5D2LB 4OKVA 1YEJL 3QWRD 2M8XA 1AGBA 1I9RL 4PJFF 4PY8I 3GMPA 2XI9A 4PJDA 4TNWF 3NTCL 3SDXA 3HNTL 3MYJB 3MRDA 1AFVH 2OTWA 4H8WC 4OD1L 2WWMD 2BVPB 3VXOB 3D39D 2F5AH 1JNJA 1MIEL 2WBJA 2GAZA 2X1OA 32C2A 3BSZL 5I1JL 4F7PA 1VKXB 5CHNA 2K7QA 2Z8VC 3FB5A 3JTSB 2JJTC 2C7UB 3BPLC 3CFCL 3FFDA 4KAQL 4JFQA 1YY9D 3V0WH 4WHDA 5DEZA 1KCKA 4YO0A 1IC4L 3WYRA 2XN9B 1IC4H 3G5YA 5JMOC 4H0HB 4HUWB 5BCAA 1CGXA 1U42A 3GDBA 2YD7A 4AIZA 1QR1B 3MV8D 5IJVB 1UT9A 4H5SB 3ECBA 1DVFD 1OGAD 3QG7H 4WI5A 4M00A 1K9TA 3R8QA 3RTQC 43C9B 1N2RB 2Q1EA