4WFFE

Human traak k+ channel in a k+ bound nonconductive conformation
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
211
Chain Sequence
b'EVQLQQSGPELVKPGASMKTSCKVSGYSFTGYIMNWVKQRHGKNLEWIGLINPNTGYTTYNQKFKGKATLTVDKSSSTAYMELLSLTSEDSAIYYCTRGNYVFDYWGQGTTLTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 48
structure length 211
sequence length 217
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wffE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wffE02
3BPLC 3HC3L 4P5MA 1UM4H 3ARED 5TJWK 3WXVL 1UH2A 2D0GA 5KVMC 5IWLC 1OGAA 2NY0D 3MRNA 3VXRA 3U82B 5DTFB 5FGCB 3MA9H 2P5WD 4NRYB 2XZCH 1YEGH 1IGYA 4KAQH 2FO1A 4HUUA 2EDQA 3UBXG 5E9DD 2BNRE 4IRJB 1NFDA 1IAKA 4MAYC 3H7BB 1MWAL 5C07D 2X4SA 3NFPB 3HR6A 1S7UB 2UV3A 4RMQA 2BERA 1EHNA 2YPKB 4PGJA 3V6FB 4FFYH 3TIDB 1WWAX 3H7LA 1TENA 1U8HA 5D1QB 4R8WL 3MV11 2JB6B 5FO8B 2G75A 2YPLB 3IETB 3MYJA 2WLYA 1U93A 2H26A 2ATPA 3D18A 1NJ9A 4CKVX 2M2DA 4Z76A 5J13C 3H9YA 3BRDA 1FNEA 4JJ5B 4ZOBA 1QZ1A 5FIEA 4X7DC 2R2HA 3UYRH 4RAVA 2BP3A 2IMNA 1HQ4B 3FOLB 1MIML 4ZNCD 4YXKH 4KDWA 5EBLA 5LCVL 5J8OA 2O61B 3VXPA 4YDLB 1N5AA 3QIUB 4MAUH 1HSAA 4NC2B 5KVDL 2E27L 3BW9B 3ULVF 1OGAE 1EIBA 1MWAA 4WFED 4G9DA 4FQIL 4QHKJ 3TJHC 4OLXH 3QDME 4HBCH 4S1SH 2Y06L 1LNUA 3WL9B 3REVA 5JQ6H 3DI2B 4J6RH 2IQAA 4UQ2B 2KQMA 3CDFA 2H2SC 4R90L 1NMAL 1ZT1B 3DOSA 2DB8A 1ZSDA 3NIDF 2PW2A 1MCWM 2BVPB 4L9LC 1CT8A 2LU4A 3NPSB 4G6JH 1GZPA 4BH7B 2DLHA 3RPIB 4JO3L 5GIRB 3THML 1JPFB 4LLYA 4PY7A 5LQBL 2CDFA 3CX5K 1GC1H 3BSZL 3PUCA 2EKJA 4ONGL 4DN3H 1WBXB 4P46A 1MFNA 4OIIH 4H1LA 3WD5H 5BO1L 5EO1A 2X1PA 1HYRC 2X1OA 4GLRH 5DDHA 3S5LG 3U30C 1MHEA 2WINA 1LP9E 1FZOB 1KIRB 4YGVB 2ZUQB 2MCPL 3L95A 1CE1L 3PDGA 1A6TA 5I66B 5L9DL 2QV2A 4NN5C 3IDNB 3L3GB 4GMTL 4KK9C 1KUMA 2B1AL 2EDFA 2CRMA 5TQ2H 2VDOH 4ALAL 2RCSH 3B9KD 1T5XB 1A6VL 1WFUA 3FT4B 1FLTX 1U8PA 4CDGC 4QF1B 3NACL 5IFAL 4CADA 4XB7A 3WFDL 4PRHD 5J6GB 2NX5B 3WO3B 4J12A 3SDXE 2PTTA 4XC1L 1BBDL 4HGKC 2WWKO 4HX1A 1JPGB 3CGTA 4NJAH 3EO1B 4WW2F 4E5XB 1ROWA 4BSWA 4U05A 4LCIL 4OFIA 2BOBB 3WLWD 5LBSL 3AFLA 1JRHL 4DTGL 4X5WA 4G8GD 2KL6A 1I4FA 2XT1B 4JFXB 4PTUA 4X6BB 3VFVB 2QSCH 1GPOL 3RGVD 2GQHA 4XNXL 2Z8WC 2XZQH 4KUCF 3BKML 1T04A 4HT1H 1NCCH 2E7MA 1UG9A 2ZSVB 4XVJH 4Z5RA 4M43H 1LEIA 2A2QT 4YDIH 5T33L 4DOHE 2NY2B 5C92A 3RWGB 3TBVA 4I2XB 3MJ8A 4HUNB 1ZEAH 4DZ8A 5CIPA 3MBED 4ZUVA 1ZLSH 3IFPB 1U8LB 2ZCKH 4LVOC 5HGAB 5F7KC 4KQ3L 4QHNA 4UOW0 4KK5D 1KBGH 1RUPH 3X14A 4WGWB 4APQD 4IRJC 3IFLH 2YZ8A 4HZAA 3W9EB 5EBWB 1OSZB 1WGOA 4AH2A 3QUYA 5J1SC 5FXCH 4JAMA 1G7JA 2QHRH 3IXTA 4YHMH 4HG4J 5I1HL 5ACZB 4GLRI 3RX8A 5D1QC 5JUEH 4KMTL 3RU8L 1T0PB 3PXHA 1MFEL 2J8HA 1DBAL 1A7PL 5IM7B 3DGCR 3QIBA 4L3EB 5HDBE 1CK0L 3KWWA 5DUML 3BP7B 3GMRB 3B43A 4PRPD 2AERT 3S96A 2XTJE 4TSCH 1T1XA 4OLYH 1FZKB 3BO8A 1A6ZB 3HE7A 3VXUA 4YEFA 5E94B 1KPVA 5B22A 3D1MC 1KCVL 1OTUD 4HGMA 3KXFA 4YDLC 2EYTA 3BMWA 2XY2A 5HHPA 4LHUD 5T1KA 3U83A 5GGTL 4JDZA 2DWEA 3TVMB 3LPWA 4M6NL 4M3JA 4PBXA 4DK3A 1RULH 5B39A 2VLMD 1RUML 3E0GA 4M4RA 4ZUSB 4UT6L 5SWZB 4HKBA 1H5BA 2VMFA 3RWJB 1YEIL 3V6ZB 2ICWJ 2W9DH 1NC2A 5DFVD 2ICES 3ROLA 1WEJH 5CZXD 3LKSA 5FYKL 4KZEL 4ZFOB 1IGTB 3NPSC 3MFGB 5I9QC 3QNYB 4TUKH 5AZEH 4RFOL 5FK9A 5T5NG 2C4FT 3O9WA 4NWTH 2XQBH 2Y4SA 3LQAL 4V2BA 2IANA 4Z7VE 3PJSA 1WBYB 1MJJB 1R5VA 1S9XB 4MA7L 1F8TL 4BZ1L 1I8IB 5EFIA 1F4XH 1FO0B 3QNXA 1LO5A 2D3VA 3MV9A 4U1JB 4IJ3B 6FABL 2X4PB 2DYPB 1QSFD 2HJLA 3BGMB 5IEHA 4JKLA 5T1LA 4Q7DA 4HWZB 5DJYB 4C56D 4HJ0C 5IUSA 1YEFL 1P2CA 2FHCA 4X7SL 5I19L 1JGVH 1N8ZA 1OLZA 4FZ8H 1RZKL 1B90A 3WS6A 4NO3A 3QO1A 1OWWA 1Q9LA 1BVKA 1A1NA 1T66D 4LFHG 4ZOEA 5CGTA 4NIKB 4GXVH 4LQ1A 3P0YL 5A2LH 3VI3E 4B7LA 3H3PH 4PRDA 1FIGH 2XRAH 3Q5TA 4EQ2A 2QL1A 3I2CL 4P2QD 4JPKH 5J4MA 1IBGH 5C09E 4QXTA 1Q0XH 5TFSL 1FORH 1HI6B 1BD2E 4OZIA 3T4YA 3X3GH 2HTLD 1OAQH 2OZ4L 4OCWL 1MH5B 4Q2ZA 3JTSB 1FAIL 4I0KA 4KJYB 1EV2E 1YQVH 4XWGH 2EO9A 5EOTB 1ERNA 1ZVHA 1SMAA 4QO1A 4E42B 1ODAA 2DQCH 3T0BA 2J12B 5DD1H 15C8L 2R0ZL 3MREA 1IAIH 5FHBH 1DBMH 1CD8A 4NZUH 2VLJA 2O5YL 1PJ9A 4FQJH 2OTUB 4KTEH 3VGBA 3JV5A 1HIML 3EYQD 4Q0XH 4ZFFA 4HJGB 2W0PA 2F5AH 5IESH 3HUJF 5T3ZL 3VWKD 1UWXK 3DBXA 4OZHA 3NIFE 2BDNH 2CMRL 3CMGA 4GS7C 1X5ZA 4M93C 5FFLA 3MCLL 4PGZA 3GGWB 2PYFB 5DK0A 1N7ML 1KN4H 3F7VA 1ZANH 1MFDL 1AY1L 4KMQA 4M9PA 2RIKA 3VFOA 1BLNA 3L7FA 3KPSB 5CP3A 1FGNL 4O2FA 2OZ4A 1T22A 2UZIL 1XCQB 3OB0H 4OCYL 4KROC 2V2TB 3BDBA 1RK1A 1Q9WB 2ZUYA 2JB5H 2XFXB 1XF4A 2VSDA 1XGPA 1IZJA 4JZNA 5FYKE 3FQNA 1JNNH 1IAIM 1IGCH 1KN2L 1QKZL 4UU9B 1HNGA 1DQDL 4MAYD 4X9HA 1UJTA 4HKJA 1WCQA 2E5EA 2UWEE 4LVHB 1R3HB 5IBLD 1Q9OB 3L6FB 1NCNA 1C16B 4WEBH 4N0UA 1EGJL 3HPLA 3ZTNL 1JCKA 1AQKL 4M6OL 3WFBL 1CTNA 4X7CC 3HE6B 43CAA 2ORBL 2UZXB 4WNQB 1I8LA 3TO4B 2EC9T 1A4KA 4RBPK 2B7DT 2V7NA 5ALCH 1BP3B 4RIRA 4H5SB 3HHRB 4XVUC 3ARQA 2APVA 4U4BA 3D39E 3S88L 3TH2T 3BQUB 4QXGL 2R29L 4OM1H 4AENB 3BP4A 4FMKA 4JO1L 4M1GH 4WJ5B 4PRAA 2F74B 2ITCB 1DUYA 3TNMB 1IAII 1UQSA 3G08A 4NO5B 4L5FH 3A6CH 4NKDB 1EAPA 1F4HA 3HB3C 3B2UC 3DYPA 2JIXD 3OWEA 3STBA 2BRQA 4QOKB 3RUGA 5KSVB 2DDQH 3DXAD 3TJHD 4TPRL 3MROA 3DIFA 1XF5B 1H3GA 3GEWB 4IJ3C 5EO9A 2BC4A 2L4OA 4I77L 5GGSA 1MUJA 1DQMH 1NDMB 1VESA 4BFIB 3PWVB 1F90H 1SVCP 3IDMB 3MRQB 2H2SD 1H3PH 3MRLA 3QWOA 5SX5H 3MLWL 4GW1B 5L2KB 4Y5YB 4PG2A 3BN3B 1TJIL 4BZYA 3IRZA 3LEYL 1QSEE 1CS6A 5TF1H 1HILB 4HIIB 1JGUL 5F7EL 3MLXL 5IB2A 4KDVA 4U2ZA 2MPAL 3AMLA 1NFKA 4CDHA 3E6FA 4NYLB 4EEEA 3M8OH 1HZHH 4GH7B 4MQ7B 5T3ZE 4NT6B 4GW5B 4EI6B 4ZSOA 3MGOA 1MY5A 4GQPH 4S1RL 1Q8MA 3CDGB 3IAPA 4CVXB 3EGSB 3INUH 3QZWB 2K7QA 3BMVA 1PSKL 4Z95L 1NPUA 4KK9D 2OS7A 1H3XA 4JR9H 1I1AB 4DKEL 1L0YA 1XR8B 1T6WA 4L8BA 4LL9A 5L2JA 3RBSA 5JR1H 1E4WL 2C9AA 1D5IH 4OUUA 4P2OA 4FS0A 3H0TB 1UKSA 1OP9A 5IMOB 3QIWB 2Y1VA 1RZGA 1XH3B 1OB1A 1M71A 4EBQH 1Z3GL 3I75B 4HMEA 3MRFA 4L4VD 4BZ2H 3MO1A 4KUZL 4ONHB 3FMGL 1KG0A 1J1PH 2C4XA 2HG5B 4HWUA 3H6JA 4GAYA 3WYRA 3GUTA 1C5CH 2VLRD 2X4QA 1E6OH 1TQBB 5FOBB 1X5IA 1IL1B 4ONFL 5GS2D 4OCRH 2WIMA 2GJZA 5KZCB 3BEVA 1W8OA 5F71A 1SM3L 4M7LL 5C3TA 4EVNA 1FYTB 3BD4A 1QFPA 3IVKB 1JWSA 3FB5A 4L3AA 4OD2B 4Q74A 4WHDA 5A16B 4M1DH 4CMHB 2AVGA 4OB5H 3CFCH 3GM0A 3EFFB 5DQJB 3NH7H 4XNZC 4PRIB 5CMAA 1L4IA 2BVOA 4IMKA 4BUGA 2WBJB 3OKKB 4PJ8A 4YHZH 3CFEB 4DEPC 4PJGA 4IRJD 5KANI 3O4LB 1I7UA 1F97A 1YEKH 4LP4A 4NNXA 5B8CA 2R1WB 3DMMB 4O9HL 4B5EA 4XPGL 2FGWH 3FQWA 3ZKNC 4OD3L 2AI0L 2F19L 4PLNC 4PGDA 5EZOH 1SJHA 5D1QD 1JPSL 4U1SA 1QBMH 2NXZC 3TO4C 3GMLB 1HDMA 3MLTA 5D7IE 1DQLH 5GSVA 1ZAGA 2DBLH 1K5NB 5F7FA 1F11A 2X70B 3BQUC 5JPMA 4K7PH 1I3RA 3OKMB 1A1OB 1LO4L 1NGWB 1ZMYA 3VFWA 3MRDB 3U4EB 5CIPH 3KPLA 3O8XB 4KRLB 1LK2B 4HWBH 5I1CL 3WMSA 2VQ1B 4LLUA 5C0RL 5IVZA 3ZKMC 2V17L 1HHHB 3OAUL 3MLRH 1CDBA 4CNIA 1WV7T 4P5TA 1LEGB 4PJDA 1JHKL 5DWUH 3S36X 3UPCA 2VZ1A 2J88L 3D0LB 1DZBA 3F6LA 2OYPA 1J8HA 5E2UL 5GISH 2B4CH 1S3KL 4Y5YC 4R6UA 4MJ6A 2GITA 1QA9B 1GC1C 3O6ML 1JGLH 1M7XA 3QWRD 5GZND 2NCMA 4LLWB 1MCBA 4HHAA 5DJ2A 2IALB 2FRGP 1DL7H 1HXMA 4PJ5B 1NSNL 4U1NB 4OCNC 2IFFH 3MA7B 5EN2B 3I6KB 1KEGL 4QYOB 5I17B 5FUCC 3IKKA 1Q9KA 1OARH 5DD6A 1X7QA 2OJZH 3CFJB 5A2KH 1T4KA 4HJ0D 4Z8FL 2NY3B 4PJAE 1D5BB 4L8DA 4MJIE 4OTXL 5EU7E 5EU5A 4OCXH 1DE4A 1I1AC 3VE0B 3W39B 1DBBH 1E4XL 3O11A 2ZCLL 3FO2B 1P84K 5LG1A 1T2QL 3UJIL 2WUCL 2IG2H 5KVEH 1ES0B 4AEHH 1DDHB 4RGOH 5F7YC 5CS7A 3HNSL 5D1XB 3W11C 2NX5D 5HY9B 3WIHH 5DQDH 1I7RB 4ORGA 5IW6B 4JPIB 5AG8A 1UZ6E 3QAZC 3LSOA 1SEBB 1MPAH 4P3DB 5F6IB 3UXFA 1EXUA 3GJEB 4WGVB 1YY9C 2GAZA 1JZ8A 3SE9L 5DRNA 1UGNA 2FZ3B 4MVBD 4TULL 4GKZA 1ZTXH 3C6LB 4JY6B 2Y5TA 4NO2A 1J8HE 4NKOB 1AGEA 3LRHA 4PJBB 5CD5C 1FNAA 5D7KE 1TZIB 2NY2D 3ES6B 3B8YA 2FL5B 4LRNH 2RFXB 2ZPKH 5F9AC 3WNKA 4O5LH 1U91A 3KLAA 1C1EH 3ROOA 5GRVK 2YWYA 4NGHH 2WBJC 5I8KL 4B50A 3B2VL 2OQJB 4ELMA 2VUYA 3UZVB 2EKSA 1MCHA 5DEZA 3DUUA 3FFCB 4ZQKB 5CZKA 5JPNB 3DMMC 1CTOA 1KJMB 1OAKH 4EN3C 4I1NB 4Z7WE 2XA8H 1T21B 3ULVH 2CIIA 5IG7A 1ZA3A 1QRNB 3SDCB 2P1YA 4UT9L 2A73B 3H9HB 1EBPA 1UB5B 1NGYA 4FRWA 2VL5B 4D0BA 4XVTH 5D7JA 5J7CC 4CMMB 2H3NA 4G8EB 3KPPB 3UROR 2NY5H 2B2XL 2LQRA 4YPGA 2HFTA 4PJEB 4RZCB 3PP4L 3STZB 3GRWA 3KR3H 5SWSB 4Z7OE 5D70H 4X7TB 5BJTB 2FWOB 3UTTA 2DTML 3PNWA 4NQCE 3L3DB 3AU1B 5CBEA 5H2BB 2MWCA 3RNKB 3O8XC 4JO4L 3WUWG 5F97E 4JM2B 2XOTA 1I75A 2QSTA 3MXVH 5HI3C 1G84A 1I7ZB 4QGYA 3VA2C 3OF6D 2MQ3A 3HZYA 2E7BA 1G7HB 3VGHA 1FZJA 4P9MH 1NUGA 4U6VH 1QSZA 3RWCA 5SWZD 3DI3B 4LU5H 3V8OA 4Y89A 4XVUD 3HS0B 2DQHL 5EZJA 5DF0A 2XWJB 4ZUWA 3CH1A 5TDOA 1IGYB 1GRWA 4HUUB 3V0VB 1ZT7B 4XWOC 3VXSB 4LEOA 2CR3A 3JBG7 1IQDB 3ZL4H 1IAKB 1X5KA 3T4AA 2P49B 3HB3D 4Y5VA 1FZMA 1WZKA 3B2UD 3OJMB 1BIHA 5F7MC 2ENSA 3SJVB 4GT7A 1T7YA 1WWWX 2CO7B 4GAFB 2DYPD 5ISZE 3CVIL 2L0DA 2NTFB 2R8SH 1QLRA 5DSCA 3LV3A 4UB0H 2NY3C 2G75B 2X89A 2H1PH 3MYJB 3UTTE 5A1AA 1AE6H 2DQDH 1AHWC 1G9EA 2HKHH 3C08L 4UV7L 4WI5A 4F9LC 2R2HB 4GSDL 4JFHE 4OLEA 1MCFA 5L8KB 1W0VB 5J57B 5LGKA 4X80H 4JN2A 5DLMH 5KBNC 1UCBH 5EBLB 3QUML 3DRTB 1LP9F 3T2NL 3MRIA 4PJ9A 4Q9RL 4FQXC 1YEDA 1HSAB 1LDSA 2ZKHH 4ZDHB 4YXLH 4BYHA 4L4TA 3K0WA 5I8EB 1AD9A 1NAML 2WUBH 2F54E 3BAEH 5JDSB 1UEYA 5HI4C 3MRRA 4U1LB 3VWJC 1BREA 3C6LC 1BFOB 1FG2A 3O6FA 1XAUA 3IFNL 1I7TA 3QUXB 4JFEE 4AEIH 1WTGT 1J8KA 3BT2H 1LNUB 4Y5XC 5E24E 5IJKC 4LCCA 2CPCA 5HYIA 1NGPL 5F7HA 4KKBC 5K9KA 1WAAE 3HAEA 3QXDA 3TJEL 4ZXBB 4YWGH 3G5VA 4EUPG 4Y4FA 4OFDA 4K8RL 3SDXF 4HS8L 1CT8B 1T20B 5HGBB 4Z9KB 2WAHA 2AJ3B 3H9SA 5INCA 3VXNB 4HUWB 2CDFB 3PL6B 4RNRA 2A6DA 4TTDC 5MHSE 2PKDA 1DLFL 3WSQH 3V95A 3MLUL 5B21A 1N64H 3GMPB 5DT1H 2WINB 3QUMA 1OD9A 2RBLA 1YNKH 4M7JH 1Q0YL 5TQ0H 2VXTL 2VUOA 1A9EB 1RJLB 2DQIH 5EDXA 1C7SA 3EYOA 3WFCL 2YK1L 4Y4HC 2YEZA 3GIVB 3KPSD 1BQUA 1AIFA 3IDJB 2VYRE 3FO1A 1NEUA 1ZA6A 4HK3N 3VA6A 3QDJB 4KJWC 4ZAKB 3QULB 2NZ9C 1U8PB 1F4YH 4FQHA 1M7DB 3CLEH 3X11B 3LPFA 3EYVB 1J0KA 1J0IA 2PTTB 4RISL 5KSUB 1RUKL 2HH0L 1RIUL 2HLAA 4X4ME 3ZKND 3V7MA 2QQKH 2GJ6E 4D94A 2XN9A 3W5NA 4XCCL 4M62L 2C3VA 4D9RD 1T03L 4NC0B 2NXZD 1BVLB 5E08L 4LF3A 5GS1B 5CZVH 5DUBA 3TO4D 3VFGL 5HDBF 3IU3B 1KCUH 4JFOA 3DECA 4N9GB 4S1QH 5F3BA 4Z7QE 1KC5L 2HFEB 1B3JA 2GCYA 3MJ8B 1ITCA 2OM5A 4JGJA 4JCLA 5CIPB 4ZUVB 3BQUD 4FNLH 3O45B 1FDLL 4YHIB 5DJ8A 1J0HA 4ZNEE 3M07A 3CVHL 4V1DB 1VEPA 4XHJC 1HOCA 5C08D 5LJYH 5HHVH 3RKDC 1RUQH 1XFPA 4I9WD 3VD4A 3ZKMD 4N0CC 4NCDA 1KCRH 3EYUL 2OSLB 4QOKD 3MXWL 2VLKA 5DO2C 4EKXA 4D9LL 1Y6NR 2V6HA 3EOBA 3DV4A 3NA9L 1RVFH 3GMMB 1W72L 2GSIA 4LLMA 2FD6L 1HYSC 1U8NA 2C7UB 3WN5A 3IJYB 4X8XA 5I71B 4HH9B 2VQTA 3WUWA 4V2CB 3QIBB 3QJFA 3TT1H 4NJ9L 4LSPH 4OZFH 4C57C 4XH2B 4HPYH 2KZWA 3RGHA 3KAAA 4Z7VF 2VSCA 5HHXL 3GDBA 1JZ5A 1QLEH 1G0YR 3PHOA 1FG9C 2PYEA 3P4NA 5C0DA 4RWYL 1EO7A 1E27A 3CVHA 2OXHA 5H8DA 4A2LA 1D5ZB 4O2CB 1WUNT 4M5YL 2FATL 1YNLL 4JDZB 3MCKA 3ZKSD 4RA0C 4MDIB 4PV8A 1MAMH 4N5EC 1A6WL 5IBTH 4F9PA 2OJEA 1OAYL 5HGDA 1I1AD 1N6QL 3G6DH 3QUXC 1H5BB 4Z0BL 2NY7L 5IW1A 1GIGH 1XGQA 4XPFL 5D2NB 5IQ9A 1P9MC 3JWNC 4ZXBC 5FHAL 3GB7B 3SDYL 2XA3A 3MGAA 1LGVA 3W11D 3LN4A 4D8PA 4G3YH 4Y2DC 1RZJH 4HJJH 3H3KA 2ATKB 3DX9A 5FK9B 1D5MB 5LWYH 1FJ1B 4PGCB 2P8MB 1DVFB 3T8XB 3Q2CA 4G6KL 4E41A 1N6VA 4M48H 5B38A 3PL6C 3PJSB 5FO9A 2EH8H 5E8OA 2FR4B 1YY9D 2WBWB 3QBTB 3N9GL 3MRGB 2W91A 4LPUA 3MV9B 2EDJA 3ZKQD 5IQ7H 1MHCB 2HJLB 2G5RA 5E6IB 2VXQH 4K3JH 5E4IA 1IKFH 3J8F7 1AGBA 2ZOKB 3G6JA 1NMCC 3EIFA 3VGEA 3QO1B 4OLUH 2G2RB 5E1AA 4PRID 1Q9LB 4MD4A 1AR2A 4OJFH 1IGFL 3VRIA 2EH7L 2PO6A 2WBJD 2DM3A 1L7IL 5JHDE 3MRBB 3NAAL 1MQKL 4XPTL 2CLRA 1S7QA 4WI4A 3L3IB 3ZYZA 1U3JA 3VD7A 5GS0L 1GGIL 5KSBE 3O4LD 3NIFF 5F7LB 5BMFL 1JNHA 3RBGA 4WRLA 3DMMD 2I07B 4EN3D 4X5XA 3CJJA 3PV6B 4YZFE 3ARBA 3RWIB 5L88H 3FONB 1FIEA 3D0VB 4WU7A 4JJHA 4HCRL 4K2UL 4YDKH 1E6JH 4EI5B 3QUZC 4MD5B 3V5KB 1OF2B 5GS1C 5C0AE 1PG7W 3CD4A 2PCPA 2VC2H 2E9JA 1LO0L 2X4RA 3TBWA 2GK0A 4I48B 4OFKA 3OKOA 1RJCA 3MLVH 4WCYL 5CILH 5IV2B 3O3BA 1KIPA 2ED9A 3F62A 1A3RH 1CF8H 1B6UA 4TNVK 1KIQA 2UWEF 1IEBA 4JFDE 3H42H 3I02A 1JIBA 1ITBB 3O8XD 5DVOA 3EO0A 1SBSL 4BKLB 4JPVL 5HI3D 2XKUA 3DBXB 1G7PA 2Q86B 4IIQA 3R1GH 5HHQA 2XKNA 3G6JE 2J4WL 4KHTL 3LQZB 1EO8H 1Q1JL 2YC1B 1E28A 1PQZA 5EC2A 3C5ZB 5E0QA 3LKOA 3REWA 3OG6B 1FNHA 4LQFH 2GJJA 4ONOA 3VFOB 5EIIB 3WDIA 5IROA 3RNQB 3WEXA 5F3HA 3ZHDA 1MFBL 1MJ7H 3S4SA 2X42A 4R97B 5I71C 4K7PY 5I8CA 4ODWA 1D5XB 2UY7A 3AUVA 4XWOD 4WW2B 2IPUG 3EJZC 3BRGC 2GTZA 4NQEE 3GBML 5FUZH 5DD3H 1ZOXA 5CEYA 2E8ZA 2XV6B 4ZOCA 3GRWH 4HKJB 3HRPA 1Q72H 5CAYB 4LASH 1CI5A 4RQQA 2DIJA 3LIZH 3WJJA 5I8OH 1TQCB 5HYFA 2IJ0C 4PJ5D 3MUGB 2BY3A 4HPOL 3IDIA 5E2WL 4WI2A 1VFAA 3ULUE 1OSPL 1M7IA 4JFYA 5JOEA 5BVPH 43CAB 2FB4L 2NY3D 4BQCA 2BNQA 4TSBL 1AFVL 1IAMA 2CLVA 4I3SL 4R7DA 3DUSA 4F7TB 2VWEC 1AH1A 4FTVA 3O6KH 4LAQL 3UTQB 4FFWC 4FXKA 5D2NC 1HSBA 5JW3L 1V3MA 5C6WH 3QPXH 4JDTL 3T2OA 4PRAB 4F7MA 4J1UA 1OD7A 5AD0A 4L3CA 3RWHB 3QQ4A 1AO7E 1DVFC 1YYLL 2XWTA 4IOSD 4Z78B 5I1JL 4PLJD 5C7XL 4ODVH 2I5YL 1AR1C 1U92A 2OK0H 4MXWL 5HI4D 3HNVL 1DUZB 3C6LD 4XCYA 1IRAY 3GMQB 2ITDA 5EOCJ 1IJ9A 3T77A 2AJVH 4M61A 4LNRA 2ESVD 5C0BA 5E6IC 5GGSB 1VFOA 4LCWE 3BE1L 2P5EE 4KKBD 1OPGH 3PGDA 4IDLA 3MRLB 3NZHH 2BHYA 5DUPL 1NLBL 2HT2C 1AXTL 3JV4A 4XMPL 4YBLC 4H25A 4NQDE 2P4AB 4RGNC 3VXME 3LB6C 1ZK9A 4HXAH 3ULVC 5GGVL 3EW3B 1OAZL 3ARWA 4TTDD 3RA7H 3FFCD 3QFJA 3L5IA 1CFQA 1EX0A 1CDIA 1QRND 1OQOA 3LRSB 4G7VL 4N90E 5E5RB 3SDCD 4GW4B 4DCQA 2VITA 2ICEA 1LK3H 4NM4L 4R0LB 2EYRA 2NY5C 4X4ZA 3GK8H 4Y4HD 5FKAA 5EUOE 4ZFGH 2AEWA 4OLWH 1ONQA 3C2AL 3MFFB 4P99A 5FM8A 5TH2A 1VACB 2VQUA 5JMOC 5L2JB 4U3XA 3AAZA 4OUUB 4DK6A 1ORQB 4KJWD 1RZFH 2A6JA 1L9NA 2NZ9D 1XCTB 3KPOA 5HHME 1YPZA 4BFEA 3DROA 1OB1B 5T3XH 4F7PA 5I1EH 1E4KA 1G6RH 4RDQG 5BVJB 1J86A 3HAEH 3MRFB 3MO1B 1TITA 3HMWL 4XTRD 1AXSA 5T5NF 1WISA 3U9PH 3SE3A 1GXEA 2FIKB 1NUFA 3QDGA 2D7QA 5J1AB 1YEJL 4JM2D 4GAYB 3V52H 5JXAH 4WV1A 3IDXL 1NEZB 4U7SA 4JHAL 2B0SH 5D7LE 1C08A 1CDGA 1CZ8H 1EEYA 3AREA 1D9KB 3C5ZC 2V2WA 3FT3B 4ZYKB 5D7IF 4QT5A 4DGIL 5IFHL 1JWSB 1RHHA 2NYYC 3FB5B 2AEQH 4N0RA 4WEMB 2CUMA 2R39A 3DTXB 2WP3T 5C0CA 1NBZB 3FB7B 4JHWL 4GQ9H 4R4NC 1HH9A 5EU6E 2P5WA 4R97C 1V5JA 3G9VA 2WW8A 4HFUH 3VXSD 4K7FA 4WW2C 1OP5K 4PS4H 1OP3K 3M1BA 5E9DA 4NKIH 4PJGB 3RKDD 2ICCA 4DJMA 1G9MH 5C07A 4D0DA 1KSRA 4HUVB 3U79A 2Z0BA 4N0CD 5C71A 3SJVD 1JYVA 5DO2D 4EOWH 2VDKH 5D2LE 4NQTA 1TJGL 1CGUA 3VXTB 5KTEH 2OL3H 3RIAF 1CN4A 3MR9A 4OZFB 5JIPA 1HYSD 4M7KH 4M6MH 4S0TD 2VXSH 3CXHJ 1FCCA 1JMXA 5C0IA 3EYFB 5DVLA 3TPUB 4FFVC 2ZSWB 1KF9B 4ORZC 1XGUA 3HUJB 3QXWA 2P24B 3VRJB 4JFZL 3C8DA 1IQWH 5ITBH 1A3LH 2R0KH 4U3CA 4D0CB 5HYSB 1UXWA 3O3EB 1N5YH 4F2MA 2IAMC 1AP2B 1HCFX 2F53B 4LLUB 5GGUA 5IIEB 2ZCHL 1ETZA 5L8JB 5ENWA 3LQMA 1CFNA 2GT9B 4PJAF 5C0CE 5BW7C 1G7MB 4ZS7L 5K9JH 2ARWA 1MRCH 1S7TA 2CRIA 4YHOH 3QUXD 1F00I 3ZHLA 2JTDA 4LPYA 4PIRF 2Q8BL 2BNUB 4L4JA 1XF3A 4MA3A 4ZXBD 4S0SD 5ELIA 1MNUH 3QEUA 4UIMB 3UC0H 3G6AB 4HUMB 4MJ6B 4Y2DD 2DMKA 5GRJL 4KJQC 3ARYA 3QJHA 3TZVC 1K6QH 1W0WA 4ZFZA 5CUSL 3RDTB 1UXSB 3PL6D 1CICB 3TWCL 1OW0C 1RD6A 3WKML 4U1MB 2WIIA 4YEEA 2W1NA 2O5ZL 4Q58C 1MHHA 2A9NH 5I18H 1Q9KB 4MD0B 1MRDH 4R0LC 4ODSL 1KELH 4N1EA 4KZDL 3OKLB 3O11B 1ORSB 2XZAL 4UQ3B 1YJDC 4KKCC 2MQ0A 1MJUH 1C5DA 2N7AA 3QDJD 3B9KA 4OIAA 2BRRL 5EC1A 2NW2B 1FRGH 3FCTB 5ADPL 2A1WL 2Q20A 4PRHA 4ORGB 1CBVL 3LEVL 4LP5A 3X17A 2JF1A 1S7XB 2DAVA 4Z7WF 5I76B 5L0QB 3RWFA 1I8MB 1K3IA 1J1OL 1HEZA 8FABA 3HZMA 4WHCA 5T5FL 4G42A 1HHKA 2YRZA 3L5JA 4F3FB 4LVEA 3IFOA 4G8GA 3WHE1 5C9JA 1YEEH 2W65B 1BQSA 4URTB 3RGVA 4PJCA 1D9KC 2IF7A 5DJZA 3LKQB 5HVFB 4F8QA 4HIXH 4Z7OF 1MF2L 4ERSH 1FC1A 4LVNC 4P49A 1GZQB 2VIRA 1EFXB 4FQ1H 3DV6B 3MBEA 5KAQG 5MENE 2WMPA 1VEOA 5JW4Q 3U7YH 2IBZY 4V1DD 4HLZH 4NKQB 3QEQE 2F5BL 2FYYA 2WWKT 1ZLWH 2Z92B 2AJUH 4JREC 1ADQH 4XI5C 5C3LD 3GSRB 4APQA 1JF1A 1YC8A 4JFQB 2EKSB 1PLGH 4HS6A 1XR9A 1JTPA 1MLBB 1HN1A 4W4NA 5EG6C 1T5WB 5DC9B 5TE4L 5CCKH 3MLZL 5GRXG 1JJUA 2FECI 2VDLL 2J1KA 3QO0A 3S34H 3HMXA 1SQ2N 2RQ8A 3C60B 1MHPL 4PD4K 5DMIL 3TA3C 5D8JL 4CVUA 1P53A 1UYWL 4MDJB 4Y19B 3LVEA 4Z7UE 4AZ8A 2GYSA 3P4MA 1MJ8L 4NQVA 4I4WA 1RFDH 5J06A 1P6FA 1UVQA 2AJZA 1KTDA 2D7OA 3EJZD 5C0FB 4PRPA 5ADOL 2QQNH 4DKAA 1JF5A 4EDXB 3FN9A 3LZFH 1JFQL 4J3VA 5HVGB 3U7WL 3LN5A 3KHQA 3FQTB 4L8SB 2DM2A 5BZDA 4PJCE 3HZKB 1T1ZA 5KVGH 2QADB 3UMTA 4ZPTA 2O5XH 1NGXB 4MZ3A 4LHUA 4Q6IC 4X0KB 3C9NB 1XGTB 1CLYL 3IB4A 2E6JA 2I9TB 4RGMB 3OZ9L 4AT6B 3J7HA 5CSZA 2NZIA 1AGFB 5ACLA 1RZJC 4FFWD 5DJ6B 1KFAL 3QWQB 1FHGA 5D7SL 4UT7L 3IT8D 3OAZK 1P4LB 1RHFA 1T7ZA 4C58B 1DVFD 2FBJL 5JORB 2JJSA 3T4AB 2VAJA 1RIHH 4Y5VB 1DSFH 4FQIH 3R0NA 1OP5H 2HT3D 1AR1D 4PV9B 3DX8B 3A67H 1T89C 2CGRH 2FJGA 1OHQA 5CD3A 5IF0A 3RRQA 3MBXH 1QSFA 5E6ID 3MNVB 4R90H 3K46A 4HGWB 1WAAF 2ADJB 5K93A 4C56A 1P4BH 5IR1A 2MNUA 4KQ4L 3IXAA 2HP4A 1X6NA 4S1DC 3U6RA 3VXQB 2HT2D 3GNMH 3BN9D 4P3CL 4ONGH 3DRQB 1TCRB 4KFZC 4KDTA 3LB6D 2H9GA 4R2GC 3ULVD 4XX1G 3QI9C 1WZ1L 4MNHB 2FJFA 2EECA 1YY8B 4P2QA 3TIEB 1YECL 2LAGB 3BZ4B 4FQLL 3RVTC 3MC0A 1K4CB 1YN6A 3E3QC 4L4TB 1FV1B 2IC2A 4ALAH 3GMOB 5H35B 4HS3B 4EI5D 4LCYA 4KVNL 3ECBA 3MJ9L 3PDOB 3VGAB 5EU3A 2VR9A 3NACH 4LCCB 3HLAA 5EO0A 1G6RB 3HAEB 3QXDB 4NHUB 5DZNA 4HWNA 4XC1H 4O2EA 4K55A 4OF7A 3F58H 3TBTB 1MI5A 3VXOA 2B39A 3KYKL 4GG6A 4DUVA 1RK0B 1QACA 4JHBA 1JHLL 5INCB 5DRXA 2H6PA 3CFKB 1M6OA 1T83C 5ID1B 4XNXH 3FKUS 2H8PB 3VWKA 3BVNA 1P69B 3GO1L 2VABA 3N1PC 4PLOB 4OAWA 4IM8A 3KNBA 3VFTA 3C5ZD 4CN6A 4NP4L 5FECB 4Z7QF 5DEFA 3KYNB 2NYYD 5IWLA 1XF2A 4Z7NE 4PTTA 4MCZA 3C60C 2P8PA 4WHTA 1TZHB 4R4ND 1BIIA 2ADIA 5FV2A 5JW4M 2UZYB 4HAFA 1F42A 3KLDA 3MJ9A 2I60L 3WIFB 4WFFD 5D96C 2ZG3A 3GKZA 2ARJA 4FQHB 1WFNA 2V7HB 1RMFH 3FB8B 3D25B 4MAYA 4X6DF 4ZO8A 1KTRL 3SKNA 1DTUA 1CWVA 1JK8A 4KUCD 4K3HA 5I1HH 5F89B 3SHSA 3ULSA 2QTEA 2OL3B 3Q0HA 4MHHI 4KMTH 3RU8H 2EC9U 3BJ91 2MHAA 2B1HH 4IDJL 3ZT6A 4UINH 3ALXA 3HI1B 1U8IA 2CDGB 4LF3B 5DUMH 3GHEL 1BWWA 1MI5E 3TN0B 2AKRB 5DHVA 5C0JA 5KVFH 1QHPA 4N8VA 3S3PA 4FFVD 4PJHA 3WFHA 1MCKA 4FHBD 1ZS8A 3ZKXB 5DJ8B 4NRZA 2VXUL 4H0HB 4WTZG 1R5WB 2HN7A 5GGTH 4W6WB 3O2WH 1JPTL 1T6VN 3S37L 3U9UB 2JJVA 3LKRB 1K8DA 4PG9A 2JIXA 3BIKB 4QTIL 2EDHA 1ND0A 1KXQE 2BVTA 3DXAA 3SY0A 4A6YL 4BM7A 4JANB 5FM5M 3NZ8B 5ICZA 3GSWB 3F7QA 3GMNB 3D85B 5FGSA 1TNNA 2X41A 5FYKH 1U8NB 2VKWA 3WN5B 1KEMH 4TOYL 1M1SA 2X05A 2Z8VC 1J7VR 1S7WB 2AXJA 2YHGA 4L9LA 4P2YA 9CGTA 4WTWA 3TZVD 3WE6A 2N56A 4XRCA 5K9OA 1IC4L 1U3HB 5TPWL 2C1OA 5TGBB 3N1FC 4GAJL 5TE6L 3D69B 1HH6A 3UBXI 1N3NB 5C0DB 4CN4A 6FABH 3BDXA 2IWGA 3I85A 1JTOA 2DQEH 3OR6A 5HSFA 1FSKC 1I9JL 3MGTA 1I9EA 3SKOA 5HGDB 1Y0LA 5IVNA 1REIA 4G5ZL 3MNZB 4FQ2L 4DKFH 4KKCD 4A6YA 1TJHL 3MRJA 5LGHL 4R26L 1DEDA 4JQXC 5MP6H 3HI5L 5KSBF 3I2CH 4YX2L 2ZOLB 1RZ8B 5IB4A 4D8PB 4LSQH 3GSUA 5TFSH 4L4VA 4YZFF 4OLZL 3V5DA 3QDMB 1I1CA 3RY4A 2CRZA 4OCWH 5B38B 5F1SA 3FB6A 1FAIH 4JHZA 1HHJB 4KGJA 4Y16B 4JZJB 2FLRT 1RU9L 3OXRB 1KB9J 4MYWB 2VLRA 3OAZH 4ESKA 1XGYL 1D9KD 1S8DB 3U2SB 5JOFB 2Q7YB 3W82A 2YD2A 2MTPA 2OR9L 3L1OH 1DFBH 1SY6L 5FYJU 3HA0A 5DTFA 5I2IA 2X4NB 4NRYA 1QVOB 2APBA 1HIMH 1X5LA 5KOVC 3VMOA 3OGOE 3ARRA 1INDH 1CR9L 2EDNA 5T3ZH 1JYXA 4XI5D 2ZG2A 4S10A 4EXPX 2ZP0T 4IRJA 2X40A 4KVCL 3H7BA 5GPRA 3BD5A 4TVPL 3NFPA 4IRZH 2XACC 4LPCA 3TESA 4LDEB 2YPKA 7FABL 3ETBF 4MNGB 3TIDA 1LO3H 1TZGL 5SX4H 1MEXH 2J6EL 2UZIH 3CAFA 4N0YL 4XGZA 5D1QA 5GRUL 2WZPD 3D48R 4TVSa 3SDXB 3TA3D 2OP4H 3IETA 2EC8A 2PCPB 3TN0C 4DAGL 1N26A 3GBNL 4N8CL 1CFVL 3WFEL 3UDWC 3BUTA 3EAKA 1J5OL 3MJ6A 1KENL 3PWNB 3MOAH 1SY6A 4XCNB 5D71L 4ZUTB 2BHUA 2OTPA 3S36L 1U8OA 1HQ4A 1NL0L 3T0AA 1OCWH 1EGJH 3FOLA 3SKJL 3ZTNH 5CJ8A 1GJIA 5JDJA 1AQKH 4M6OH 5CEZD 3ULUF 2O61A 5E6ZA 2F53D 4XB8A 3QIUA 5GGRB 4XX1E 5HYJE 4IIQB 3LMJL 5DD0L 3BW9A 2XKNB 1TCMA 2IADA 4JFPA 3C5JA 1Y6KR 3U1SL 1PQZB 5FV1L 2W92A 2UY6A 3S88H 4QXGH 4XP1L 3AXLB 3DX7B 4OQTL 1G9NL 3NFSH 5E4EB 2J6EA 4MSWB 5IT2L 1JNLL 1NCAL 4EDWL 1QSVA 3S4SB 3WNPA 5BRZD 1ZT1A 5I8CB 2SEBB 1D6EB 2BVPA 5GJSH 3ZLQC 3CU7A 2GTZB 4BH7A 2J8UB 3QWRA 4YC2B 1A7OH 3RPIA 5CEYB 4J4PC 5FYLD 1U3HC 4O02L 3RDTD 5GIRA 2MJWA 1JPFA 4Y0GA 1CICD 1WBXA 4TPRH 3U4BL 5KS9B 1TTFA 4G6MH 2XXMB 2AK4E 2OMBA 2DI9A 5ICYB 2APWA 3L3JB 2YPLE 2JLLA 5MERB 2R69L 4MNQE 4YGVA 3O3UN 4QY8B 2XTJB 4F80A 1GVIA 2H32H 5I66A 3MLWH 2CXGA 2BNQB 3LEYH 3L3GA 3VG9C 1UM5L 3DUSB 1FQ9C 1F6LL 2F58L 4S1DD 3N50A 4XBPB 1T5XA 3OHXA 3FT4A 3O6LH 4JQIL 4OQTA 5HDQL 4JB9L 4NN7B 5GGQH 4R2GD 3LS4L 3G9AB 3QI9D 2UYLB 1NBQA 5J6GA 2NX5A 4TVPE 3L5HA 4W6YB 3RVTD 4QNPE 3EO1A 1UT9A 4NOBA 4D3CH 1PSKH 4Z95H 4QXUL 2BOBA 4KKLC 4JZJC 4Y16C 4DKEH 1GOHA 4HMCA 4MA8H 5EUOF 1VDGA 4JDVA 4JFXA 3VFVA 4OD1L 4XCYB 2DI7A 2ITDB 2E9IA 4U0RC 4OIBA 2ZSVA 4HLJA 1TMCB 5IGXL 1MRFH 1EVTC 1Z3GH 1MCNA 4RRPA 3RWGA 4I2XA 5IBUB 2X5PA 3OKNB 2Z9TA 3W2DL 4AG4H 3FMGH 1U8LA 2OXGA 4PGEA 5HGAA 1RUAH 4LKXA 2MCG1 3MV8E 4RMVA 5CINL 2LTQC 3QRGL 1Y18B 4KU1A 3A0OA 1PGRB 3EOYG 4F7EB 3QFJB 1CLOL 4M7LH 3W9EA 2X4UA 5EBWA 1OSZA 3NCEB 2R4SH 1WFTA 3CNKA 1IC1A 2C26A 1UKQA 4K3DL 2ICEB 3VG0L 3OTTA 5ACZA 5JIIA 1HWHB 3C60D 3L5WB 3KJ6L 2R1YB 1ONQB 3IDUA 3UZEA 5GHWL 1J88A 3UBXB 3UTSB 4Y19D 2HT4D 2A83B 5C09B 5IM7A 1BD2B 3KPOB 5FO7A 3BP7A 3GMRA 1IGJB 1A5FH 3ARTA 4QRRE 4XPGH 1C5BH 2EE2A 4X6CB 1FZKA 2AI0H 3KVQA 4YUEH 3T3PE 2DF3A 5E94A 4HUKB 2YSSA 1JPSH 3QDGB 3NTCH 5D2LF 2QADD 1GYAA 1KJ2H 5JNYB 3T0EB 3OF6A 5D1ZC 5J56B 2A74B 4YAQB 3FN0L 4P46C 1EA9C 3CFBB 3EOAB 1S9KC 4GAGL 4ZUSA 5SWZA 1UENA 3BIAX 1IT9H 5AYQA 2CUIA 2HJFB 3BKYL 4KI5E 1QBBA 3V6ZA 5JW5B 3MV7E 2P5WB 3I50L 2NMSA 2A9MH 5I1CH 4XCFL 5EWIH 3RY6C 1AI1L 3D3VE 5E70A 1PVHA 3VFMB 3MZTA 4ZS6C 4ZFOA 1IGTA 1B2WL 1NCBH 5E9DB 3QNYA 1YN7B 4G9FE 4YC2C 2V17H 1KOAA 4HXBH 1FLRH 4LSUH 4D0DB 1P5VA 1WBYA 1MJJA 5C9KA 2AV7B 3RQ3A 4WENB 4ZTOL 1I8IA 1TVHB 1FO0A 3JVGC 2HMIC 4U1JA 5FF6B 3PWPE 2X4PA 4L3EE 1TXKA 2DYPA 2XTJC 3BGMA 2YD9A 4HWZA 3MR9B 1S3KH 3PGFL 3QNZB 2UWEB 4WFGE 3VGGA 4RSVA 4UUJA 5C0IB 2HWZL 3E2HB 1IGIL 5DHVH 5DMJB 2DQJH 4NN7C 1JGEB 1NSNH 4UTBL 3LKNB 4LPXA 4B7IA 2OI9B 3S5LB 2N4IA 1KEGH 3F7PC 4F2MB 4NN6C 5GGUB 3FT2B 3MA9L 1HI6A 4Z8FH 1YEGL 3D39B 4QRSA 4KAQL 5ENWB 5SWZE 2E7LC 1E4XH 2ZCLH 1MH5A 1S7TB 1ACYL 5CJXC 5CHNB 1T2QH 4KJYA 4D9QD 3RPKA 2WUCH 4JKPH 4X4XB 5EIQA 1AJ7H 5EOTA 1N0XL 3X12B 3FFDB 5T3XD 4E42A 5F72S 1XF3B 2R2BB 4MA3B 1BBJB 3QEUB 2XYCA 1FFRA 1VEMA 3C6SB 3R8QA 1GCFA 5F9WB 4UNUA 4AEEA 3QXTA 1L7TH 1JN6B 2FX8H 2OTUA 5HGHB 4LBEB 4QRPE 2PR4H 2PXYB 4HJGA 5IFJB 4NFBA 3NN8A 2XG4A 2Q76B 3QEGH 4P4KB 5F96H 3QYCA 1GGCH 1S7SB 2JJTC 2X7LA 3HE7C 4XHQA 1QSEB 2FX9H 1BJMA 1U0QA 2PYFA 1GAFH 4YQXH 2BSTB 4YDVB 3IGAB 1BJ1J 5DQ9B 5EZLB 1JF6A 4JRYE 4YXKL 3BPOC 5J12B 4OGAD 3KPSA 4OKVB 5I8KH 3BRFA 4OZGE 4DGYH 4MAUL 1XCQA 3V6OE 4XP5L 5TE7H 2KKQA 2GSGB 2V2TA 1C5DB 1Q9WA 3OKEB 4WUUE 3B9KB 2DWDB 2XFXA 4QHLB 5IHLB 2BVQB 4UU9A 2CJUH 2YOCA 4PGBA 4HBCL 2ZUXA 1R6VA 1R3HA 4ZMAT 4XNYH 1Q9OA 3L6FA 3EOTL 1C16A 2R4RH 4G42B 3W0WE 3ABZA 3QA3B 1DN0B 2E7CA 4G6JL 3HE6A 1OTTD 3B5GA 4WNQA 4Z7UF 4XPAH 3DJ9A 3TO4A 4CGTA 5I1KL 3R4DA 3P0VH 3TN0D 2P43B 4PJXE 3WD5L 4H5SA 4IBLT 2GUOB 2VIRB 1KIUA 1L0QA 3BQUA 4AENA 4FN0A 5T1DH 3DHJA 2F74A 5JA9A 3EUUA 3TNMA 4CW1B 1S9VB 4HFWA 4K3EH 5KG9B 4NO5A 4BH8B 2X4OB 2RCSL 4Y8DC 2GY5A 3QPQD 2ILLA 4M8VA 4X98A 2ADFH 3RHWF 3P30H 4X7FC 4QOKA 5KSVA 2X10A 1MQ8A 3QO0B 1XF5A 2DQHH 3TT3L 2BNRD 3D85D 1NDMA 4BFIA 3PWVA 4EZMA 1CQYA 3IDMA 3MRQA 4GW1A 3SDAB 4U6YB 4JG0H 4NQVB 4Y5YA 5L2KA 2YN3A 5C8JB 4XAWH 3RVWC 3QEHB 3D2UD 4OM0L 2QSCL 3E2HC 4PRPB 3SKMA 3GI8H 2XZQL 1HILA 4HIIA 4J4PD 1U3HD 4RDQF 5F7UA 4M43L 1OT1A 4NYLA 4CVZB 1O7VA 3LDBC 4YHNB 1NGZB 1RZKC 3P2TA 4OV5B 2H32B 5D7IB 4NT6A 4GW5A 4GOSA 4EI6A 2ZCKL 1XIWC 3CDGA 4LHUB 1TETH 3RIFK 3ARFC 3EGSA 1QYGH 4GRLB 1F6FB 3B3IB 1KBGL 3QZWA 1RUPL 1ZT4B 3VW3H 4NZRH 4UV7H 1I1AA 3O3AB 4ETQB 1KJ3H 1XR8A 1YMME 3IFLL 3MTRA 4IOIB 4ZD3H 1GGUA 3CFIC 3H0TA 3MRCA 4WO4B 2QHRL 3QIWA 3V5HB 4YHML 1XH3A 3T2NH 5ABDE 4Q9RH 4HIJA 1NKRA 3I75A 4Y1AE 5HD8C 5JUEL 2LFGA 1VSCA 4ONHA 3QDMD 4KY1H 3VD3A 3WLBA 1NAMH 1RZ7L 3WNNA 2PXYC 2HG5A 4KKLD 4Y16D 4ISVB 1MLCB 4BUHA 4P4KC 3DYOA 4UDUB 1F3DH 5FOBA 1IL1A 1DR9A 4HK0B 1QHOA 4TSCL 1R0AL 1NGPH 1X3DA 3UP1A 3TJEH 4OF3A 4OLYL 5CJOL 5L2KE 3IVKA 1INEL 5A16A 4IHOA 5J12C 1BQHG 4HS8H 3P4OB 1YMHB 5H94B 2BCKB 5I1IH 1T80A 5DQJA 5JOPE 4R4FL 4PRIA 1DANU 3E6HB 2WBJA 1LILA 3QQ9C 3BHBB 4JG1L 3CFEA 1DLFH 1JUFA 3MLUH 1D6VL 1QPXA 4MJIB 3O4LA 3HG1E 1Q0YH 2E9WA 2R1WA 3CK0L 3DMMA 3DO3A 3DSNA 4KWUA 4EN3A 3ISWA 5IKCB 1GHFL 2JJWA 1HHIA 2W9DL 2YK1H 5LAXB 4U0QB 4NZJA 4PRBB 1A0QH 4XCEB 3PQYE 4Z7NF 1F5WA 5D6CB 5D5ME 5IB3A 2XQBL 3GMLA 3U48A 1MELA 2B5IB 5EORH 1F4XL 3O2VH 1CDHA 1K5NA 4RISH 4GKNB 4DZBB 2JJUA 2X70A 1RUKH 3SGKC 4XNMB 1RIUH 4XPHL 4KV5E 4AK1A 1KJ2B 4U1IB 3MRDA 3U4EA 1CD0A 4PG2C 4AQOA 3O8XA 5F93C 5IVOA 1M6OB 1LK2A 2ZNWA 3GSOB 1T3FB 4FZ8L 5DVMA 5FOJA 2VQ1A 5LXGH 4R96B 3GSQB 3M45A 1FYTE 5AWNL 3Q3GB 3BVNB 3VFGH 5D1ZD 2R9HC 2CUHA 4GXVL 4P46D 1KC5H 1A9BB 2FEEI 1LEGA 1J18A 1B88A 2L7UA 3FAWA 4OF8A 1I1FB 1WITA 3H3PL 1FIGL 2XRAL 4N1CA 4JKMA 2BY1A 4MCYB 2IBBA 4JPKL 1U8KB 2FHFA 4GUPB 5JHLL 1IBGL 3D0LA 1FORL 4H0GA 1Q94B 4Z7WB 3O4LE 3ARDB 1NC4B 3MRPB 3SDAC 1ED3B 4HV8B 4ZS6D 1WZMA 1FPTL 1U36A 4UOW1 43C9A 1OT2A 3F6IA 3KPTA 4LLWA 2Y25A 4XWGL 4OKDA 2IALA 3MX0A 2PW1B 4D9LH 1IM9B 4PJ5A 3ULSB 2DQCL 4U1NA 3C8KB 2HMID 3MA7A 5DD1L 5EN2A 3I6KA 1IAIL 5FHBL 5E5UB 1CGSH 2MHAB 2XTJD 5I17A 2J2ZA 1U42A 4OSUL 5DD5H 2RGSA 4GRLC 1DEEB 1U8IB 3CFJA 4NQCB 4FQJL 4KTEL 5HHOE 4NJ9H 1D5BA 1AGCA 4Q0XL 4LHJB 5F1NB 2F5AL 5DHVB 5IESL 4K94H 4ZO9A 3FO2A 4H1LG 2BDNL 4W70A 4F9LA 1CGTA 2Y36L 5KAQF 1FFPB 4RWYH 1DDHA 4WO4C 2YUZA 2C3GA 4NRZB 1KN4L 1ZANL 4POZC 5D1XA 1BZ9B 5HY9A 1I7RA 2DM4A 3CCHA 5E7BA 5ID0B 3PHSA 2Q8AH 5EU4B 5IW6A 4I5BB 1FBIH 1A6WH 3E8UH 1QEWB 4WDIB 1OAYH 4P3DA 3P40A 3GJEA 4PG9B 1N6QH 3K8LA 3BEWB 3RX7A 2FZ3A 2BXYA 2Y7QB 4RFNB 4HIHB 5B8CC 1IC5H 1JNNL 1IGCL 3C6LA 4F33B 3DXAB 5C0NC 4JY6A 4NQSB 3UJTH 1ZVYA 2Y72A 4NKOA 4XPFH 1A6PA 1H3TA 4PJBA 2ESVA 5IJKA 3SDYH 1TZIA 3ES6A 3NABH 1NBYA 5FM4A 2FL5A 3HC0A 4WEBL 1U8MB 4EUPH 3JTTB 3SGJC 5E8DH 4G6KH 2NY1B 5ISZB 2EDBA 2C1OB 3HCVB 3ULUH 5ALCL 5EU7C 3FFCA 1IVLA 4ZQKA 5JPNA 4JY5L 1KJMA 1IM3B 1T21A 3G5YB 4PJFE 4WWID 1QRNA 4OM1L 3SDCA 5HHNB 2A73A 3H9HA 1UB5A 3EYSL 2QQLL 2VL5A 3N1GC 3SKOB 2IPUK 2A6IB 4MJ5B 4QKXB 4CMMA 1L7IH 4L5FL 3RWDB 5ALBL 4G8EA 3KPPA 1MQKH 3UTSD 4XPTH 5C09D 2Q3ZA 5J3HC 4PJEA 2AEPH 4RZCA 2B5IC 1GGIH 3STZA 1BD2D 4JFFE 5F44A 5BMFH 4GRWF 4WIQA 2XTLA 2DDQL 2F54B 4ODBD 4X7TA 4LSVH 4XP6H 5BJTA 2FWOA 1IE5A 3U36A 5IEKB 5K9QG 4L4VB 1KGCE 5H2BA 1UKTA 3V5DB 2DD8L 4K2UH 1ZLVK 1F90L 3RNKA 4RAHA 4JM2A 3HN3A 3LKPB 4FP8H 4HQQH 1I7ZA 3T0ED 1GL4B 4JN1L 2VLRB 3B9DA 5IMMA 4UILL 1G7HA 1CYGA 3VH8A 1NUNB 3LPGA 5E1HB 1OM3H 3IRPX 1HZHL 3WNLA 1ZLUK 3HS0A 3MJGX 5I2IB 4N68A 5HDLA 2XWJA 4LVOB 1PZ5B 3DVIA 3ARDC 3V0VA 1SBSH 1ZT7A 4JPVH 4NOFA 3VXSA 3INUL 3NMEA 3IJSB 1FNGA 1IQDA 5B39G 1BOYA 3JWOL 1QRNE 2J4WH 3IF1B 1WSST 2YKLL 2BSRA 1CXKA 2YMXL 4JVPA 5I16B 3SJVA 5IMLB 3F7YB 2JK5A 4NBXB 5FYKD 1MFBH 4XGZB 2VDPL 5CP7B 2NTFA 5SWSE 4OI9A 2EIZB 2AJYL 2FX7H 2WLZA 3KPNB 4Q6YA 3ILQC 1C5CL 3RVWD 1E6OL 4YHLH 3L3HB 4CAGA 1ZHLB 1W0VA 1LVEA 5GJTL 1DBJL 3RHWK 1OQXA 2R23B 1U8OB 5IVXE 2CK2A 1OSPH 3DRTA 4M1DL 5DJDB 1R3IL 3P73B 5ERWB 1WTLA 4YHPB 3NH7L 5A3IC 4ZDHA 3GSVB 3RAJH 3D39D 4NRXB 1XIWD 2I27N 1AFVH 5J1TC 1OAXL 3ARFD 2YXFA 5I8EA 4O58H 2IADB 4JFPB 3VXRE 1SHMA 1GGBL 1IILE 5JDSA 4YHZL 4RFNC 3C5JB 5HPOA 4U1LA 3FQUB 1BFOA 3B8SA 3QUXA 5JW3H 1YEKL 3ILPB 4JDTH 4X6DB 2FGWL 4Y4KB 1NFDE 1P9MA 4ZXBA 5D7JC 5EZOL 1B4JL 4Y2DA 3BP6B 1IZKA 1T20A 5HGBA 5HD8D 5I9QB 2NY1C 4QNPF 3RTQB 3T09A 3SJVE 3WV0A 2AJ3A 3VXNA 2DLEA 1UM6L 2CIKB 1CG9B 2PXYD 4HUWA 1JI1A 4XPBH 3HNVH 3PL6A 1NGQL 4RFEB 5DJ0B 5DJXB 3JSSA 4P4KD 1DQLL 3UJJL 2YD3A 2DBLL 2AGJH 3GMPA 1KYOK 1QSED 3BE1H 4XC3H 5CLTA 1S9WB 3PGCB 1H15B 3K4ZA 2G9HB 4GKSB 1A9EA 1RJLA 5DK2B 4HH8A 3L3KB 4KHXH 1U95A 5FB8B 5E2TL 5DUPH 3GIVA 4GJTB 1NLBH 4HWBL 3C87A 3IDJA 3AS0A 1XGRB 5T3ZD 2IEPA 1AD0B 4NKMA 2PNDA 5INDB 3QDJA 1OAZH 3QQ9D 4ZAKA 1SYSB 3OHXB 3QULA 3MLRL 4WFHD 4UV4L 2EDEA 3GIZH 1M7DA 3X11A 3EYVA 5BZWB 2X9WA 4G7VH 4X99A 3BKJL 1JNJA 5KSUA 5DA0B 2GFBB 2OBGA 3EO9L 4TYUA 2VDNH 2EDYA 2ZUWA 4PJ7F 4U33A 2AK1H 2B4CL 2VRAA 3OG4B 4JDVB 4NZTL 1BEYH 3QG7H 1KJVB 1JGLL 3EHBC 2IPKB 3I9GH 1ZGLM 4PP2B 1BVLA 2FO4B 3WHXB 3KYMA 5GS1A 1CL7L 3IU3A 1DL7L 4N9GA 2W59A 2HFEA 5L6YH 3ARSA 5E56A 1IGML 3H8NA 4PGEB 2BHZA 3LS5L 3O45A 4HWBA 4YHIA 4QEGA 4JY4B 4LKXB 5D72H 3TBYB 3ZDXE 4V1DA 1YEJH 1OARL 3SBWC 4QLRA 3RFZC 1P7HL 3S35L 3HRZB 3RP1A 4JHAH 3IU4L 2Z91B 3V2AR 2X4UB 4GS7B 4FQQB 4M93B 2IG2L 2R9HD 5KVEL 2V5YA 4AEHL 2AQ1A 2ENYA 2OSLA 3QDAA 1G7IB 4RGOL 1X4ZA 2EDDA 3LY6A 1WWBX 3QDJE 3WIHL 4KI5F 5DQDL 5KSBB 3GMMA 4KRPC 2C7UA 3IJYA 4HH9A 4KROB 1MPAL 3SDAD 4IOFC 3HFML 4AYFA 5FO7B 3GM8A 1V7MH 3Q6FB 4XH2A 4P5KA 4WW1B 2IBGA 5KJRH 3ARPA 3QFDB 3MLYH 4RX4D 5ESQB 5K33A 3ZYOA 4H20H 4WU5B 2YSSB 4Y4FC 4X6EB 4LRNL 2ZPKL 4OLVH 1D5ZA 4O2CA 5F9JA 1EHLH 1C1EL 4BFBD 1S5IL 3ZTJG 4NGHL 4GRLD 4MDIA 5DI8B 3GSNH 1QR4A 5J9PB 1QQDA 4JFDB 1VHPA 2X9XA 4LFHD 4LIQL 3IJHB 2W60B 4JFZH 3T65A 2XA8L 5D2NA 3WIHA 4Y4KC 4OFYD 3RVXC 4WO4D 2UVFA 3GB7A 4POZD 4M3KB 3ZDZE 4WWKC 3PHQB 4O4YH 3O3DB 2ZCHH 5E00A 3RTQC 2ATKA 4XVTL 1D5MA 3PP3K 1FJ1A 4PGCA 2P8MA 4YFLF 1DVFA 3T8XA 4I3RH 3ZMRA 5FA4B 5C2BH 2NY5L 4HWEL 3BDYL 2FR4A 2E6QA 2GI7A 3MRGA 4MLSA 4MMZC 5CJQH 5D70L 3WJLC 4K8RC 2XNAB 4NQEB 1MHCA 3B9EA 4LSTL 5E6IA 1W8NA 1HINH 3RJDA 2VOTA 2X1XR 3QCUL 4EUPB 2ZOKA 5EA0L 4MZ2A 5GRJH 2MKWA 4LMQE 4UUJB 3K8MA 4QCIA 2G2RA 1IFHH 1K4DB 2V9TA 5CUSH 3VXUE 5CJBA 2BJMH 3TWCH 3MRBA 3ESVF 5BXFB 4KI1A 1WIUA 3FTGB 3KXFE 3WKMH 2YA1A 4P9ML 3MCG1 3L3IA 4U6VL 4YK4B 5I0DA 4MJID 4W81A 2COQA 4U6HA 1WWCA 4LU5L 4P4RA 4XZUA 2I07A 3HNTL 4PR5B 5GSRB 3OMZA 1CXLA 3PV6A 3CSYA 5BQ7A 3RL2B 3RWIA 3FONA 4ODSH 1EEZB 3D0VA 4QRSB 4KZDH 2Z93B 2AXHA 1FVEB 4ZTPH 4XBGB 4OZGF 4EI5A 4MD5A 3V5KA 1OF2A 1JL8A 2BZDA 4S2SB 2JELH 1UJ3B 1AO7B 3CIQA 5J3HD 3UTOA 5ADPH 2A1WH 4I48A 1CBVH 5IV2A 4JO2H 4P57A 5IHUH 5E99H 2IANE 4I8DA 3O2DH 4ZPVB 1J1OH 2R8SL 5DHYB 3IS1X 4HSQA 3MV9E 3BD3A 5D7KD 2H1PL 2P5EB 3CH8A 4YFDB 2DQDL 3H3BC 4BKLA 3NN8B 4NM8L 2Q86A 2D7TH 4MJ2A 1VFMA 5IB1B 2Z8SA 2X7LB 3MUZ1 5F9DC 3LQZA 4TN9A 5TDNB 2D7MA 2YC1A 5SWQA 1YDPA 4NQDB 1CLZH 3C5ZA 3VXMB 4X80L 4PJXF 2D03L 1UCBL 1PY4A 5HPMA 4LIQE 5EIIA 3RNQA 2F5BH 3ZE1E 4CBPA 5HJ3B 4XNZB 4YXLL 3NFNB 3FOMB 1FL5B 3ARDD 1NC4D 2W0LA 2HVJB 1JYWA 1D5XA 4WW2A 2OX5A 3BAEL 1UZ8A 4DEPB 4MQXC 4QTHB 3MLSH 3U0PB 4LPTA 3TO2B 4U7MA 4PGBB 1N0LA 5EUOB 4OZIE 2IH1A 4PY8I 4RMWA 2HKFH 2EXWC 1JZ2A 1IM9D 2P8LB 3M17B 3MUGA 1Z5LB 5GS3A 5HHMB 1MHPH 1KNOA 3QCTL 5DMIH 2Y6SC 3TLRA 1N4XL 1UYWH 4IMLB 4F37F 4K94C 4NQCD 2NXZB 5EOCL 1ZHBA 4AIZB 4C83A 2DKUA 1DCLA 5ADOH 2UVEA 2VLJE 1LHZA 4WI6A 3ILQD 4F7TA 1BHGA 2VDML 3EDDA 3WSQL 1JFQH 2CK0H 1JGDB 4NO0B 4DW2L 1N64L 3U7WH 3UTQA 5DT1L 1DJSA 1UH4A 1YNKL 4M7JL 5TQ0L 3IAGC 5D7LB 4OZHE 5F8QC 2DQIL 5F7DA 2FJHB 5C08B 4HFWB 5M94B 5EUKB 3RWHA 4Z78A 1P7KA 5A3ID 1QPPA 5AAWA 5EPMA 4FQCH 1BFVH 2IFGA 4O51B 4X98B 2Z8RA 4M6AA 5EU6B 3S3SA 3OZ9H 5BW7A 3UO1H 3MOQA 1F4YL 1DUZA 3CLEL 3GFUA 3GMQA 2W9LA 3ARBC 2Q6WB 1JZ7A 4HC1H 3BWAB 4MB3A 4WFFE 1KFAH 4OFPA 4KMLB 1NAKH 5D7SH 2APTA 3K4AA 3KYOB 4QRTB 3BYYA 2QQKL 1X5XA 4XBEL 5D7JD 5KSAB 2FBJH 2DIAA 2LVEA 3SKMB 3ULUC 2NY1D 5D2LB 5DMKA 3G04B 4LOUC 3TZVA 5ISZD 5CZVL 4N0UE 4YK4C 3MRMB 3MLPA 3TNNB 5BOZG 1OW0A 4S1QL 1ZGLB 4PP1C 3U0TB 1K2DB 4Y7MA 1B0GB 3V9FA 1QFHA 3CDYA 3OXSA 3LRSA 4FNLL 5FCUL 4GW4A 5EULV 1RPQA 4RA3A 6CGTA 4R0LA 2DQUH 5C0GB 5EZIH 5FYJL 2MMXA 4MB4A 5BV7L 1C7TA 5HHVL 3MFFA 1VACA 1UJ3C 1ORQA 5E8EB 1KCRL 1QR1B 1XCTA 5JO5B 4AL8H 4JKWA 3MRCB 1YECH 2F54D 4FQLH 4NNPH 1BQLL 1B0RB 3OGCB 4HIJB 3B6SA 5BVJA 3PIQA 4BSVB 1EBAA 4JFED 2R56H 3RUGE 1ZWIB 3WLBB 3QAZB 1NANH 2FIKA 5J1AA 4LEXL 5ICXB 3TT1L 4M03A 5D5MF 4MA1B 1K8IB 4HPYL 2QKIA 3EHBD 3PP3H 4XXCC 2JCCF 1NEZA 5I1GH 5EB9A 4QRUB 4ODTH 3WJJC 1IKNC 5E2VL 1D9KA 4DGVH 3FT3A 4ZYKA 4IHOB 2X9YA 1H3UA 3QHFL 3DTXA 3KYKH 1NBZA 3FB7A 5MHSD 1JHLH 1RIVL 3BWUC 4KV5F 4Q97A 3IDYC 4NCC2 1I1YB 1JV5B 1P7QB 5D9SB 4YDJB 1WK0A 1MAML 1AXIB 4RMRA 4GBXB 4JZOB 1JUFB 4ZSOE 3VJ6B 3LOWA 1MREH 3G6DL 4OGXH 4X6FB 2Z4QA 4MQSB 3I6LE 4HUVA 4EN3B 1HHIB 4UZGA 5KOMC 3U4AA 1A21A 4L8CB 1T2XA 1O0VA 4G3YL 2VL4A 1RZJL 4UMGA 3VXTA 3SQOH 5IB3B 4LKCB 4OZFA 3TA3A 4KPHL 1J10A 4M48L 2CQVA 4J7RA 2EH8L 1QO3A 1LDPH 3EYFA 1VFBB 35C8L 3TPUA 3BGAA 2GJ6D 3CMOL 2ZSWA 4G7YH 1VENA 3HUJA 2P24A 3VRJA 2J3SA 4UIKH 1NCDH 1NMBH 2VXQL 4XMLH 4D0CA 5HYSA 1NUDA 3O3EA 2K1MA 1AP2A 2F53A 3GSNB 4OLUL 2WQ8A 5IIEA 3GHEH 1FNFA 4OJFL 4ELKB 5MENB 2D7NA 2GT9A 1WQVT 5EBMA 2CKNA 1G7MA 2KZ1B 5FYJE 1UWXH 1DQJB 3MRHB 1J11A 1CE6B 1ZHKB 2VXUH 3PV7A 2BNUA 4G8IA 3ARVA 2HFFB 4PJGE 3HC4L 1EJOL 4Y4KD 3RVXD 4GRWH 1EJ6A 1CDJA 1U8QB 5BRZA 4UIMA 5KSAC 4WWKD 3G6AA 4YDKL 3AS1A 3S37H 43C9B 1E6JL 3RTQD 1OL0A 4HG4K 5A2FA 3CLFL 4GXUM 1PKQA 3NGBB 3RDTA 5DRZB 1UXSA 3UCRA 5C0EA 1P1ZB 1CICA 3PABA 5DRWB 4Z7UB 3MLVL 3HAEG 4U1MA 1T89A 5CILL 3X13B 4PY8J 1NDGB 1BAFH 2CO6B 1A3RL 3SE3C 4MD0A 1KLGB 1UWGL 3B5TA 1CIDA 1AGCB 5C6TH 3OKLA 3FO0H 1AHWB 1S9YB 1A47A 1ORSA 2JKXA 4PJIF 4UQ3A 4NHCL 3FQRB 3VFUB 2YUVA 5TE6H 2NW2A 1R24B 2F53E 3JWDL 2NY0C 4RBPH 2BSED 4LSRH 1UH3A 3FCTA 3QI9A 2LABA 4X8JB 5AYUL 4PLKC 3VFNB 3CCHB 1S7XA 2VR4A 1I8MA 5I76A 1I9JH 4PJFF 3C2SA 4FQXB 1MJ7L 4PJDE 3GKWH 2Y23A 1WT5C 4MXVE 4F3FA 2GIYA 4MA1C 4FQ2H 2Y07H 2W65A 3BPNC 2NY6B 3VWJB 4L1DA 5DD3L 1TJHH 1ZV5A 3GRWL 3LKQA 1Q72L 5L7XH 2OR7A 4LASL 2ESVB 4Y5XB 3PE9A 3UPRA 3KPRB 4H0IA 5GGVY 1NBYB 2KPNA 4NQXB 3HC0B 1GZQA 1EFXA 2YXMA 3DV6A 3CX5J 2Z31B 3T04D 2Z92A 4GBXC 1RU9H 2AQ2A 3GSRA 3OX8B 1T83A 4JFQA 1XGYH 1J87A 3NCJH 2J8OA 3FN3A 4FFZH 2EO1A 1MLBA 4OGYH 4HKXB 4TNVF 2OR9H 1T5WA 5JHDD 3SO3B 3QPXL 5DMGC 4UDTB 1F3JA 4Y4HB 4XP9L 3C60A 3IKCB 1ZGLP 4I3GA 2AXFA 3QRFM 1G6VK 4KROD 4MDJA 4Y19A 1JE6A 4TSAL 4KVCH 2OK0L 4I13B 4TVPH 4P3WA 3GSXB 4MQXD 5C0FA 1FVDB 2HRPH 4EDXA 4L1HA 5JIKA 3U36B 2AJVL 7FABH 3V4PH 5C0AD 1J1XL 2EXWD 3FQTA 4KRMB 1OPGL 4L8SA 4HULB 3HZKA 3P0GB 4EJ1C 2Y9RT 3NZHL 1NGXA 3BXNA 1TLKA 1F13A 1RQ5A 5IMMB 3BOVA 4X0KA 5HDOA 4DAGH 3VH8B 3C9NA 1KCSL 1XGTA 1WC7B 4JFDD 2I9TA 1P4IL 4M9OA 1CFVH 5I1AB 4OT1L 4AMKH 3N0PB 4AT6A 4NWUL 4TTGA 3RA7L 1KENH 5D71H 4LLQB 1AGFA 1E4JA 3HI6L 4ELME 4E0RB 4XAKE 1S5HB 5DK3A 4C59B 5DJ6A 5IVXF 1TNMA 1XZ0B 3NVQA 3GK8L 3DURB 1FNGB 3L5XL 4ZFGL 3QXUA 1P4LA 5EOQH 1MY7A 4F37K 3NGBC 5JORA 2BSRB 2N1KA 3U1SH 3QP3A 2WNGA 4PV9A 5BS0B 4M4PA 3DX8A 2I26N 2VO5A 1Z9SA 2JK5B 5D4QA 4AY0A 2P45B 1G9NH 3ALWA 4NQED 1RSFA 5T3XL 1SEQH 1JNLH 5IT2H 5I1EL 1G6RL 4K23H 4OF5A 4EDWH 3MNVA 4Z77B 4WEUD 4HGWA 1MFAL 2ADJA 1NFDF 3CPLA 4YHKH 2DTSA 5B38G 2DM7A 4CU6A 4PBWD 4WVRA 4O02H 3VXQA 5JXAL 4F58L 3ULUD 3UTPE 4H88H 4LOUD 4LAJH 2B0SL 3DRQA 1TCRA 5DJAB 1CZ8L 1F58H 4JLRB 3WXWH 5K59E 1BGXH 3AGVA 2R0LL 5FGBC 4MNHA 2ED7A 3IDGB 2C1PB 2D31A 1YY8A 3TIEA 1VGKB 2BFVH 1CDYA 3BZ4A 4A2MA 4KK5C 1K4CA 2MKLC 2D0FA 3HTLX 1S7VB 1FV1A 1UM5H 4I18B 3EJYC 4HFUL 1MCCA 1R5IA 2NY6C 3GMOA 2VXVH 3E1F1 4HS3A 4NKIL 4QHKI 4W6XB 5H35A 3OR7B 1G9ML 1RURL 2KQNA 4P23B 3PDOA 1FCGA 5LGJB 1AO7D 2CKBH 1G6RA 4JQXA 1CGYA 4NHUA 1II4E 2MFNA 4EOWL 1C12B 2Z31C 3TBTA 1G7QA 4Y2DB 1FC2D 3QT2A 1RK0A 2VJXA 1EUUA 1M05B 4M7KL 2BVEA 4LCWD 3CFKA 3ZT5A 2P5ED 5ID1A 4IS6B 2RJMA 1V05A 5FGRA 2H8PA 2CRYA 1TVBB 3CSGA 4DQOH 2W0FA 1D7FA 1WLHA 1F02I 4ZUUA 3FQXB 4NQDD 3SO3C 1IQWL 3VXMD 5FECA 4NFDA 3KYNA 5ITBL 1A3LL 2AJXL 1U95B 2R0KL 3O0RL 1NMCB 1N5YL 2EDTA 2LVCA 1TZHA 2AABH 3P9LB 3ZDXF 2YD7A 2BMKB 1NFIB 4NKMB 1U58B 2V9QA 4N90D 3WIFA 1MRCL 1YJDH 3OV6A 2V7HA 2X1QA 1Y6MR 2VTFA 1A22B 3D25A 3FB8A 4L4TE 3F65A 1DQQB 1AC0A 4X99B 1AQDB 4XNQA 3PF2A 3BFOA 1RI8A 5F89A 4D9QE 1U3ZA 2OL3A 3S4SG 1X5JA 1FN4B 5HHMD 1N59B 1MNUL 3UC0L 4OZ4B 5GHWH 4X9GA 4FZEH 2YD6A 4F57H 3W9DB 3HI1A 3QUZB 1IC7L 2CDGA 5I75B 2DICA 3V4VH 3KYMB 2PF6A 5I1DB 2A77H 2AAVA 4K71B 3TN0A 5GQBA 2AKRA 2FECL 3H9SE 2P7TB 3CZFB 4NO0D 3UDWA 1FVCB 1OTSC 5ICZB 5D7LD 2A9NL 5I18L 1VKXB 2DLGA 1MRDL 1R5WA 3DGGB 3QUKB 3U46A 2FEDC 3VGFA 4DUWA 4G8FB 3QDHA 3MODL 1CU4L 2XIDA 4OI7A 3U9UA 3KS0H 3LKRA 4WTXA 5DS8A 5EU6D 3BIKA 1QLFB 3PXJA 2R15A 2G5BB 3BKYH 1FGVL 5M7QA 4JANA 3NZ8A 2BNRA 1I3GH 3GSWA 4GRWB 1WICA 3GMNA 3D85A 4XCFH 2XWBB 1AI1H 1LO2H 1B2WH 3ZDZF 5MI0B 5BOPA 5KSAD 1W2KT 1S7WA 2DRUA 2VH5L 1YEEL 4P5KB 1YQ2A 3EBAA 3QCVH 4QHUB 4J4PA 1U3HA 4UTAL 2P47B 4ZTOH 2WP3O 1D3CA 5TGBA 1LD9A 2XN9E 4HIXL 3D69A 4ERSL 3QB7C 1N3NA 1UA6H 4XMKL 3K80A 4YFLI 3LHPL 4FQ1L 5F9JB 1TPXC 5I15H 3U7YL 4I18C 5CEZH 4KK6C 4UBDC 4LRIC 5C1MB 4JPWH 4R4BB 2AJUL 1ADQL 1QQDB 4TQEH 3DO7B 1EPFA 4YPJA 4P23C 5MEOB 1PLGL 3MNZA 1IGIH 4UTBH 1FNLA 3BZEB 3VI3F 5HYJB 5HTSA 2ICWI 3T65B 1L6XA 4XP4H 4U1HB 5CCKL 3PWJA 5C0CD 4XXDA 2ZOLA 1RZ8A 3B4NA 4M1CC 1MCWW 3S34L 4PLKD 4JRXB 5KW9H 5E00B 3QDMA 2WANA 1I8KB 3A6BL 2VLKE 1R3LB 3ZZ1A 5IK3B 3CFDB 3GJFK 1ACYH 2H41A 1HHJA 4Y16A 4JZJA 5FKPA 1RFDL 3OXRA 5FYLH 1N0XH 5ACMA 2AJSH 2QQNL 5IP4A 4PRNA 3WS3B 1AGDB 1S8DA 5IBLC 3U2SA 5JOFA 3LZFL 1T7VA 5B4MC 5CD5D 2Q7YA 1NCWH 4J8RB 4G80A 1DBKL 1PBYA 2APFA 3CC5A 4M5ZL 5KVGL 3K2UL 5GXBB 4QCIB 1A14H 1ADQA 2O5XL 2AK4B 3STLB 2X4NA 2BX5A 1QVOA 3OPZH 1P7QD 1LP9A 1MFCH 2PYEE 3CX2A 4MNQB 4YBLB 4RGNB 3WUZA 4GBXD 3DARA 1DANT 3K8KA 2E7HA 4POYA 4U6HB 1YZZA 4BFGA 3NIGE 4P4RB 4XZUB 3T0DA 1VPOH 3TC9A 3AB0B 3CSYB 3FO9B 3KPQB 5BQ7B 4NUGL 3V7AG 1MCPH 4MNGA 5DMGD 3SE8H 3I3BA 4XP5H 5C70A 4LLVB 3AM8C 3ZE1F 1QFUH 5I75C 2VN7A 3SDXA 2YN5A 2FHBA 4K71C 1RIHL 1DSFL 2HTKC 1L6ZA 4HF5H 5J0BA 3A67L 1X9QA 2CGRL 3BH9B 4DVRH 4P57B 3PWLB 4E41E 4OZIF 2P48B 3PWNA 4XCNA 4ZUTA 3EOTH 3MBXL 3V0WL 4WY7L 4OQ1A 1P4BL 3D6GA 4U1KA 5I0ZA 2CDEB 3UAJC 2VAAB 2QJDA 5GGRA 1LE9B 3MMEB 2NQCA 1CXIA 3CXDL 5ANMB 5I1KH 5D1ZA 5MEND 5I1LB 3GNML 1FL3B 1U9KA 4U49A 1WCBB 3SEPA 3QEQD 5SWQB 3MV8B 1YDPB 3QXAB 2Z35B 2EEBA 3QHZH 2ZUUA 2FGZA 5HPMB 1V7NL 1B4RA 3AXLA 3DX7A 5MEPB 1UACL 3OB0K 1A7RH 1PG7H 4MSWA 3NA4A 4OZHF 5MI0C 2SEBA 5AUMB 3RY6A 1D6EA 1UZ8B 1F3RB 3HR5B 4PJ7B 2J8UA 5GRYA 4MNGE 4JGUA 1I85C 2DLFH 2RHEA 3CUPA 2IH1B 1CD9B 5KS9A 3TT3H 4HAGA 1DLHB 3HPJB 5ICYA 3JVGA 3L3JA 1MAJA 3JUZA 1KNOB 2A6KB 4JGMA 5MERA 3F58L 2CLZB 3MOBH 4QRRB 4QY8A 4X9IA 2UUDK 2RB8A 3AY4C 1MCOL 5ITFB 2NW3B 1BX2A 1ZHBB 4C83B 4OM0H 5KN5B 2ZG1A 1KB5H 2WV3A 4LCUB 4ODUB 1AKJB 3MUJA 4XBPA 4FQPA 5CBAB 5E7FA 5F7DB 2UYLA 2ZUVA 5HYEA 3ZE2E 1HWGB 4JE4B 2IAMB 1UB6B 4FQXD 4C4KT 1P7KB 4WUKH 3TF7C 5EPMB 3V4UH 3SE4C 4OBRA 2NNAA 3EJYD 3MV7B 2E7LA 1TDQA 2G60H 2CKBB 2NY6D 3VWJD 5CJXA 3D3VB 3LAFA 5DEGB 1RMFL 4Q9QH 5I6XB 4G9FB 5DR5H 2W9EL 1WBZA 2XKSA 3KPRD 4JQVC 1PX3A 4Z7VA 2J8UE 5SX5K 4EXKA 3QQ3B 3OKNA 1P5UA 2Z31D 4QRQB 1RZ7H 1A7NL 2B1HL 4JRWA 5DMKB 5KS9E 3PWPB 3RUGF 4UINL 3TZVB 2VISB 3BH8B 3UEZA 2AV1A 1Y18A 2PETA 2K3TA 3EKCA 4K9EL 2HYMA 4U1GB 1EH9A 3SDDB 5SV4A 4F7EA 1R0AH 2KDGA 2WM0A 3GI9H 5KVFL 2QR0B 5CJOH 3AB0C 3TH3T 4XVSH 2JJTA 2BNQE 1INEH 4HUXB 3OXSB 1YUHB 2LE9A 3DX6B 1N6UA 3N85L 1P84J 4MB5A 1K85A 3QIUC 4FTVE 4R4FH 2VDQL 3L5WA 2R1YA 2E9BA 4ZOAA 3NCYP 5HI5C 3O2WL 5FDWA 4JG1H 2DLTA 4H8WL 3UBXA 3UTSA 2A83A 4TUJB 5C09A 1D6VH 5C2UB 4M7ZB 1BD2A 1IGJA 1V3LA 1A8JH 3CK0H 1GHFH 3B6SB 4X6CA 3PIQB 4PB0L 4DN4H 3ESUF 1I9RL 1QG3A 1KEML 3S6CA 4HKZB 5JNYA 5GZNC 5C0BE 2ICWB 3T0EA 2QKIB 3EDEA 3SQBA 1IEAB 1T7WA 2A74A 4YAQA 4GMSL 3GJFH 3CFBA 4PUBH 3EOAA 4QRPB 1OY3B 2R0WL 2YUXA 3KS0J 4LVNB 2ZUQC 4XPHH 2HJFA 4ETYA 4FG6C 5JW5A 1R3JB 1OTSD 1UFUA 2DQEL 3BZFB 5GGTA 4LHUG 5T1MA 3QFJE 4XHJD 1CXEA 3TM6A 3EZJB 5AWNH 3VFMA 3VFSA 4JREB 4Y2OA 5JQHC 1YN7A 2FEDD 1LE5B 4JRYB 1FP5A 4IRSB 2Z4QB 4DKFL 1X5GA 5JXEC 1G9NC 4OZGB 2DLIA 4CL7A 1OGTB 3ARGB 5IHZB 1EMTH 2AV7A 5BS0D 4WUUB 2VB5A 5MP6L 1TVHA 5CKGA 5JHLH 5FF6A 3UTSE 4LSQL 2FSEB 4PJGF 5TDPB 3QNZA 3TA3B 1YPZE 2UWEA 1FPTH 2D2OA 4MVBC 3TYGH 1QO3B 2V5RA 4X6CE 4YE4H 3ZSSA 1G7LB 1F4WL 3W0WB 1JP5A 3Q1SL 1Q38A 3DVNB 3AVEA 3QDGE 2NY2C 2ADGB 1JGEA 1LEKB 3LKNA 32C2B 3VCLB 3T0EE 3S5LA 4YXHH 1MI5D 3L1OL 1DFBL 4AM0B 1E0OB 1YNTB 4OSUH 4PJXB 1ZHNB 3MZGB 3FT2A 2CXKA 4KI5C 1NBVH 3D39A 1KPUB 1XIWA 3ARFA 4Q6IB 4KK6D 4UBDD 5EBMB 1INDL 4N5ED 1QBLH 5IOPB 2VNCA 2ZUSA 5CHNA 2EIEA 3V7AE 2P5WE 1GSMA 4P23D 4X7EC 2Y36H 4X4XA 5I6XC 4P59H 3X12A 3FFDA 4IRZL 1CFTB 4G8IB 3K81A 5E9DE 4OV6F 1CDUA 3SOBH 2R2BA 1BBJA 3SGEH 5BRZB 5ESAB 1LO3L 5C07E 3RI5F 1MEXL 3C6SA 4KGLA 4M1CD 2R2EB 1JN6A 1X6LA 1UZ6F 2DMCA 4NNYB 5HGHA 4PJDF 4LBEA 3K74B 12E8H 1PKQB 4D2NA 2OP4L 2PXYA 2DQGH 4U1GC 4MXVF 5C0EB 1CGVA 3F12B 5IFJA 3PABB 3SDDC 1KULA 2Q76A 4P4KA 5I30L 4XNUH 4YR6B 1S7SA 1FFNB 4YBQC 1KTLB 5DC0A 2HFGH 4OCSL 1QSEA 3T3ME 3MOAL 5B4MD 2BSTA 1FL6B 4YDVA 3IGAA 1I9IL 3IAQA 5DQ9A 1OCWL 5EZLA 1BFTA 4UOJA 5JLZB 3R06A 2DOCA 4OKVA 3RL1A 3TVMC 2AXGA 3LH2L 1YYMH 3ZYJA 5JW4R 2GSGA 2I9LB 3OKEA 2UUDH 4M7ZC 2VERN 1JWUB 5DZOA 2XZZA 2DWDA 5ESVB 4QHLA 4R2GB 4JY5H 4LPVA 2BVQA 3KDMA 4HIEB 3QI9B 4K7PX 1JHTB 3VFRB 1YMMB 3NFSL 4NC1E 4P2RB 5F1OB 4WFEE 1SJEB 2IQ9H 2VKXA 4NCC1 3EYSH 2QQLH 3HMXL 1UWEL 3QA3A 1DN0A