4WFHE

Human traak k+ channel in a tl+ bound nonconductive conformation
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
211
Chain Sequence
EVQLQQSGPELVKPGASMKTSCKVSGYSFTGYIMNWVKQRHGKNLEWIGLINPNTGYTTYNQKFKGKATLTVDKSSSTAYMELLSLTSEDSAIYYCTRGNYVFDYWGQGTTLTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 48
structure length 211
sequence length 217
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wfhE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wfhE02
2DTSA 3TJEL 5JUEH 3D85A 3L1OL 5JIPA 3VU2A 3K8KA 4B5EA 4GBXB 5E2TH 4OUOA 5CCKH 3LN9A 3T0DA 2ARJQ 2Q86B 5I1CL 2DIAA 2GFBA 1HHJA 5F1NB 3GMQA 1ZLSH 5ETUA 4MQXC 3PG2A 2FEEI 1IKNA 3BZFA 3QAZC 3WFHA 5D71H 1JHKL 2C1OB 2NY4B 4KUCD 1S7SA 2BNRE 1TJHH 3MV9A 2HFEA 1C12B 1MAKA 3Q6GL 2OTUA 3RDTA 5HHXH 4K94H 1NMBL 1KCKA 4MCZB 5GGRY 4G6MH 5E2UL 3SDXF 1KSRA 3HR5B 1FO0A 3V0WL 1WCQA 4UB0H 2ADFH 3BX7C 2V5MA 3VFRB 5D72H 1MJJB 1NFDF 4M7JL 3TJHD 1NBZA 3U83A 1CLCA 1KBGL 5IFJB 3GGWA 4NOFA 3A6BH 2CDEA 1HCVA 4MJIB 1IKFH 1BP3B 4Z77B 5KVDH 2B1HH 4P4KA 4OZHA 2W0KA 2NW3B 5EU7E 4XI5D 4GKZB 5L8LB 1H9VA 1M71B 4J6RL 4JFXA 5CILL 1BEYL 4H8WH 3PWPD 4QRQA 2FR4A 1DL7H 3KYNB 2NW3A 1R6VA 5JORB 2DQTL 5B4MD 3LS4L 1W2KT 2DN7A 3ZT6A 1ZLWK 5FYJU 1BFSA 2MSPA 4HIIA 2H41A 5F9AC 3IETA 3GSNA 4GRLC 3SGEH 3SJVA 2NY1D 1N5AB 5JORA 2IMNA 1QSFE 3P77B 4S1SL 1NC2B 1UH2A 4JFEB 2HKFL 4MNQD 5J12B 2F8OA 4OCYH 1P7QB 5DD5L 5HDBE 4UV4L 3T0BA 3ILQD 1QLFB 1NGZA 3KS0H 5HHNB 1F4HA 3QFJB 5TQ2L 1UQSA 3GI8L 5E9DE 3OR6B 5D1QD 2EKJA 3EYFB 3NGBB 3QXTA 3KPSE 4PJ5E 4GT7A 3RRQA 2EDLA 1OWWA 2NX5A 3ZO0A 4QXUH 2ADGB 2KZWA 3MRQB 4G9FE 5T1DL 4G7YH 2XZCH 4LQ1A 3RL1A 4HUWB 1FPTH 5GZOD 3JWDC 1QUNA 3I3BA 2AK4D 2AJUH 1LO3L 4P3WA 3S5LG 5F88B 1UWEH 4I2XE 3VXQA 1WIOA 3P4MB 2CRMA 4LRNH 3T4YA 1CK0L 1MNUL 2D7TL 3VD7A 2XG5A 3VI4F 1GHFL 3EHBD 3TBWB 2A6IB 4FQCL 4X4XA 1XGRA 1RIVL 3DVNB 3I75A 1MI5B 1E0OB 3DX9B 2HLFD 1I1FB 2ICEB 1FC2D 3HMXL 4H1LH 5HHVH 4Z7QE 2BFVL 3EYVA 4XRCB 1NFIB 1QP1A 2JKXA 2P24B 1O0VA 5BS0E 5CJXC 1IVLA 5C07B 3W5NA 2E9WA 3QJFA 1CG9A 1IBGH 1MI5A 4XMPH 3V52L 3O2VH 1T0PB 5EDXA 1PYWB 4XRCA 1OAKH 1CE1L 1BQHB 2LU7A 1DBJH 2O5XH 3KJ4B 3WSQH 3F58L 5GGRA 3KJ6L 1P2CA 1F97A 3WJJA 2XICA 3I6LD 3REVA 4X5XB 5K9JL 1EH9A 1U0QA 1YDPA 1RJZA 3QEQE 1FORH 4WI9A 5T3ZH 2CSPA 5J56B 4KI5D 8FABA 4F7CB 1YN6B 4QRRA 4L8SA 4YHPA 2X9XA 2V7HB 4F7MB 5HGBB 1T03L 3OKDA 1UEYA 1AO7D 1ERNA 4K3DL 4WEBL 3KYMB 2WLZA 1KIUA 4HIJB 1JUFA 2JTDA 4BZYA 2AAVA 4GAJH 2QHRH 3KPPB 4F7MA 1CDGA 2BSTB 5CBEB 2QADC 5BV7B 4AIZA 1E6OL 1NUFA 4O2EB 4P23D 2ZCHL 1R5VB 1T89C 5L7XH 3IDYC 2NY5L 1MQKH 4NCC2 4HWEL 2QL1A 3GMRA 5FYLH 4ENEC 2NY0B 3GSVB 4QCIB 4ONFH 1GAFL 4CNIA 3EO0B 1LEGB 3BP4A 2OP4L 3NFNA 1R24B 4RGNE 1J0JA 5TF1H 3L5XH 4O2EA 2JB5L 5B3JF 4HBQA 2HAZA 2X89A 4NHCL 1IAOB 4L4VE 2FX8H 1OP3H 4F7PB 1I9RL 4L4TD 1KPRA 3PQYB 1DBBL 5DLMH 1FFPB 4QCIA 1G84A 3EO0A 1XGUB 2YD4A 1BD2E 1RZ8A 1F5WA 3WE6B 43CAB 3QQ9D 4PJCF 1MCOL 4X99A 2E7LC 1FNLA 4FZEH 4DFHA 2DYPA 2NY6B 1FYHB 1J8HB 4F2MA 1J12A 5E8PB 3PQYA 2UY6A 4V2CB 4GRMB 1HZHL 1V3JA 3ARUA 2I60H 3QPQD 3ZDZE 4PRHD 5CSZB 3MODH 1QLEH 1XGUA 1EV2E 1ACZA 1A6UL 3ARGC 3UC0H 3IXTA 1QBBA 2GW5A 3FB8A 5IF0A 2EDTA 2EC8A 3ZDXE 2BX5A 1EBPA 5LWYH 3VGAB 5D6CA 4R8WH 5T33L 4N0FB 5IVZB 2VQ1B 1KB5B 1G1CA 1CGWA 3LH2L 5C6TH 3W9DA 1OT2A 3T2NL 4PG2C 4JFQA 3MPCA 4PGZA 1FO0H 2YMXH 1KULA 2XA8L 3RP1A 5IHBA 4M8QA 2E6QA 3QI9D 4GXVL 3HS0B 3A67H 3HNVL 3UTSA 4N8VB 3SDCB 3SDDB 3AY4A 1AC6A 5F3BB 1B90A 3C9NB 4M61A 5F1IA 4Z7WA 5SV4A 3EGSB 1FL6A 2HFFA 1HCFX 2PO6D 3UTQB 2DJ4A 3WIFA 2X10A 4IRSD 4XXDB 5F3BA 1XAUA 4S1QL 5ISZE 3QXWA 4ZTOH 1JGEA 1JV5A 2Y23A 3RKPA 2J8UB 4WHDA 1BOGA 3WLBB 4JO2H 4G6JH 1KJ3H 3D48R 2VERN 3TYGL 5EUOF 1RZ7L 2DDQL 4XXDA 5H94A 3QFDA 4WI7A 2QQLL 3GSNH 1IT9H 4MQXD 4UV7L 1U8JA 1XGQB 2J2ZA 3K4AA 5GSRA 4WHCA 4CRPA 4PYHA 1KIPA 3C08L 1UVQA 1KCRH 4JPKH 4RBPK 4TSBL 2LTQB 5DFWH 2OL3L 1IEAB 4UZGA 1HIML 2LAGB 4UU9A 5B3NA 2A0LC 4AK1A 3BZDA 5DRNB 5BJTA 1XGQA 5SX4I 5F7DA 3BE1H 3RA7H 2VE6A 4IMKC 1U58B 4WUUD 4G6KL 5K93A 3EDJA 2C3VB 2E6PA 3EO9H 1ZK9A 2UY7A 3WMSA 2OMNA 2DMBA 3U2SB 1F3JA 3DRTA 4KZEH 3D3VB 1EJOL 5AAMA 4CKVX 3KYOB 1EO5A 1CLOH 3F5WA 2IBGA 2CLZB 3WKMH 3GUTB 1NEZA 4JO1L 3NCFB 1YEIH 2C3VA 3NIDE 1ZT7A 4PB0H 3JVGA 1KIQA 5DJ2A 1DSFH 3OAZH 3ET9F 3QULB 4APQC 3PHOB 5JXEC 4Y4FC 3RWDA 4POUB 4HIEB 4HJJL 2ESVD 1F58L 5D2LB 1N3NB 2VXVH 4YFEA 4HUUB 2DWDA 4FMFA 3SGKA 1B3JA 4K7FA 4YHZH 5CEZH 5I2IA 3UO1H 4OLUH 2NY2C 5DXWA 1MLBB 3HAEG 4WI4A 4KKBC 1A02N 1MF2H 4RZCB 4H20L 2E6JA 3VXPA 2OBGA 3WDJA 4KAQH 2R1XA 3T3ME 1R0AH 3AREA 1BFOB 2PXYC 1B9ZA 1QRNB 4LAQH 4KTDH 4GRLD 3UBXA 5FF6A 2V9TA 4MJIE 3FRUB 1H5BC 2AV1B 4MD4A 4Y2DA 4PGJA 2I5YH 4FFZL 3ESUF 5CP7A 3WIHL 1X5JA 3QDMD 1BFOA 2X1QA 2ZUXA 1OTSC 4TRPH 1V3KA 1G7QB 5C0BB 2CKBL 2W0FA 1DQLL 1HH9A 4Z7QF 4KK5C 5M95B 4R7NA 2GITA 3GMNA 5AZEL 3O3BA 1GGTA 5DURD 4I3GA 2EDHA 3F7VA 3OJDB 4PJ8B 2F5AH 1T20A 3TIEB 2ZCKH 2CUIA 4QOKD 4YEEA 4OIIH 4PJAA 3LKPA 4WUKH 2Z31D 2D0GA 2AK1L 1JF1B 3HE6C 3OPZL 4HXAH 1UB6A 3EKCA 4GW5B 4GKNA 5L88H 3FMGH 4HXBL 4JQIH 1R3KB 4TSAH 3MRRB 1A1OA 4PJ8A 1I1AB 1FE8L 1H0DA 1OTTD 4JFEE 4MD5B 4W70A 4BFIB 5C0AB 1S9XB 1TCRA 4JGUA 1KF9B 3SPVA 3CD4A 4NO0A 5I74B 3THML 2XTLA 5HVWA 3BP5B 1H3PL 3QFJE 3ZE1E 4K7PH 2Y36L 4PJHF 4KQ4L 3D1MC 3P9LA 4U4BA 3KPMA 4ZDHB 1FAIH 1F11B 1TJGL 4JM2F 5EN2B 2YZ8A 2BVYA 4WTZG 4OI7A 3Q3GA 2BJML 1J0HA 1K8DB 5MENB 3G6JB 4U6YB 1HKFA 5I1IL 1YJDH 4M7ZC 2UWEE 2A6JB 1NKRA 1Z9MA 3ULUE 3RWJB 4C58B 1I75A 5EOTA 4BSVA 4PV9A 4LVEA 4MX7A 5EN2A 2RHEA 1TITA 1BIIB 1S7XB 4KVNL 2FNBA 1KFAL 4I0PD 4YHML 4XCEB 1IEHA 2CXGA 3VJ6A 2DJSA 3MR9A 4D0BB 1Q9LA 2A6JA 1JFQL 1A6ZB 3GKWH 5EBMB 3HPLB 3T65A 4X6EA 3CFCH 3X14A 4QWWC 1BIIA 3IFLH 1JNLL 1S7XA 4JFHD 5KS9A 1IC4H 3BDYL 2CK0L 1E4KC 3ARFC 2CJUH 4IM8A 3F65A 4EIGB 1OT1A 5C07E 4HGWB 5F72S 1REIA 4EIZC 1YYLL 3KNBB 2Q8AL 4Q0XH 4GH7B 5JW5B 4MWFA 2F53D 1X5HA 1NCNA 5A2IH 3BKJL 3LQZB 4U0RB 3BO8B 4CW1A 4LLAA 2AEWA 3RVVC 4JHAH 3T04D 3ZDZF 2CIIB 5MEQB 2QADD 3VGFA 4IHOB 2OYPA 1MPAH 3ZDXF 3FQWA 3WN5A 4NQVB 3ZL4L 1BGXL 3UMTA 3O11B 3B8YA 1ZWIB 2IH3B 3GK8H 3RWIA 4ZYKA 2DICA 3BZ4A 2MHAA 1HSAB 2MCPL 5F89B 5HPMB 3OKMA 1Q0XL 5AYUH 4K3HA 4DW2H 2HT3C 3QNYA 1TTFA 1DQDH 4NNYB 3FFDB 3G9AB 1U8NB 3V9FA 1FNSH 1JN6B 4U1SB 4K3JH 3SEPA 2WBJB 1E4WL 4ZAKC 1P9MC 1MFEL 1HSAA 1A4KB 4E42A 4ISVA 2V5YA 4GAFB 4XGZB 3LZFL 5LBSL 3T0EB 1EHNA 3V6FB 5I8KH 5HY9B 4Z78B 5E7BA 3C5JB 4ZFGH 3ARGD 5JO5B 2EDRA 3QUMB 5TDOA 1RU9H 2Y5EA 1UZ8A 5GPRA 2CRIA 1X3DA 5CZXD 5C0DB 4ONHB 2DI7A 2G9HB 2OR8A 4Y5YB 1NDGA 2VDML 3T8XB 3N1MC 1U8LB 4XNUH 4KQ3H 4JZJB 3FHQA 3ARZA 4PRPD 2AXFA 5D7IF 5GRJH 3V6OE 4ALAL 4P4RA 4NO2B 5TE6L 2PTTA 3I6GA 5C0DA 1PKQB 5EPMB 1A7PL 4TULL 3AM8C 3LV3A 4ZO8A 1WSST 4XPTL 1QPPA 1J8HE 4NPYB 4G80B 4HFWA 2ICWB 5E4EC 2I26N 4WV1A 3MXVL 3O3DB 3MRFA 4P2QA 1ACYL 3AU1A 2CIKA 5IB3B 4Z0XB 3NA9L 4X4YB 4I3RH 1JYXA 4Z8FL 2CO7B 1OTUC 1ONQA 4KRMB 4DAGL 2FO4B 3MUHL 1XCTB 1VFAB 4Y1AB 1MCWW 4E9LA 1PGRB 5B38G 5ERWB 3UTPD 3MRGA 1BLNB 1NGWA 3MV11 2DOCA 1RZIA 3E2HB 3TBVB 3GM0A 1MCCA 3BH9A 3BSZL 1FC1A 3RIFF 1A6PA 4ZODA 1XMWA 1LILA 4NC1C 4TTGA 5IV2A 1RUAL 3TEUA 1RJLB 1BLNA 1DBKL 1XIWB 2EYRB 2VDOL 2HMID 5IESL 5FUCE 1MLCB 4PRNA 5I71C 1TTUA 1LD9B 1BFTA 1Q94B 5FV1L 3HG1B 1EGJL 2A0LD 2HWZL 4B53A 3WS3B 1K6QL 1SBSL 3H9SA 3DXAB 1LEIA 1EEQA 3CFJA 2EH8H 3ULVL 2M1KA 4YHLL 4H1LG 2YC1B 3QNXB 4OZHF 4NZUH 4ODTL 3INUH 4Z18A 2J8UE 3HG1A 1Q9WA 5LCVL 3IXAB 5JHLL 1KC5L 1KIRA 4N9GB 5J3HC 5HI4C 1UT9A 1TPXB 3K4ZA 3CMOL 2BXZA 5DR5H 3MJ9L 1FFOA 4P5KB 2JJUA 5IR1A 3U82B 3SDAC 3VG9B 3DUUB 3LHPL 4APQD 4JKKA 4PJEB 5JXED 4Y4FD 3E8UH 3P4OB 3RTQC 3GMMA 2IPTH 3DRQB 4L3EA 4NNXA 4LF3B 2IAND 3P4NA 5KTEL 5DA4A 2NY2D 3FJTA 4KKBD 2OJEA 3DUUA 2W91A 3SKMB 1I9IL 4Y8AA 3ZTJH 5FOBB 2ICCA 1LEKA 3D3VE 2A1WH 5KJRH 1AGBA 3VXUD 4BKLA 3MX0A 5E7FA 5IMMA 5D1ZC 1KENL 4NQXA 1S3KH 2PXYD 3BFOA 4JFDB 1CL7I 1OGAB 4AMKH 3V7MA 4DEPC 4HX1A 1HHKA 3I84A 1S8DB 5INCA 3BT2L 4J2XA 3CFBB 4LLMA 3ZE1F 2ZSVB 2R56H 5SWSB 1OTSD 1OD7A 2MQCA 1LO0H 4MQ7B 4WFGE 5D2LE 2BNQD 5DEZA 3TVMB 4H5SA 4J8RB 3LDBC 4KK5D 1GC1L 2BY0A 3LSOB 3RJQB 1DN2A 1I85C 4V1DB 4RQQB 3D25A 1G9MC 3CFBA 4FTVA 1DLHB 1ZE3C 1EEYA 3GMPA 2V9RA 3K46A 4WFFD 1ADQL 4JFOA 4HS8H 1RZKH 4LSSL 1IC5H 5I8CB 4WW2B 1QRNE 2PYED 4G9FA 4V1DA 2DLFL 1JYWA 3KR3L 1RIUH 4O2FA 3QWOA 1FZJA 4DQOL 4EN3D 4Y5VB 3VGBA 4YHIB 2D7MA 2A6DB 2I24N 2R0LL 3FO0H 4NUGL 5EZJA 4I2XA 4NQSA 4WW2A 5C0BE 1RMFH 3OXRA 4LVHC 4FFWC 2YPLA 3DV6B 1FGNH 5CBAB 1JPTH 5GS1B 5FK9A 3CFDB 4UBDC 3WXVH 1MIML 2JIXD 5HDQH 5HGAA 4JQVA 1J86A 1G6VK 2JJVA 4ZPTB 1INDH 5GRZA 3UP1A 4J4PC 4FHBD 3VXNB 3OSKA 4LNRB 3CFDA 4DN3L 4MAYB 5E6IA 3TYFB 2VDQL 3BPLC 3TCLA 3PHQB 4RX4D 2AJ3B 3UYPA 5IVXA 1NCWH 1D5XA 4R90L 4U33A 4R0LA 4C54A 4HS6A 5C0AE 2VLKA 1BF2A 4OI8A 4KJQC 3HRPA 2VLME 2X4NA 4LNRA 4EXKA 2OJZH 5IT2H 3QH3B 4Y5XA 4QWWD 4LGSB 3FFCA 4UILL 1G0YR 5EU6A 1NDMB 1XF5B 1B0GB 4M5YL 5C08D 4ZG1A 4N1HB 4ZOAA 5I16A 3WUWG 5MENE 3G6JE 3TNMB 1UJ3B 3T1WA 3BGFB 5E8NA 5HSFA 4ZXBC 3CX5K 2B1AH 3GSQA 4LCWB 1B0GA 3U36B 1AD9A 4OFVA 3MXWL 1IGIH 4P57A 3RVVD 1NLBH 4OFIA 3VI3E 3BGMB 3EFDL 3K74B 2JJTC 5CIPB 1AXSA 5GGQH 4JO3H 4BQ6A 2Q87A 1D6VL 1MHHA 3B9KA 5I1KL 5GGVY 1T21A 5BO1H 5DMIH 3MLSH 4MXVE 4X6BA 4F8TA 1G7IB 1SJVA 3JV4B 4KHTL 3V7AE 4X98A 3OZ9H 4C4KT 2NXZC 5EC2A 5IJVB 5LVEA 3GMLB 1KEML 4OCRH 1CFVL 1K2DB 3V0VA 4ETQA 4ZAKD 3JV6B 5FB8A 3S36H 1HH6A 4UT7L 3EO1B 4MNHB 3VFNB 4L9LA 1UKTA 4Z76A 2DM7A 4D8PB 5HYFA 4P3DB 4AQ1B 1A8JH 2C9AA 1UXWB 3TO4B 1EMTL 1K5NB 4PV8B 4RMVA 5E95B 4FFVC 4O4YH 1LO5B 3VFNA 3RZCC 1XF1A 5D7LB 4NQDE 4JR9L 4D8PA 5A2KH 1VFOA 1LO2L 3N9GH 1MCPL 1WBXB 3VGEA 3S3JA 1QFWM 1MVFA 1FVDA 2VSDA 3DO7B 3OKNA 3DX6B 1RUMH 4WENB 1EEZB 4YHKL 4JAMA 2Y1VA 4YUEL 4GKSB 5HDLA 4JKMA 1LO5A 4XWGH 4JO4L 5IIEB 1AFVL 3KPRB 3VXMB 4MB4A 4XHQA 3DX6A 1N8ZA 1Z5LA 4Q97A 3T0EE 5J57B 3SKJL 3BPNB 2P7TA 4YQXL 4PGBB 1WBZA 2B4CH 2C1PA 4TVPH 5C0CD 3ES6B 5IJKA 4HAGA 1OTUD 5BRZD 1F4XH 4M1GL 3U7WH 1NBVH 4Y16A 3VFWB 3D0LA 5IVNA 4U31A 2Z4QB 3RHWF 4BZ1H 4WFHD 3AB0B 4XPGH 5IHZA 2IQAB 1SM3H 3CC5A 4I13B 2J8UF 5EZLB 4NO3B 3ILPB 4FQQA 4G43B 4UQ2A 1IFHH 5A3IC 5J11B 1FVEA 1AQDA 1IAIM 2A77H 4O58H 7FABL 1PKQE 4FZ8H 1TVBB 1LHZA 1VGKB 1QVOA 5HYJA 1MFCH 2AI0L 3B3IB 1A3LL 3GIVA 4KDTC 2Y25A 3N85H 3QWQB 4YXKL 3LPWA 4OLYL 1VENA 2OL3B 4L29A 5T1KB 2YD3A 4MAUH 3QJHA 2OSLA 4DVBA 4ZOCA 5CEYB 3BH8B 1EBAA 1U8KA 4F7TA 1M4KA 2GCYB 3U79A 1M7XA 2EE3A 3FO9B 4Y1AE 2FBJL 1KJMA 2ATKB 4XP4H 5J06A 5DJCB 5GJTL 2C4XA 5CEYA 2YSSB 3HNSH 1N59A 4C83A 5D70L 2GCYA 2XPGB 1IGML 4ACPA 1O7SA 1ZTXL 5GS2D 4Y4KC 5J3HD 4XPHH 1KELL 3I3DA 5HI4D 4YFLF 1VEMA 2XWBA 4PRIA 3MZTA 1XF3A 1YY8B 4K7PX 5K9QG 3NN8B 2CD0A 1RZJH 4QTIH 3AGVA 3HZKA 1IKNC 3SDAD 3WJLC 4LSPL 2R1YB 5D8JL 4PJXA 3RTQD 1DFBL 3CSPA 4S2SA 3QCVL 4RWYL 3DX7B 3GSOA 4LSTH 2A83A 1VGEH 3DXAE 4LQFL 1GCFA 4DTGL 2HG5B 2O5YL 3RIAF 3IB4A 3WEXB 4KKAC 3SKNB 1VFUA 5JDSA 3VA2C 5I18L 1NEUA 3QUYD 3SE4C 5CHNB 2XG4A 3STLA 1LE5A 4OD1H 4NUJA 1BWMA 3KPOB 1SY6A 1BBDL 2EXYD 2GJ6A 4GMSH 4HG4J 5D1ZD 3P30L 1L7IH 4X0KB 4FNLL 5I30L 1WITA 5IROC 4PGCA 2N7BA 1CICB 5IFHH 1FVCA 2CKBB 4KKCC 1DR9A 2EXWC 2GAZB 3FN0H 1R3LA 1I1RA 3P11H 4PJAF 4PJEE 3LAFA 3O6KH 5FYKD 1X5YA 1AD0B 3LKRB 2FD6H 4PRDA 2J88H 3VRLF 4NFBA 5B8CB 4YBLB 3VXTB 4FG6C 1QEWA 5KSAB 2AJXL 3OHXA 1HKLH 2WANA 4QRPA 5BCAA 2X4SA 2C7UA 2IH1A 2W0PA 1I7TA 4E41D 3FB5B 3KPLB 3V5KB 3MGTA 4B7LA 1G7PB 4P2RB 4EOWH 5GJSL 1L9NA 2VDPL 4NN7B 4IOFC 4YDLB 4R9HA 4RMUA 4JFDE 2AQ2A 1OGAE 4OUUA 4LIQH 1ZT4A 3MOBH 4HFUL 4HC1A 1BM3L 3O45B 1BBJB 5E99H 1B6UA 2XOTA 3OAZK 1QLRB 3NFSL 5K59E 3KPLA 5JLZB 1VB9A 3QEGL 4P2RA 3GHEL 5DMGC 5SWSE 1ZS8B 3HZVB 1T5XB 3VWKD 3RGVA 3HCVA 4FFWD 5JPMB 1VEPA 5EG6C 2X4QA 4ZFZA 1H3VA 5KVEL 2VQTA 4AH2B 1BFVH 2IPUG 3PV6A 2BHZA 3HZVA 3PNWB 4O2CA 1SYVB 2IAMC 1V7NL 5DQ9B 2EDKA 2Z92B 4J4PD 1PSKH 3MV8D 1X5FA 2BHUA 1S7RA 1T3FA 1A0QL 4XCYA 5T1LB 3Q0HA 1YY9C 1JE6A 4OFPA 5C0FA 3QUXC 2VIRA 5DD0L 1J1OL 4U7KA 4JKPL 3PDOB 1M1SA 2UUDH 3S88H 1NEZG 4KJQD 4LFHG 1DQQB 4P9ML 4MNGB 3O3EB 3UJIH 3SO3B 3MLYL 1AP2B 3GB7A 2E3VA 5F9JA 5TE7H 2V2XA 3UYRH 2SEBB 3FN9A 3U9PL 4LMQE 5CKGA 4M5ZH 3MUGB 3BEVA 4RNRA 5SX5H 4LPXA 5F21B 3D0VA 1S9VA 4LLVA 2VLLB 2W0LA 4XBGB 2BY3A 4NM8L 4QKXB 4P5MB 4U6HB 1CIUA 3NACL 4ZXBD 1L9MA 3HC0B 4E5XB 1C5BH 3B4NA 3DSNA 1BVKA 3FB7B 3MLTB 1LE9B 4GRWH 1FDLL 4GAYA 3PWVA 5CZKA 2B5IB 1QQDB 4RMWA 4F58L 2DQFA 3QCUH 4MS8C 3UBXG 4KJPC 3HC0A 5L6YL 2VAAA 5HTSA 1HINH 3MV01 1QRKA 1YPZB 2AJVL 3ARTA 1JZ3A 2VKXA 5E8EA 4PLNC 1FNEA 5DSCA 1P7HL 3HI1B 5HGHA 4OD3H 1P4IL 1WT5A 5IQ7L 1OAYH 1MUJB 5EOCJ 5CJ5A 1ORSB 3BPOC 2LE9A 2YXMA 1MHCB 3STZB 2NXZD 1A9BB 2HT4C 2UV3A 4RDQF 1YPZA 4D0DB 1D5ZB 2BHYA 4LHQB 2HJLA 3BRDA 1SVZA 4XP1L 4LCWE 4C56D 3QXAA 3QNZB 5DK3A 2PTUA 4CN1A 5HYEA 3B43A 3CLFH 4WY7H 1WICA 2DIJA 4JVUA 4F37F 1D5ZA 1I7RB 1SQ2N 2H9GA 1A7OL 4I18C 1FCGA 4M8VA 3R0MA 2I27N 5DHVB 4ZNCD 5CD3B 1A1MA 1MJUL 4FFVD 4NYLA 1QSED 2D31B 3MNZA 5KN5A 3ULSA 3JV5A 3FCTA 3B9AA 4LP5A 2PW2A 5F3HA 4HPOH 4HT1L 5CD5C 3LOWA 2BK8A 3F7QA 2BC4B 3MBEC 2XT1B 4GMTH 2C4FU 4KY1H 4XZUB 1OP5H 3ZTJG 1I3GL 4GS7C 1RK1A 2ZUWA 1FZKB 5FO9A 2EIEA 4Z0BL 1MEXH 3PL6B 2UZIH 1OD9A 3BMVA 5LGHL 2DQHH 3BESR 2D03L 2I25N 2R2CA 5AZ2L 4MA7L 3FT3B 4ODHL 3PWPB 3E3QC 1Q9OB 3QDJB 1HXMA 4MVBC 1QFHA 4JM4H 1G7LB 4KZDL 4HKXA 1JHTA 5TH2B 1SEBB 1U41A 3R1GH 5I76A 4GAGL 4HF5L 4DUWA 5DDHB 2A6KA 2Y9RT 1ZVSB 2VLJA 5D7LE 3QIBB 1C5CH 3M07A 4P9HC 1N6QH 3WFEL 1IGFL 1GGBH 3MV7D 1K9TA 2NY1B 1SJEA 1OM3L 2NR6C 4PJIB 1JK8B 4PJBB 4MNQB 4X9IA 1WQVT 4LP4A 3VFOA 4KHXL 2V2TB 3MA7A 5DDHA 3ZKNC 2DI8A 2E7MA 1SY6H 1Y0LA 5ALBL 4Z9KB 1TZGH 3KPRE 2J12B 3VXME 2IADB 4ZO6A 4P0DA 3RWEA 1CF8H 1OP9A 4MNQA 2WUCL 2AEQL 3FAXA 1BECA 3QG6A 4ZS6C 4Y88A 4LBEA 4N1CA 1QNZL 3PP3K 2P5EA 1ORQA 2IPUK 5I6XC 3H9HA 1YYML 2AK4B 1U3HC 5D1QA 1IILE 2VLRE 5FYLD 5E5MB 4HJGA 3L7FA 5SWZA 3O4LA 4WHTA 4MCYB 3FTGB 4AQOA 5C09D 5JR1H 3BHBA 2ZG3A 1T0MB 3TNNB 2DTML 1LK3L 3EJZC 4LVOC 1TQCC 2IMMA 1HILB 2BVEA 3BD4A 4GUPA 3D85D 3MSPA 1UXSB 1RUKL 3GDBA 4Y4KD 1YC7A 1U6AH 3GNMH 4MCYA 4PBVC 3MLXL 4Z6AT 5EU4A 4HC1H 1N0XH 4K8RL 5GGUB 3O8XC 3SDYL 1B4JH 2ZPKL 5HYIA 3VG0H 4PJEF 4YNYB 3G6AA 2AGJH 3MBXL 5DHYA 5FDWB 3WIIH 3CH1B 3IDNB 5IEHA 3C5ZC 3MV9D 4OCWL 2JCCE 3DI3B 5JNYB 2FIKA 5LQBL 1A7NH 2ZUYA 4YGVA 3RWGA 3I2CH 4KKAD 4G6AC 5JPNB 1VPOL 5DRXB 3CDGA 2VDKH 5F7EH 3IDNA 4IOSD 4P3CL 3GRWL 3QIWB 1CXKA 2YR3A 3DYMA 1N2RA 2IQ9H 2VWEE 4HH9A 4TTDC 4PY8J 5IGXL 4XMKL 2HKHL 1XR8A 4KKCD 5SX4H 2EXWD 1IEBB 1AO7B 3A6OA 1MRDH 4JJ5B 1F90L 4ZQKA 1BJ1J 2X1PA 3FOLA 2HJKB 4PS4H 1BAFL 5D7KD 4C55A 2W9EL 1WISA 5ESAB 1X4YA 2DQEH 1CFQB 4K23L 4FG6D 4GW4B 1IEBA 4TUKL 1ZHNB 4JJ5A 4P23B 3SKOB 3S35L 1Q1JH 4RMQA 4WCYL 5GS3A 4Q74A 4WW2F 5KANG 5BMFL 3SCMC 4NKDA 1UA6L 3DSFL 5IP4A 1EDQA 1ZOXA 4IOFD 3LQAC 3LB6D 4LLUB 1LDPH 4PLJC 1CQYA 3V6ZA 4YO0B 4JFPA 5IMKA 4BZ2L 4F9PC 1IM3A 4JFFD 1CU4L 2ZOLA 3SKOA 5EFIB 4HK3N 1V3MA 4PD4K 1LVEA 5DMGD 5KAQG 4WW1A 4DGYH 5DGQA 3DETC 2FHCA 3CAFA 3VE0A 2R4SL 4Z95L 2FIRT 3KPTA 3QHTC 4M7KH 4PJGB 1RK0B 3TPUB 1MRCH 4OD2A 4OV6F 1OGTB 1MJ8H 4L4TA 3EOTL 3MCLL 1QHPA 1W0VA 1KCSH 3MRMB 4B41A 3PIQA 2NX5D 4PRHB 2BOCB 4XHJC 1XEDA 3CVHA 3QHZH 4OF6A 1YNLL 5C9JB 1AE6H 3ARVA 2OQJB 2XNAA 4OM1H 4XXCA 5CGTA 32C2B 4P99A 4DGVL 5D5MB 1YY9D 3L3JB 3L3KB 3HUJA 1NPUA 2O5ZL 3QUXD 5FYJD 3ROOA 1DBAL 4HWZB 4LPTA 4LVNB 1D9KC 1QFOA 1PY4A 4TPRL 4OGXH 4XAWL 3RL2A 4YHOL 1WUNT 2VO5A 1G9NL 4G9DB 3GZKA 5AD0B 4X6CA 5E00B 1YEGH 2IPKA 4HV8B 5DC9B 4OGAC 3W82A 1NMCB 4G5ZH 3P0VH 4BQCA 4LSQL 3N0PB 1FL5A 3BDBA 3FQTB 5CEZD 4X9BA 3VWJC 1FN4A 5I1EL 3O4OC 3D18B 2XZZA 4KROB 1QBMH 3QDHA 1EERB 1MHEB 4U1KB 4QO1A 3QI9A 2VXUL 4DVRH 4EEEA 1K8IB 5DHVH 4ZSOB 1JPFA 3RBGA 4ZFOA 3VFTB 3B5TA 2I07B 2PO6B 2Q6WA 3NCEB 2PCPB 4Q2ZB 4NBZB 3CCHA 3VRIA 5L0QC 1OVZA 1KN4H 2Y72A 3X12A 4U1NB 4R2GC 2W60B 4MNGE 3FT2A 4MS8D 4ZSOA 4X6DA 4KJPD 1BHGA 2DBLL 2YHGA 1WEJL 1RZFH 4IIQA 2PO6A 1S7UA 1LP9B 4HEME 4F9LC 2HFGH 1CT8B 1F02I 1DN0B 4LCYB 5ACZB 4EUPG 4K9EH 1XF4A 4IRSA 4CVZA 1NLDL 3VFVB 4YXLL 3QPXH 2YPKB 5DD1H 3NIGE 1MCIA 4H0GA 3OX8B 2HRPL 1S9YB 3MOAL 4NP4H 4YFDB 4DKDC 3QAZB 1GGCL 4G8EB 1MHPL 4OM0L 3FQRB 4XH2A 3V4UL 1T6WA 2Z91B 2HT4D 5FO7B 4QXGH 3GSWA 1LNUB 4HS3A 2J5LB 3FZUC 3NCJL 3PWLB 4U1IB 4BELD 4RAVB 3TBTB 1SBBA 4WUUB 4OQTA 4DUXA 4U3XA 2JJWA 3BWAB 3L95A 2G75A 1EHLH 4JRXB 1JHLH 1TJIL 3FONA 1FQ9C 4O02L 4NNPL 2DL9A 4BYHA 2GIYA 4X6FB 4A6YA 2X4UA 4PRAB 3ARBB 1AC0A 1I8MA 2GYSA 2IFGA 2F19L 3N50A 1PEZA 1V05A 3IGAB 4OZFG 3DBXA 2PUQT 4QHLB 5CD5D 5IHUH 4YDKH 1TNMA 2X89D 2F5BL 4FQXC 4YR6A 1H3GA 3ARDA 1A6WL 4LSRH 1PZ5B 3RWHB 2R0KL 5DS8B 1HHHA 3IDIA 2XWTB 4NJAH 5DFVC 4XCFH 5D1XC 5TPWH 4KTEH 4HHAA 1N0LA 4MVBD 2WLYA 4QXTB 5KVFH 3PGFL 5GS0C 2FECL 2ESVA 3BPCA 4HUNB 4NQCA 1CLYH 1VACA 3MLUL 5K9KB 1S7QB 3KLAB 1BZQK 4G3YH 1DVFA 3RWCB 5BZDB 3ZSTA 3WKNA 4UNVA 1KGCE 5E08H 4RIRA 3TN0C 2YD1A 2IG2H 2NR6D 2YEZB 3NMEA 4RFNC 4C59B 2BVQB 2OTWB 2QKIB 3QDMB 2BRRH 4FP8H 4TOYL 1UM5L 4NFCA 3RWCA 4GRLA 3UYOD 1UJTA 2DQUL 4U1HB 2EKSB 3MLPA 1QYGL 3PWPE 5FECA 3QDJE 4N5UA 3SBWC 2OK0H 1M05A 1Q9KB 5DURB 2WIIB 5DK2B 3U7YL 5DYOB 1T6VN 1KTDA 5FA4B 2XKUA 3UTSD 5DMKA 4KRPC 2Z31B 3QHFH 3WO4C 4NDMB 1RIHL 1U3HD 3S97C 3SE9H 1NGXA 5I75C 5JUEL 2CUHA 3BIKB 1EEUA 1G7MB 4MXQC 4W81A 5E2TL 5TFSH 5CCKL 1CGSH 5DK2A 3T77A 3DPBA 1AGDB 4PJBE 4PJIE 5CWSB 3CU1A 4QOKA 3EJZD 1CTOA 4M48H 1Y18A 1ZLSL 2BP3A 2LVEA 2AXJA 4LPCA 3O3AB 3OG4B 4BH8A 2DLIA 3OAYK 3U0WH 2E8ZA 5D71L 4XP6H 5IFAH 1TJHL 3C6LB 3O8XD 4P2OB 4MA3A 1BJ8A 1ETZB 4P5TB 4XBPB 5HHXL 4BJLA 3BKCH 3RY6A 4Q9CA 1HSBB 4K94L 2AK4E 3K1DA 2E7HA 1YC8A 3M8OH 4PBWD 1H3TA 1NKOA 4UB0L 1QBAA 4PJFB 2ADFL 5FEBA 5JIKA 1NUGA 1UZ6E 5CJXA 1F8TH 4OF5A 4I0PB 4G6AD 5D72L 4IMLA 1VFBA 3MCKA 4QRUA 1AI1H 3QCTH 1HSBA 1NQBA 4PY8I 2GSGB 2YBRB 3IJYB 5EIQA 3A6BL 3CVHH 4JLRB 1CGYA 1IKFL 2CXKA 1H15A 4W4NA 3LMJH 2B1HL 3A6CH 3HPJB 3RUGE 4TTDD 1XZ0B 4M4PA 1F6AA 4LFHD 1I3UA 1HQRA 3Q5YA 3I9GH 3U30C 4YWGH 4H8WL 3RX7A 1GYAA 3RPIA 1RY7B 3GIZH 3PUCA 5JW4R 4J1UA 1DL7L 5GRUH 2YD5A 4N0YH 4ONGL 3AMKA 1EPFA 3O6LH 4NBYB 3BP6A 4XBEL 1U91B 3JUZA 5EU7C 2QADB 3EYOB 1BQUA 3I6LE 4OGYL 1ZA6B 5D7JC 5BVJB 4UDTA 3SCMD 2F53A 3ORJA 4DKFH 5EBLB 3TBYA 5IHLB 1FJ1B 4ODVH 1KYOJ 4PLJD 3ARED 1RQ5A 3SY0A 1DE4A 3FB6B 1OSPH 1T89A 3MLWH 1AO7E 2MQ3A 4X8XA 1T4KB 2VZUA 4JHWH 4UT6H 1FJ1A 3GJEB 4DKEH 4QXUL 3LCYA 3PDGA 4AENA 4HUXA 4G7YL 3DURA 2XZCL 2KBGA 3AROA 1CL7H 3D39B 4RMSA 1FPTL 3DI2B 2V5TA 4G42B 4XHJD 1UWEL 1AR1C 1INQB 2XRAL 3S4SG 2IWGA 3KXFB 2HJFB 3HB3C 2CDFA 1ZHLA 3RY5A 2E7LA 4AM0B 4EVNB 5GRVK 1I7ZA 4OZ4A 1D9KD 4HZLB 5IUSA 1AXIB 4XTRC 4OQTH 4RCAA 2Y5TA 4MSWB 4TNWK 2FB4H 4PRPB 4NT6B 1INQA 2OCFD 3ARGA 4QRTA 3REWB 5HHVL 4AM0A 3EJJX 1FRGH 5TDNA 1CD9B 3LKOA 4OGAD 4PJGE 3NIGF 1KJVB 4A6YH 4LEXL 5A16B 5C3TA 2R2HA 1OB1A 4ONOA 2W59A 1JGDA 1KPUB 4JQVC 4PRHE 1J05B 3ECBA 1RD6A 2AP2A 5DRWB 5E1HB 4PJDA 4N0UA 2FJHB 5CJ8A 3MC0A 3O6FB 4J3XA 5D5ME 3ESVF 1GJIA 2EDOA 2VRAA 3HKFA 2A73B 4RISH 1U2CA 2EDJA 4R2GD 2F54D 4ZUSB 1FORL 5KG9B 5FCUH 2UYLA 5T3ZL 5HHOD 4ELKA 3EFFA 4ELMB 1YPZF 3I6KA 4QT5A 1I4FA 1RHHA 2VB5A 5EH1A 1J11A 1OQXA 4EBQH 2NMSA 1F2XK 3P40A 2X44D 1ND0A 3FQUB 5FUZH 3OB8A 3Q1SH 4KUCF 3MJ7A 1DBML 5ENWB 4R7DB 1RFDH 1D6EA 2QHRL 4YDJB 3VGHA 4JANB 3DVFA 1TQBB 5J1AA 1JP5A 1GZQB 5FA3B 4UIMB 2UUDK 5DA0B 4RSVA 5L7XL 4CADB 1URLA 1MQKL 3HMWH 4NWTH 3T0AA 3IRZA 3UJJH 2C3XA 4EJ1C 5HHPA 1UCBH 2A9MH 1QFPA 3MRDB 1GXEA 4ONFL 3LIZH 3VXRB 5JHDA 3L5XL 1LP9E 3S5LB 3S8WA 3B9KC 4JY4A 3HE7B 5JIHA 2FX8L 4IMKA 4ZFFA 5DLML 1AGFB 1SJXA 5I8EB 1ODAA 5DRZB 3L1OH 4APQB 2FL5B 4FQXD 5DO2D 4TNVF 4Y4FB 3JWDH 3DTXA 3V5HB 5DEFA 4EQ3A 4Q9QH 5I73B 2IANB 4OLXH 2I60L 3MODL 4JPVH 1QLEL 5DFVD 1DEDA 4WUUE 2KPNA 4PTUB 3VXSE 3MRKB 2VXTH 5D1XD 3UC0L 2DAVA 1UADC 4JRXE 4XNYH 5JXEA 3OG6B 3R06B 1A1NA 5GS0D 5LWYL 4R8WL 2VXSL 4ZOBA 2IANA 1GGIH 1QFUH 4U3CA 4Y2OA 4YIQB 3HLAA 5CKAA 5C6TL 4O51B 2X4OB 3QXDB 4NN6C 4PJBF 1FO0L 3IDJA 4KXZI 2YMXL 1H5BB 1M7DA 3MGOA 1KOAA 3I02B 1XGPB 1NCBH 3VXUA 3GSUB 3K4DA 4X4ME 2EC9T 3ALPA 4U7SA 2PXYA 1B4RA 1K4CB 3GEWB 3MRNB 4U2ZA 3HRZB 2BNQB 3SGJC 2PW1B 1LQSR 3PP4H 3FRPA 3A67L 1Q8MA 1H5BA 1MAJA 3OGOE 5EC1B 4CU6A 2R15A 3B5GA 4ETYA 4NIKB 1MCQA 5J6HA 2RJMA 3MRNA 2DWEA 1NL0H 4P2QD 2OR9H 4KRPD 2ZUQC 2PYEB 4J6RH 4GOSA 1MVUA 1BQHG 5IJKC 1B0RB 4ZTOL 2FSEA 3VRJA 5ANMA 4Y16C 2NZ9C 3M17B 2XN9B 2W38A 2QTEA 4R96B 1YEFH 4JO2L 5H37H 4EN3B 1UYWH 4WU5B 1FLRH 3NZHH 3UTZB 2AKRA 3BUYA 2E7BA 5D93C 3QDME 1CFNB 4JZNA 4F80A 4YDIH 3MRHB 2R4RH 3GSNL 1IT9L 3HE6A 2AJYH 3IJHB 2VR5A 4LKXA 4F7EB 2JIXB 1RUPL 2C5DC 3PWJA 1DQMH 1KCRL 1U95A 1CFNA 2YWYA 4P46B 4S1SH 2HVKA 4H25A 2VITA 3RA7L 3BE1L 2VABA 1HHIA 3EO9L 2CKNA 1G7HB 2NY3B 3C2AH 4KZEL 43C9B 4NJ9L 3VFMA 3S96B 3H9SD 5HVHC 4F15B 5J6GA 12E8L 4HKBB 2BNRD 3MACH 1CLOL 2JCCA 3PJSB 4RGOH 4LOUC 3SHSA 5HGDA 5I0ZA 3WKML 1V8HA 3QO1A 2X9YA 4KI5F 2W92A 1YEIL 4NRYA 4OFYD 4R3SA 4PB0L 4RX4A 4FABH 1S9WA 2EDBA 3VH8A 5EU5B 5LKNA 2E27H 1UG9A 2D9QB 4K71C 1SJHA 1K4DA 5C08B 2NTSP 5IB4A 3WLWC 2VXVL 3L7EA 2ZSWA 1CK0H 3W0WA 1MNUH 3P3YA 5E1AB 4YHZL 5CEZL 2DB8A 1R3JB 3CSBA 4DUVA 1HHGA 1MF2L 1U42A 4L3CA 2VL4A 2Z8WC 3VMPA 1RIVH 2BY1A 3LRSA 4L3ED 4PJFE 1E4KA 3ARFA 5I1DA 2G5RA 1EO7A 3RX8A 1R0AL 2DLEA 2FZ3B 2Q76A 4NQEB 1ZGLM 5CP3A 5JMOC 5EBWB 5D7JD 2E8YA 4LAQL 1X7QB 1U8PB 4KTDL 4LPVA 1F3RB 4QHMB 3DUSB 1AHWA 4OT1H 4JREB 2WWKT 4WU7B 2LFGA 4YAQB 5L8JB 4MDIA 4U1MA 3CUPB 4J3WA 1FFQA 4TRPL 1QR1B 4JN1H 2YA0A 1X7QA 4UDUA 3WIHA 4NO5B 2X4TA 4QHNA 4YEFA 4JG0H 4YX2L 4PJGF 4U49A 4PYGA 3PABB 1UB5A 3MOQA 4ZAKB 1MCJA 3S37H 1MREL 4HDIB 2ZCKL 1HOCA 4JGMA 4OIIL 3OGCA 1CE6B 4WUKL 1SYSA 4N8VG 1W8NA 3V5DA 1I1YB 2D4FA 1HXYB 1UFUA 4FTVD 5K9OB 4Z7OE 4X6CF 5HYSA 4R4BB 4HXAL 1XH3A 5IMLA 1AR1D 5L88L 3MYZA 3FMGL 1P9MA 1I3RA 2DMKA 4TSAL 5D5MF 4CMHB 3HB3D 4PJ5D 5L2JA 2J4WL 1R3HB 2DM4A 4PUBL 2FO1A 4G9FD 5MEOB 2IALB 5AG8A 2PN5A 4K7PL 4XTRD 3UTTA 2P44B 4WJ5A 1FAIL 3L5WB 5L8KB 4BSWB 2AV7A 2OI9C 5DJZB 2YPLD 2FWOA 2VISA 5C71A 4LSUH 3D39E 1IMHC 2FGWH 3G5XA 1DUZB 1YJDL 1NCAL 4OV5B 4Q6IA 2X4PA 3SGDI 5C0IB 4BSWA 1E4XH 1JTTA 1YEDA 5D9SB 5C0CB 1OY3B 3L9RA 3KXFE 5BRZB 3AM8A 4IS6B 3GSRB 4FQ2H 2ZJSH 5KSBB 4LKCA 3AAZA 4BFGA 3HAEB 3BZEA 5EO0A 1MCOH 4UUJA 3W2DH 5BS0D 4OV5A 1PEWA 5B39G 5HHQB 1EFXB 4PJCB 1WC7B 2DQJH 3D2UD 4NRXA 1FIGH 3GMOA 1LP9F 1V3LA 4XWOC 2P8LB 4KVCL 3ULUC 1KB9J 2VLKD 1IC4L 4X80H 5CJOL 5JQ6L 1JYVA 4RBPH 4LHUA 2CJUL 3IFPA 4EDXA 5FHBH 4LK4A 5HHQA 3FFCD 2F74A 4TUOA 2Q7NA 3NA4A 5EU6D 5F1KC 1UH3A 5IOPA 3QEQD 4BM7A 2DQIH 5EO1B 5EORL 4OAWA 4QRSB 3Q48A 5ITBH 4LLQA 5IQ9B 4JHAL 1KB5L 2IF7A 2XA8H 4R6UA 4XVTH 1AGEB 1CYGA 3MMEB 4GXVH 3UTPE 5T3XH 1I7UA 4L8BA 1MPAL 4R4FH 1Y6KR 5IM7B 1U8MB 1RVFH 2ICES 2P8MA 4S1DC 4ELME 5GGSA 4HUVB 3BW9A 1T2JA 3KJ4C 3L3OA 5AYUL 3MMEA 3B9KD 1L6ZA 4DW2L 1QG3A 5I9QB 4NN5B 1DQDL 2P8PB 2YD6A 3IU4L 3P9WB 5C2BH 4PY7A 2Q8BH 4K3JL 2FHFA 1KTLB 1MWAB 1MH5B 3Q5TA 3H3PH 3SDAB 3OKLB 1WT5C 1JRHI 1OAZL 3JTSA 3RTQB 5A40E 1BX2A 3IS1X 1OQOA 3GI9H 1QTYT 5I8KL 5FM5O 2Q7YB 3OXSA 1P7KA 5D2NB 4ESKA 3MRCA 5EUOB 5SV3A 1CBVH 1RAMA 4ZMAT 2X1XR 3QUYB 1RU9L 1T04A 2LQRA 3KWWB 3OKEA 3RTQA 3TH2T 3VXRE 2VXQH 4XNXH 1BD2D 2I9LB 3NCYS 5E70A 5LG1A 4FXKA 1S5IH 2MCG1 4ERSH 5D1ZB 4KQ3L 5BV7C 1HIMH 1U8QB 2ZOKA 4WTZA 4JN2B 3F7YA 5GRJL 3IFNH 2X4RB 3SO5A 1IGTB 1WCBB 4DEPB 1DQJB 3F62A 1T80A 4OSUH 3B2VH 4HKZB 3UCRA 3TIDA 1OLZA 4QNPF 1GH7A 1WBYB 2OMBA 4QHUB 4ZPVB 1J8KA 1KT2B 1UM4L 4LGPB 1KLUA 3U9UB 3ZMRA 1JIBA 5E5RB 3BRGC 1S7VB 4OZIA 3Q6FB 3DMMB 1N4XH 1ZHKA 3QUKB 4I3RL 5E4IA 3V6OC 1MAMH 1IGJB 5SWQA 5ESQA 4WO4B 1TZHA 3TWCH 2PTVA 3EDKA 4HQQH 3IVKB 3T3PF 5IB5A 2V2WB 1OAQH 4HUMB 2NY6C 1XF2A 3WNKA 2HH0H 4QTHA 3BXNB 4NRZA 3MO1B 4Y16D 1CCZA 3P9MB 2Z8VC 3DIFB 4E41A 2JB6B 3EJYD 5CP3H 1CFTA 3U4EB 2APXA 2X70B 4ODXA 2RB8A 1N5YH 1A9EB 2N4IA 1JI2A 3VWKB 1SEQH 3L6FB 3RWFB 2ZKHL 2BNQE 4LVHB 4TSCH 1VKXB 3HC4L 3L5JA 4G8FA 3ZHLA 3WL9B 1DANU 4MYWB 4YPGB 1T1XA 1P53A 3U7AA 4Q9RH 4YHNB 4F33B 4WFFE 3BN3B 3MRPB 2I9TA 5F7YC 5TQ0L 2R29H 1EGJA 4PJFF 2PYEE 2GTZA 5FUCC 4OLVH 4ZUVA 3JTTB 3CFEB 2ZUUA 3SDCC 3SDDC 2XN9E 1ITCA 2APFA 2EIDA 2MKWA 3QEHA 4M43H 5KW9H 4U0QB 5DTFB 3CPLB 4J4PA 3MV8A 4U1GB 4LOUD 5HYQB 4GQ9H 4ZNEA 2ADJA 5DR5L 3DROA 3FQXB 3JWOC 1XR9B 3OJMB 2GJZA 1BZ9B 2ID5A 2VDRH 4FQHA 1WZ1L 3FQNA 1HEZB 4UTBH 3SKUD 1X5KA 3P0YH 3E8UL 4BSJA 4PRID 1MCDA 2IPTL 4QYOA 3ZE2E 1FFNA 1IQWH 4PJ7B 3WLWD 4YBQC 3FQXA 3RUGA 1XR9A 3QIUB 4X4ZA 1CFSB 1I8KA 2WK2A 5C8JB 2A1WL 2ILLA 1TDQA 4PJHB 5KJRL 4QY8A 4Z7OF 4G8IA 1U8HA 2R2BA 1XGTB 1S3KL 2EYSA 4JM2B 1CFSA 4K2UL 2IBBA 5DUBB 4ZXBA 4S11A 4AMKL 1JCKA 1HYRC 5B38B 1EXUB 4NKMB 3RNQB 2GT9A 5CAYB 5EO9A 1R5IA 4HIXH 2JJTA 2R56L 5C08E 3WO3B 2BCKA 1LO0L 2BRQA 1A2YB 2EH7H 2W65A 2NXZB 4MDJB 2FHBA 4OLEA 4X5LA 5DJXA 4F3FB 3AXLA 4UQ3A 3VI4E 2P5WB 4MJID 4C56B 4GG6A 3CSYB 3WDIA 4MJ2A 2RR3A 4NQEE 5TDPA 4YXHH 5DVLA 1A2YA 3QB7C 1Y6MR 1RZKL 1T1YB 3PV7A 1IC5L 2BMKA 1CDIA 4JPWH 4QRPD 1L0XA 1RIUL 4N8CH 3GJFA 5GSVA 5DJYB 1YYLH 2ZUVA 5DD6A 4YJZL 1U93B 3LRGA 1QSEB 4PB9H 4WTWA 4WI2A 2XXCB 1FG2B 3BKJH 3W9EB 2PYFB 5F7HA 3D69A 4H1LB 1RMFL 3ZSSA 1BIHA 1FGNL 1JPTL 4K55A 4N5EC 2YK1H 3WFBH 4HIHB 5C0GB 3WXVL 5F1SA 3X13A 1NCTA 1VERA 3PWNA 3RZCA 1FNGB 5J9PA 3K1KC 3V95A 3RBSA 3RGVD 1CZ8H 2V7NA 1TCMA 5ITFB 3UZQA 4WWKB 2BSRB 1P7QD 3NCBB 5C3LD 4ZUWA 5KOMC 3BVNA 3WS6C 1QA9B 4PGDA 5GHWH 2K3TA 5DUPL 5AEAA 4I4WA 3L3HB 1NCWL 1IGYA 1ZHBA 1FZMB 1R5WB 1F13A 1KN2L 4YK4C 1A7RH 3QZWB 3V8CA 2OJZL 1RULH 5EU3A 1JTPA 3QSKB 4YC2B 5IMOA 4Z7UA 2WMPA 3VD4A 3B6SB 1NCDL 5LGJA 4JDVB 3ULUD 3U0PA 4G8GB 1F3DJ 2JE8A 1ZGLP 4UI2A 3MTRA 1I1AC 3MV7A 3ROLB 3L3IB 4M7LH 3T4AB 5IEKB 1QACA 4IRJB 5I74C 4HWUA 4X7SL 5IKCB 3RVUC 1M7IA 3ARQA 4X8JA 5B3JE 3NTCH 2B1AL 2DLGA 1ITBB 4M00A 4MJ5B 3MNWB 1W0YT 2QLVB 4HMCA 5C0CE 4EI5A 5ECJE 1IGIL 5BRZE 3EZJB 1TVHB 1NLBL 1VADA 5KSBE 1NFKA 5DEGB 5GGQL 4WFHE 1ZGLA 1XFPA 4XPFH 3LN5A 3CZJA 3CVIH 3IDMB 2ITDB 5C07D 1YMMB 5C09B 4PJCE 1U92B 1QO3B 1JYNA 5BO1L 2CMRH 4S1DD 3MLSL 2BVOA 3NA9H 3CXDH 3D85B 5MERA 3TM6A 3OZ9L 2ITDA 5BVPH 4HKJB 2GFBB 1HHJB 4OLZH 4XCCH 4Y4HA 5MI0C 1G9MH 3GMQB 5C9KA 5ETUB 1RJYB 2IFFH 4KUZL 4OCRL 4AZ8A 3V79C 5JW4M 4M9OA 1ZEAH 5FM5M 5CMAB 5FOJA 3LPFA 2VDLL 2Z35A 3CH8A 3BSZH 3BZFB 4Y4KA 5F9WB 3S36L 3WFHB 3UPRA 3MREA 1BMGA 4HKJA 4HBCH 5ID1A 1S7SB 3MV9B 2HFEB 5EOCH 1RJYA 3NZ8A 2OTUB 3RDTB 2W07A 5F93C 5GRYA 5CMAA 2FGZA 5E8DH 2ZCLL 5IESH 1OAXH 2X6MA 4QGTA 1EZVX 3WJLA 4O4YL 4IDJH 2GTWA 1YEEL 3N9GL 2EEAA 1FO0B 3O3UN 4NKOA 4BH7A 5HGGS 3LEXA 1NBZB 3SE4A 4HW6A 2WINA 3EOAA 2DQCH 1IM9D 2PETA 3GGWB 4U6VH 3ULVH 1WWCA 2P1YA 3CXHJ 4JY6A 4XWGL 2CDEB 3FL7A 1KJ2A 1OCWH 4LCUA 4YHLH 1K85A 1CS6A 2BZDA 4GG8A 3FKUS 3UJTH 5E8OA 2YN5A 4S1RH 4P4KB 4OZHB 4HCRA 5TGBA 3V6BR 5IROA 3ARDC 5MHSD 1OARH 4JFXB 3NCCB 5D2NE 3IDXH 2B4CL 4TVPL 5EUOE 2NXYC 4EDWH 3RVTC 1F4XL 4ODUA 3U7WL 1NBVL 3H42L 4L8DA 2WBJC 4QRQB 2FR4B 3QO0A 2GQHA 4XPGL 5F9OH 4KMLB 1DUYA 5L9DL 1J8HD 4FXGA 4HK0A 3ZKQD 3T0EC 1VA9A 3WUWA 1IFHL 4HIIB 4O58L 3IETB 2VLJD 3KPQA 3GSNB 4FZ8L 1DVFC 5D6DC 3ZE0E 4QF1B 3SJVB 2P4AB 1J1PH 1U8OA 1MFCL 1NBYA 3Q2CA 3RJDA 3IJSA 1KLGA 5FYKE 3N85L 4XNQB 3BAEH 4Y5YC 3O81A 4WI5A 4FOMA 4JFFA 4JZJC 4MAUL 1NGZB 4U1LA 1EK3A 3U48A 4QF1A 3ZE2F 1T7VA 1UQSB 5E0QA 5TE4H 3NH7L 1PZUB 1AIFA 3G5YB 2ORBH 2NX5B 4XP4L 5EWIH 3BT2H 3IFOA 1AKJA 4XNQA 3SOBH 2P5ED 3QRGH 3RL1B 1Z2KA 5F6IC 3RI5K 3HNSL 4PRBA 1Z9OA 5IG7A 4KJYA 3SDDD 1BZ7A 1J9CT 3G5YA 2VNCA 5SWZD 3O4LD 2FX9H 3ARXA 4LCCC 3VXQB 2IAMA 2ADIA 2D0HA 3TESA 3E6FA 3KDMA 3T4YB 4E0RA 1ZT1A 1NGPH 1RZJL 5ICXA 4CMMA 4QTIL 3GJFH 2FJFA 4G7VH 3QUXA 5T5NG 1IAKA 4X4XB 1XGRB 3NBNA 3I75B 1EO8H 4KGLA 1S7WA 4DQOH 2ARJA 2H8PA 3H3KA 3NFPA 4LSTL 3EYVB 1VGEL 3AC0A 1UM6H 3WNLA 3TV3H 4UNTA 3RY6C 3TT3H 2DMCA 3QJFB 1CG9B 2FEEL 4XVJH 4OD1L 4YPJA 2ZZUT 4GMSL 2B8OT 3OL2A 4HPYH 1L7IL 2AQ1A 2CLRA 5GGRB 1P2CB 3TFKC 4NHUA 3CFKA 4X7TA 1QKZH 4HLZG 3REVB 5IFHL 2IEPA 1YDPB 1U3ZA 4OCSH 1RJZB 2VDQH 3FN0L 2EECA 2EE2A 3VCLA 4XMLH 4B0MM 3P11L 5H8DA 4WEUD 8FABB 3S3PA 4QRRB 4PJ7E 3FRPG 4UMGA 4L8SB 4GW1A 1JWMA 2FD6L 4YHPB 2J88L 1A21A 1P6AB 1TPXC 4P49A 3OKDB 1HKLL 1T22A 1X5ZA 3R8BB 2EEBA 1JUFB 3EOBA 2N56A 4PJHE 5ID0A 2HFTA 4EOWL 4M5YH 4DOHB 1BJ1H 2KL6A 2CGRL 4LIQL 4WFGD 3MOBL 1SHMA 4AIZB 2EDEA 1FSKC 5J13B 3TA3C 5E99L 3T0WA 3PWUA 3TPKA 2K7PA 3GMRB 4Y19E 3QDGA 4L1DA 4CNIB 3BP4B 3NFNB 5E94A 1TETH 1YEKL 4N5ED 4I18A 1HYSD 3O6ML 2A74A 3VFGH 1QRND 4PG9A 1BFVL 1KPRB 5HVGB 2P5WE 5IVOA 2AQ3A 4C56E 4ZS7H 3WV0A 4J12A 2HYMA 3MJGX 1DP0A 1RZ8B 3IDGA 2HN7A 5IBTH 2NY7L 4X99B 3MBEA 1FZOA 2DYPB 4F2MB 4X9HA 1HWHB 3TVMC 4RMRA 2XTJB 3VFUA 5KSBF 5C1MB 1CFVH 4I48B 1QSEE 4LLWA 3S88L 3IXTB 1IAMA 3FB8B 5IF0B 4KV5F 3UJIL 3VH8G 4B7IA 5TE7L 5D6CB 3UYRL 3ELAT 3MRLB 4WNQA 2R1WA 4M5ZL 5C2UB 4I48A 3VFSB 1DLFH 3W9DB 4JFQB 2H6PA 3MNVA 4Y5VC 1IZJA 1I1AD 1UWXH 3KYKH 4JRYA 3E6HA 5CZVH 4M8QB 5C0AD 3L3GA 2X1OA 3V4PL 4JDZA 4L8CB 2PNDA 1OLLA 2VLMD 4JR9H 3MRLA 3RVUD 4TYUA 3VFSA 3NOIA 5GS1C 1C5BL 2XZQH 1KJ2H 1IL1A 3UTSB 3BKML 2Q1EA 1E27B 4XC3H 1DJSA 4ZUUA 4KK8C 5T3ZE 4HCRH 4L8CA 4M61B 5F1IB 1GPOH 3QCUL 4Z7WB 1FL6B 2IBZX 2HFFB 5MEND 4JFYA 5CLTA 1HINL 3LS5H 4MAYC 4XAKD 3WIFB 1E27A 4G8GE 5CSGA 5KSUA 1U3HA 3CK0H 1JGEB 1FYTE 1JV5B 4OD3L 1BOGB 3IKCB 1OAYL 2JJSA 1D3CA 2DKMA 1PW3A 2EDXA 3S35X 5H94B 3QFDB 3D87B 1U8JB 5I1LA 5JW4Q 1PG7W 2EDDA 2GHWB 3KVQA 5L2KA 3IKCA 5GSRB 4UAOB 5BZWA 4OTXH 5D7IE 5BXFA 3CLFL 1KIPB 5FYLE 4WY7L 5J0BA 1WAAE 1UVQB 3SQBA 4PJ9A 4GXUM 5HYSG 2P43B 3O8XA 4UU9B 5D96B 1U9KA 1YMME 5C09E 4OF7A 1A3LH 5BJTB 4B50A 1UJ3C 1X5XA 3BGFC 2H1PH 3UROR 1PLGH 5F7DB 4AEIL 2VE6B 2QR0A 1YNTA 2XKNA 3C5ZA 1LK2A 2NY5C 4LSVH 1FL3A 3R0NA 4RMTA 1F3JB 3DRTB 4HPOL 5F7NC 4AJ0A 3EOYG 4GMTL 4D3CH 3ZE0F 4KY1L 3F5WB 3AVEA 4PR5A 1NEZB 4Q7DA 5J1TC 2IBZY 3CMGA 1ZT7B 1MEXL 2YRZA 1KIQB 2UZIL 5DJ2B 3WXWL 1N64L 1IGMH 2DKSA 3QG7H 1CDBA 5C0JA 1B88A 4NQDD 3H3BC 5C0EA 3MV9E 3RWDB 1UKSA 5FXCH 3ARDD 4YLQT 4JM4L 2ED8A 5FYJH 5F1OB 2DWDB 3R1GL 3CZFA 2NXYD 1WZKA 4K7FB 3IAPA 5I2IB 2BVPA 3RVTD 4IRZH 1PG7H 3O9WA 2WBJD 1C5CL 3SCMB 4DCQA 1GGBL 3VXPB 3FO1A 2R1XB 3DVGA 4QHKJ 1P1ZA 3AREB 3T0ED 4AL8H 4C57C 4NQCD 3TO4C 1T1ZB 3BKYH 2VR4A 2O5YH 2OXHA 1UENA 4I3SH 1DVFD 1SY6L 4LHUG 3UBXB 5FF6B 4WI3A 4CGTA 1TZGL 3SCMA 2BERA 3BYTA 1EVUA 4MD4B 4Y2DB 5DVMA 4OZHE 5CP7B 1CF8L 1OOAA 4EQ2A 2DL2A 1MQ8A 5D7KE 4LDLB 1T1ZA 4F9PA 2W0FB 1HH9B 3SDXA 4CN6A 3DVIA 5FFLA 4R7NB 2GITB 3GMNB 1NAMA 2JK5A 3O3BB 3ZKXB 1FBIH 4FQLH 1NFDA 1P84J 3F7VB 2ZP0T 5DQJA 5JR1L 1T20B 3G5VA 4PJAB 3LKPB 3ME0A 1JPGA 1DDHA 3BPNC 4CVXA 4M6NH 3SJVE 1UB6B 2ED7A 4GKNB 4ORGA 1U6AL 3GNML 2GUOA 1A1OB 1OF2A 1H0DB 4OKDA 4YDVA 4HC1L 1TCRB 1N0XL 3AB0C 3EUUA 2AERT 1L4IA 3SPVB 1B4JL 4NO0B 3VG0L 4N9OB 2AGJL 2XQBH 1D9KA 4DGIL 4PJ7F 1BM3H 2ZWLT 3WIIL 2H26B 3P9LB 4OZGA 3KPMB 4K07A 3BQUA 4KPHH 3DX8A 4H26A 3Q3GB 5EIIA 1A7NL 1A14L 1RI8A 4HSQA 3I2CL 5ACLA 2H26A 2NNAA 2VDKL 3VWJA 2HP4A 4W6XB 1CR9H 1OHQA 1QZ1A 5L0QB 5D7SH 5EOTB 3LD8B 4BSVB 4PV9B 4MX7B 4MA1B 4R2GB 4DZ8A 4M1DL 2G5BA 2X40A 3WUZA 4DZBA 3VJ6B 3TFKD 3KPNB 1YMHB 3ARWA 3DXAD 3MR9B 4KDWA 4WFED 1Q9LB 1NAKL 1JWUA 1WIUA 2BNUA 3T65B 1I9JH 1C5DA 4X6EB 3X14B 2F54A 5CEZE 3DYOA 5HHOA 1GZPA 1KPVA 2F8VA 2JELH 5KS9B 3HZYA 3TLRA 1J1OH 4UINH 5FKAA 5JW3L 4PS4L 1H8NA 3KPNA 1YMHA 1KNOA 2D9CA 15C8H 3GO1L 4F9LA 2DQEL 4YHYC 2VWEC 1L7TH 4KRNA 2H2PC 1MI5E 2DQDH 4Z7VB 2PR4H 3DGCR 4P9HH 1Q1JL 4UOW0 4MWFB 1EVTC 4L9DA 1IGCH 4CW1B 3MRIA 2Y7QB 4X7DC 1LDPL 1U8IA 2VC2H 2O61A 3LEVH 1TXKA 3RX5A 3TA3D 4YZFF 4Z7VA 3H7LA 3MLZL 1AHWC 3FQWB 3WN5B 3RAJH 2ICWJ 2L0DA 1UWGH 4FMKA 5DJ8B 2Y7QA 2HT2C 4QRRE 1JGVH 4DGYL 1MRFH 4ZYKB 3RNKA 1G6RA 3RWIB 3BZ4B 2EYTA 1JBJA 2MHAB 2D0FA 3OKMB 4M7KL 4HAFA 4JFDD 1OGAD 2XQYG 1MRCL 3QNYB 1MJ8L 1KG0A 4NZTH 4ENED 3M1BA 1A7QH 5DJ8A 2AJSH 5TF0A 1MJ7L 4TQEH 5CJQH 5AUMA 2BY2A 4FQJH 3QHZL 4E42B 3BUTA 5D1XB 5SWSD 4ISVB 4Z7UF 1A4JA 1AE6L 4FQXA 3TVMD 4OM1L 4D0CB 1HDMA 5B8CC 4POZC 1F4WH 5KSAC 1ZSDA 1YN7B 4OGXL 3AMLA 1QHOA 5H35A 4KKNA 3BP7A 5EZIH 3KLSA 1FV1A 3QQ4A 1X6LA 5TDOB 5D1XA 1GVIA 1LWRA 4U6XA 1UZ8B 1CXIA 1IZKA 1R3IH 1YEGL 4HG4K 4D0CA 4NN7C 1NDGB 4YDLC 1HE7A 2D7QA 3P0VL 1AR2A 1YN7A 4IDLA 2AXFB 3EYSH 1A7OH 4P4RB 3PP3H 1NCCH 2PTTB 1QBML 3I6GB 1QFWI 4YBHA 4UTAH 4AEHH 1F4YL 3QRFM 5DJ6A 3TN0A 4DVRL 3LV3B 1JNNH 1VEOA 2QSTA 5I1HH 4HFWB 4HT1H 3PQYE 2XTJE 4YFLI 4WV1B 3T2PA 1WAAF 2FJGA 1JGUH 3MRFB 1T83C 4MLSA 3QEUA 4P2QB 1KN4L 4Q6IC 2UZXB 1ZAGA 3AU1B 4KRPB 2CIKB 5DK0A 5GIRA 1A6TB 3U6RA 4FQ1H 4Z0BH 1ONQB 3SBWA 1J10A 1C16A 3F7RA 2ITCB 4D9LH 4MA7H 1RZFL 2BOBA 2HFGL 3MRGB 4MAYD 1CTNA 1NGWB 1JZ8A 5T5FH 4K9EL 1RZIB 3OB0K 1A6TA 3QPXL 3BH9B 4JFZH 4NGHH 3SGDH 3QISA 5DD1L 1TZIA 1N7MH 2ITCA 1BQLH 5GZNC 5IV2B 3H7BA 4XP9H 3S6CA 1IGFH 3LN4A 1IAII 2OXGA 3QUZC 4QXGL 5AWNH 1X5LA 2MQ0A 4PRNB 1WFTA 3UTSE 4AG4H 4XNMA 4CU8A 1OSZB 2G2RA 3LQAH 4FS0A 3ARSA 5EUKA 5FO8A 1EHLL 4KK6C 3HA0A 4Z7WE 1JHLL 1F45A 2D4DA 5IB2B 3I50H 2NW2A 2VR9A 1T2QH 2HVJB 2J3SA 3H9SB 3OKOA 1LEIB 3CFJB 4QGYA 1NUDA 3TZVC 1ZVYA 1NAMH 3FT4A 1S5HA 1VESA 4D9QE 1OSZA 3IU3A 1E28A 1F6FB 1Q9WB 3UDWC 4MMXC 5JHDD 5IB2A 1KIRB 4YDKL 5HDOA 2HVJA 1H3WM 2BNRA 4M6OH 5HHMD 1LO4H 4LSRL 4NSKB 1C08A 1GOGA 1FFOB 4OFYA 3RKDC 5IR1B 2DD8H 4NJAL 2AEPH 4XCFL 1MCBA 3WHE1 3T1FA 3U0TB 2LV4A 4XCNA 3W39A 2VAJA 4KTEL 3E1F1 3GMMB 4L3EB 4NNXB 5FYKU 3P4NB 4NSKA 5JOFA 3E0GA 4QHKI 2OJEB 2XYCA 3TP4A 4G3YL 3U0TA 4KC3B 3C5SA 5H2BA 1CD1A 5E08L 1LEKB 1JRHH 2QQKH 4XX1G 1AGBB 4X5WA 1Z3GH 4BKLB 2IG2L 5GISH 5IW6A 5IMMB 4OCWH 4NQXB 1CLZH 1MFBH 5LQBH 2BRRL 3TO4D 1B0WA 4FP8L 2XKSA 5D7JA 4I9WD 2GK0B 4HX1B 3TJHC 2B20A 1HHKB 4CJ0A 5INCB 1KLFA 2VN4A 5D7LD 4EUPB 4LLMB 3MJ6A 2CDGA 2OK0L 1YNKH 2FYYA 5FUOH 4AEEA 3VW3H 3R4DA 1I8IA 4H5SB 2XQYK 5T3XD 2GK0A 1Y6NR 1D5MA 2WBWB 3FOMA 3QHFL 4ODWA 3SE9L 3D25B 5CINH 4FTVB 4EUPA 3PL6C 1EEYB 3GMPB 3D5OF 5TFSL 3VXMD 1CGSL 3BIAX 3WFZA 2BSSB 1QSFA 2QSQA 4JFOB 1DEEA 1BAFH 4M48L 4G9FB 3SE8H 1BOYA 2EC9U 5FM4A 3U0WL 4O2FB 3IRPX 1FZJB 2VH5H 3QWOB 5E9DA 2AS5M 2VLRD 4XP6L 2BSSA 2X7LA 3KPSA 4XPAH 4PJ5A 3QIBC 1RJCA 5BMFH 3VD5A 5EZJB 4FQPA 4I2XB 2NY1C 4NQSB 1WTLA 3OXRB 3HE6D 2YPLB 1KV3A 5ICZB 1U36A 3BKCL 5FK9B 3IF1A 5M7QA 5HGAB 4BQ9A 5T1MA 5IB1A 3M8OL 1G6RH 3U46A 4M6MH 4LPYA 1NANI 4OZFA 1F8TL 5ICZA 4PJAE 4IOIB 4MZ2A 4XC1L 5T1KD 5E6IB 4P2YA 3TCLB 1T7XA 4JKLA 1AY1H 3VRLE 5KSVB 5IVXB 2BXYA 2B2XH 2R0WL 2ZNXA 1D5XB 5E03A 3ULVC 2VN7A 1NJ9A 3LMJL 4P2CG 3A6CL 4R0LB 4HS6B 1BWWA 2YOCA 3O41A 2VLKB 4IOIA 5DJ0A 4OIBA 4LLDA 2X4NB 4XP5H 2YZ1A 5LGKA 4JZOB 1YECH 1Q72H 4ZO7A 2R23A 4Y5XB 5BS0A 1D5BA 5KSVA 2BVTA 3FFCB 1WWWX 3D2UA 3F12A 5EU6B 3GIZL 5DI8A 1NGYA 2DI9A 5GS0H 3TT1H 1YUHA 4N0YL 4CDHA 4JZOA 5I16B 3QQNA 3W0WD 2A9NH 1ED3A 2H2PD 5E8NB 1JWSA 1T7ZA 3MLRH 5CS7A 1EAPA 3WHXA 3MJ8A 3QEQA 4N90E 3GSQB 2XWJA 1AD9B 4DKFL 4LSDA 1L0QA 3NPSB 3ARFD 2LAAA 4P57B 5INDA 2ICWI 4ODVL 1J5OL 4ZFOL 4OCMC 2M2DA 4PP1C 3OBAA 3GJFK 3NABH 1AXSB 1OSPL 1MHHB 1WTGT 1N6UA 3B9KB 3L3DA 3MLWL 3WD5L 5I17A 3FO2A 4BQBA 3MLVH 1T21B 4JHWL 3GSXA 2GKIA 2HT2D 3GHBH 4UT6L 4X6BB 5KS9E 3QIWC 4FA8A 3WFCH 4DKEL 5B22A 2B0SH 2YXFA 4X98B 3ZYZA 1CL7L 5EC2B 3PDDA 3V0VB 5ESVA 4ETQB 4KKLC 3C60A 5HJ3A 3X11A 1GC1C 1QSZA 5FB8B 5F44A 1HH6B 2HRPH 3MOAH 2HT3D 1QR4A 1MHPH 4L9LB 1BD2B 4Z76B 3RVWC 3LKSA 1A3RH 2ATPB 4POZD 1ZXQA 2XXMB 4L4VA 4DK3A 3DHJA 1KEGL 5I15H 3U1SH 2FB4L 4J7RA 4P23C 3BYYA 4NN6B 1PD6A 3KLHC 1HI6A 5F71A 1BD2A 4JPIA 2ATPA 1FVDB 3OKNB 1BVLA 2VL5A 4JAMB 2FX7H 3UTTD 3NPZB 3VFPA 5I66A 3ALWA 4LEOA 4ODBD 1S78C 1MFAH 1KCVH 5D4QA 1W72A 4GRWB 3CSGA 4D9RE 2MPAL 3KG5A 3OKKA 1N8ZB 2J7LA 1Z5LB 2V6HA 3G04A 5MEPA 3WNMA 3T08A 2AXGA 3MFFB 2ZG1A 3SGJA 4RISL 5DZNA 2P7TB 2WUBH 2ZUQB 4Z7WF 1WBZB 2C1PB 5DJAA 5FCUL 4EI6A 1T0NA 1W8OA 3LRHA 2RFXA 2RIKA 4MJ6A 1M6OA 1DANT 4Y16B 3D0LB 3OAYH 3O0RH 4RFEA 5IHZB 4JB9H 3MFFA 2X2YA 3CC5B 4EBQL 5D93B 3VXOA 5T1LD 2YUZA 4FQQB 1HWGB 4PP2A 4UQ2B 1A3QA 1FVEB 1AQDB 2H2SC 1PBYA 2W9DH 1CXLA 5GZND 1QVOB 3C8KA 1CD8A 4LHUD 1FYTA 4NOBA 7CGTA 1RFDL 4N0CC 5HYJB 1XCQA 4PGEA 1MSPA 1WVZA 3G08A 3GIVB 3QUZD 4L29B 3ZT5A 1JZ4A 4P2QE 5LAXA 2J8HA 3QJHB 2OSLB 4DVBB 3HMWL 1UM5H 4EI5C 5ISZA 3UJJL 1U8KB 4F7TB 1T2XA 2A9ML 4KK6D 5EULV 1A6AA 4KROC 2DQUH 4FN0A 3LIZL 1KJMB 5D7IA 1KXTB 5HVHB 1WZLA 4JQXC 4M4RA 3QQ3A 4KJWC 3TZVD 3U7YH 1MCWM 4EUPH 1UWXK 1N59B 4C83B 2H32A 1AJ7H 4RAUA 5IW1B 1ES0A 4PTTA 5DD3H 4K71B 3JWDL 2XWBB 4PRIB 4Y4HC 1XF3B 4Q9QL 3S4SA 1PQZA 4OLXL 3RKDD 3EAKA 3PGCA 3HZKB 2XFXA 4JPVL 4LASH 2E9BA 5IW1A 2VXTL 4PJXB 4XNYL 4GBXA 4S2SB 3GSOB 2Q86A 1AQKL 1P4BH 2A83B 5F1NA 3H9SE 4K3EH 1VFMA 1RPQA 1GGIL 1QFUL 1QBLH 4LMQI 5JDSB 2J5LC 3STLB 1LE5B 3HG1E 3HN3A 4NUJB 4KMTH 2GJ6B 4OZFH 3IAGC 2C1OA 3DO3A 1NCBL 5IBUB 1J0ZA 1UKQA 1C12A 4PGCB 1IC7H 1FVCB 3PP4L 4QLRA 3ARBC 4TVPE 1JPSH 4MCZA 1R3LB 4LARH 3ZYIA 3HR5A 4GFTB 1KGCD 4L3EE 3EDFA 4PRDB 1NL0L 3VFRA 2OR9L 2VZSA 1MJJA 2M26A 1QEWB 5IFJA 3OHXB 3KHQA 3JSSA 2W1NA 4QRPB 5I0DA 2EDNA 3PL6D 4MJIA 2X4SB 4Z77A 2C7UB 2IH1B 1I7TB 4U1JB 1YEFL 1UYWL 1FLRL 3MGTB 3NZHL 3QDJD 2NTFB 4GKZA 3D9AH 4OUUB 1ZT4B 4ONGH 4OZGF 1M71A 4YDIL 2R4RL 4XBEH 2MFNA 2AJYL 4K7PY 1NGQH 4OGYH 4U1JA 3QIBD 1DQML 1JF6A 3KYNA 2NTFA 2OI9B 3RGVB 3HCVB 4KH2A 2HTKC 2X4QB 4X7CC 3VD9A 4ZFZB 1FHGA 4FTVE 3PV6B 3VMOA 4J3SA 4KMQA 2LABA 1N5AA 3C2AL 4ZTPH 3P77A 4O2CB 1NC2A 4JFEA 3GBNL 3MACL 1P7QA 4RGOL 4UBDD 1S7RB 4V1DE 1T3FB 4POYA 1QLFA 4XCYB 5HHNA 3NAAH 2R2EB 3QFJA 5GGTA 4FABL 4N8PA 5C0FB 2Z31C 2VIRB 4W4OC 1XGYH 3OR6A 3ULVD 2E27L 2UWEB 3EYFA 2ADGA 3MRQA 3HC3H 3JZ7A 2XRAH 1OTTC 2YPLE 5KS9F 5F9JB 3GB7B 2R2EA 2V2XB 4HUWA 4GKOA 2UWEA 5F88A 3BEVB 4UNUA 4H88H 4RNRB 25C8H 3D0VB 3U4BH 1S9VB 2UVEA 4LLVB 5C6PB 4Z7VF 3P4MA 3OTTA 3C6LC 4P2OC 4X9GA 3TBWA 4P5TC 2A6IA 4LEXH 3P2TA 5IVXE 1BVKB 1W72H 1T7YA 3DVNA 4N68A 3AUVA 4OT1L 3DX9A 1OAUH 5E56A 1I1FA 1I9EA 2ICEA 2VLKE 1A47A 4GAYB 3PWVB 4PP1D 1HQ4B 1ZA3B 3OAUH 1NFIA 5DT1H 2DQFB 1TENA 3MROB 4P59L 2P24A 4JN1L 4OF0A 2YUVA 4I0PC 2VAAB 5C07A 4HK3J 2ERJC 4NM4H 3FFCE 4WGWB 4LHJB 4JG0L 5EU6E 1P5VA 3QIWD 4W68A 5E8EB 1FNEB 3NCYP 5DSCB 5HGHB 1HQ4A 1PYWA 1ZA3A 3MROA 1BQHA 3S37L 3QBTB 4WIQA 4LIQE 4X5XA 4OJFL 2HJLB 4KKLD 3QXAB 5MP6H 1SMOA 3UEZA 4L5FH 4NCDA 4BUGA 4F7CA 1YN6A 1DBMH 2VZOA 3RVWD 2V7HA 3RPKA 2H9GB 1OWRM 4R4NC 3QA3B 3MUJA 5HGBA 5JZ7C 3MUY1 4RRPA 2K9UA 5JIIA 3KYMA 4HIJA 1A1MB 3AS1A 4NYLB 3T09A 1JGLH 1IM9B 3MNZB 3KLHD 5KN5B 3ULSB 3FCTB 4MHHG 2PW2B 5F3HB 3KPPA 3QA3A 2BSTA 5CBEA 4LSUL 2FGWL 2H32H 4HLJA 1R5VA 5FAAA 1RK1B 4UT9H 4BFBD 5ALCH 5FO9B 1IM9A 3RZCD 1E4XL 1S78D 1YEHH 3GSVA 4M62L 3B9VA 4DN4H 2Z93B 3B9DA 9CGTA 2G60H 1LEGA 4FQ2L 3B9EA 1R24A 2ZJSL 1HXMB 2BDNH 5DUMH 3W2DL 1LDSA 4HKXB 1JHTB 1IAOA 4RGMB 4F7PA 3MRJB 5DQDH 2DQJL 5I76B 3V6OA 1FFPA 1FIGL 5GGVH 4PBXA 2YN3A 2Z93A 2A6KB 4X80L 2VLJB 2IGFH 1FCCA 3WE6A 43CAA 1KYOK 1HNFA 4M93B 4MGXA 5FHBL 1J8HA 3MRJA 5CZXC 1SJEB 5E8PA 2XA3A 1CGVA 2X42A 4GRMA 5EOQH 3VFOB 2VXSH 3MA7B 4CBPA 3HFMH 2H2SD 5CSZA 1X4ZA 1Y0LB 2DQIL 2YKLL 3J7HA 4GRWE 5ITBL 5KAQF 4N0CD 4PLKC 1F3DH 3RWEB 3N06B 4NKQB 2FBOJ 4XVTL 2WAHA 1GL4B 3QG6B 3MA9H 5T3XL 5A3ID 4N0FA 5IVZA 4LBEB 2VQ1A 1KB5A 4R4FL 2P5EB 4PIRF 4EI5D 1ORQB 3K8LA 1RVFL 3H9HB 4NFDA 1MFNA 5D1QB 3CDYA 4KROD 4HJGB 3L7FB 4JVPA 5SWZB 3O4LB 1J0YA 4WHTB 3SE3C 3BHBB 3HS0A 2DQGH 4KJWD 1HNGA 3O6FC 2KUTA 5GRXG 5C2BL 5I19H 2Q8BL 4N8VA 3SDCA 3SDDA 4GUPB 4O5LH 3H3PL 2EO1A 3C9NA 2JJSC 5HYJE 4Y4HD 3EGSA 4O9HH 5EU4B 2CLVB 3GI9L 2R8SH 1E4JA 3UTQA 3CLEH 3O2WH 2CO6B 3G6AB 2VZ1A 4NC2B 1TMCB 5DHYB 2A38A 5DWUH 5E2JA 1CBVL 2HMIC 3KYAA 2MMXA 4KWUA 5IEHB 2J8UA 3WLBA 2VXQL 4PJ9C 4XNXL 4M6AA 2CLVA 1RUPH 2FIKB 1S5IL 2ZUSA 4ERSL 1FGVH 2YWZA 1UACH 4YGVB 3RWGB 1G1YA 3I85A 1TQBC 2E5EA 1I8LA 1X4XA 3CDGB 1TIUA 3IFNL 3VXSD 3C09B 4OSUL 3B2VL 5JA9A 5B39B 3K2UH 4JRXD 4TUJB 5CUSH 1IEAA 4PRIE 1KXVC 3SQOH 1N2RB 2Y07H 1VDGA 3Q5OA 5I1GH 4HH9B 4NJ9H 5DRNA 5GGTH 12E8H 3HE7C 2CRYA 1KUMA 1XR8B 3ARBD 3JV0A 5DZLA 1U58A 1N4XL 3IS0X 1YEJH 1MAML 4ZQKB 1N26A 3G6DH 2HA1A 5B39A 4PJXE 3ARYA 3TWCL 4TUJA 3U2SA 3FOLB 4HQQL 5HDBF 3D3VA 1OAQL 3KYOA 1ZKAA 2CLZA 1CXFA 2HH0L 5I73C 3GUTA 2AABH 3ULUH 1LGVA 5ICYB 3O2DA 3O9WC 4HD9A 2QSCH 2ARWA 3CDCA 5FGRA 4NKIH 5KBNC 2GJ6E 2WV3A 5KVMC 4NKDB 4J3TA 3LQMA 3QULA 3PHOA 4LRIC 4TN9A 1N5YL 4HIEA 3QDAA 1SEQL 3V6ZB 4WTXA 5D2LA 4JFPB 1N3NA 4TSCL 5ICYA 3RU8H 5IMKB 4HUUA 1IM3B 3J8F7 3WYRA 1UC6A 2ZOLB 3K80A 2GEEA 1J88A 4NWUH 1MLBA 4GJTB 5E2WH 1JI1A 4RZCA 3F6LA 3EYUH 4WW1B 4Q9RL 3VE0B 2HTKD 3P73B 2R29L 2VYRE 1QRNA 4OD2B 1T5WB 5LXGH 4L4TB 4QRPE 4OLVL 1W0VB 3FRUA 2AV1A 1GIGH 3PIQB 4YX2H 1AKJD 3CVHB 4M43L 3P73A 3X3FH 5KW9L 4YK4B 5EZOH 5IVXF 3WFDH 4RFOH 5A43C 3WS6A 4GQ9L 1G7QA 5C0BA 1MREH 2XNAB 1T5WA 4LLYB 3HUJB 1CXHA 3ROOB 3A0OA 3S36X 3LEYH 4TNWF 4BQ8A 1OW0C 2VDRL 2AJZB 4NQUA 2IAMD 4UTBL 4P2RE 3RL2B 3P0YL 1WJ3A 2RCSH 2J6EA 4EN3C 3OJDA 3QYCA 2H3NB 4X6CB 1IQWL 2IPKB 4LLYA 4UIKH 3TIEA 2J4WH 1MCLA 4PUBH 5E6YA 4ZUTB 2RQ8A 1KCUH 1FL5B 3V4VH 1Z0MA 2AJZA 1JF1A 4K8RC 5FHAH 2FH6A 1FN4B 5DF0A 3BQUC 4Z5RB 4GW5A 1R3KA 2H3NA