4WFHE

Human traak k+ channel in a tl+ bound nonconductive conformation
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
211
Chain Sequence
EVQLQQSGPELVKPGASMKTSCKVSGYSFTGYIMNWVKQRHGKNLEWIGLINPNTGYTTYNQKFKGKATLTVDKSSSTAYMELLSLTSEDSAIYYCTRGNYVFDYWGQGTTLTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 48
structure length 211
sequence length 217
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wfhE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wfhE02
1ORQB 3MV8E 1IFHL 4ENEC 1ZLSL 1NJ9A 4CMHC 5J13B 2CDFA 4J23A 3FQNB 4GAFB 4JY5H 3WLBB 3IKCB 3MRFA 4CJ1A 4TPRH 5IQ9B 5GSRB 3IXAB 3D25A 5HVHB 4U49A 1HHJB 4HX1A 3KPSA 3I6GB 3TT1H 4KHTL 1TJGH 1X6LA 5E08H 3MRNA 2AGJH 4Z77B 5IM7A 5M94B 4ALAH 3V9FA 5AG8A 2YD8A 3QUXB 1AD0B 4UT7H 4HH8A 1ZHLB 3DX7B 3QFJA 3MV8D 4GKZB 4OGZA 2CMRL 1AIFA 5CILH 4NN7B 4K94L 1MY7A 1U91B 4CVXB 1KC5H 4PLJC 4BFIA 1U41A 3O6MH 4NQDA 4L8DB 3UAJC 5IT2L 2OP4L 4PYGA 4PJHB 5EO0B 1T21A 4U6HA 1R5IA 4PJIF 3Q1SL 2AV1B 2AJSL 5JQ6L 4U6VH 1A7PL 3DPBA 4CL7A 4LGRB 1QLEL 1H15B 4XMPL 3VFGH 3FRPA 4KTEH 4EI6A 2RGSA 1HOCA 4OKVA 2APBA 3CXHJ 4OGAC 1FHGA 1WTLA 5GSVA 4G8EA 4S1SL 3FZUD 1M7DA 5FO9A 4F37F 5D72H 4LRNH 3W9EB 5FHAH 3AVEA 4NYLB 2YWZA 4YDVB 4YQXL 4FXLA 3TPUB 3FB8B 5AWNL 1NCBH 1LGVA 1G6VK 2D9QB 3ULSA 5F7EH 4XBEH 4RFOH 5HD8D 1A7NL 3H0TA 2O5ZL 3X3FL 3C5ZC 2QTEA 1OP9A 5HHMB 2E9JA 3F12B 1MCCA 3V6OE 2OMBA 3Q6GL 4W70A 4MJIA 5L2KB 1T22A 4QRRB 1Z2KA 2YD7A 1SJEB 1MVUB 3DXAE 1J86A 1BMGA 4H20H 3O9WC 1AD9A 3MMEA 2X05A 3G9AB 4NUGH 1KCVL 3FOLB 1ODAA 5IB2A 4E42B 1Q0XH 5TDOA 4YHNB 1U93B 3RPIA 2Q8AH 1RPQA 4AQOA 2BZDA 4EBQH 3ECBA 3HG1B 4MJ6A 5A43C 2EICA 1ACYL 3MLVH 5FF6B 4GAJH 1V3KA 2VMFA 1JZ5A 3UZEA 3VWKB 2N56A 5KZCB 4BK5A 5BVPH 3O2DL 3O6LL 1FAIH 5CBEA 3TO4B 2NY4B 2VR5A 4KROB 5IB3B 2IANB 3MV7B 3O4LA 2H41A 1A3RH 4WW1A 1V3JA 1K8DB 1U3ZA 2E6JA 4OCRL 3IDXH 4FQ2H 3QISA 4HC1A 3ETBF 1F6LL 4PREB 5FOBA 4K3EH 3DXAD 1ZLWH 5CZXD 4PJBE 3TN0B 3L95B 2C1PB 3ARVA 5DMGC 5F9OH 4F7TA 4UBDD 3ZE1F 2WWKO 3BKYL 2NZ9D 5CUSL 5FYLL 3VH8A 1JPGA 3VI4F 1SEQL 2XG4A 4P46C 4EXPX 2X41A 3M45A 4ZD3L 2D2OA 5IWLA 5IB4A 2AV7A 3VFWB 2UUDK 3OJDA 3A6BH 1GIGH 1WWCA 3CFKA 1NCCL 2APVA 4ZO7A 1T83C 3RX5A 4YHOH 1XF4A 2F58L 1M71A 5B4MC 1PYWA 3IGAA 4ZXBD 3SDDB 2X9WA 4XVSL 2X4OB 3GGWB 4A6YA 2BSED 1HHKB 3TVMC 2VLKE 1CFQB 4NN5B 5DHYA 3U30C 4NC1C 2R2EA 4U3XA 1DBMH 3QO0A 1MFCH 3F58H 5JXED 1VGKB 1M05B 5T1KA 4Y19A 4UIKH 4APQC 1BM3H 4NO2A 3PGFL 1RUPH 3IJYB 5JHDA 5TQ0L 1OGAE 3HI5H 5DJAB 1LO2L 3QG7L 4HIXL 4AYFA 4DCQA 2DD8H 1C16B 3F8UB 4OLEA 1KIQB 2DJ4A 4PJXF 4U33A 3A67L 3MNZB 4UQ3B 4JFDE 2VLKD 4MQXD 5CJQH 5DDHB 2X4PA 3Q5OA 1KEMH 3AREA 4UINL 3BPLB 5TDNA 3LD8B 3HAEB 4QYOA 3ALWA 4N5ED 1A4KA 2WUCL 3HE7B 1S7SB 3QH3A 4OFPA 4M4RA 3L7FA 5D7KE 4U1LA 1IAOB 2VITA 3MCLH 4HUMB 2OK0L 2H9GA 2GHWB 1WWWX 3SDXF 1DANT 1UFUA 5FYJE 4FQCH 5ALCH 3MGTB 5T5NG 3DGGB 5GGRB 3R1GH 1P4LB 3P9MA 2FX9L 2YUWA 4OLXH 1PG7L 4HMEA 1TMCB 5KVEH 2H8PA 1IAMA 4JAMA 1FZKB 1VEMA 3PWLA 1BVLB 4XC1H 3VXSE 4JFDD 4CW1A 3V5HB 4PTTA 3JWDC 2FLRT 4DUXA 4IDJH 1U8NA 4ZPVB 4DEPB 4L3ED 3DROA 1Z3GH 5CJXA 5MHSD 3LQZB 4L5FH 5CSZA 4ZUTA 4ZAKA 5D7KD 2FR4A 3RVTD 3V4PH 1T7VA 4EQ2A 4CKVX 1J0JA 5DGRA 3DVNB 2BJML 4Y4KC 2PO6A 2CLVB 5DRXA 1X5IA 1D6VL 1F3JB 2ICWA 4MXVF 4UDUB 4ZUWB 3QXTA 2OL3L 5TFSL 2AQ2A 2BXYA 5AYUL 3WV0A 4OI9A 5IVZB 1OP3K 1ULVA 3UTTA 5F9WB 1NLBL 1OHQA 1JPTL 1MFNA 3MREB 1RIUH 3VXSD 5FYKL 3QUYC 5TF0A 2HT3C 4TRPL 4U1NA 1UQSA 4HWBL 5D2NC 5IW1A 1MNUL 3UPRB 1S7UB 4G3YL 4NKMA 1QSZA 2Z8WC 4MNGE 1S78C 1B0GA 5F8RC 1NDMA 3JSSA 4LVOC 5C9KA 1JPFA 3PWVB 4IOFC 1UACH 4Q9RH 1JE6A 2BVQA 3VXRA 2R0ZL 1G7HA 3I84A 3QHFL 1R3KB 1OTUD 3S4SG 2JCCE 4F58H 2I5YL 3ORJA 3MXVL 2OXGA 3WIHH 3IXTA 3C2AH 1L0QA 1FFNA 1FBIH 2OTUA 3G6AA 3GMLA 4PTUB 3DI3B 1EERB 2EDFA 3BYTA 4JGUA 5EZOL 1G7JB 2QV2A 5DVOA 3ARFD 1Q8MA 1R5VB 2VLJE 1RK1A 4TYUA 1FNAA 4LKCB 2OZ4L 3C6LD 5F9DC 4Z5RB 5DD6B 1EJOH 3MJ8A 4KHXL 3VCLA 2DQFA 4Z76B 3RVVD 4MD4B 1JK8A 1MJ7H 1UEYA 4WRLA 4E41B 3S37X 2YMXL 3S35L 1DUZA 3UP1A 4OZFH 3UJTH 5EO1A 3RY6C 2XNAB 4HXBL 3BD4A 2FIRT 2J8UE 2O93L 1ZANL 3EYQC 3O2DA 4XMLH 5DC4B 1AJ7H 4P57A 5CJOH 5KBNC 4LQ1A 4C4KO 1DBJL 4WU7B 3L3OB 3IFNL 1DVFD 1LD9B 3H3KA 5C0AB 2WINA 2P24A 4PY7A 4X7DC 4CNIB 3N85L 4D94A 2AI0H 3QUMH 1CZ8L 5MEOA 3WFDL 1IM9A 1PKQA 4YXKL 4QRPA 4M7ZB 2XQYG 3KXFA 1OL0A 2CH8A 2QLVB 5TQ2H 5HI5C 3WDJA 5TE7H 1MUJA 4ZMAT 4KKBD 3VD7A 1N3NB 2H32H 1WC7B 3ARPA 2EYRA 1S7TA 4QCIA 1RZ7L 3ROOB 2C3GA 4X7SH 5EUOA 3A6CH 1HQ4B 1TVHA 4ONFL 5TPWH 4J1UB 1WZKA 1Z9MA 4CVZA 1PEZA 2F19H 4F33A 1VPOL 3HNSH 4W4OC 3W0WB 4R26H 1WAAE 2E5EA 2EXYD 1J87A 2ADJA 3BEWB 4GRLA 5BXFB 1QLRB 4YK4B 1T1XB 2DOCA 2GFBB 1S3KH 3CDYA 1CQKA 4JFOA 1DQJA 1F00I 3OXRA 3I3EA 2VKWA 2VZVA 3PP4H 2NY5H 1XGQA 3T77A 1KJVB 2EEAA 3U7YL 5CJBA 2WUBH 1C5BH 1BEYL 4KGLA 4ELME 5CCKL 4O00A 4NC0B 4ODHL 3EFFB 3LMJL 2BCKB 4XPFL 4X9BA 3WN5C 3KJ6H 4PJAA 2E7LA 3HFML 2DLHA 1A3LL 2XN9D 5I1AA 4JB9L 3L3DB 4TSAH 3G04B 3A0OA 1KN4L 4XPTH 5I76A 4NSKB 4Y4HA 3SDAC 1VHPA 4PD4J 3CXDH 2V17L 4J4PD 3O3BA 1UM5H 3S36H 3JTSA 5HHOB 1KJ3L 2Z31A 4JFYB 1X4YA 3UJJL 2DWDA 5IJKC 3GHBH 4P23B 4JR9L 4ZFFA 5LXGL 3SDYL 3RWDA 3ARGA 1WT5C 1P7QA 1BVKA 4LU5L 4YEEA 3CXHK 5D1QB 2EXWD 2PXYC 2GSIB 1OAZH 3QRGL 3KYMB 4N0FA 4O9HH 2Q87A 1H3GA 1Q72L 1AO7A 4IRJD 4NQCE 4JM2C 4FMKA 2ADIA 4M6OH 1UGNA 5ISZB 1NGZB 2OM5A 4YXHH 5IMMB 2BSRB 4M1GH 1IGMH 2D7OA 2DQUH 4S2SB 3ZKNC 4XAKD 5HPMA 3MR9B 2WIIB 2IALA 2R0WL 4DWHA 3CFDA 4GUPA 4OLYL 1X4XA 3HPJA 4LCYB 1A1MB 3K4ZA 1KEGL 1IQDA 4UMGA 3FT3A 2DQCH 4FQXD 4OD2A 4HG4J 2WWMD 4LPXA 3KPRE 3R06A 1NGXB 1DLFH 1NGYA 2VLME 4RDQF 2IPKB 3HZKA 4H25B 2AQ3A 2OL3A 1XGYL 4NQCD 3T2NH 4ZUSB 4FG6D 5BZWA 2R0LL 5B8CB 3RX8A 4KZEL 3CAFA 5IVNA 4M00A 1NCNA 2JIXB 3PV6A 4GRWB 1IQWL 2NR6D 1RZFH 5D93C 3O2VH 4HUWA 4KK8D 3U0PB 2MTPA 4KKAC 4JPWH 1XGPA 3MV11 5DYOB 4JRYA 4MXQC 3GKZA 4JG1L 43CAB 4X4MA 5C1MB 3H9SB 2IG2H 5FGRA 1GH7A 4IHOB 1P9MC 2X4RA 5HYJA 3RY4A 2KKQA 1KTDA 2VL4A 4L4VA 1GZPA 3V4UL 5GGUB 3GSNA 5DQJA 2MCPH 2LFGA 5JDSB 1E6OL 1A6WL 5E8DH 5IQ7H 1S7RA 2AEPH 1MRCL 3BESR 1QYGH 2AW2A 4R90L 3QCUL 5CP7A 2D0HA 4K3HA 5E6YA 2GAZA 3KNBA 4DK3A 2EC9U 4PBXA 1AGCB 4PJIA 4HH9A 3P0GB 2ZG2A 3L5IA 1OQXA 3PABB 3GSQB 1TJIL 1I1AD 4M7JH 1DN0A 2ZOKA 4HBQA 4DKAA 4PLJD 4OV5B 4HQQH 2EZ0D 2QQNL 1CLOL 4AQ1B 3X17A 3V79C 1KJMB 2EIZA 5ELIA 1AGDA 3AC0A 3UAJD 5MENE 4WUUE 3CSGA 2J8OA 4LSUL 4POYA 1MRFH 1JNHB 1YEJH 4R7DB 3TT3L 4HIIB 2ZNXA 3RPKA 5F89B 2GK0A 4YDJA 4NO5A 4X7CC 5SX5H 4LK4A 2JCCF 3NCYP 4F80A 3PL6C 4XVTH 1YN7A 3ZYJA 3INUH 1J12A 2Y5TA 1RURH 1AKJA 3ARQA 3WE6B 1N64L 5BOPA 3U36B 5ILTL 1S7XB 3QIWC 1BJ1J 2NXZC 2NPLX 1EHLL 4HUVB 1FH5L 3SDCB 3HLAA 2PNDA 3BH9B 1YY8B 1U6AH 1NBZA 4PV9B 4WUUD 5MEND 1JCKA 1T20B 2DYPD 4BSVB 4F15B 4OF7A 1QEWA 2IWGA 3IRPX 2DDQH 1NMAH 1JGVL 1TJHL 1PG7W 3WXWH 3BQUA 3QDGB 3T0BA 4LNVA 4Y0GA 1UWXH 3C5ZD 3KPNB 2CDEA 3MACH 2JB5H 1CDJA 4U1SB 3C2SA 4XNXH 4FQQA 1IEHA 4UV7L 5KAQF 2FJGA 2J8UF 5HPOA 5L7XL 3QI9B 3UO1H 1BLNB 4HPOL 4RGNC 2GCYA 3O9WD 3G5ZA 3NBNA 2NTFA 5IFHH 4G6KH 1BZQK 3ET9F 2BOBB 5GJTL 2APWA 4PJHF 4X5XB 3BFOA 4C83A 1E27A 2AEQL 1CVRA 2DJSA 4WTZA 1XF5A 2FATH 2XACC 4LHUB 4M6MH 3QHZH 4HWEH 1NGWB 1NSNL 4NCC1 2P7TB 2DI9A 1AQDA 2L7UA 1CXEA 2N4IA 3K4DA 4BSWA 3QXDB 4OCYL 4QOKA 3CLFL 3HE6C 5DMGD 1P5UA 1HINH 5FUZH 3OR6A 1QNZH 4IMKC 5EOQH 1ZTXH 5E5MB 1WAAF 2MNUA 1HWHB 4M3KB 4P46D 3OXSA 3T0EA 3MV8B 4NC1E 4RX4D 4NFCA 2D4DA 1IKFH 1OLLA 1FLTX 2CXGA 4JN2B 4ZFZB 1MCLA 2E8ZA 1ZLUH 3BKJH 3I02A 4HCRH 3B5HA 5DJ8B 2NY2D 5CD5C 4M6NH 5B4MD 4ELMF 2AK4A 2P8PA 1F58H 5IEKA 1G9EA 2YPKA 3DVGA 3VU2A 3D1MC 3TVMD 4R2GD 2W9DL 1IM3B 1NUNB 3T1FB 4DFHA 1C5CH 4AK1A 4UQ2A 3U4EA 5JOFB 3FFCD 1I8KA 2CRYA 1BJ8A 1NAKH 5E2UH 3GSWB 5HY9B 3O8XA 3EJZD 4N90E 4OJFH 5EC2A 4LOUC 4M7LL 1MHHB 3VFOA 5DLML 1KNOB 3DSNA 3QA3B 5HI3C 4APQD 5C6WH 2B2XL 1OSZB 5IFJA 1KBGH 1QFWI 3MJ7A 3MRBB 3DOSA 4L8SC 3OF6A 4LIQE 1N7MH 4XCFH 3VRLE 1UJ3C 5EPMA 4XNMB 3OKDA 3CFBA 3SDXA 4I0PA 4P9HC 1YA5A 2BNUB 1MFAL 1DQLH 1MF2H 1UM4L 3ZLQC 3MUHL 1QRNB 2NW2A 1FORH 5DR5H 1DCLA 4GBXC 5AUMB 5ACZA 5DVLA 5CEXA 4TUOB 4WU5B 4N90D 5D1ZD 2VQTA 3V5DB 3MRGA 3TYGL 5ACLA 2FNBA 2YD9A 5J12B 2Q6WA 4FQJH 3ZKMD 3TNNB 5CHNB 4EIGB 4YHZL 2VTFA 4LPUA 4ODSL 3ZSTA 5CINH 4X4XA 4UIMB 2DLFL 4RIRA 3OHXA 4DZ8B 2ORBL 1H5BA 2X4UB 3BGFB 4KUCD 4P2YA 5DFTA 3GJFK 2EYTB 5B22A 4M5ZL 1Z0MA 3FL7A 3RBGA 3FRPG 4LASL 5I18H 1MOEA 5ECJE 5D2NE 1UZ8A 5F7HA 5MERB 1ZGLA 5F6HJ 1UA6L 4M9OA 2EYSA 3RDTA 2ICCA 1UKSA 1YZZA 5L88H 1S9YB 4PBWD 3FO0L 4JFZL 4I2XB 1TQCB 2XT1B 3CSBA 4MA1C 1K3IA 1X6NA 2FL5A 5GJSH 5FYJL 1F11A 1S9KC 3VW3L 3K1KC 4L9DA 1OY3B 3SO5A 4NRZB 2Z8RA 3I50L 4Y4KD 4F7PA 1GGBL 5BQ7A 2O5XL 3UYRH 4MXWL 4R0LB 3TBYA 4NO3B 2BHZA 4Z0BL 2JLLA 5H37H 5GZOC 5ITBL 3BRGC 3QXAA 2Z4QB 4ZDHB 2X70A 3JVGA 1YEHH 4G9DA 1F4YH 1AGEA 3QUYD 2HT3D 2HMID 5EOTA 3EYFA 2R1WB 3N0PB 2AERT 4GG8B 5JUEL 3D18B 3WKNA 5BV7H 2OR9H 1G7MB 2A6DA 4XRCA 1TTGA 4U1HB 1AQKL 4ZXBB 3BE1L 3JBG7 3OR7B 4YHKH 4LCCB 1JNJA 1NLDH 2ZUTA 5JW4R 1MJUL 4P4RA 4PJBB 1KN2L 2AQ1A 3CC5B 2IMNA 1AXSB 4PD4K 3U9UB 1B90A 3QR2A 5DI8A 3AROA 4PR5B 1WEJH 3FQRA 1T4KB 1CWVA 3LZFH 5KN5B 2JJWA 4MQ7B 2WBJA 4RFEA 5E2VL 2ZCLH 3I6KB 3IDGA 5ADOL 3B9EA 2R2BA 1RVFH 1UXWB 1DEEA 1ZXQA 1LP9E 4QTHB 1U3JA 3CX2A 3FB5A 4OFVA 1NH6A 3P77A 4BH8B 1YEGL 5TE6H 3BWUC 2Q1EA 1WZMA 4IIQB 3VH8G 1UM6L 3BZEB 2ITDA 3S96A 1NAMH 2VLKB 1U95A 5A1AA 1JHKL 5IW6B 2PW1B 3LKQA 3CPLA 4X5LA 2YPLE 1RI8A 4FFYH 4GS7C 1W8OA 2XZCH 3V6OA 5F1NA 1KG0B 2BVPB 2YZ1A 4HD9A 1IMHC 4H88L 1VFUA 3LN5A 1P6FA 12E8H 1L7IL 3CMOH 3DXAA 1XF1A 5CP3A 1TCRB 2AJXL 3PWNB 1UH3A 2J4WL 3QUZA 5EO9B 3TIDB 4AEHH 4FTVB 1DBBH 1GGIH 1RQ5A 2UY6A 3RZCC 4V1DE 4NRXB 4JFDB 2FJFB 4MNHB 3TGXA 1HDMB 5BVJB 5GGVY 4Z7QE 4K3DH 1EDQA 4K71C 4L3EB 4P3DA 4WEMB 3PNWA 1YMMB 4KY1L 4K7PY 3U4BL 5DT1L 3L7EA 2IADB 2XG5A 4XCNA 1XGTA 2B39A 1SY6L 2VZSA 5C2BL 5T1MB 3L9RB 5HYSA 4NKOB 4EOWH 4ZOAA 1I7ZB 4QXTB 3JWOC 2F5BL 3PDOB 1H9VA 5BRZB 5E70A 5I73B 1XCTA 4NFBA 4ZPTA 4I3GA 4NKDA 5DK2A 4Y5XB 4YWGL 4Z0XA 5JOEA 2EDQA 5IB5A 1OAXH 3X11B 5FFLA 4FMFA 1HKFA 4MD5A 3V0WL 1A6AB 4YE4L 1G7QB 2ENSA 2H6PB 3UTSE 3T2QA 4XCCH 4UILH 5C0GA 5IR1B 2HTKD 4KUZL 1VESA 1U42A 3W9DA 4OGYL 3EOTL 2X89A 3GJFA 4XP4L 2XA8L 5HYEA 3JV4B 3SDAD 3PDDA 4E5XB 5GRYA 3LRSA 2FDBP 3ARFB 3SO3B 1Q1JH 5F21B 2A38A 3NFPA 2A9NL 4MLSA 1Q9OB 1AHWC 4FFWD 1MJJB 1U8QA 3C6LB 4MNGB 1OB1B 1ZLVK 1B4JH 3SPVB 3AFLA 1A6UH 3NA9H 1FYHB 4OCWL 3WHE0 3UTSD 3BHBB 1OGAA 3L3KA 3SKMB 1A6ZB 4PGEB 3VXUE 3R8QA 2P8LA 5T3XH 4YIQB 3RI5K 1RIVH 4JFXA 1JUFA 1IAII 1EEQA 1AE6L 1BQLH 2IAMD 5F7WC 2YKLL 3T4AA 1QSFA 1AFVL 4HW6A 5EUKA 5JIHA 2WW8A 4BQCA 1IEBA 3B6SA 4ZQKB 2IH1A 2V5YA 1FO0L 4ZOBA 5KSUB 3ZKND 3U6RA 1GOHA 1NMBL 5C0ND 5IFAH 1IGYA 1CTNA 1DVFB 3VRLF 4XX1G 5CGYC 5HHXH 3VRIB 1JNNL 3QDJB 5T1LD 4G6FD 5EU7C 1TIUA 3LQAL 4K8RL 2BSTB 4U1IA 1B9ZA 1HKLL 2YPVH 3VXUD 5FDWA 2MPAH 5CGMA 1Y6KR 2FRGP 1SYSA 3MLRH 3Q3GA 5ERWB 1HIML 3KPLB 2CQVA 2GSGB 3S5LA 1NDGB 3VXSA 2JTDA 2JE8A 1RUKH 3EO0A 4PJFE 1X7QA 3LEXA 2Q7NA 4JQXC 1LK2B 3QBTB 3E6FA 1VFBA 5DHVB 1CXKA 3AGVA 2AJYH 4OIIL 5DWUH 43C9B 4AL8H 2BDNL 4KKAD 3D3VD 5A16B 1UB6A 1FSKB 1CD8A 4MXQD 1IGFL 1KELL 1ZA3A 2R23A 4Z7WE 4DVBA 1RSFA 4JPKL 3LVEA 2KQNA 2DWEB 4HC1H 4L1DA 4ZFOL 3D0LB 4FQ1H 1O5DT 1G9NH 3KLSA 4JFPB 4Z7UB 3UTZB 4D2NA 4RAVB 2Q7YB 4RWYL 4HKBB 5TDPB 5SWSE 2X9XA 1T5XA 3VFMA 4LLQA 1NC4D 2OI9B 3QEGH 5SV4A 4OFIA 1MIEL 1CFVL 5EBGA 3LKRB 4PJGE 1KENL 1B6DA 2Q8BH 4Z8FH 1XAUA 5DJ6A 2I9LA 2Z35A 5CZKA 5DJYA 3EO9H 1NGPH 4HS3A 1A14H 5F93C 5SWZE 3K8KA 1CT8B 3L3JA 1J0ZA 1V3LA 2XN9B 1CFNB 2EDYA 2AJVH 2JCCA 3GIVA 3FQNA 4RISL 4PG2C 3CVHL 3GBMH 5JLZB 1FFPB 1AR1D 4ZSOE 3UYPA 1YMHA 2P45B 2QQLH 4XTRC 5IQ9A 1J88A 1P4BL 4A6YH 5EORH 5DUPL 2VDKH 1JGLH 3IXAA 1GXEA 3NN8A 4XNUH 2VLJA 3TBVA 1YJDH 1ZK9A 4G7VH 3F7PC 4U1KB 2R4RL 3HC4L 3MBEA 4R7NA 5LVEA 3RNQB 3SCMB 4DVRH 4KFZC 5EBLB 3X13A 5SWZD 3TO2B 1SMOA 4PLKC 3G6JF 1JGUH 3RWCA 4H8WC 4IRJB 1F4XH 4XP1H 4RGNE 1SBBA 2P47B 3QIWD 4UV4H 2W0FA 4XNYL 1L0XA 2V9QA 3X3GL 1LDPH 4YDIH 4UTBH 1NMCB 2WIMA 2J8UA 1AI1L 4XWGL 3O6FC 2A6KA 1IGCH 3WFHA 1K5NA 3ULUE 1LP9F 3C5JB 5FV1L 4HJ0C 3GMQA 4BM7A 1ZHNB 3K2UH 1LEKA 1N4XH 5D7IB 5DJZB 3ULVC 5IIEA 1IFHH 2CXKA 4PJHA 5EO0A 3LN9A 4PJ8D 5E9DA 5C0DB 4FQXB 5EZLA 4GKOA 1XGUB 4YX2L 1XIWC 3RWJB 2VISA 2VO5A 3MFFA 4XGZB 3KWWA 4KTYA 2FECI 3NZ8B 1PAMA 1KPVB 1KIPB 3BISA 2W65A 3GSOA 2OJEB 4RGND 3MLTA 4EQ3A 2A77L 4NZDA 1II4E 3TM6A 4HK3N 2DQIH 2NLJB 4UDTA 1VFMA 4WFGD 1CDCA 1WITA 4KJPC 4KHTH 7CGTA 5H8DA 5JO5B 3ULUD 2Y06L 5HHNB 4E0RA 1T0MB 2GTWA 2HT4C 4N8PA 1QACA 3DV6B 3P11L 3IETA 4DUVA 1ORSA 4AIZB 3KPOB 1INEH 2XOTA 3E0GA 3TPUA 1NGQL 2CMRH 1NFDE 1WAAA 3JV6B 4K94H 3VXOB 5HGHA 3D39B 1AC6A 5CMAB 4Z7QF 4J4PA 5J1SC 4FFZL 3QHTC 3BPNB 1ZT1B 1ZHKA 5JQHC 1Q94B 5IT2H 2DS4A 2OP4H 4N0CC 3AU1B 4IJ3B 3HE6D 3RJQB 2YBRA 1YEKL 3DJ9A 3Q1SH 5DF0A 4ELMA 3ARYA 2BERA 1M7IA 4RMRA 4WHYG 1A7PH 4WWKC 4E42A 1QLEH 5DJDA 5HGBA 2PUQT 2G75B 2P44B 2ICES 1D5XB 1I1AB 3KDMB 5KSBE 1S7VA 1FL6A 4NHUB 3DARA 3H7LA 2CKBA 5KVFL 3BUYB 1GZQA 2HA1A 5C8JB 3G5YB 5CD5D 32C2B 1SQ2N 2YN5A 3CVHB 2H3NA 4DZBA 4KDWA 2AAVA 1R0AL 1WSST 4YQXH 4IRZH 4HDIA 4P2OC 4HKZA 4O2CB 5AWNH 2EE3A 4ZO6A 5GRJL 1U3HA 1RZIB 4LQFL 4OZGF 4MJ4A 1PQZB 1KXVC 5ICYA 1J9CT 4XI5C 4QWWC 3Q6FA 3TZVC 2C1PA 2MHAB 5I1CL 1ZS8A 3PGCB 4JM2F 2O5ZH 1IGTB 3X3FH 1FVEA 3Q6GH 5JIKA 2WK2A 5DK0A 2V6HA 2EDBA 4R4BB 2MQCA 3ZHLA 2Z91A 2BNRD 3PDGA 1D9KB 3QEHB 4KRPD 1UT9A 1ED3B 3HS0A 1FRGL 1ZA6A 3E3QC 1G7LA 1KCVH 5H2BB 2HWZL 3C08L 1CIDA 3VRJB 4D9QE 2W0PA 2DYPB 3DSFL 2AXHA 1ACYH 1OWRM 4HLZH 2Z92A 2NTSP 4BQBA 3MLSL 3O2DH 3O6LH 1HHKA 2K7PA 3IFOA 4HPYL 3T65A 1OPGH 4GBXD 3MYJA 5IBTL 4X7TB 4OCRH 1MCNA 3KPRA 4YC2B 4C56E 1OD7A 4ZFOA 3HR6A 3SQBA 3V2AR 3W2DL 3DO3A 3V6FA 4LIQL 4F7CB 2RFXB 2NY6C 3HUJF 3B3IA 2VQ1A 3CSYB 5IVXE 3DETC 3BKYH 1SJHA 3BKCH 1KIRA 3QUKA 4OCXL 5CUSH 4W81A 3C5SB 5FYLH 4RZCB 4XP6L 1SEQH 3JWDL 4DJMA 2FHCA 3DHMA 4HEPG 3V7AE 3BJLA 4ZD3H 2LTQB 1KIQA 3KS0H 1FCGA 4HAFA 4UQ3A 3RBSA 3M1BA 1NCCH 1R6VA 1WV7T 1R3HA 4G8GE 3X12A 4R96B 2F58H 4PJFF 3D85A 3DBXB 3FT2B 5GISL 2UWEB 3EO1A 4XVSH 2GTZA 2Z8SA 3DX9A 5FA4A 3ZE2E 2VE6B 4Z7WF 3PWPB 5FO7A 1BIIA 1P4LA 5MEQB 3K81A 4GSDH 3IU3A 1RJYB 2OTWA 4OLVL 2BNQA 2P8MA 1MHCA 4HFWA 3GMOA 3WFEH 2I25N 2VAJA 4DN3L 4D9LL 3BP7B 3BVNB 2RAMA 4DK6A 4O2FB 3PGFH 4G8GD 2NY2B 4PJGF 5TQ0H 3AB0C 4WUUA 1KCUH 1LO2H 4Q7DA 4QXWA 3LQZA 3QG7H 4TUKL 2ATPA 1JV5A 3TVMB 4G6AD 4LHJB 4WTZG 3VWJC 4R2GB 4BYHA 2W91A 2J5LB 1MFDL 3A67H 2Q76A 4H0HB 4M62L 1F45A 3DVNA 4UINH 3FFCB 3C5ZA 3QDMA 1QZ1A 1S8DB 3L1OH 1B6UA 2ZUYA 4YO0B 5LBSH 3P0VL 2WUCH 4GXUN 3S98A 25C8L 5IVZA 3SGDH 1K8IB 1KLUA 4L4TE 1U2CA 5E8EB 3WMSA 3O9WA 2NY3D 1WUNT 2A6JB 3EOBB 3GBLA 4CN4A 4WNQB 3FFDB 4Y5VB 2FX9H 4NJ9L 5IROA 1PG7H 5I1LB 2HLFD 3GSRB 3QIBA 3BEVB 4G9FD 1R3KA 5INCB 1OP3H 1D5MB 1J8HD 3VFSA 5I0ZA 1I7TB 2CK0L 2GW5A 5F7LB 2FYYB 1KT2A 1XMWA 4JHBA 4AM0A 3PJSB 4PGCA 3UMTA 3ZDXE 3IDMA 4JHWL 5D1ZB 3W39B 3GSVB 1LEIA 2OTPA 1TVDA 5GS2H 3QDAA 1QA9A 5DRZA 1YNKL 2PW2A 4ODBD 1J18A 3DTXB 4ZUUB 1I8IB 2XA3A 2BJMH 3PQYD 4IOIB 4Z5RA 5DD6A 4G7YL 4P46A 2OL3H 5TFSH 4MD4A 4E41A 4OQTL 2VRAA 3QAZC 2IPUG 4U7KA 5C0EB 1Z9LA 1JPTH 2IC2A 4X99A 5FYKH 1U8KB 2ICEB 3B4NA 3G6DL 4HWBH 4TRPH 5IBLC 1MNUH 3U2SB 5B3NA 3BGMA 1T83A 1I1FB 2UVEA 5DFWH 2E27L 3CU7A 4X6EB 2R0ZH 4JJHA 3O3DB 1T2XA 3QHFH 4X4YA 3F7YB 2XQBL 4PRBB 3DMMC 5DMKA 4XAWL 4Y4KB 3GIZL 2I5YH 3MXVH 5C0AA 1FVCA 5ID0B 4HK0B 1HXMB 2VIRA 4ORGA 1NFDF 2HJLB 4QXGL 5C07B 3EYOA 5EZOH 5HBBA 3I6LD 5K33A 5D2NB 1HHIB 5DQ9B 5C0FA 1MLBA 3ARSA 1NFIB 2VXSL 4MJ5A 4APQA 3GKWL 4MNQD 3VXMA 3LS5H 4PUBH 1A9EA 2OZ4H 1T2QL 2CR3A 4HUNB 5LGHL 4KHXH 4Y2OA 3ILPB 4Q0XL 3AUVA 4JLRB 3HKFA 2YMXH 3AREC 2WQRA 1QFUL 3DRQA 5T3ZE 4JFHE 3TA3C 3TESA 3RWHA 5IKCB 2HJKB 3BEWA 4HXBH 2B20A 5I1HH 3SQOL 5INDA 9CGTA 5HDQL 5KSBF 3S3JA 3MSPA 4MAYC 1T1XA 5HHPB 4JFQA 3EJJX 1QO3A 4OZIE 1VACA 2UY7A 5DJXA 4JG0L 1DBJH 2W0LA 1UYWL 3IFNH 5J9PB 1ES0A 3BD5A 1EPFA 4PG9B 1QP1A 2FH8A 5EU7E 3RP1A 1QLFA 4OZHB 3QXVA 5JW5B 1ZEAL 1CZ8H 2BCKA 3B9KD 3WFDH 5K59E 3SGKA 4YXKH 4LCUB 3KPQA 1PZUB 3FB6B 2B7DT 5T3ZD 4FRWA 1MCOL 4Y1AE 1T04A 4PRPE 4J6RL 2DKMA 1FFOA 4XWOC 3DI2B 3PIQB 4ZAKC 1JNLL 2OQJA 3NFSH 1H3VA 3NIGF 3QJHA 4ONFH 4KU1A 2VUOA 2VABA 4ODWB 1XR9A 3L3GB 1VPOH 2X4NB 5CGYD 1BF2A 3NABH 4JHAL 3V0VB 5CZVL 2G5BB 1REIA 4FXGB 5IBUB 1RUQL 1CQYA 2FX7L 3ARZA 4G6JL 2P1YA 4A2LA 3GI9L 4JPVL 4B7IA 1FJ1B 2NCMA 1FE8L 1Q9WA 3QUYA 4YLQT 4Y1AD 4RMQA 4PRPD 5D96B 4QY8B 1BEYH 2H1PL 4RNRA 1J10A 3WIIH 3FO9A 5F9JA 5CCKH 4QRTA 3SJVB 4ODHH 5I74C 3LMJH 3AS0A 4XPFH 5ESQB 3OQ3B 4PRIE 2XWBB 4LEOA 1X44A 3HFMH 5IVXF 2MMXA 2GJ6E 1A3LH 2ESVE 3TV3L 5C0CA 4O51B 1KTLB 4JB9H 3M17A 3F65A 4S1DC 1KN4H 2B1AL 4MA7L 4RCAA 5C09D 1RHHB 5GRXG 4P5TA 1HYRC 3ARBC 4LSSL 2V17H 2C1OB 1NGXA 4B41A 4YDLB 3G5VB 1OCWL 3OKKA 4L29A 3BPOC 1KJ3H 3ZKXC 3GM0A 5ENWB 1MCRA 4JR9H 5HHQA 5LXGH 4NUJB 3SDYH 4J3OC 5DEGA 1LO4L 5B8CA 1IAKA 3REWB 5DGQA 3O41A 4LU5H 4JJ5B 4PRID 1RJZB 3ZE2F 3QRGH 2GJ6D 3HZVB 4G43A 5I75C 1RUAL 5DYOA 3RY6A 1CD1B 3TH4T 3G6JA 8FABB 5AG9A 3SDAB 2JK5A 4X6BB 5ABDE 2DQJH 2JB6B 1T0NB 3HB3D 2ZG3A 3HCVA 1CXHA 3IDUA 2IQAB 1QFOA 3HN3A 5CIPA 3ULVE 2VQUA 3ROLA 1NC2D 3GSUB 5IMKB 4X6DF 2R0WH 3KVQA 3MGAA 5JDSA 3RTQD 4J3WA 1DANU 4OLYH 1XF2A 4DOHE 3EOYG 1KEGH 4Y2DA 5HHVL 5HYSG 5KJRL 3IF1A 4GW5A 3CCHB 1CF8L 2EC8A 1I3RA 3REVB 2VZ3A 2ZPKL 1RJCA 1D5BA 5FECA 2DM2A 1AY1L 4Z95L 1Q9KB 2IAMB 1XGYH 2QQKL 4TVPH 4GAYB 3RVXC 4OQTA 4J3TA 3QEQE 4AEIL 4IRSD 2R0LH 4DW2L 2YPLA 3IDNB 3O6FD 4KZEH 1CICC 1OAYL 3VG0H 4HJ0D 3IRZA 1A0QL 4Y8AA 5BS0E 3ULVD 4GRLC 1X5XA 3S34L 1JNHA 4HIIA 3OKOA 3S7GA 5LGKA 1HI6B 1XIWD 4G6FB 3QQ9C 4JG1H 3AMLA 1D5IH 4JO3L 4Y5YB 1DQTA 1AXTH 2XXCB 3V4UH 5E03A 4V1DA 3QB7C 1MCPL 1SVCP 1E6OH 4HAGA 4KJPD 2BSSA 1MRCH 1S7XA 4LVHB 3MO1A 1IAIL 1NEZB 5CBAB 3QCUH 4JM4L 4J8RA 5J1AA 1WCBB 2HT4D 1V7NL 1NCAL 2UZIH 4KI5F 1YY8A 3D3VB 4EN3D 5KSAA 2CIKA 1QVOB 5F6IB 1KB9K 2HRPL 3GMNB 1A6TA 1TJIH 5AAMA 1RK0B 1JWMB 1TZHA 4HUUA 5AZ2H 4H0IA 3ZYOA 1CD9B 1CLOH 3G5XA 4OFYA 4RDQG 5K9OB 2GJJA 4Q6IC 4U1SA 2Z31C 5GGRY 2NW3A 4GRMB 1NC4B 4XNQB 1CLYL 5I1JL 4LSUH 4XC3L 4NNXB 3ARGC 3BZFB 3SGJC 1W72L 3TT3H 1AC0A 4WWKD 4L1HA 5D7IF 5HSFA 5ESVA 1FL3A 3D48R 4Z78A 3PHSA 4KDTC 3DRTA 1MJ8L 2VC2L 2LAAA 5EBWA 2PXYA 3J8F7 5BZDB 4OZGA 4CDGC 3MRDB 3MTRA 3WKML 3ZDYE 1UKQA 2PF6A 4GO6B 4QF1A 4JM2A 1FG2A 3S5LG 5ILTH 1EEYB 4ORZC 4LHUA 3E3QE 3ZKQD 1EHLH 1FH5H 4MX7B 1DQQA 3MV9D 1S7QA 4NZRL 4LSQH 4TVSa 3QO1B 4AENB 1BZ7B 1NKOA 2CRIA 3GSXB 1J05A 4WWID 1LILA 1HSBB 1I4FB 1YNTA 3NGBC 3QNYA 1JGVH 3MV01 1KGCE 1DUYA 4XI5D 2DM4A 2HAZA 1TJHH 3TZVD 2Y1VA 5IHZB 4M1CC 5D7LA 4KC3B 5T1LA 4OI8A 1XCQB 1GRWA 1MHEB 4LSDA 1FIEA 5SWZB 5JDJA 4UV7H 4KXZH 3PGDA 2D31A 3FQXA 1RZKC 1DE4B 3QIWB 5L7XH 4JFFA 5F7NC 3LDBB 4HPOH 1I9RL 5D2LF 5TF1L 4P9HL 5GJTH 5EWIL 1LEGA 2HH0H 3GNML 3HUJA 5AYQA 4ZTPL 1NCUA 3RHWF 4PJ8B 4ODUA 5KS9E 5DJCB 1KGCD 1JF1A 3GMPA 3T1FA 5K59F 5BW7C 1XR8B 4UAOC 1NSNH 1G1CA 3KPSD 4Q9QL 2GY7B 1RIHL 3FJTA 5EOCJ 3MLYL 5HY9A 3VFVB 3VGEA 3QG6B 1T7WA 5CP3H 4OCYH 1TZIA 4NZTH 5J06A 3SY0B 2NY6D 3LPGA 4WGWB 3CLFH 3FRUB 3QA3A 3QFJD 3V6ZA 1URLA 4NO0A 4PJFA 1R5WB 1OSZA 2E9IA 3QCVL 2AKRA 3V0AC 3RAJL 5FIEA 2HJFB 3MRBA 1WISA 4UT9L 4HFUL 1INQB 3V5KB 1G7IA 1Q0YH 4G5ZL 4BJLA 4HIEA 4Z7WA 2F53E 3RVUC 5MI0C 2IGFL 4NQDD 1GGCH 4FQHA 5KAQG 5I1IL 1IGIL 5LAXB 4MGXA 5AUMA 3MRPA 3WFCL 4LSVL 1S5HB 2FIKB 4BZYA 5SWSA 4TUOA 4X80L 5MEPB 2HN7B 3HE6B 5C08B 4V2CB 4YUEL 3OWEA 2FECL 2EDXA 3R8BB 3TNNA 4M48L 1FC1A 3CDFA 2XFXB 1QKZL 5EU5B 3D69B 4NQXB 3PL6A 3CDGA 3LKOB 4OZFB 5EIIA 2Q86A 3P4MA 2VXTH 4M7LH 4OB5L 5JPMB 3VGHA 3NMEA 5DLMH 4RMUA 1NFKA 2B2XH 4LPWA 1HQRB 1T66C 2AXFA 5FB8B 4NZUL 4ZSOA 2NY1D 4I0CC 4NN6B 4U6XB 5L2JA 5E00B 3BQUC 3GJFH 3WL9B 2KBGA 3LKSA 1ZE3C 4QO1A 1MFAH 4I4WB 2ZUSA 3QUMB 2ICWI 1WZ1L 1UC6A 1QSEB 1UM4H 3BP4A 4Z7VB 3UPAA 1MFBL 4M61B 1GGUA 1U8HB 1NBYB 4R0LA 1U9KA 5KSVA 4U6TA 3FTGB 3ZT6A 2BNRB 4KRPB 1VDGA 4WHCA 3TYGH 3VXNA 3EDFA 3RGVC 2H32B 2BXZA 3MUGA 4D0DB 4HSQA 4QXUL 3EW3B 1D6EB 4PGDA 4ODSH 5B39A 2V7HA 2DLFH 4PRDA 5ETUB 3IFPA 1G7MA 2ORBH 2YC1A 2Y7QB 3U4AA 1A4JB 4U1HA 2DBJA 3VFUB 1T89A 4LLDB 4M5ZH 3HNVH 4GW4B 2OJZL 5FA3A 2CGRH 3TIEB 1EO5A 4HZLB 4BA8A 1UA6H 4PJ7B 3U9UA 3RUGB 1E28A 2A83B 3ZL4L 1Y0LB 1UWEH 3MOBL 3FO0H 4JFZH 2HG5B 1BZ9B 5KN5A 1A9BA 2F8XC 4ONGL 1MI5E 5C9JB 4POZC 5FYJH 2GT9B 3CFJB 3I6KA 4YHPB 2GJZA 3VW3H 1I9IL 4KK6D 2XKNB 3T0EC 3I50H 4UU9B 1RJLB 3L3HB 5I8CA 1G9MC 1GGBH 1W72A 2E6QA 3QZWA 4BH8A 1UXSB 4Z0BH 5ITBH 4CAGA 3BZEA 1I3UA 5FK9B 5GRVL 1E4KA 5J11C 1NFDA 5D6CA 4MSWB 1MCHA 3PE9A 1J0YA 3DIFB 3MODL 5JHDE 3WXVL 4JFEE 4QHNA 1K6QL 2X40A 5IW6A 4P5KB 5HGDA 4HUXB 4YR6B 3O4OB 1A2YA 3LKPB 1PDKA 3LV3A 1A7RL 1IC7L 2DQHL 1AQKH 2W9EL 3VG9B 4LFHG 1MI5D 3BE1H 4NPYA 2P5EE 4GG6F 4I18B 4ODXA 3JWOL 1MJUH 4HWNA 1KN2H 1MHPL 1QG3A 3O8XC 2ITCB 1TCRA 4KKLC 1FNEB 1UJTA 5DA0B 2AXJA 2X1XR 5EO9A 2HLAA 5T1KD 4H26B 4Y19D 3TIDA 4PRHE 3RWFA 5GRVK 4FTVA 5E2VH 1BPVA 4XPAH 5KSBA 3H3BC 5JHDD 5ADOH 1HDMA 5GZNC 3QFDB 3Q48A 3QNXB 1W0WA 5JIIA 4L8SA 4I0PC 1H0DB 2QADC 2ZWLT 5F3BA 1BX2B 3ARED 2XQYK 1MAJA 1FN4B 4LLVA 2VDLH 4HIHA 4YAQB 15C8L 5DJ2A 3UTQB 2XZQL 1BFOA 5GPRA 4J3VA 2CLRB 4F7EB 3ZDYF 1WBYA 3IDYC 2DRUA 3UBXA 1W0VB 5I9QC 4B7LA 2BY1A 2EIEA 1FNGB 5GRWA 1I1YB 4XHJC 2OSLA 1FYTE 5BRZA 1PKOA 1WIOA 4H88H 2NY3B 1L7IH 1WFOA 4FP8L 4XT1C 1U8JA 3S4SB 1IGJA 4JY6B 4GOSA 2YEZA 3UEZA 3RKDC 3UTTE 4M6AA 2J4WH 1FZOA 1JN6B 4L9LC 4D0CA 5T3ZL 5M7QA 4LLYB 4NNYB 4M43L 2NZIA 4G9FB 1J8HB 4PJCB 4LLMB 4AIOA 2VZOA 3BDXA 3BH8B 5CJ5A 4GS7B 3B83A 4ZAKD 1U92A 3PUCA 4P49A 4OM0L 3BW9B 3O0RL 5D6DC 2Z93B 4C56A 4KY1H 3U4BH 2PO6D 3B8SA 3VFNA 5DT1H 4N8VA 4ERSL 1SY6H 5GIRB 3GM8A 5F7MC 5ESAB 1MCWW 3PQYB 5CEYA 3UTTD 5IVXA 2GK2A 3JVGC 1OF2A 5KS9F 2YUVA 1ZWIA 5IK3B 2F5BH 4KVCL 1KCRL 1H8SA 4PJ5E 4PGEA 3LB6C 1DQML 1RULL 4D8PB 4YWGH 3NFNA 1KXQE 4HWZB 3P9LB 4EZMA 4K71B 2UV3A 1C12B 1Z5LA 4LLUA 3BYYA 3VXRD 1ZLVH 4I3SL 1YPZE 3V0WH 4C55A 1B0RB 5DUBA 4LF3A 5T5FL 2X2YA 1XZ0B 2ADFL 4OT1L 5A3IC 5C0JB 2ARJA 5A2JH 5B3JE 4KUZH 3GUTA 4FQIH 3WNKA 1OARL 4WO4B 5I1DB 1U36A 1BJ1H 2FO4B 1S9XB 4OGYH 3EOTH 4S1DD 3MLUL 3O3AA 3RL2A 4BUHA 4XP4H 1ONQB 2VLLB 2XA8H 3QDJA 3IAPA 2BC4A 4WHTB 3I3DA 5JW4N 1B4RA 5F1IA 1ZLUK 4PP2B 4PJ5D 4JO2L 5IF0B 4YHML 1I9JL 2V7NB 1ADQH 5DMYA 3CU1A 5AD0B 5F3HA 3KPLA 2V5TA 4MNQB 2GY5A 5JW4Q 2A9NH 3VDAA 1P7KA 4WW2B 4XBGA 4R97C 2BVTA 5E94A 3TH2T 3KXFE 3TJHD 4OCWH 4X6DA 3VXPB 4YXLH 1JZ4A 4GW1B 3DUSB 4HGMA 4IMLA 4HS8L 3E8UL 1EAJA 2YD3A 4XBPB 1HXYA 1AE6H 1UB5A 4NC2B 2YKLH 5EUOE 3KG5A 3H7BA 4QHMB 1AFVH 4UUJB 2BVOA 3HPLA 4N8CL 4X8JB 5EU3B 2H2SD 3UTZA 1FO0H 1UVQB 3NH7L 1WQVT 1JWUB 2NXYD 5EU4A 1NMBH 4YZFF 2VWEC 3NCEB 4PRNA 4OI7A 4L4TA 1U8LA 4G80B 4X6CE 1IM9D 5DK3A 5GS1A 4QRPD 4PJEB 1JNNH 3KXFD 4H8WL 5EOCL 5FYLD 2A74A 4P4KA 3B9KB 3BO8A 4OF3A 3LQAH 2VOTA 3N1GC 1HKLH 3FT4A 5K9JL 2X4QA 3RZCA 1YN6B 1HIMH 3AAZA 1EMTL 3RVXD 2B4CC 1A7OL 4P48A 4PJAE 1SJVA 2BRRH 1LK3H 3ULVL 1RZGA 1F4WL 3EJYC 4CADA 5E8OB 5DZOA 5EN2B 4GRLD 1N26A 2DBLL 4OIIH 4OZIB 4U1JA 1MQ8A 1P84J 5CKGA 2PTVA 2BDNH 5TGBB 4TUJA 4HS6B 4PRAB 1IGFH 3K74B 1KELH 5J6GA 1JJUA 1R3LB 3QQ9D 1R24B 4JPKH 4WCYL 5I71B 4XPBL 3MBXL 2XTJE 4TSCL 1SEBA 3STZB 4JREC 4JRWA 1UCBL 4RWYH 4NKIL 2GUOB 1DSFL 2D3VA 3SKOA 4HJGB 2HFEA 4Y1AB 3WUZA 2VAAA 4PRPB 4YBQD 4MA3B 1CFVH 4WV1C 1KENH 1GVIA 3GI8L 5E4EB 4ZTOL 3ZKSD 5IOPA 1RUMH 1ZOXA 2ICWJ 4QRQA 5I66A 1ZHNA 5D7IA 5JOPE 4Y4HD 3HZMB 3BWAA 7FABL 4OD1L 2NQCA 3C60C 3WS3A 5C0DA 1F4HA 3EGSB 4RISH 5K9KB 3CVHH 4EVNB 5C09B 2XTJD 2Z31D 4EI5C 1NBQA 4PJDB 4GT7A 1E6JL 1MEXL 4K7FB 5FM4A 1P4BH 2P5WB 5DUPH 3QJFB 3NZ8A 3ARGD 3AM8C 1VKXB 1P7QD 3OX8B 1ZHBA 4UNVA 1AHWA 1M6OB 2WWKT 4QTIL 4RMWA 5KVDH 3I85A 2XRAL 3HC4H 3CH1B 1E0OB 1AO7D 4N0UA 1OAQL 5IMOA 4QGTA 5D9SA 2GJ6B 4K2UL 2F54A 4YBLB 5JOPD 4JDTL 4I48B 4DQOL 3F7QA 2FBOJ 4HGWB 3JV6A 4PV8A 4XNYH 5E2TL 4IOSD 3X3GH 3VJ6B 3Q0HA 5F97E 2CLZB 5D71L 1AI1H 3D39A 4XWGH 4JRYE 3WIFA 5CMAA 4R4FL 1HSAA 4X4ME 4WDIB 3KPPA 5D2LA 3HC3H 3RTQB 3RGHA 4PPTA 2DLTA 2X09A 3AU1A 4XNZB 3MX0A 3CIQA 3CK0L 1WK0A 2ZNWA 4MCYA 2H2PC 2JJVA 1KPUA 2B1HL 4M1CD 3PXJA 4AH2B 4YX2H 3TBWA 3QIUA 5FHBL 2ZSVB 1U8IB 1WLHA 3IVKA 4NGHL 3GBNL 4ELKA 1ZMYA 1ERNA 2F74A 4JN1L 2V2TB 1OVZA 5FYKD 1N8ZB 3RWIB 4IRSB 5D5MF 4JQXA 1SMAA 4AMKL 3QULA 4WFFE 4CVUA 5I1GL 4JRYD 1QBLL 2Y06H 3IS0X 32C2A 5L8LB 4GH7B 3P11H 4RMTA 1WWBX 4BH7B 3LKNA 2NNAA 1N2RB 3VI3E 1DP0A 5HYJD 1NGQH 1RZIA 1QBML 5F88A 2CPCA 2DTSA 1NEUA 1OLZA 2MHAA 3F7RA 2GITB 1P2CA 2KDGA 3RWEA 3ARUA 4FFZH 3MRMB 2PR4H 1I85C 3ESVF 4R4BA 5ICZB 1BQSA 2GEEA 2V9TA 5BV7B 1J1OL 1D9KA 5JORA 1YEKH 1OTSD 2X4SB 1YYLL 4G8FB 4WFFD 3OKEA 1FV1A 1C5DB 1MPAL 2AJZA 4ZS7L 4LMQE 2A73B 1J11A 4FFVC 4KDVA 5LWYL 3GHEL 1QFPA 3VRJA 5DTFA 2MSPA 4EN3B 5I16B 5J13C 4OGXL 4PRIA 1K85A 3CUPB 5C0IB 2EH8L 2DQEL 1J1PL 2A0LD 2ESVA 4OTXL 2KL6A 3RVUD 4OZ4B 2IPTL 4FQLL 4PG2A 3OKNA 3M07A 5KVFH 3ARDA 1TVBB 1T3FA 5HVHC 2N7BA 2FH6A 1ETZB 4NCDA 1PLGL 4PGJA 5DSCA 3WFZA 1R0AH 3EYSL 4LP5A 1YPZF 4EXKA 1MWAL 3T0VA 3FONB 5IG7B 1K4DB 4XVUC 3GMMB 4LQFH 4WWKB 5B3JF 3QUXC 4MWFB 2IH3B 3WDIA 5I1CH 2AVGA 1SYVA 4L3CB 3ZZ1A 2CSPA 1KB5L 1IC1A 2B0SL 3RIFK 5CAYB 1X5AA 2QSTA 3MOAL 1OGTB 3MCG1 5JNYB 3O3EB 4ZUVB 1FRGH 2BFVL 3MV9B 3LRGA 3KLHC 2EDWA 3O6FA 3MLZL 5IV2B 2HWZH 3C08H 2FWOB 1ZVSB 1LO5B 3BQUD 3KR3L 1I7UA 2CDGA 3DSFH 1EHXA 2R69L 3T4YA 3KYOA 1CIUA 2A6IB 4XZUA 3MLSH 1XIWA 2V2WB 4HPYH 4QOKE 3V52L 5FGBA 5IBTH 3PWPA 2AK1L 5EUOF 3C6SA 5T33L 5L6YL 2G9HB 2Y4SA 3QPXH 5LGJB 1YUHB 2EIBA 3OG4B 4LIQH 1MLCA 3T0EE 1FDLL 3QEQA 2DQGL 1NJ9B 3OTTA 2BOCA 2CDFB 4X6CF 4OCXH 1X5GA 4XP6H 3MRFB 5BS0A 5KG9A 3BIAX 2FSEA 3JWDH 3LAFA 4N9OB 1IEAB 4I0KA 4F2MA 3VFGL 5E4IA 1CGYA 3F7VA 1S5IL 2R56H 1ITCA 3D25B 4HULB 4HX1B 5H35A 2AK4E 4LHUG 4QOKD 3KPSB 3SKNB 1HH6A 4TSBH 1UADC 5IM7B 4DN4H 4LNRB 5D72L 4LRNL 4Z7NF 3UPCA 4HJJL 1XGRB 1A1OA 4KXZI 3ZTNL 2HVJA 3QFJB 3T0ED 3SGEI 3BAEL 1AIFB 1TPXB 5ALBL 4GG6A 3FFDA 4R3SA 3WBDA 3IB4A 4BFIB 3VWKC 3HHRB 1X3DA 4OLVH 1X5JA 4LCWE 3TO4C 2NY4C 2YHGA 4KROC 3MGOA 3TBTA 4JQIH 4PP1D 1I7TA 4NQDB 5GGSB 3D87B 2UYLA 1BD2B 4RGOL 2AK4D 4DN3H 1T21B 4D9LH 4U6HB 3STLA 1R5IB 3NTCL 1KFAL 4P5MA 1F4AA 3TN0C 4P2OA 4TUKH 2EH7L 4KJWC 3RU8L 1JFQL 4EI6B 4GKSA 1MFDH 1HOCB 3O8XD 4OKVB 5I2IB 4M62H 1K2DA 5GSVB 4G8EB 1TCMA 3OB0K 2R2HA 1FAIL 5MP6H 3D2UA 3C9NB 5KVGL 2GIYA 1M7DB 1OAUL 3EZ8A 1EV2E 3P0VH 5FGSA 1MELA 3NCBB 2C3VA 1XF3A 1CE6B 3KYNA 4FQ2L 5GZND 3WD5L 4CRPA 1RMFL 1FZMA 4LSPL 4WGVB 1EFXB 4I0PD 3U2SA 2NY1B 3ARRA 4MXVE 3SDDC 4WI6A 3L3IB 1WFUA 3H0TB 2FO1A 4NJ9H 1PFCA 1N5AA 1BFSA 4MJIB 2W60A 1T22B 2DQDL 2Y5EA 5B21A 2ERJB 1E4XL 3WUWA 4M1DL 2HFTA 5CIPH 2VSCA 5DJ0B 1AD9B 3QQ3A 1GIGL 2ZKHL 4XHJD 5E6IA 4DAGL 4JHWH 4HHAA 5IB2B 5TDOB 3RPIB 2C7UA 1BOYA 2G2RA 4U31A 3ECBB 4MJ6B 5DQ9A 1YNKH 3BP6A 3T0WA 5EZJA 4OSUH 4O58L 2E6PA 2PETA 3T2PA 5CBEB 1T1YA 4G7YH 4I5BA 3MRJA 2YXMA 1QFWH 1YNLH 3O4LB 4OQTH 2MJWA 3RDTD 3BPLC 4M4PA 3LD8C 1G84A 5KS9A 5FOBB 4PB9H 2VUYA 3G6DH 2R1YA 3HE7C 4P99A 1DBML 2Y07L 3F58L 1P84K 1H3WM 1MSPA 1BM3L 2E27H 4F7TB 3P73A 1A3QA 3VH8B 1JPGB 5DO2C 4ETQA 4F3FA 3HI5L 3B2UC 3IKKA 4XAWH 3GIZH 2BP3A 3NZHL 4KK9C 2DD8L 1MWAA 4LSTH 3EDJA 5IB4B 1QPPA 2AV7B 3NVQA 3OJDB 3VI3F 1T03L 1BOGA 4OZHA 1KEML 3QAZB 3LB6D 4QXGH 3CFKB 2EDTA 1IRAY 3MOQA 3O81A 3FO2A 3VE0B 4KK5C 1XF4B 1JGEB 1KB5A 4DEPC 2F53A 1M71B 2HTLD 1PYWB 3IGAB 3GKWH 2ILLA 4A6YB 3MCLL 1T2QH 5B39G 5E8PB 4NFDA 4CMMB 1Z6JT 5LGHH 1QBBA 4OM1L 2CO6B 5A3ID 3B2VH 4U6YA 4Q0XH 5DHYB 3OB8A 4ODWA 4UZGA 3VWJA 1QFUH 1UH4A 3L3GA 5F96H 1L4IA 2WBJD 3AXLA 2R2EB 2BRQA 4D9RE 1J0HA 3SQOH 5BMFL 5T1KB 2ZUQB 4KJYB 4Y19B 5F9WC 3FQTB 2XWJA 5LCVL 4NO2B 4AT6A 4LLWA 5JHDB 2PYEE 3IT8D 1N59B 4U2YA 3GK8H 4GKNB 4HIJA 1UYWH 3G08A 4DCQB 3C8HA 3MFGB 4QY8A 2LAGB 1K3ZA 3HMWL 5IROC 3QIBC 5DFVC 1EUTA 2X4PB 3SJVA 3QZWG 1ZEAH 3AREB 1PY4A 2QBWA 2DLEA 5ESQA 5J6HA 4LL9A 4QYOB 4MDJA 5J3HD 5C0BB 1T5WB 1A4KB 2IBZY 3QH3B 1CR9L 1HHGA 3C8KA 5HDBE 2ATKA 3E6HA 1MCOH 2QSCH 2K3TA 3L7FB 4GXVL 3VA2C 4J6RH 2WMPA 4U1LB 2VITB 1RIUL 4O02L 1JNLH 2H9GB 3FAXA 3DYPA 3CX5J 1W2KT 1LNUA 3P9MB 3QUZD 1OW0C 4KKCD 3HNTL 2EC9T 2H8PB 4JHAH 4U4BA 4JAMB 4X0KA 5HJ3A 5CZVH 4NUJA 4WHDA 6FABL 4M02A 1GL4B 1RUQH 4N1HB 4CW1B 2FX7H 4PTTB 3AS1A 4G6JH 5HVFB 4XMKL 2YWYA 2QEJA 3GI9H 3DROB 4XH2A 5TH2A 1FE8H 3TCLA 5DUML 5CSZB 4IS6A 4QHKJ 2H1PH 1LMKA 3EJYD 4D3CL 2WQ8A 4YGVB 5H94A 2PO6B 3U9PL 5DRXB 1I9EA 1MI5A 3DMMA 2ZG1A 1DJSA 3K8MA 3ILQD 1CFTB 2G60L 1IARB 3UTTB 2BK8A 3L5WA 4U2ZA 3UBXG 4MA7H 4U1NB 5IW1B 1FZJA 3NIDF 1G0XA 2R1XA 3PHQB 4HEME 3IU4L 1B0GB 5DA4A 1NDMB 1NUDA 1TZGH 1W8NA 4LSSH 2VDOL 1AH1A 1JPFB 1OCWH 5DZLA 3ES6A 2BVQB 3VXRB 1IJ9A 1G7HB 4JFEA 1I75A 5I17B 1E4JA 4NKQB 2JJUA 5JMRA 2HVKB 4FS0A 2X89D 3NIFE 3IXTB 1QSFE 5FUCC 5ITFA 2P5EA 3GMLB 3T08A 3TA3A 1RUAH 3FN9A 3RL1B 1HI6A 2YA2A 4FQPA 4MAYA 4D0BA 4WVRA 5EU6E 4PRHA 1HHHA 3MNWA 3UTOA 4Y5YA 4RA0C 3MJ8B 1IL1A 3LH2L 3ZKXB 2ZJSL 4X7SL 2DQFB 1JK8B 1CGWA 1HCVA 1OGAD 4N8VG 5TPWL 2LVEA 1JHLL 1BHGA 3PP3K 5SX4I 5HHVH 1O7VA 1VSCA 1RD6A 3SGKC 1DUZB 4R26L 5KJRH 1CF8H 5EO1B 3KJ4B 1QSFD 2XXMB 4JY4A 3DVIA 1JMZA 4N0YL 3FCTA 3V7AG 1AY1H 4Z95H 4P57B 2RR3A 2QQKH 1RK0A 1TQBC 4JKPH 4AEIH 4DW2H 5K9OA 5A2LH 2NXYB 2P24B 4PY7B 1OAYH 5EFIA 1FYTA 4P23C 1A0QH 1U8OA 5D5MA 5FYJD 4F7MA 3U7WL 5MEOB 2AJ3B 2VYRE 3S34H 3LHPL 1PKQB 4QRPB 4GFTB 4OF5A 2VZTA 5CSGA 1TNMA 1RZKL 1MUJB 1U8MA 5BZDA 4JO3H 2EYRB 3L5JA 1S7TB 4QCIB 4ZNCD 1TVHB 4AEFA 1KXTB 1B3JA 1MCPH 4CVZB 5GGVL 3ULUH 4YNYA 4UOW0 2AEIT 1KULA 1IAIH 1H3PL 2JJSC 2P48B 4JM4H 2FEEL 3OGCA 4QT5B 2ADJB 1AXIB 4GRLB 4K7PL 4OLZL 1WF5A 4Q2ZA 3GEWB 3DURA 1BZ7A 4RQQB 3HRZA 3GSNL 4JFOB 3S3PA 1DQJB 2HRPH 4P5TC 5D7JA 4JDZA 1XGQB 1NCDL 3ARBA 1MCFA 1NPUA 3R0MA 4M7LT 4P2RA 4M6OL 4PJ5A 2NX5A 3MZGB 1CLYH 4JGMA 5B8CC 5I1JH 4NRYA 1I8MA 4PJAB 1W72H 2PN5A 2HRLA 4CGTA 2X10A 4FZ8L 4WJ5A 1YPZA 5I1AB 3U46A 5IGXL 1MJ8H 5JZ7D 2VC2H 4U1MB 4YHIB 5I76B 3LSOB 4Y4HB 35C8L 3E2HC 2DIBA 3WKMH 3WDHA 1HYSD 2OMNA 1DLFL 2EE6A 3O3BB 4M3JA 3H6JA 3JTSB 4NHCL 3U0WL 1FIGH 2I9TA 2XTJB 2Z31B 2DWDB 2VLJD 1WWAX 4PJHE 1F90L 1GAFL 3T04D 4NZRH 3I3BA 1NQBA 3RWDB 1DL7L 2VR9A 5E9DE 3ARGB 1EO8H 1P7QB 3MBED 4Y2DC 3IJSA 1F8TL 4XVUD 3SY0A 2VJXA 4BZ1L 4M8VA 3QUXD 3MLPA 1BWWA 4N0FB 1AO7B 3T0XA 4KRLB 5FKAA 4KQ4L 5DEFA 2XY2A 4ZS6D 1OT1A 4F37K 1D5ZB 5HPMB 1NL0L 4OIAA 1I9RH 2IALB 3K7UA 3CFDB 1IE5A 3KPMA 4GUPB 5E8DL 5EBMA 3KLHD 1CL7L 1HK6A 1CICA 4P9HH 4XP5L 3FAWA 1R3JB 5EWIH 1IQDB 1QSVA 3AMKA 5E9DD 3RIAF 2FIKA 5IJVA 3GNMH 3QYCA 1DDHB 3NPSC 3R06B 4X6CA 1NGYB 5HHME 3HZKB 2J88L 1O0VA 5L2KE 2OL3B 1GJIA 3BUTA 4QRRE 2V9RA 5HDBF 4NBYB 5BZWB 1IILE 2EKSA 2IBBA 2H45A 4HQQL 3QQ4A 4MYWB 1RIHH 1CGVA 3MLYH 1PJ9A 4ODVL 3PV6B 3OKMA 4OZFA 3TYFB 2MFNA 3QXWA 1MFEL 3SDCC 4ESKA 4HUWB 3HG1E 2EDEA 5KSAC 4JQVC 1XGPB 3BP5A 3QCVH 2XWTA 3LY6A 4UT9H 2J6EL 4HFUH 1BFVH 3BN9C 1QHPA 1VADA 4BFBD 2X4RB 2VXVL 5HYJB 4NOBA 1JRHL 4G5ZH 4JRXA 2IANE 1KTDB 4L4VB 1FPTL 3EHBC 2D7MA 5F6HI 2IGFH 3GSNB 1I7RA 4KJQD 5DQJB 3DWTA 4UAOB 2YSSB 2Y36L 1S7RB 4Q6IA 1YY9C 2F5AL 5I1IH 1U8HA 4PS4L 1IGIH 3MRKB 5CP7B 3WFCH 5J1TC 2GAZB 3KNBB 1G9ML 3H9HA 5C71A 3SGJA 3FTGA 4PJIB 4HH9B 4YUEH 1MIML 4ONHB 1U6AL 2ED7A 4HKXA 3HG1D 4M48H 4D0DA 1NMAL 4KDTA 2RIKA 4XP9L 1QKZH 1DN0B 4NWTL 2UVFA 3VWKD 1ND0A 1HZHL 3FB7A 1NCWL 3TO4D 4LLDA 4Q74A 3T0AA 3JV0A 5JPNA 1O7SA 3WNOA 3DV4A 2DQTH 4YFDB 4OB5H 4H5SA 1AGDB 1EHAA 4LEXL 1NCTA 3RVWC 4IDLA 3QCTL 4NZUH 3W81A 1U3HD 2GK0B 2HKHH 3BMWA 2ARJQ 2WNGA 4Y16A 4NO5B 4U0RB 2HG5A 1BZ9A 3BZDA 3F6LA 3O3UN 2GT9A 3NIFF 2DB8A 3MA7A 2X4TA 5I19L 2Y5TB 1WZ1H 2XKNA 1AKJB 1BQHA 4WI5A 2FATL 4K8RD 5IHLB 2PYFA 5FM8A 4OLWL 3L5XL 3VGGA 5JMOC 1RZJC 4GQ9H 5DVMA 3ZT7A 3VXTA 3HLAB 5FK9A 3WCYA 5DS8A 4NQVA 4BQ6A 2KZWA 4LFHD 1QEWB 3FMGL 4QXUH 4ENED 3VFPA 1F2QA 3QWOB 5D70L 1L6XA 3LKPA 3BQUB 1J1XL 1JWSA 3GB7B 1YDPA 2QKIA 3DUUA 2BVEA 2IPUK 1Z9OA 3ARXA 3B8YA 2OJZH 4FQQB 1S9WA 5DRNA 2GYSA 1LO3L 3KPRD 5BW7A 1AGFB 2FJGB 2VLMD 3ABZA 1CU4L 3FOMA 3V8OA 1KCKA 2VL5A 1RU9L 2GCYB 1MVFA 3ZL4H 2NTFB 4CVWA 1KJ2L 3CX5K 3QDHA 3FZUC 3TF7C 2MQ3A 3WEXA 8CGTA 1F13A 4YPGA 4ZNEA 4MS8C 4JZOB 4C83B 1E27B 4NQSA 2QHLA 1I9IH 3B9AA 3I9GL 1INDH 1XF5B 3WO3B 5DRWA 3C09B 2BNQE 1LVEA 4JKKA 5GRUH 2SEBB 4MQSB 1CVSC 3IDJA 1BX2A 3K4AA 4OUOA 5B38A 2DJUA 5F7YC 1TENA 3DX8A 4P59L 1AQDB 3OAUL 1NAKL 2PKDA 3MRQA 4BSWB 1Q38A 3HE7D 3WXVH 3GJEA 1DQDL 4JZNA 3D85D 4QOKB 4S1RL 1K6QH 5E5RB 2A2QT 3G9VA 3KHQA 3BXNB 1A7RH 3OR6B 5J12C 1IC7H 1U58A 2A9ML 2DQHH 2W9EH 5J8OA 2X1OA 1PD6A 1N7ML 3QDME 4YHYB 3B2UD 3B9VA 2UZYB 3T8XA 1G6RL 5E8NA 3JWOH 4XXCA 4KK9D 1MHPH 3BGFC 1RZ8A 2I07A 4OGAD 2BNQD 1K9TA 1MCSA 3I02B 5DR5L 4KK5D 2V2XA 5CWSA 1CGXA 4LLMA 4Y4FA 2ADGA 4JDVA 4MCZB 2P8PB 5IEKB 3WSQL 4ZYKA 1TQCC 4X9GA 2YPKB 3BH8A 3DVGB 4IM8A 3K80A 4UQ2B 4BKLA 3VD9A 1CDYA 3U4EB 2EO1A 3EDKA 1M4KA 3VMPA 3QDMD 4P2QB 15C8H 3H3PL 1I8KB 4PJXB 4ETYA 1HEZB 3O8XB 5GIRA 2XZQH 2BHUA 4R0LC 5EC2B 2YD4A 3VFOB 2DIAA 5FO8A 3MRCB 5DD0H 2VLRA 5IFJB 1BREA 4UT6L 2O61A 3MJ7B 2WP3T 2QR0A 3QWRA 1BIHA 1YEDA 3RGVA 4D8PA 1VENA 5EPMB 4FABL 4DFIA 3OKDB 3CFBB 3P9LA 3SDXB 5GJSL 4FP8H 1MCBA 4E41E 4EUPA 1CYGA 1T89C 2GKIA 3QIBD 4OAWB 4ZXBC 4LRIC 3DX6A 2VDPL 5GQBA 5LQBL 4LCCC 3BZ4B 1JYXA 2NW2B 5T3ZH 3RKPA 4M43H 1XZ0A 5ACMA 4HKJA 3UYRL 5ACZB 5JW3L 4Z7OE 2J6EA 5CEXB 3P4NA 1EO7A 4I77H 2Q6WB 4WIQA 4TNWF 4LARL 4LVEA 5JXEC 4OM0H 3O0RH 5C0AE 4X4XB 1CGUA 3MRIA 3OHXB 5CEZE 1H5BB 1VEPA 4ERSH 1RAMA 2A1WL 3UJIL 4OCNC 4E41D 4WW2A 1DLHA 3I75A 1UZ8B 1E4KC 2Y9RT 1ZGLB 1UENA 2B4CL 4KVCH 1KCRH 3VXME 2EYSB 2WAHA 3RDTB 1PSKL 2VXQL 5FV2A 1N0LA 1DQMH 3LZFL 1RULH 1BBDL 2ZOLA 5D1XA 2FL5B 1BVZA 2AJUH 5F7DA 4UUJA 1F11B 3W0WE 5FUCE 1CS6A 4LVNB 4F7PB 5C0AD 5ANMA 5T5FH 3LIZL 5BQ7B 2KUTA 2ADFH 4OT1H 5CEZD 2DF3A 3QNZA 4XCYB 3TBYB 4NIKB 1OARH 4LAQL 4C59B 3QXAB 1I1CA 3S37L 4G9DB 4LDEB 3MLUH 4F57H 1AGEB 3NOIA 1I1RA 1FNHA 5EOTB 2Z8VC 3EYFB 4RAUB 4OFDA 3WUWG 5E24E 3VFRB 3VXMD 4YFLF 4JO2H 3B9DA 4YHMH 1QQDA 3CSPA 4LCWA 1L9NA 4XRCB 4OCMC 4NDMA 1KLGA 1F6AB 4MVBC 1Y6NR 4K07A 2R29L 4P4RB 1EHNA 3W0WD 2D7TL 2RBLA 5DI8B 5E8OA 5DXWA 4HS8H 3BIKB 4MA8L 3E8UH 3GZKA 2DL9A 4PRAA 1QR4A 2WBJB 1GC1C 4Y8DC 2X1QA 3MJ9H 4UNUA 1R3LA 2F8OA 1ZSDA 5I73C 2R2BB 4N8CH 3LN4A 1DEEB 4Y5XC 2QQQA 3FB5B 3NH7H 3P77B 4QRSA 3UZVB 1KJ2A 4R97B 3B43A 4MB4A 2ITDB 4PLNC 1KCSL 2WV3A 1QR1A 3S96B 5C86A 4H8WH 4KGJA 2YK1L 5EOCH 4L9LA 3N9GL 3W82A 1U95B 1JHTA 3CPLB 4LDLB 5K9JH 3PHOA 1D3CA 5I6XC 5F1NB 1EMTH 2YUXA 5HGAA 1A7OH 3V7MA 3LN5B 5C0RH 3ARFC 4PGBA 3DXAB 5K9KA 3MRRA 4UI2A 5L0QC 4KTDL 3SO3C 3ULVH 4H1LA 5C0CE 1F4WH 1MCJA 2YZ8A 5D6DA 2OYPA 4K7FA 5IMLB 1YC7A 2DBLH 1MH5B 3C6LC 3P30H 2Y25A 1F02I 3QUZB 5IEHA 3OX8A 4UILL 2VDML 5HYQB 1WJ3A 3DYOA 3T3MF 1EVUA 2VNCA 4WCYH 1G6RA 4JO4L 4XPBH 3MBXH 4TSCH 4WEUD 1UCBH 3MRHA 4NKIH 1S78D 1DSFH 4P3DB 3PNWB 4IOFD 4I48A 3GMRA 4GRWE 4Y88A 2GQHA 4G6ML 1Q1JL 3L7EB 4RAHA 1OAKL 2K1MA 1XGTB 5BO1L 3QEUA 1EXUA 5EIVA 4LBEA 3GI8H 1EAPA 4JKWA 3TBSB 5C0CD 4YGAB 4ZTOH 5HYSB 3I2CL 1G7PA 2X7LA 2ZUXA 2XPGA 3G6JE 4K23L 3RNKA 4WDIA 3H9SE 1FNFA 3VFTA 3SE3C 3LPWA 4JO1L 3ALPA 4P5TD 7FABH 4OD1H 5T3XL 2LE9A 4ZPTB 4NKDB 5DK2B 4PB0L 3A6OA 4Z0XB 3X14A 5IB5B 2FEDC 4M93B 1E6JH 1BBJA 4JHZA 4MD5B 1DFBL 4KKBC 4LDOB 3IAGC 3IJHA 4JPIA 4JVPA 5C0GB 3DNKA 4L8BB 3RWIA 1PG7X 1GGYA 2R8SL 4QTIH 3R0NA 5KOMC 2XRAH 3W9DB 3OMZA 1FSKC 3GJFB 5GGTL 3H9SD 1L7TH 3P4OB 1T2JA 5IVOA 3EYQD 4JDTH 1XH3A 3LRSB 4DQOH 3U79A 5E2TH 2XV6B 4X98A 5IUSA 5C6PB 1U8QB 5D71H 3T3PE 4HG4K 2OI9C 1JYWA 5JIPA 4Y2DD 5GS1C 4C54A 3SOBL 2PYEA 1OGAB 4FN0A 4P4KC 4LSRL 5DWUL 2P8LB 3CK0H 3BSZH 3BPCB 3EOAA 4JFXB 1JUFB 2B1HH 3K2MC 2XTLA 1ZT4A 5HI5D 3T4AB 1QSFB 4OUUA 2ARWA 3WLWC 1T1WA 5FHBH 2PTUA 1IEBB 5I16A 2LV4A 3B6SB 3EUUA 2IH1B 4G42A 3QRFM 2BX5A 2YPLD 4ISVA 2OCFD 4NGHH 3GBNH 5C0IA 1LE9A 1Q9LB 1HILA 4JN1H 5FEBA 3U6RB 3OL2A 5A2FA 1IGYB 1CE1L 2VKXA 1A1NA 3QEGL 4AMKH 5IB1A 1QTYT 4LKXB 5I1GH 2CUHA 1JBJA 2EEDA 2IEPA 1QBLH 4JZJA 1KYOJ 1MCKA 1EJ6A 3WNMA 3QDGE 4KI5C 4Z8FL 1C7TA 3MROA 4L8CB 1FL5A 4U1IB 1CFBA 5F7UA 3UDWA 5IG7A 5FDWB 4NQEA 2X44D 3SCMC 1SYSB 2EXWC 1QBMH 3Q3GB 4XPGH 3S5LB 3W11C 1JGDA 1T7YA 4V1DD 3VXSB 4Z7OF 1RFDL 4IRJC 2MKWA 3LS4L 3EO0B 1X7QB 3LEXB 3FHAA 3K3QA 1NAMA 3E6FB 1VFBB 3S6CA 2QQLL 1NMCC 1HWGB 4WV1A 2VDKL 1JGLL 1J1OH 4OZGE 1UB6B 5KSAD 3H8NA 3EYVA 4F9PC 1YYLH 1ZA3B 2R23B 4DVBB 3S35X 1MPAH 3BN9D 4ZS7H 2W59A 3MJ6A 2D4FA 5LWYH 3GHEH 1VGEL 4OGXH 1EEZB 3PWUA 4OFYD 3OSKA 2EH8H 5CD3A 3BDYL 2DQEH 3C60A 4OTXH 3H9ZA 4R8WL 2WWMC 4NT6A 3VFMB 2IPTH 3U1SH 4LLQB 4FQLH 1J0IA 4XP1L 4EI5A 3BJ91 2JJTC 4FG6C 3AM8A 3WO4C 3PWJA 2I9LB 3EYSH 3JZ7A 5D7LE 5DJYB 1IGCL 5GHWL 5JR1L 1MWAH 4HS3B 4X5WA 2PXYD 4OF0A 3L3JB 1EZVX 2CKBL 4W6WB 4BSJA 2JCCB 3SE9L 4KK8C 2EEBA 5DQDH 4JM2D 3GIVB 4JFFE 3EFDH 1KB5H 3CZFA 4LHUD 2B0SH 4PJ9A 1YMHB 1IEAA 4FHBD 3MOAH 2VDRL 3Q2CA 5C70A 1CFSA 5F7KC 1IT9L 3RVWD 1BGXL 3IYLW 3HUJE 1Y18A 3NN8B 5J0BA 2VLJB 1CGSL 3TBVB 3TFKC 2DQIL 1CDIA 2BFVH 3BPNC 3N50A 3MLZH 3SKNA 5EU6A 4IJ3C 3IFLH 3MBEB 5J89A 4R7NB 3DO7A 1F97A 3KR3H 4LNRA 5D7LD 4GLRH 4B5EA 1KCLA 1P1ZA 3X13B 1XGRA 3P0YL 2QHRH 2R69H 3QIUC 3RWCB 1INEL 1DBKL 3STBA 3BKML 4NBXB 1J7VR 2PTTA 2W0FB 4JFFD 3V52H 1I1AC 4Y7MA 4OD3L 2AK1H 5T33H 3OZ9L 1PX4A 2J8UB 2OBGA 2EZ0C 3MUZ1 2AXGB 5L6YH 3WFHB 2A6KB 1K5NB 4CDHA 2B5IB 3GMQB 2NY0C 1LEKB 5GGSA 5IIEB 1FDLH 4M8QA 1BD2A 2DQGH 4PIRF 4C57C 3N1PC 4R4NC 5E9DB 3O2WL 5EZLB 3VGAB 3U7AA 1QRNE 2I24N 2VISB 3MFFB 3KWWB 1S5IH 3FO1A 5FKPA 2W65B 3GSOB 4GAGL 5EULV 5I2IA 3MLTB 4QHUA 4UDTB 3KYKL 3C9NA 1VEOA 1MQKL 1D9KC 4NO0D 3F5WA 1CXLA 4MS8D 1I85A 2P49B 4E0RB 4HJJH 2GTWB 1CE6A 3B5GA 1LE5B 3ZTNH 3IETB 4IRZL 1ORSB 2ZZUT 3JTTB 1EFXA 3BAEH 1ORQA 5ALBH 1WFNA 3N1QC 3OB0H 4CBPA 1W0YT 3L3IA 5HGHB 1QRND 3WLBA 3ARDC 5T1DL 3IKCA 4MD0B 5IP4A 4O5LL 5GGTA 1KACB 2DICA 4I2XE 4KVNL 4Z9KB 5SWSD 3UBXI 1ZHKB 1JZ7A 2EE2A 4YC2C 4RGOH 5GSRA 2YBRB 3MLXL 1HHJA 5DJ0A 3NTCH 4GRWF 4RMSA 1KFAH 1V7ML 4ELMB 1MCQA 3I6GA 5EZIL 1M7IB 4Z77A 5DJDB 5HGBB 2CRMA 2EH7H 3RU8H 1JFQH 3PL6D 3QUXA 3VA6A 1AD0A 1MY5A 1ZHLA 3DX7A 1KPRB 1S7VB 5DD3H 1IC4L 1FL6B 4GKZA 1KSRA 3H9YA 2CKBB 5AZEH 5KVGH 1U91A 4CVXA 2NXZD 1GZQB 1OAUH 2LTQC 1OPGL 4AEEA 1VERA 1HE7A 5I1EL 4GXUM 2DTML 2H3NB 4DZBB 4OZFG 2VB5A 1BFTA 1P4IL 3WD5H 2B8OT 3L6FB 1RMFH 3MXWL 4HDIB 1YEIL 1FO0B 4LSPH 3Q5YA 4HKZB 4L8DA 1U3HB 1ZT7B 2VH5L 3WHE1 5ICYB 1ZLSH 2AV1A 1F5WA 3Q6FB 1JTTA 2D7PA 3OKYA 1ZS8B 4LPVA 3EKCA 3BKCL 3JV5A 5FGBC 1FVEB 2DL2A 5DK0B 1H15A 2DQDH 2Z91B 4OQ1A 3ZYZA 4NQCB 2R9HC 1E4XH 4TTDC 4M1DH 2FHFA 1FG9C 3HS0B 1NKRA 1ZA6B 2VSDA 2ZKHH 1JYNA 1G7LB 4DTGL 4DAGH 5CSBA 2RCSL 2AS5M 1YQ2A 2HFFB 3VE0A 1CK0L 3EAKA 3T3PF 1T7ZA 1JGEA 3LEYL 3W9EA 2NY2C 5E6ZA 4NYLA 2FGWL 4YDVA 4CMHB 2Z92B 4EDWL 4O58H 1AGBB 3FB8A 3IFOB 5E8PA 4CMMA 2EE9A 4R2GC 4JGJA 4I8DA 4OBSA 3T65B 5J57B 2J5LC 4M7KL 3MYJB 4CN6A 1YEFL 5IW3A 3KPRB 4CU7A 4GSDL 4ZFOB 3F12A 5L2KA 3EJZC 2WZPD 4HV8B 4QRRA 3V6FB 2Y07H 3SBWA 3WFEL 2XZAL 3MYZA 1SJEA 1MVUA 4KJYA 3B3IB 2VQ1B 3FQTA 4NWUL 2AJSH 5JQ6H 1SJHB 3N1FC 3EYUL 1KIRB 3FOLA 3QUKB 4YHNA 1U93A 3HI1B 1N59A 1KCUL 4GKNA 4Y5VC 3VMNA 4XMPH 3NZHH 3HG1A 4FTVE 1BQHG 5FF6A 3SKJL 1T03H 3VWKA 3M1BB 4S1SH 1I8LC 3TO4A 3L1OL 1R3HB 2E7HA 1PEWA 2R0KL 4L3EE 3X12B 5IB3A 5C0BA 1T5WA 2IANA 5LBSL 2MCG1 3MV7A 3TC9A 5MHSE 5LJYH 1K8DA 3D85B 1YMME 4WTWA 1JMXA 5D1ZC 3EO1B 4PREA 1OQOA 4K9EC 5D8JL 2Z9TA 5CEZL 3WHXB 2GTZB 3DX9B 3ZKMC 5FA4B 4OM1H 3TN0A 3L95A 1QUNA 4AY0A 5FO7B 1BIIB 1A7NH 4UNTA 3IU3B 2OTWB 4LOUD 2BNQB 2P8MB 4FTVD 5BRZE 1MHCB 4HFWB 1NANH 2XYCA 1YECL 3GMOB 3MCKB 5HI3D 3VFWA 5BMFH 3K8LA 3NIGE 5LCVH 4MVBD 5MENB 4WUUB 1YMMD 5GXBB 2ATPB 1JV5B 1UEMA 3HMWH 4JE4B 3SDDA 4DGIL 2Q76B 2X4OA 3GGWA 1MAML 3ISWA 3C5ZB 4YGVA 3QDMB 1CFQA 3OKLB 5TE4L 5B38G 1CBVL 1V05A 2BY3A 4P2CG 1CR9H 1EGJL 1OM3L 4N9GB 5E6IC 1CFTA 2IFFL 5BRZD 4HLJA 1HH9B 1KLUB 4GXVH 3WFBL 3O9WB 1YEEL 4O02H 5GS0C 5FYKU 1VGKA 3PHQA 5FOJA 1M05A 4N68A 3TNMB 2IMMA 3IJYA 1T0PB 4D9QD 3RY5A 3HNTH 5DJAA 5I17A 3QIBB 1MCEA 3VFSB 4X9IA 1CLCA 5L8KB 4P0DA 6FABH 1C16A 3OAYK 2HVKA 3P40A 3MNZA 1KT2B 4XMKH 5DDHA 4AM0B 4PGCB 5E2WL 3SN6N 3HAEA 3IDMB 5D4QA 5I0DA 1LEIB 4C56D 3HE7A 5I8KL 1S7SA 5DUMH 3WYRA 4KZDL 3RL1A 5ICXB 1KYOK 1QA9B 3OPZL 3DYMA 4ZODA 5DRZB 3QXUA 5CJ8A 4D3CH 2PW2B 3DUHA 3LS5L 1IAOA 4PUBL 3NCYS 3U9PH 3QDJE 3MGTA 3DGGA 4P46B 5GGRA 3JUZA 1T6WA 4MDIB 5DVKA 5DZNA 5GZOD 3SHSA 5HGGS 2G60H 3ELAT 1EVTC 2C4FU 1GHFL 4GQPH 2DMBA 4X99B 1FZKA 1F6FB 1BVLA 3GO1L 3TPKA 3BGMB 5I1HL 4RGMC 3V5HA 3IU4H 2VDOH 5CLTA 4ZPVA 4X6DE 1A6VL 2FX8L 2ZCKL 1AP2B 4X4YB 4KAQL 2HT2C 4HIXH 4WI7A 5EA0L 4EUPG 5DMKB 1C1EL 5HI4C 3PP3H 3QPQC 1Y6MR 1FVCB 2BY2A 4JVWA 3UC0L 2VIRB 4ORGB 4LLAA 3QDJD 3NACL 2CLVA 4I13B 1F3JA 2AJ3A 3U30B 4Z7UE 4UDUA 4ZUWA 3EYOB 2FEDD 4L3AA 3FQUB 5C0FB 1MLBB 3B5TA 1CDHA 1QBAA 5J56B 4MJ5B 4APQB 1CG9B 2E7BA 3VXMB 3MREA 1A9EB 5A40E 3ZO0A 2OK0H 3UPRA 1S7UA 5D96C 1SM3L 3LH2H 3NFSL 4LPTA 2ZJSH 3PWVA 1JHLH 3DRQB