4WFN1

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22 in complex with erythromycin
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
53
structure length
53
Chain Sequence
b'AKDGPRIIVKMESSAGTGFYYTTTKNRRNTQAKLELKKYDPVAKKHVVFREKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
total genus 2
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00471 Ribosomal_L33 Ribosomal protein L33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.120 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4wfn100
5DM61 4V196 3J7Z1 5JVG1 5MLC3 5GAEc 5DM71 3PIO1 3PIP1 5GADc 5GAHc 4U671 3J7Y1 5JVH1 5GAGc 5H1Sc 4WFN1 4UY81
chains in the Genus database with same CATH superfamily
3HAXC 2WB1P 1DX8A 2KKDA 3M4OL 4AI0A 1TWCL 8RXNA 4A3KL 1QCVA 3S17L 1WJVA 4AR6A 3QQCE 3S1ML 1T9PA 3PWFA 1IU5A 3HOWL 3H0GL 4JAGA 4A3JL 1BFYA 1NXGA 1K83L 1S24A 1CADA 2GMGA 7RXNA 2R93L 2XJRA 1YV1A 4Y7NL 2J9UB 1YUZA 5GAHc 4BBRL 6RXNA 4LHNA 1I3QL 1VZHA 4XGHA 2ERJA 1SFOL 2VUML 3PO2L 2M6OA 1R0FA 1BQ8A 5FLML 4C2M1 4A3BL 2RDVA 5H1Sc 4E6YA 2E2HL 3I4ML 3A44A 2ZIXA 4A93L 3HOUL 1VCXA 5EINC 1F4LA 1IW7D 2NVXL 3PIO1 4POFA 3HOVL 2AUSB 3SS2A 4BY7L 1YUXA 4AR5A 4A3ML 2ERSA 1ODHA 3B08B 1DVBA 5EIOC 2JA8L 1BE7A 3PKJA 4TPUA 2BE5D 1YK4A 1B13A 3GTJL 1TWHL 4AR4A 5M3FL 1T9OA 2NVYL 1R0HA 3RZOL 3H99A 1Y1WL 3LWQB 3GTGL 2V3BB 4AR3A 3QVDA 2A68D 3S2DL 4B8CD 3S1QL 1BQ9A 1PFVA 3LNLA 5K2ME 3KYWA 5GAGc 5C3EL 4A3FL 3M3YL 2EY4E 3GTQL 1B2JA 3HJYB 1TWFL 2XJVA 3NFPI 3H9CA 1JYBA 3FDJA 3LWOB 2A6ED 5M5WL 2JI2A 2V0EA 2YU9L 3RYGA 4UY81 3HOYL 4V196 1RWDA 1RB9A 2XJTA 1H7VA 2CKCA 2WAQP 4C3HL 4AHYA 5IP7L 2JA6L 3LWPB 4AI1A 4A3IL 1PZXA 2V0FA 4LHLA 2PVXA 4JADA 2JI3A 4JAEA 2PYAA 3H9BA 2XJPA 5MLC3 3KYUA 1R9TL 3LWVB 2B5ID 5GAEc 5C44L 4U671 1LTLA 3PKIA 4A3CL 4ZN3B 3RZDL 1BRFA 1I6HL 4A3LL 4BXXL 2PSMC 3KYXA 1ZRPA 5RXNA 3RZ6A 3HKZP 1PFWA 3P8BA 1WCML 2XJSA 3HOXL 3PL5A 2M6PA 4BBSL 2K2DA 1PFUA 2XJUA 3GTKL 4AHWA 5M3ML 3S1NL 3IU3I 4YWMA 2JA5L 2A6HD 4AHZA 4X6AL 2C6BA 2R92L 4GS7D 2XJQA 1RDVA 3H97A 5DM71 1Z92B 2NYDA 1QQTA 2CR8A 3MQKB 4RXNA 5C4XL 4ZN1B 2KN9A 1P7PA 1VZIA 5M5YL 1RYQA 3KYYA 3P2AA 4AI3A 5IP9L 5AI3A 4AYBP 5DM61 3H3VM 1OWCA 1VZGA 4C3JL 1Y1VL 3S15L 3GTML 3B0AB 1RYTA 1I50L 3GTLL 5AI2A 3RZTA 3PIP1 1OWBA 3MSUA 5MFPA 1FHMA 3S2HL 4A3GL 3FKIL 5JVG1 4BY1L 1IRNA 2C6AA 2PPTA 3PZAA 2JI1A 5JVH1 2R7ZL 2MS3A 4TVMA 1TWAL 1NNQA 2HR5A 2O5JD 4G6BA 5MFZA 4JAFA 2E2IL 2NVQL 2Z3QB 4Y52L 1R0IA 1SMWA 1IU6A 4K9FA 3KYVA 1IROA 2A69D 3J7Z1 2L0ZA 5M5XL 1SMMA 1B71A 2AYJA 1RDGA 1QYBA 2PMZP 3HJWB 4AHXA 4YWLA 4WFN1 4XXBB 2JA7L 3MPSA 2VL6A 1R0JA 5FJ8L 3HOZL 2Y0SP 2APOB 2DSXA 4C3IL 1S30A 1B2OA 3LWRB 2Z3RB 1S2ZA 2H12A 1LKOA 2CKAA 1LKMA 4QIWP 4POGA 2HVYC 2M4YA 5IYBL 4ME3A 1FHHA 2RFKB 3LPEB 2PVEA 1YK5A 5C4JL 3CQZL 1T9QA 3GTPL 3K35A 3I4NL 1SMUA 2M4VA 5IYCL 3S14L 5AN9H 5GADc 5MGNA 4AI2A 2QL0A 3S16L 5IYDL 5MF6A 3JR7A 1CAAA 2B63L 2LCQA 3ZG6A 3PO3L 1PFYA 1C09A 3VPBE 1LKPA 3J7Y1 3K7AL 4A3DL 2E2JL 1NXEA 3S1RL 3GTOL 3WWLA 1E8JA 4A3EL 1TWGL 2AQCA 2NVTL 1R0GA 3WWNB 5IY0A
chains in the Genus database with same CATH topology
2A69D 3J7Z1 3PIP1 2L0ZA 1DX8A 2KKDA 4AI0A 1SMMA 4AHWA 8RXNA 1B71A 2V3BB 3IU3I 4YWMA 4AR3A 3QVDA 2A68D 1QCVA 2A6HD 4AHZA 1WJVA 2C6BA 4AR6A 2AYJA 3QQCE 4B8CD 4GS7D 2XJQA 1BQ9A 1RDGA 1RDVA 1T9PA 1Z92B 1QYBA 3LNLA 3PWFA 5K2ME 5DM71 2NYDA 1IU5A 4AHXA 4YWLA 3KYWA 5GAGc 4WFN1 4JAGA 4XXBB 1BFYA 1NXGA 1B2JA 1CADA 1S24A 3MPSA 2GMGA 7RXNA 2VL6A 1R0JA 2CR8A 2XJRA 1YV1A 2XJVA 4RXNA 3NFPI 1JYBA 4ZN1B 2KN9A 2DSXA 2A6ED 2J9UB 1YUZA 1S30A 1B2OA 1VZIA 2JI2A 5GAHc 1RYQA 2Z3RB 3KYYA 2V0EA 6RXNA 4LHNA 3P2AA 1VZHA 4XGHA 4AI3A 3RYGA 4UY81 1S2ZA 4V196 2ERJA 1RWDA 1RB9A 2H12A 2XJTA 1LKOA 2CKAA 1H7VA 1LKMA 2CKCA 2M6OA 5AI3A 5DM61 1OWCA 4POGA 1VZGA 2M4YA 1R0FA 4ME3A 1BQ8A 1FHHA 4AHYA 3LPEB 2PVEA 1YK5A 4AI1A 3B0AB 2RDVA 5H1Sc 1RYTA 1T9QA 5AI2A 2V0FA 4LHLA 4E6YA 3RZTA 1OWBA 2PVXA 3A44A 2ZIXA 3MSUA 4JADA 5MFPA 3K35A 2JI3A 1FHMA 1VCXA 4JAEA 1SMUA 2M4VA 2PYAA 2XJPA 5EINC 5JVG1 5MLC3 5AN9H 1IRNA 3KYUA 2C6AA 5GADc 5MGNA 4AI2A 1IW7D 2PPTA 2B5ID 2QL0A 3PZAA 2JI1A 5GAEc 5MF6A 3PIO1 4POFA 4U671 1LTLA 3SS2A 1CAAA 3PKIA 1YUXA 4ZN3B 4AR5A 2ERSA 2LCQA 5JVH1 3ZG6A 1ODHA 1BRFA 3B08B 1C09A 1DVBA 2PSMC 5EIOC 2MS3A 4TVMA 3VPBE 1LKPA 3J7Y1 1BE7A 1NNQA 2HR5A 3PKJA 4TPUA 2BE5D 3KYXA 2O5JD 1YK4A 1ZRPA 4G6BA 5MFZA 5RXNA 1B13A 3RZ6A 1NXEA 4JAFA 3P8BA 2XJSA 4AR4A 2Z3QB 1T9OA 2M6PA 2K2DA 1SMWA 2XJUA 1R0IA 3WWLA 1E8JA 1IU6A 4K9FA 1R0HA 1R0GA 3KYVA 3WWNB 5IY0A 1IROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM6 1;  4V19 6;  3J7Z 1;  5JVG 1;  5MLC 3;  5GAE c;  5DM7 1;  3PIO 1;  3PIP 1;  5GAD c;  5GAH c;  4U67 1;  3J7Y 1;  5JVH 1;  5GAG c;  5H1S c;  4WFN 1;  4UY8 1; 
#chains in the Genus database with same CATH topology
 3HAX C;  2WB1 P;  1DX8 A;  2KKD A;  3M4O L;  4AI0 A;  1TWC L;  8RXN A;  4A3K L;  1QCV A;  3S17 L;  1WJV A;  4AR6 A;  3QQC E;  3S1M L;  1T9P A;  3PWF A;  1IU5 A;  3HOW L;  3H0G L;  4JAG A;  4A3J L;  1BFY A;  1NXG A;  1K83 L;  1S24 A;  1CAD A;  2GMG A;  7RXN A;  2R93 L;  2XJR A;  1YV1 A;  4Y7N L;  2J9U B;  1YUZ A;  5GAH c;  4BBR L;  6RXN A;  4LHN A;  1I3Q L;  1VZH A;  4XGH A;  2ERJ A;  1SFO L;  2VUM L;  3PO2 L;  2M6O A;  1R0F A;  1BQ8 A;  5FLM L;  4C2M 1;  4A3B L;  2RDV A;  5H1S c;  4E6Y A;  2E2H L;  3I4M L;  3A44 A;  2ZIX A;  4A93 L;  3HOU L;  1VCX A;  5EIN C;  1F4L A;  1IW7 D;  2NVX L;  3PIO 1;  4POF A;  3HOV L;  2AUS B;  3SS2 A;  4BY7 L;  1YUX A;  4AR5 A;  4A3M L;  2ERS A;  1ODH A;  3B08 B;  1DVB A;  5EIO C;  2JA8 L;  1BE7 A;  3PKJ A;  4TPU A;  2BE5 D;  1YK4 A;  1B13 A;  3GTJ L;  1TWH L;  4AR4 A;  5M3F L;  1T9O A;  2NVY L;  1R0H A;  3RZO L;  3H99 A;  1Y1W L;  3LWQ B;  3GTG L;  2V3B B;  4AR3 A;  3QVD A;  2A68 D;  3S2D L;  4B8C D;  3S1Q L;  1BQ9 A;  1PFV A;  3LNL A;  5K2M E;  3KYW A;  5GAG c;  5C3E L;  4A3F L;  3M3Y L;  2EY4 E;  3GTQ L;  1B2J A;  3HJY B;  1TWF L;  2XJV A;  3NFP I;  3H9C A;  1JYB A;  3FDJ A;  3LWO B;  2A6E D;  5M5W L;  2JI2 A;  2V0E A;  2YU9 L;  3RYG A;  4UY8 1;  3HOY L;  4V19 6;  1RWD A;  1RB9 A;  2XJT A;  1H7V A;  2CKC A;  2WAQ P;  4C3H L;  4AHY A;  5IP7 L;  2JA6 L;  3LWP B;  4AI1 A;  4A3I L;  1PZX A;  2V0F A;  4LHL A;  2PVX A;  4JAD A;  2JI3 A;  4JAE A;  2PYA A;  3H9B A;  2XJP A;  5MLC 3;  3KYU A;  1R9T L;  3LWV B;  2B5I D;  5GAE c;  5C44 L;  4U67 1;  1LTL A;  3PKI A;  4A3C L;  4ZN3 B;  3RZD L;  1BRF A;  1I6H L;  4A3L L;  4BXX L;  2PSM C;  3KYX A;  1ZRP A;  5RXN A;  3RZ6 A;  3HKZ P;  1PFW A;  3P8B A;  1WCM L;  2XJS A;  3HOX L;  3PL5 A;  2M6P A;  4BBS L;  2K2D A;  1PFU A;  2XJU A;  3GTK L;  4AHW A;  5M3M L;  3S1N L;  3IU3 I;  4YWM A;  2JA5 L;  2A6H D;  4AHZ A;  4X6A L;  2C6B A;  2R92 L;  4GS7 D;  2XJQ A;  1RDV A;  3H97 A;  5DM7 1;  1Z92 B;  2NYD A;  1QQT A;  2CR8 A;  3MQK B;  4RXN A;  5C4X L;  4ZN1 B;  2KN9 A;  1P7P A;  1VZI A;  5M5Y L;  1RYQ A;  3KYY A;  3P2A A;  4AI3 A;  5IP9 L;  5AI3 A;  4AYB P;  5DM6 1;  3H3V M;  1OWC A;  1VZG A;  4C3J L;  1Y1V L;  3S15 L;  3GTM L;  3B0A B;  1RYT A;  1I50 L;  3GTL L;  5AI2 A;  3RZT A;  3PIP 1;  1OWB A;  3MSU A;  5MFP A;  1FHM A;  3S2H L;  4A3G L;  3FKI L;  5JVG 1;  4BY1 L;  1IRN A;  2C6A A;  2PPT A;  3PZA A;  2JI1 A;  5JVH 1;  2R7Z L;  2MS3 A;  4TVM A;  1TWA L;  1NNQ A;  2HR5 A;  2O5J D;  4G6B A;  5MFZ A;  4JAF A;  2E2I L;  2NVQ L;  2Z3Q B;  4Y52 L;  1R0I A;  1SMW A;  1IU6 A;  4K9F A;  3KYV A;  1IRO A;  2A69 D;  3J7Z 1;  2L0Z A;  5M5X L;  1SMM A;  1B71 A;  2AYJ A;  1RDG A;  1QYB A;  2PMZ P;  3HJW B;  4AHX A;  4YWL A;  4WFN 1;  4XXB B;  2JA7 L;  3MPS A;  2VL6 A;  1R0J A;  5FJ8 L;  3HOZ L;  2Y0S P;  2APO B;  2DSX A;  4C3I L;  1S30 A;  1B2O A;  3LWR B;  2Z3R B;  1S2Z A;  2H12 A;  1LKO A;  2CKA A;  1LKM A;  4QIW P;  4POG A;  2HVY C;  2M4Y A;  5IYB L;  4ME3 A;  1FHH A;  2RFK B;  3LPE B;  2PVE A;  1YK5 A;  5C4J L;  3CQZ L;  1T9Q A;  3GTP L;  3K35 A;  3I4N L;  1SMU A;  2M4V A;  5IYC L;  3S14 L;  5AN9 H;  5GAD c;  5MGN A;  4AI2 A;  2QL0 A;  3S16 L;  5IYD L;  5MF6 A;  3JR7 A;  1CAA A;  2B63 L;  2LCQ A;  3ZG6 A;  3PO3 L;  1PFY A;  1C09 A;  3VPB E;  1LKP A;  3J7Y 1;  3K7A L;  4A3D L;  2E2J L;  1NXE A;  3S1R L;  3GTO L;  3WWL A;  1E8J A;  4A3E L;  1TWG L;  2AQC A;  2NVT L;  1R0G A;  3WWN B;  5IY0 A; 
#chains in the Genus database with same CATH homology
 2A69 D;  3J7Z 1;  3PIP 1;  2L0Z A;  1DX8 A;  2KKD A;  4AI0 A;  1SMM A;  4AHW A;  8RXN A;  1B71 A;  2V3B B;  3IU3 I;  4YWM A;  4AR3 A;  3QVD A;  2A68 D;  1QCV A;  2A6H D;  4AHZ A;  1WJV A;  2C6B A;  4AR6 A;  2AYJ A;  3QQC E;  4B8C D;  4GS7 D;  2XJQ A;  1BQ9 A;  1RDG A;  1RDV A;  1T9P A;  1Z92 B;  1QYB A;  3LNL A;  3PWF A;  5K2M E;  5DM7 1;  2NYD A;  1IU5 A;  4AHX A;  4YWL A;  3KYW A;  5GAG c;  4WFN 1;  4JAG A;  4XXB B;  1BFY A;  1NXG A;  1B2J A;  1CAD A;  1S24 A;  3MPS A;  2GMG A;  7RXN A;  2VL6 A;  1R0J A;  2CR8 A;  2XJR A;  1YV1 A;  2XJV A;  4RXN A;  3NFP I;  1JYB A;  4ZN1 B;  2KN9 A;  2DSX A;  2A6E D;  2J9U B;  1YUZ A;  1S30 A;  1B2O A;  1VZI A;  2JI2 A;  5GAH c;  1RYQ A;  2Z3R B;  3KYY A;  2V0E A;  6RXN A;  4LHN A;  3P2A A;  1VZH A;  4XGH A;  4AI3 A;  3RYG A;  4UY8 1;  1S2Z A;  4V19 6;  2ERJ A;  1RWD A;  1RB9 A;  2H12 A;  2XJT A;  1LKO A;  2CKA A;  1H7V A;  1LKM A;  2CKC A;  2M6O A;  5AI3 A;  5DM6 1;  1OWC A;  4POG A;  1VZG A;  2M4Y A;  1R0F A;  4ME3 A;  1BQ8 A;  1FHH A;  4AHY A;  3LPE B;  2PVE A;  1YK5 A;  4AI1 A;  3B0A B;  2RDV A;  5H1S c;  1RYT A;  1T9Q A;  5AI2 A;  2V0F A;  4LHL A;  4E6Y A;  3RZT A;  1OWB A;  2PVX A;  3A44 A;  2ZIX A;  3MSU A;  4JAD A;  5MFP A;  3K35 A;  2JI3 A;  1FHM A;  1VCX A;  4JAE A;  1SMU A;  2M4V A;  2PYA A;  2XJP A;  5EIN C;  5JVG 1;  5MLC 3;  5AN9 H;  1IRN A;  3KYU A;  2C6A A;  5GAD c;  5MGN A;  4AI2 A;  1IW7 D;  2PPT A;  2B5I D;  2QL0 A;  3PZA A;  2JI1 A;  5GAE c;  5MF6 A;  3PIO 1;  4POF A;  4U67 1;  1LTL A;  3SS2 A;  1CAA A;  3PKI A;  1YUX A;  4ZN3 B;  4AR5 A;  2ERS A;  2LCQ A;  5JVH 1;  3ZG6 A;  1ODH A;  1BRF A;  3B08 B;  1C09 A;  1DVB A;  2PSM C;  5EIO C;  2MS3 A;  4TVM A;  3VPB E;  1LKP A;  3J7Y 1;  1BE7 A;  1NNQ A;  2HR5 A;  3PKJ A;  4TPU A;  2BE5 D;  3KYX A;  2O5J D;  1YK4 A;  1ZRP A;  4G6B A;  5MFZ A;  5RXN A;  1B13 A;  3RZ6 A;  1NXE A;  4JAF A;  3P8B A;  2XJS A;  4AR4 A;  2Z3Q B;  1T9O A;  2M6P A;  2K2D A;  1SMW A;  2XJU A;  1R0I A;  3WWL A;  1E8J A;  1IU6 A;  4K9F A;  1R0H A;  1R0G A;  3KYV A;  3WWN B;  5IY0 A;  1IRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...