4WFN1

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22 in complex with erythromycin
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
53
structure length
53
Chain Sequence
AKDGPRIIVKMESSAGTGFYYTTTKNRRNTQAKLELKKYDPVAKKHVVFREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
total genus 2
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00471 Ribosomal_L33 Ribosomal protein L33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.120 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4wfn100
4U671 5JVH1 4UY81 4V196 3PIO1 5GAHc 5JVG1 5GADc 4WFN1 5DM61 5DM71 5H1Sc 5GAEc 3J7Y1 3J7Z1 5GAGc 3PIP1 5MLC3
chains in the Genus database with same CATH superfamily
1SMWA 1NXGA 1I3QL 5M3ML 3H0GL 3NFPI 1YUZA 2XJUA 2K2DA 3LNLA 1VCXA 3CQZL 2WB1P 3I4ML 2APOB 3GTLL 1SMUA 3ZG6A 4QIWP 1FHMA 4AR5A 3GTJL 5FLML 1NXEA 4AI2A 1C09A 5EIOC 3S1ML 1OWBA 4TVMA 3JR7A 3PKJA 1RDVA 6RXNA 3H3VM 1RYQA 4AI3A 2A6HD 2AUSB 1JYBA 4JAGA 3HOWL 2ERJA 5JVH1 2JA7L 1VZHA 1E8JA 1TWCL 5MLC3 3LWQB 5IYBL 2LCQA 1B2JA 4YWMA 2A6ED 8RXNA 4A3ML 4POFA 1PFVA 1NNQA 3H99A 2Y0SP 2B63L 1TWHL 3KYVA 2E2HL 1RWDA 3MPSA 4WFN1 5DM71 3RZDL 2PPTA 1IU6A 1DX8A 7RXNA 1S30A 1TWGL 4AR6A 1T9OA 3IU3I 3LWRB 2V0EA 1BQ9A 1Y1WL 3PO2L 3KYWA 4K9FA 5GAGc 4Y52L 4JAEA 4U671 4A3JL 4A3BL 4A3LL 3PKIA 2NVQL 5RXNA 1TWAL 3HOXL 2A69D 1B2OA 2V3BB 1I6HL 1IW7D 3SS2A 5C4XL 4X6AL 5M5XL 2XJVA 3K35A 5MFPA 1B13A 1VZIA 5M5WL 5IYCL 1YUXA 3GTGL 4AR3A 4B8CD 1DVBA 2JA5L 2PMZP 1LKOA 4GS7D 4BY7L 1R0IA 3PIO1 1SFOL 2DSXA 2PYAA 2V0FA 2R7ZL 3S16L 1B71A 3J7Y1 3KYXA 5IYDL 4UY81 2R93L 1ODHA 2XJSA 5EINC 5IY0A 3P8BA 5GADc 5IP7L 2KN9A 3S2HL 4A3GL 4AHYA 1Z92B 1RYTA 5M5YL 4JADA 4A3KL 3B08B 4ZN1B 2JA6L 1PZXA 1TWFL 2KKDA 2C6AA 4V196 1PFYA 5C44L 2E2JL 2ZIXA 3GTML 2J9UB 1QCVA 3QQCE 4AHXA 1SMMA 3LWPB 4RXNA 3QVDA 2JI3A 2CR8A 4AYBP 3LWOB 1IROA 1K83L 4C3JL 4BY1L 3HJYB 1LKMA 5H1Sc 3S1RL 4A3FL 1QYBA 2RFKB 4C3IL 2XJQA 4LHLA 4A3DL 3FKIL 2PVEA 2A68D 1LKPA 5AI3A 1LTLA 3HOVL 3H9BA 1S2ZA 2HR5A 1R9TL 3RZOL 2MS3A 3GTOL 1R0HA 5M3FL 2Z3QB 5IP9L 2AYJA 4Y7NL 2PSMC 2PVXA 1Y1VL 1RB9A 5MF6A 4E6YA 3HAXC 2B5ID 4A3EL 1H7VA 4YWLA 5DM61 3HOYL 3S14L 3WWNB 1YK5A 4TPUA 4AHZA 3HJWB 3H97A 3KYYA 1BQ8A 4BBRL 2XJTA 2QL0A 3GTQL 1CAAA 2E2IL 3S1QL 1PFUA 1ZRPA 2O5JD 3S2DL 2JI2A 3GTKL 4POGA 2Z3RB 1YV1A 4AI1A 3P2AA 5C4JL 2GMGA 3PL5A 2C6BA 1QQTA 3WWLA 2WAQP 2NVXL 1P7PA 1IRNA 3PO3L 2ERSA 2AQCA 3PZAA 3HKZP 1IU5A 4XXBB 4AI0A 2JA8L 2YU9L 5GAHc 2NVTL 3B0AB 4C2M1 3H9CA 2NYDA 3MSUA 2VUML 1PFWA 2M6OA 3KYUA 4LHNA 3HOUL 4AHWA 1R0FA 3GTPL 3A44A 3RZ6A 4BBSL 1WJVA 4AR4A 2BE5D 4G6BA 5AN9H 1FHHA 3PWFA 1YK4A 4C3HL 2L0ZA 2JI1A 1VZGA 3LPEB 3J7Z1 4A93L 5K2ME 2VL6A 3LWVB 5MFZA 5AI2A 1T9PA 3PIP1 1RDGA 1F4LA 2M4VA 3S17L 1BE7A 4A3CL 3S1NL 2CKCA 4ME3A 2H12A 1R0GA 1R0JA 5JVG1 1OWCA 1WCML 4BXXL 5GAEc 2XJRA 1S24A 3HOZL 1BFYA 2XJPA 1BRFA 5FJ8L 2M6PA 3MQKB 1I50L 5C3EL 3I4NL 4XGHA 5MGNA 2EY4E 4ZN3B 3M4OL 3FDJA 3K7AL 4JAFA 3RYGA 2RDVA 3RZTA 2NVYL 1CADA 2M4YA 4A3IL 3S15L 3VPBE 2CKAA 2R92L 1T9QA 2HVYC 3M3YL
chains in the Genus database with same CATH topology
1SMWA 2J9UB 3PKIA 4XXBB 1QCVA 1NXGA 3QQCE 4AI0A 5GAHc 5RXNA 3NFPI 4AHXA 1YUZA 3B0AB 2XJUA 1SMMA 2A69D 4RXNA 2NYDA 3MSUA 3QVDA 2K2DA 3LNLA 1B2OA 2CR8A 2JI3A 2V3BB 2M6OA 1IROA 3KYUA 4LHNA 1VCXA 1LKMA 1IW7D 3SS2A 5H1Sc 2XJVA 4AHWA 3K35A 1R0FA 5MFPA 1B13A 1QYBA 1VZIA 3A44A 1YUXA 3RZ6A 1SMUA 1WJVA 2XJQA 4AR3A 4LHLA 3ZG6A 4AR4A 4B8CD 1DVBA 2BE5D 4G6BA 1FHMA 1LKOA 5AN9H 4AR5A 4GS7D 2PVEA 1FHHA 1R0IA 3PWFA 3PIO1 1YK4A 2A68D 1LKPA 1NXEA 2DSXA 2L0ZA 4AI2A 1C09A 5AI3A 2JI1A 2PYAA 5EIOC 1LTLA 1VZGA 2V0FA 1OWBA 3LPEB 4TVMA 1S2ZA 3J7Z1 2HR5A 3PKJA 5K2ME 1RDVA 2VL6A 6RXNA 2MS3A 5MFZA 5AI2A 1B71A 1T9PA 3J7Y1 1R0HA 1RYQA 3PIP1 3KYXA 1RDGA 2M4VA 4AI3A 1BE7A 2A6HD 4UY81 2CKCA 2Z3QB 1JYBA 1ODHA 4JAGA 2XJSA 5EINC 4ME3A 2AYJA 2ERJA 5IY0A 5JVH1 2H12A 1R0GA 2PSMC 1R0JA 3P8BA 5JVG1 1OWCA 5GADc 2KN9A 2PVXA 5GAEc 2XJRA 1VZHA 1E8JA 1RB9A 5MF6A 1S24A 4E6YA 5MLC3 1BFYA 2XJPA 1B2JA 1BRFA 2B5ID 2LCQA 4YWMA 1H7VA 4YWLA 5DM61 2A6ED 3WWNB 8RXNA 1YK5A 2M6PA 4TPUA 4AHYA 4AHZA 4POFA 4XGHA 1NNQA 5MGNA 3KYYA 1BQ8A 1Z92B 3KYVA 1RYTA 4JADA 4ZN3B 2XJTA 2QL0A 1CAAA 1ZRPA 2O5JD 1RWDA 3MPSA 4WFN1 5DM71 3B08B 4ZN1B 2JI2A 4JAFA 3RYGA 2PPTA 1IU6A 7RXNA 4POGA 2RDVA 3RZTA 1S30A 2KKDA 2Z3RB 4AR6A 1T9OA 2C6AA 3IU3I 1YV1A 2V0EA 1BQ9A 4AI1A 3P2AA 4V196 2GMGA 1CADA 2C6BA 2M4YA 3KYWA 3WWLA 4K9FA 5GAGc 4JAEA 4U671 3VPBE 2CKAA 2ZIXA 1IRNA 1T9QA 2ERSA 3PZAA 1DX8A 1IU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U67 1;  5JVH 1;  4UY8 1;  4V19 6;  3PIO 1;  5GAH c;  5JVG 1;  5GAD c;  4WFN 1;  5DM6 1;  5DM7 1;  5H1S c;  5GAE c;  3J7Y 1;  3J7Z 1;  5GAG c;  3PIP 1;  5MLC 3; 
#chains in the Genus database with same CATH topology
 1SMW A;  1NXG A;  1I3Q L;  5M3M L;  3H0G L;  3NFP I;  1YUZ A;  2XJU A;  2K2D A;  3LNL A;  1VCX A;  3CQZ L;  2WB1 P;  3I4M L;  2APO B;  3GTL L;  1SMU A;  3ZG6 A;  4QIW P;  1FHM A;  4AR5 A;  3GTJ L;  5FLM L;  1NXE A;  4AI2 A;  1C09 A;  5EIO C;  3S1M L;  1OWB A;  4TVM A;  3JR7 A;  3PKJ A;  1RDV A;  6RXN A;  3H3V M;  1RYQ A;  4AI3 A;  2A6H D;  2AUS B;  1JYB A;  4JAG A;  3HOW L;  2ERJ A;  5JVH 1;  2JA7 L;  1VZH A;  1E8J A;  1TWC L;  5MLC 3;  3LWQ B;  5IYB L;  2LCQ A;  1B2J A;  4YWM A;  2A6E D;  8RXN A;  4A3M L;  4POF A;  1PFV A;  1NNQ A;  3H99 A;  2Y0S P;  2B63 L;  1TWH L;  3KYV A;  2E2H L;  1RWD A;  3MPS A;  4WFN 1;  5DM7 1;  3RZD L;  2PPT A;  1IU6 A;  1DX8 A;  7RXN A;  1S30 A;  1TWG L;  4AR6 A;  1T9O A;  3IU3 I;  3LWR B;  2V0E A;  1BQ9 A;  1Y1W L;  3PO2 L;  3KYW A;  4K9F A;  5GAG c;  4Y52 L;  4JAE A;  4U67 1;  4A3J L;  4A3B L;  4A3L L;  3PKI A;  2NVQ L;  5RXN A;  1TWA L;  3HOX L;  2A69 D;  1B2O A;  2V3B B;  1I6H L;  1IW7 D;  3SS2 A;  5C4X L;  4X6A L;  5M5X L;  2XJV A;  3K35 A;  5MFP A;  1B13 A;  1VZI A;  5M5W L;  5IYC L;  1YUX A;  3GTG L;  4AR3 A;  4B8C D;  1DVB A;  2JA5 L;  2PMZ P;  1LKO A;  4GS7 D;  4BY7 L;  1R0I A;  3PIO 1;  1SFO L;  2DSX A;  2PYA A;  2V0F A;  2R7Z L;  3S16 L;  1B71 A;  3J7Y 1;  3KYX A;  5IYD L;  4UY8 1;  2R93 L;  1ODH A;  2XJS A;  5EIN C;  5IY0 A;  3P8B A;  5GAD c;  5IP7 L;  2KN9 A;  3S2H L;  4A3G L;  4AHY A;  1Z92 B;  1RYT A;  5M5Y L;  4JAD A;  4A3K L;  3B08 B;  4ZN1 B;  2JA6 L;  1PZX A;  1TWF L;  2KKD A;  2C6A A;  4V19 6;  1PFY A;  5C44 L;  2E2J L;  2ZIX A;  3GTM L;  2J9U B;  1QCV A;  3QQC E;  4AHX A;  1SMM A;  3LWP B;  4RXN A;  3QVD A;  2JI3 A;  2CR8 A;  4AYB P;  3LWO B;  1IRO A;  1K83 L;  4C3J L;  4BY1 L;  3HJY B;  1LKM A;  5H1S c;  3S1R L;  4A3F L;  1QYB A;  2RFK B;  4C3I L;  2XJQ A;  4LHL A;  4A3D L;  3FKI L;  2PVE A;  2A68 D;  1LKP A;  5AI3 A;  1LTL A;  3HOV L;  3H9B A;  1S2Z A;  2HR5 A;  1R9T L;  3RZO L;  2MS3 A;  3GTO L;  1R0H A;  5M3F L;  2Z3Q B;  5IP9 L;  2AYJ A;  4Y7N L;  2PSM C;  2PVX A;  1Y1V L;  1RB9 A;  5MF6 A;  4E6Y A;  3HAX C;  2B5I D;  4A3E L;  1H7V A;  4YWL A;  5DM6 1;  3HOY L;  3S14 L;  3WWN B;  1YK5 A;  4TPU A;  4AHZ A;  3HJW B;  3H97 A;  3KYY A;  1BQ8 A;  4BBR L;  2XJT A;  2QL0 A;  3GTQ L;  1CAA A;  2E2I L;  3S1Q L;  1PFU A;  1ZRP A;  2O5J D;  3S2D L;  2JI2 A;  3GTK L;  4POG A;  2Z3R B;  1YV1 A;  4AI1 A;  3P2A A;  5C4J L;  2GMG A;  3PL5 A;  2C6B A;  1QQT A;  3WWL A;  2WAQ P;  2NVX L;  1P7P A;  1IRN A;  3PO3 L;  2ERS A;  2AQC A;  3PZA A;  3HKZ P;  1IU5 A;  4XXB B;  4AI0 A;  2JA8 L;  2YU9 L;  5GAH c;  2NVT L;  3B0A B;  4C2M 1;  3H9C A;  2NYD A;  3MSU A;  2VUM L;  1PFW A;  2M6O A;  3KYU A;  4LHN A;  3HOU L;  4AHW A;  1R0F A;  3GTP L;  3A44 A;  3RZ6 A;  4BBS L;  1WJV A;  4AR4 A;  2BE5 D;  4G6B A;  5AN9 H;  1FHH A;  3PWF A;  1YK4 A;  4C3H L;  2L0Z A;  2JI1 A;  1VZG A;  3LPE B;  3J7Z 1;  4A93 L;  5K2M E;  2VL6 A;  3LWV B;  5MFZ A;  5AI2 A;  1T9P A;  3PIP 1;  1RDG A;  1F4L A;  2M4V A;  3S17 L;  1BE7 A;  4A3C L;  3S1N L;  2CKC A;  4ME3 A;  2H12 A;  1R0G A;  1R0J A;  5JVG 1;  1OWC A;  1WCM L;  4BXX L;  5GAE c;  2XJR A;  1S24 A;  3HOZ L;  1BFY A;  2XJP A;  1BRF A;  5FJ8 L;  2M6P A;  3MQK B;  1I50 L;  5C3E L;  3I4N L;  4XGH A;  5MGN A;  2EY4 E;  4ZN3 B;  3M4O L;  3FDJ A;  3K7A L;  4JAF A;  3RYG A;  2RDV A;  3RZT A;  2NVY L;  1CAD A;  2M4Y A;  4A3I L;  3S15 L;  3VPB E;  2CKA A;  2R92 L;  1T9Q A;  2HVY C;  3M3Y L; 
#chains in the Genus database with same CATH homology
 1SMW A;  2J9U B;  3PKI A;  4XXB B;  1QCV A;  1NXG A;  3QQC E;  4AI0 A;  5GAH c;  5RXN A;  3NFP I;  4AHX A;  1YUZ A;  3B0A B;  2XJU A;  1SMM A;  2A69 D;  4RXN A;  2NYD A;  3MSU A;  3QVD A;  2K2D A;  3LNL A;  1B2O A;  2CR8 A;  2JI3 A;  2V3B B;  2M6O A;  1IRO A;  3KYU A;  4LHN A;  1VCX A;  1LKM A;  1IW7 D;  3SS2 A;  5H1S c;  2XJV A;  4AHW A;  3K35 A;  1R0F A;  5MFP A;  1B13 A;  1QYB A;  1VZI A;  3A44 A;  1YUX A;  3RZ6 A;  1SMU A;  1WJV A;  2XJQ A;  4AR3 A;  4LHL A;  3ZG6 A;  4AR4 A;  4B8C D;  1DVB A;  2BE5 D;  4G6B A;  1FHM A;  1LKO A;  5AN9 H;  4AR5 A;  4GS7 D;  2PVE A;  1FHH A;  1R0I A;  3PWF A;  3PIO 1;  1YK4 A;  2A68 D;  1LKP A;  1NXE A;  2DSX A;  2L0Z A;  4AI2 A;  1C09 A;  5AI3 A;  2JI1 A;  2PYA A;  5EIO C;  1LTL A;  1VZG A;  2V0F A;  1OWB A;  3LPE B;  4TVM A;  1S2Z A;  3J7Z 1;  2HR5 A;  3PKJ A;  5K2M E;  1RDV A;  2VL6 A;  6RXN A;  2MS3 A;  5MFZ A;  5AI2 A;  1B71 A;  1T9P A;  3J7Y 1;  1R0H A;  1RYQ A;  3PIP 1;  3KYX A;  1RDG A;  2M4V A;  4AI3 A;  1BE7 A;  2A6H D;  4UY8 1;  2CKC A;  2Z3Q B;  1JYB A;  1ODH A;  4JAG A;  2XJS A;  5EIN C;  4ME3 A;  2AYJ A;  2ERJ A;  5IY0 A;  5JVH 1;  2H12 A;  1R0G A;  2PSM C;  1R0J A;  3P8B A;  5JVG 1;  1OWC A;  5GAD c;  2KN9 A;  2PVX A;  5GAE c;  2XJR A;  1VZH A;  1E8J A;  1RB9 A;  5MF6 A;  1S24 A;  4E6Y A;  5MLC 3;  1BFY A;  2XJP A;  1B2J A;  1BRF A;  2B5I D;  2LCQ A;  4YWM A;  1H7V A;  4YWL A;  5DM6 1;  2A6E D;  3WWN B;  8RXN A;  1YK5 A;  2M6P A;  4TPU A;  4AHY A;  4AHZ A;  4POF A;  4XGH A;  1NNQ A;  5MGN A;  3KYY A;  1BQ8 A;  1Z92 B;  3KYV A;  1RYT A;  4JAD A;  4ZN3 B;  2XJT A;  2QL0 A;  1CAA A;  1ZRP A;  2O5J D;  1RWD A;  3MPS A;  4WFN 1;  5DM7 1;  3B08 B;  4ZN1 B;  2JI2 A;  4JAF A;  3RYG A;  2PPT A;  1IU6 A;  7RXN A;  4POG A;  2RDV A;  3RZT A;  1S30 A;  2KKD A;  2Z3R B;  4AR6 A;  1T9O A;  2C6A A;  3IU3 I;  1YV1 A;  2V0E A;  1BQ9 A;  4AI1 A;  3P2A A;  4V19 6;  2GMG A;  1CAD A;  2C6B A;  2M4Y A;  3KYW A;  3WWL A;  4K9F A;  5GAG c;  4JAE A;  4U67 1;  3VPB E;  2CKA A;  2ZIX A;  1IRN A;  1T9Q A;  2ERS A;  3PZA A;  1DX8 A;  1IU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...