4WFN3

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22 in complex with erythromycin
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
59
structure length
59
Chain Sequence
THKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
total genus 3
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4wfn300
5JVH3 5DM73 3PIO3 3PIP3 5JVG3 4WFN3 5DM63 4U673
chains in the Genus database with same CATH superfamily
1SRUA 3U9SA 2EY6A 4LF4Q 3LWEA 3EQLC 2OQ0A 3SXHA 3NTKA 2RKSA 2AUJD 1TT2A 4R8IA 1V1PB 1J8IA 1O7YA 1IXRA 2Q8RE 1O7ZA 1KC8C 1DM0B 2AKWB 4ULLA 2F4VL 1SFOH 1G6ZA 3C46A 4AYBE 2CW0C 1WTHA 3KUPA 4A3DB 3ULJA 5C5MA 2XTIA 1TS4A 3CRKC 3KDFA 1W6JA 2VB3X 2XRSD 5JEAG 4R4OA 4POFA 1VQGA 2QW7A 4ILWA 3UDXA 3HOWB 1TS5A 4HIDA 1RD9D 3HS0C 3QIAA 1OXVA 4LWCA 2QKIC 3P1HA 2R92H 4F7XA 3H0GB 1GHKA 2M00A 1JWUD 4F8MA 3BDLA 5JJZA 4UP8A 2B63G 1CZGA 2RSNA 1R4QB 2E5LQ 1X3QA 1B53A 4DV2Q 4RKLA 1SNDA 2E2HH 1KDAA 5CV7A 2A68D 1BNZA 1KABA 2DJFC 1OXSC 1YNND 2I46A 1RTNA 4NXML 4TSSA 1IYUA 1ENAA 5C3XA 4WFN3 1D5XC 3R3OA 5J1ZA 1KL9A 4C3HH 5IYCG 2Q8IB 4DR4Q 1YJNA 4G4KA 1PRTB 2D5DA 1PH8A 2IX1A 4A3FB 3GTQH 2B2TA 1DOKA 5K36G 4FDBA 1K83H 3ZYYX 5IGFA 1ZYRC 1D8LA 1Z9FA 4B9XA 2LS01 4A3MG 3KF6B 1A0IA 1E22A 4IUVA 5C4XB 2F0GA 3OPOA 3T4AC 1U4LA 5D3DA 3AYHB 4FF4A 4ZRZA 1K0RA 2VXWA 3AEVA 1N36L 2C9OA 1LTLA 4P2CB 1CKMA 2AQ1B 3VYTA 4BY1H 5GAHC 1WD0A 3NUCA 2R7ZH 4KHPL 4M1UB 1UE1A 2UXDL 2RHSB 3E3XA 1CUKA 1QUQB 1EQQA 3T56B 1KXLA 1Y1VH 4DV4L 1HZBA 2NVQB 3S9WA 2F0JA 2F0SA 3S1NH 1B7YB 2WAQE 2D2CC 1LTRD 1MIUA 3OIPA 5C0XJ 3BZKA 1IBLQ 3TSSA 1EIYB 2XIWA 2UXCQ 2VL6A 3F8TA 2ZXRA 1Y1WG 4FXDA 2CVRA 3SHLA 4FNFA 3VYSA 3OSOA 3WOFA 1NY4A 2AQ2B 3VYUA 1HPCA 1S5CD 3F2DA 2B29A 5JPNC 4IFDH 5D3IB 3TREA 1U4RA 2HCCA 1TWGB 1SE2A 3CAMA 4HMJA 4OELB 2WIIB 5M3FB 3L9AX 1YJWA 2F0OA 4AIMA 4ZLTF 5AJ3Q 3R93A 2K5QA 1STNA 4X6AH 2EYFA 4R4CA 1IZ6A 3UI2A 3KK7A 2NN6I 1OXUA 3I4NB 1U4PA 5E4XA 3K58A 5M3MH 4APVA 2E2IH 1VQCA 3A55A 4XTCS 3E0EA 4A3GG 1K8MA 5LHY1 3S2HB 3RZOH 2G5DA 5ELEA 3I4MB 2B39A 3T51B 1JB3A 1ICFB 4HEDA 3A5UA 2F0TA 1S5FD 5EJWA 2F1MA 2HCIA 3E6ZX 4NB3A 1AZQA 3CU7A 1EEID 1PZJD 4KN7C 4JI3L 3GTKH 1EY4A 4XT3B 5M5XB 4RGTA 3VA7A 4JC0A 4DV1Q 1QJOA 1PTOC 3RD4A 1SLJA 2KJXA 4KY6A 1X3GA 1HNZL 1C8CA 2X69A 4OL7A 2A69D 4G57A 3J81i 4CJ2C 2JQOA 5EKKA 4U68A 1PVOA 3NE5B 4A3BH 5K5PA 3G48A 3DEOA 4X3KA 1N9WA 3HP3A 4A3IG 4LF6Q 1I94L 1HUNA 4KHVA 2D0PA 3TP8A 2QILA 3ULPA 3HOYG 2JP1A 3CCJA 4K8JA 2BE5C 1K3BC 2KCCA 2N78A 1GJXA 3PV0A 1B3QA 3MFGA 4CKBA 3HOUH 4DR6Q 4RFBA 3UE1A 4WJ3M 1WFQA 4A3CH 2A5HA 2YU9B 1PHJA 4J1MA 2QF7A 4YHHL 1EZ6A 2K5WA 3I8ZA 1E1OA 2X6GA 3PF5A 3KBXA 5IWAL 4V0BA 3RR5A 1N33Q 2HD3A 3R8BA 2CKZB 2VQEL 1EFID 1O78A 4OEMB 1EY7A 4A3KH 4QCLA 1VQ5A 3Q6SA 1L0WA 3NWSA 1XMOL 2C35B 4LF4L 2EOTA 4EQOA 2RCFA 2CH4A 1G291 4KLKA 5CBAE 2B8GA 4O1NA 1KDCA 1LYLA 5KNCA 4H44C 3K59A 3R2TA 2ZM6Q 4HIMA 2KECA 4UHVA 1VQOA 3KLSA 1LTID 1KDBA 2R92B 1SE4A 4XYOA 1PRTC 3OIQA 4KD4A 5IP9H 1CTMA 3H6MA 5C44G 1VQEA 2RDGA 2NUCA 1UEBA 3N6RA 4A3LH 4HIKA 2EYMA 4JI4Q 2E2HB 2PCFB 2XN9C 1I4QA 2KHIA 3AQQA 1I6VC 2B2YA 2L5TA 3GTOB 3H3VI 3OYYA 2HHHQ 3VR3A 1SXTA 3OWEB 4R4TA 5I6YA 2I5LX 3UDFA 1E1TA 2E76C 5D65A 2J7ZA 2HIVA 2KA7A 1JJCB 4DAYB 5LMUQ 4A75A 4A3JG 2EPBA 1XNQQ 1Z47A 4BBRH 4DV6L 1PFSA 2UU9Q 1RJTA 2F0UA 2Q2IA 4DN4M 4PMBA 5C4HA 4A4IA 2CH4W 4DV2L 2KVMA 4DFAA 1SNCA 5I2YA 4MZ9A 4YY3L 2GVBA 1B3AA 2JA5H 5GQOA 1N32Q 2B3GA 3ER0A 5H1SE 1Y14B 2F0LA 1VQMA 1LT6D 4K5XA 4XYQA 5C3EG 2K75A 4K14A 4JG2A 4DR4L 4P71A 2PW7A 2F0MA 2PZWA 1MJCA 2HDMA 1TR5A 1VQ4A 3HOWG 1VQKA 4BXXG 3DMUA 4P74A 5G3LF 2X6LA 4H13C 4DV0L 3MVVA 4BY1B 1FGUA 1NTGA 2DNEA 4RA8A 5CYUA 4OX9Q 3SK8A 1DGSA 3IFDA 1Y1VB 4PQXA 4NP5A 5IGCA 1KNAA 4F88A 4DUZQ 3S1NB 1K3RA 1L2FA 5E4WC 1VQ6A 5G3LD 2C5CA 1ZEQX 2N55A 3T1YQ 4A3DH 3SR1A 1CA5A 1KAWA 2OQKA 1G2SA 1S5DD 5CV5A 1JJ2A 4HJ5A 4FYDA 2KCNA 4WRDA 1RTOA 2DUDA 4QMGA 4JI6Q 3O13A 4OWXB 3PIPA 1CM9A 1YI2A 1NBWA 3BZCA 4A3FG 1TS2A 5LMNL 1D7QA 3J80i 2K03A 2CCZA 3CPWA 1H9MA 3CF5A 3H0GH 3TS0A 1IBLL 4PZ6A 3HG9A 5CV9A 5T1GA 1Y8NB 2YTYA 4AQYQ 1MJEA 4KI0A 3ICEA 1D1IA 1VCIA 3A8JE 4JI5Q 5M3MB 2E75C 2E2IB 1VQNA 1H9SB 5M9OA 2I5MX 3I3CA 1X54A 1SYCA 2NB0A 3VR2A 3BU2A 4LF7Q 3D4RA 1DD2A 1RDPD 2Z6BA 4N8X1 5DM63 4HAEA 2HT1A 3Q23A 1PFBA 1YVCA 2A6HD 4DK6C 5AJ3L 1G6PA 2KBNA 1IBKQ 1CQFA 2HQLA 3KFUA 3C3LA 2Z0SA 1CQVA 3QWNA 4JOIC 4B3TL 1B4OA 3KF8B 2XWJB 3ND8A 3GTGH 4IUTA 3BZDB 1ML0D 3PIO3 3GTKB 3CPFA 1Q1BA 5FLMG 1YITA 3CCQA 4KK7A 3E9IA 1LABA 5ELBA 1SROA 5C4XH 3ERSX 4JBMA 2K5HA 4OIKA 2KENA 4RH6A 1YIJA 4UY8C 2VZAA 1GHJA 2IPKD 1HZCA 4A3BB 1EWHA 3QOLA 2RSOA 2OTLA 4K0KQ 4L63B 3FP9A 4YIJA 3S1RH 3M3YH 3WWVA 2DY8A 4FF1A 3HOUB 1WTQA 1W2BA 3IFTA 1QVGA 4GKKQ 4IUPA 4O2DA 1MBYA 1RL2A 1AN8A 1SYFA 1EY8A 4QIWB 3MTSA 4XQQA 1WJJA 1JR0D 2A6ED 3PUWA 3OW7A 4JYAL 1E7ZA 3GP7A 4LF6L 4BBSH 3DWQA 5C4ZA 5GAEC 4LNQA 3TEHB 3ONAB 4ZK9B 4KJOA 2EJMA 2K5DA 2ASBA 1SYEA 3S1QB 1VQHA 2LMCB 1M4VA 2CQOA 3JAML 2EIFA 1TWGH 4QJFA 1LM0A 2DN8A 5M3FH 2OXPA 3CCMA 3JAME 2EXZA 2BH2A 3SEBA 1BXTA 1MSHA 2EDGA 1FJGQ 2SDFA 2F0KA 1M8AA 1WTXA 3K7AB 1B1ZA 1CZWA 5IT9L 2WP8J 4N8FA 1SE8A 4R8NA 5DEHA 3MEHA 3J7A5 3PO2G 3S2HH 3TP6A 3OTOQ 1WTRA 4DR5Q 1I4HA 1QVCA 3DM1A 1K8GA 2O5IC 3I4MH 1A8VA 5IT9E 4JI7L 3DWAA 3PUXA 1G8ZD 2R7DA 4NW2A 5NUCA 2ZM6L 4QQBX 1K73C 1EYGA 4JCVE 4L6TB 2P5ZX 3F2UA 3I4OA 3CCRA 1VMCA 1EL0A 1ONLA 4F87A 3KJOA 2Z1CA 1VMPA 1JCKB 1YNJC 3RNUA 3NQTA 4EQ5A 2M2LA 4IPDA 3CCVA 2JA8B 1BKBA 1IW7D 1EYAA 4JI4L 1YHBA 3BYTB 3J7YW 1WCMB 3BVMA 1LTTD 5JEAJ 1M90C 2PZTA 2F0VA 3I91A 2F03A 1U9RA 4P73A 1N8RC 5LMUL 2EYPA 4IURA 5AFWA 2UU9L 3VR6A 2O2LD 4ODGA 4ZQ3A 5IYBH 2KQ3A 3BYYB 3Q8DA 5BR8Q 4DR2Q 3W1GA 1K8OA 5HY6A 4J8QA 1DXMA 2F0HA 3G7LA 1I4PA 1PH5A 1PH2A 1N32L 1TS3A 3TS2A 4C3JB 1QZGA 2VB2X 4OIJA 4OO1H 1FYCA 5IT9c 3M4QA 1K0SA 4CHTB 2GN5A 4LFCQ 4LFBL 4MHEA 3FPUB 4H02A 5TSSA 1D1KA 4JPBW 1O80A 5KYIA 5C5LA 3MXGA 1VQJA 5CV4A 3FKIH 1JICA 1C7YA 1PZID 1PXUA 4JI0L 2ZXOA 3Q22A 4FXGC 1STBA 4C3HG 3HGBA 5M5YB 2F3IA 2H4OA 1UE6A 1HTPA 4DR7L 3HRZC 2FHTA 4DUZL 2Y0SB 5KRUA 3LNNA 3MEFA 2PMZB 4A93B 4DR1L 1JE4A 5IGEA 1X6OA 1O7LA 3VA5A 3T1YL 1KLUD 4IOAA 4CBVA 2F0FA 1HNXQ 2B2UA 3NWTA 5C3WA 1CT1D 4XQNA 4JI6L 5HURA 3IAYA 1EUJA 3U9OA 1S3OA 3RN2A 4IFDJ 2DY7A 3NHHA 4X66Q 4YCVA 5IP7G 1NJIC 1VS0A 1QB5D 1X32A 2EYOA 2SNMA 2ZXPA 4GNXA 3GTOH 2PQAB 1A15A 1BUVT 4XT1B 4CDEC 2EZVA 1V43A 4MN3A 2WB1G 3FMCA 2MJ8A 3TMEA 4ALPA 3TRZA 4CKCA 1TVXA 4HSPA 1YJ9A 4AQYL 1B50A 2R7ZG 2J0TD 1A6XA 1I3QH 2MGSA 1PLFA 2VQFQ 2ZT9C 1Y1VG 3GTGB 1VF7A 1PA6A 1CI3M 1DONA 1LTSD 1OXXK 2E8GA 4JV5Q 1AP0A 4JI1Q 3ND9A 1YEZA 1S4ZA 2AWOA 1GUGA 3PF4A 4LUVA 4DV5Q 1G91A 2ALYB 4WJ4A 5GROA 1PYBA 1WOCA 4IFDG 4AH6A 3D8GA 2TMPA 3C1FA 3DWPA 2FMMA 2WV6D 3KDFB 3S1RB 5KYLA 3M3YB 4DV3L 1OO9B 3OOCA 3QG1A 2F0EA 5M3MG 4HSVA 4ZAIA 4BY7G 2EY1A 3V2TA 4K0KL 1JE5A 4JVZA 5ELCA 4BBSB 1JMCA 3B6YA 1WTPA 3STBD 3LGJA 4HR7B 4K6DA 2JXMB 2E2JH 3WDNA 1ICWA 1G2TA 1X3PA 1FL0A 4JI8L 2EYHA 4DV7Q 1PH9A 3GTLH 2Z9HA 1EZ8A 4GKKL 1IKLA 1CFMA 3ITPA 4R4QA 1NE3A 3HOVB 2A8VA 1I50H 1A2TA 2WAQB 4JOIA 2B2WC 4GOPA 3S16H 2CQAA 1Y8OB 3PUVA 4YCUA 3LWUA 4B3MQ 3HOZB 2OF1A 5JJKA 2I5HA 3F2CA 1CSQA 1Q12A 3E5SA 3D4DA 1KAAA 1KRSA 4A3BG 3E0JA 3FPPA 5IGGA 4B3SL 1I5FA 1EQRA 4RKBA 4A3EH 2IX3A 1N34Q 4DUYQ 3CC2A 1EQVA 3NTHA 3PGZA 3HOUG 3HFZB 2Q2HA 2ATWA 2OTJA 4A3CG 5C4JB 2N3SA 1NUCA 4LAAA 1HH2P 3VDYA 1HR0Q 1UWVA 4P75A 4KKTA 3I72A 4DR5L 4DGZA 3V05A 1SMYD 1S72A 1QVFA 3OW2A 2LKVA 2QA4A 1XMQL 1SE3A 4XQJA 2CWAA 2Z8LA 3ULLA 4HCEA 3HEJA 1JJGA 1E24A 1FD7D 2Z4HA 4IZ8A 4A3KG 1EY6A 3GD7A 4KN4C 2A74C 1NMFA 4DAPA 4HCSA 1NR2A 2ZTDA 2NZOA 3MC0B 1XXGA 2FFKB 3MAQA 1I6HH 1HA5A 4LF9Q 4L5RC 2QDLA 1VQ9A 3T53B 2VS1A 1AZPA 1STGA 3NBIA 5JPMC 4A3GH 4X65Q 1TU2B 2VNUD 4QUFA 1EU3A 1H9RA 3TZUA 1VQ7A 1Q3LA 3T13A 1GUNA 4IUQA 5C0XH 1F9RA 5IP9G 4HMIA 2YTVA 4DAYA 4KY5A 1OTCA 2OCEA 2TSSA 3S1QH 3S17H 4A3LG 5BR8L 3UDIA 3NSWA 2EQSA 2ICEC 4LF8Q 1TQOA 4HN7A 4QL5A 3GO5A 3A7AB 1PH4A 1R9TB 4GN3B 1R4PB 3FKIB 3OMGA 2WKDA 1F77A 3EVQA 4DKAC 3HKZG 4I7AA 5EAYA 5L37A 1WTVA 2RA4A 2WACA 1Y69U 1JWMD 1HFGA 1BDOA 5HGTA 2H1EA 3F1ZA 1DOLA 2AQ3B 5EKIA 4BBRG 1GUTA 3F2BA 5BN3A 2RVLA 4B3RQ 2CWPA 1XYIA 3K7AH 1PFMA 1Q90A 4GKJQ 4GZYC 2K4KA 2PYKA 2AHOB 2JA5G 3HOXH 1SR3A 2RF4A 3BDOA 3RLFA 5LL6X 4E6IA 4NXNQ 5J39A 2HDLA 1XTDA 2UXBQ 2JK8A 4YWMA 3HZXA 2EJFC 4TKOB 2FJ2A 2K5NA 3C2PA 1TWCH 5CV8A 1V1OA 3OWFA 1HNXL 1GD7A 3T1HQ 1I3QB 2E5LL 4I65A 1GO3E 1CKNA 3SVMA 4FF3A 2JA8H 4IFDI 2OWOA 1MKHA 2IHFA 3J81c 4IPGA 1J6QA 1WCMH 1WI5A 4MNOA 4UAIA 3TP5A 2Q2UA 5COYA 2NTTA 1JWSD 2ID0A 2RBMA 1IYVA 4N9TA 2WFWA 1QG7A 2YTXA 3I2ZA 4A3DG 3PO3H 2DGYA 1PV4A 5IE8A 3W3AA 2JYOA 1MGSA 1TWFH 4IPCA 4YWLA 2ICIA 2N49A 2WB1E 5IY0A 5FKAC 1HNWQ 3GDEA 2VQFL 1EY0A 1AH9A 1SJED 1H9SA 1BQQT 1EQTA 2Y0SG 3CC4A 1SBBB 4JV5L 2Z4IA 3H0GG 4C3JH 1MSGA 1L0YB 4IUNA 1BCPF 3S2DH 4DNTB 1II3A 1LO5D 1UE7A 4ZUJA 3M4YA 2E2DC 2B2VC 3EN2A 2R93H 1PH6A 3NBHA 4RCOA 3CD6A 3KF8A 5E1FA 1ENCA 4C1NI 3GTPH 1NR4A 2V4DA 5I9OA 1I4XA 3AFPA 1A63A 3RLOA 1BCPD 4O0AA 5CBEE 1EWCA 2E2JB 2EYJA 5M5YH 4IJLA 5FJ8H 3GTLB 1FNVA 1B9MA 1STEA 3D6CA 5I2XA 5JVG3 2FMCA 1T9HA 1X9NA 3BVZA 1SDFA 4O42A 2MFIA 4A93H 1U0LA 4U673 1I50B 4CKEA 1ET6A 3TDQA 2UXCL 3S16B 3Q24A 4DXFA 4G7ZC 5C4XG 3M7GA 4KHZA 5GAGC 1KTKA 1JQYD 4CDCC 4C3IH 2QDBA 1ENFA 1EY9A 2VUMH 5CR3A 1JORA 3S15B 4NKLA 5KEEA 1GUWA 3MXNB 2J4XA 3A7LA 4NPSA 1CHPD 3X3NA 3RLNA 3AMUA 4IPHA 1MD2D 4A3EB 1IYJB 3KLRA 1YBYA 3PMFA 1DOMA 3L3OC 4MTKA 1T5EA 4UDUC 3NXWA 4B3ML 1PDQA 1VQAA 1PTOF 2A68C 1YNNC 5EBCA 3U58A 2L0CA 4GLXA 2K50A 3I7FA 4RHRA 5GADC 1C0AA 3RMHA 1IBMQ 2G9DA 2K7VA 2K52A 5M5WH 1EOVA 2ZJPA 3SE0A 5EBDA 3NTIA 4IALA 4RCNA 4ZYSA 1ESFA 5A35A 2XVSA 1N34L 1PTOD 2PPBC 1PH3A 4DNIA 4DUYL 1MHWC 3AU7A 1N36Q 4RMFA 4K6LA 4L5SA 3J81j 1HR0L 1XJVA 1I6HB 2UUAQ 5M3FG 4DV1L 2LSSA 3RZDB 2UXDQ 2WAQG 4V190 4J6HA 3NEMA 4CGYB 1AFPA 1P8LA 1HR0W 1SAPA 2BE5D 1LT5D 4A3GB 3I4NG 1HQRD 2JSOA 5E3FA 1LT3D 3TN2A 1TKWB 2GVAA 1LTBD 2SNSA 3S24A 1ZXTA 3K5MA 1NSNS 2KHJA 4KMUC 4MIUA 1U5KA 1Q7YC 3I4MG 4CJ0B 2LY7A 5IYDG 4DR6L 3JAMi 2UUBQ 2K01A 3S17B 4LUOA 3HOVH 3STBC 4A76A 1F2ZA 1I4RA 2G9HD 1N33L 1PFNA 1O7IA 1ILPA 2K6AA 3DHQA 1LT4D 3EA6A 4HTHA 1PRTF 1NAPA 2L12A 1YHAA 3HOZH 3G4SA 3K8AA 4DPGA 2R6GA 3D4WA 4X62Q 4CDDC 5KIXA 4FO2A 1F2YA 4HJ9A 4A3IB 5EKLA 1QILA 3HOYB 2BOSA 3CCUA 3HOXB 1H95A 1ZKOA 4OHJA 2BH8A 2JA7H 1BCPB 1PRTD 1F2LA 3D3RA 3GQBA 1LUZA 3HKZE 3MHBA 1BF4A 1V1PA 5IYBG 4IN3A 1C9OA 3NENA 5C4JH 1GUOA 3E9HA 5ELNA 1EIGA 4UP9A 3JC66 4DK0A 4GKJL 1GUSA 1TWCB 2KEDA 3TZDA 5EPKA 2MO1A 4PMWA 2QEXA 4UPAA 5FOBB 4NMZA 1GXDC 1B2TA 4OO1G 4I7ZC 1RCVD 3EROA 1L1OB 2LFNA 3S1MH 2B8FA 2UXBL 2HHHL 1C4QA 2JA6H 3GTJH 1I94Q 3FKIG 1XWEA 1MI2A 3GV3A 1JOKA 3PO3B 2IW3A 4L8JA 1F9SA 1XNQL 4G7OC 1TWFB 2A69C 5BN4A 2K04A 3CRLC 4DA2A 5FLXc 2HQEA 2NZ1D 3IKJA 4QUCA 1FNUA 4LF5Q 5IOCA 3J7ZC 2KCTA 5IGBA 1H9KA 1FNWA 3UE0A 2PNRC 2R92G 2L1BA 2B2YC 4EVOA 5KGUA 1SNQA 2K14A 4C56C 2D62A 1DCZA 3S2DB 1Z7TA 3FRPB 3K57A 1AE2A 1HQMC 2NN6H 1CHQD 1STHA 3W1BA 1VQPA 2R93B 1HNWL 2D0OA 5FO9B 2F0IA 2KCMA 1Q46A 4PMCA 3U4VA 1XMOQ 1R9TH 1Z6HA 4ME5A 3G6JB 3GTPB 4DR3Q 4A3JB 3H91A 4RGOS 2EE1A 3PIOA 3M9BA 3CXCA 4LK1C 3KF6A 4OX9L 2Y0SE 4K5VA 5J3BA 2PMZE 3CCEA 2KOLA 1QOHA 2MHVA 3A8KE 3H15A 2PQEA 1STAA 4G7HC 1J5EQ 1VQLA 3QR8A 1TWHB 1B44D 4PG3A 5C3EB 2UUCQ 1JOOA 1Y8PB 4AYBB 2NVXH 1D2BA 1B8AA 2WINB 1IL8A 3K5LA 1SJHD 1UUPA 2FXQA 3A54A 1DJRD 1UAPA 3P20A 1QNKA 1QUQA 4C3IB 3MA2B 2VUMB 1Q8KA 1LTGD 4TQUS 5DM73 2ZTCA 4IJHA 3K81C 4FVMA 3D6WA 4ZCKA 2L15A 2GA4B 4L5TA 4BY1G 4Y7NB 1PMRA 4DV6Q 2RDFA 1CK1A 3QJYA 4DAVA 4ZKBB 3DXJC 1WD1A 2BA1A 4JI5L 3T16A 2YYZA 5J22A 5DAUA 1WTWA 3Q0AA 4YY3Q 4JK1C 4M8AA 4DAMA 2F3VA 1WYDA 4LF7L 5JOBA 5M5WB 2B2VA 2I0QA 5JEAH 3MFYA 1IKMA 1C48A 1HZAA 4GS3A 1IBKL 2EY2A 1IHZA 1FR3A 1X3FA 1YZ6A 1AEXA 2O4XA 1P16A 3A56A 3DUZA 4WORA 2F0QA 4DV0Q 2EVBA 5KNBA 3GTMH 2N8NA 2B63H 4FF2A 1IBML 4R1JA 1HUMA 1NCVA 2QCPX 4ME3A 5CGKA 1QZHA 1E0BA 1DZ1A 3HKSA 4OGQC 2ZTEA 3H94A 5IP7H 1PH7A 4WJWA 4ABNA 3CP0A 1SSOA 3CCSA 3A74A 1EWIA 5LL6S 1HZ9A 5IYCH 2UUAL 1TWAH 4TVAB 3OHXC 2Z6KC 2OT2A 3FHWA 2PO4A 1W6KA 3UDGA 2Q2TA 1KD1C 4A3EG 2CHBD 5K36H 4GNXB 3SK6A 1VQ8A 2EXDA 1NNXA 5CMDA 2SEBD 2ENBA 1RHPA 5LMNQ 4X64Q 3H3VH 4A3MH 1BCPC 2DJGC 4KKUA 3N52A 3W5OA 5KNDA 2NBFA 1T5XD 1S40A 1V9PA 1SYDA 2UUBL 1ET9A 1VF5C 3PSIA 2JEAI 1PZKD 1BO0A 2IY5B 2JA9A 1Q82C 3KLWA 1HA6A 3CQZH 3S15H 3D0FA 1HHVA 3IRBA 4IQZA 1BBUA 1JB7A 3K7UC 1X3EA 1XPUA 4OO1I 2RQXA 4KY7A 2KEEA 5FK9C 2JA7B 1KHIA 1L1OC 3VR5A 1L0XB 4OXPA 2MNAA 1FJGL 5EPJA 3SK4A 4B3TQ 4HIOA 2NVTH 4X62L 2F0WA 5HGQA 4XIGS 4BY7H 3NK9A 3S14B 4GN5A 2A6HC 3OTOL 1LTAD 5FO7B 1Y1WH 5JJLA 1K28A 2PI2A 4IUUA 3A0JA 3URYA 3K6OA 4IO9A 1PYSB 5C0XG 1XPOA 1M1KC 1F2MA 1YNJD 2F0NA 3A8IE 1KLGD 3S1MB 2IWHA 1D5ZC 4N9PA 4C2MB 2JA6B 3IL8A 3GTJB 1CKOA 3PIP3 1EIFA 3VR4A 4LJZC 5BN5A 2NTSA 2AUKA 5E7NA 3AFQA 3RZDH 2IL8A 3P7JA 2EY5A 1SN8A 4JI2Q 2JN4A 5JVH3 2A19A 2LXKA 3P75A 3BVGA 4QGUA 1XTCD 5ELFA 3PO2B 3EFXD 5D14A 3J81L 2BCOA 4JYAQ 2FINB 1SYGA 4GOPB 2PW5A 3I55A 1TY0A 4IOCA 3HOXG 1EYDA 3CW2C 3J81E 4RWSC 2PI2E 3M7NA 2K32A 3NQIA 3U50C 3I70A 2A6EC 3NPPA 4Y52H 4DR2L 3PQIA 4K2LA 1SNOA 1SYBA 4Z9CB 2NVYH 4YCWA 2SOBA 4LF5L 4P72A 1B70B 2HUGA 1VQDA 2CW0D 3TQYA 1B9NA 1F9QA 4XXEA 1SEBD 1DYQA 3SGIA 4MTNA 1W3SA 5C6AA 4LFAQ 5JAVA 1KNEA 4EQPA 1VDZA 4LFCL 2JA8G 1SFOB 2K1BA 1GKHA 1XNRQ 4A3IH 2QGQA 2ZJRA 1WCMG 4DF7A 3CCLA 3HOYH 4DR3L 2NVXB 1EEFD 1D5MC 4JI7Q 1GVPA 1EU4A 3M4OH 4H7BA 3J7AF 3PO3G 3K80C 3PCOB 2MP1A 1K9MC 1J5EL 3H09A 1BVSA 1UNSA 2M9VA 2F52A 3PUYA 1QCBD 2WKCA 2RDHA 3KJPA 1JT8A 5IODA 1PYWD 3L2PA 2UUCL 1A62A 4ID6A 4L5QA 4PV1C 4C3JG 1KIXA 1STYA 1EIHA 2R7FA 4RGMA 4RGNA 2EJGC 4X66L 4FXKC 3DM3A 4KV6A 1PH1A 1E3PA 2R93G 2AMCB 4DK3C 3SK5A 4POGA 1HFNA 4C3HB 1I4GA 1ZYRD 2ZJQA 2BDNA 1IW7C 2EYLA 1ASZA 1VQIA 3EIVA 3GTQB 3EBEA 1HCZA 5FJ8G 1GOZA 1BBXC 3BDCA 1K83B 2IT1A 2B2UC 1YNXA 2BDOA 4FP5D 3DLLA 4DK1A 4X3SA 3GTMB 4NDXA 5C44H 2B63B 4A93G 4PZ8A 3D31A 3L7ZC 3MXNA 3TBIB 4JI1L 4GNXC 3MXUA 3VYRA 4YWKA 4AYBG 5EQ0A 2IHEA 5IGDA 1PTOH 2IX0A 4LFBQ 4OWWB 2F4VQ 4DV5L 2NWGA 2MO0A 1A3TA 3TP7A 3CMEA 4C3IG 1V8QA 1EOTA 4EGVA 2VUMG 2MQHA 4PNYA 1HJPA 2WB1B 4A3JH 4JI0Q 1V1QA 2B2TC 1TWAB 2R7ZB 2RCNA 1Q1EA 2L9HA 4JBJA 3SDZA 3M85A 2VY3A 1XPRA 4DR7Q 2BA0A 4QF4A 4HJ8A 2YV5A 1E2VA 3K5NA 4DR1Q 1Q81C 1TWHH 4A3MB 1SNPA 3WOEA 1ASYA 5ELDA 1SNMA 5C3EH 3CKIB 5EGTA 5I4DA 2XSCA 1A2UA 2XWBB 1YHQA 1LLRD 1F9PA 1CKNB 3ERQA 4C1NK 5ELOA 4DV7L 4DU9A 1RODA 1WVLA 2DNCA 3HOWH 2MPMA 3MXPA 1SMXA 4BXXH 1S5BD 3CQZB 1EFWA 4NXMQ 1QE6A 4DXGA 4GLVB 4X64L 5A2QL 4QY7A 3J80L 3G6EA 5C0XI 3K0YA 1LV9A 4Y7NH 2KHSA 5LMNW 5I9PA 1QWYA 4KJNA 5A2QE 2R3ZA 2D9UA 4GLAC 3J80E 2NVTB 4BY7B 1FGBD 1XX8A 2A73B 2IJ0A 3RZOB 1Y1WB 5CC4A 1NMGA 3RN5A 4HJ7A 3KBGA 3FDTA 1EYCA 4BBSG 1WTOA 4DNRB 3RUZA 4H0LC 1X56A 3CC7A 1BR9A 5FO8B 4ZKCB 4A3FH 3NBHB 1E2ZA 1X65A 3LX0A 1RF2D 1ILQA 4GOPC 2Z6KA 3V96A 4EQNA 2XGTA 1S5ED 4UP7A 3HOVG 2PZUA 4GN4B 5IIFA 3NELA 5EPLA 4R4IA 4DV3Q 4KHPQ 3G71A 4J15A 3BJUA 4QIWE 1BBWA 1IL2A 4X3UA 1Q8IA 4DV4Q 2QEJC 2OEOA 4OONA 3HOZG 2F0DA 2NYZD 3J7AV 2B2WA 1VQBA 4LMQD 1D6EC 3C1EA 3QB3A 1TIID 4OWTB 1CA6A 2L4NA 2AWNA 4LF9L 1X55A 2V1CC 2JEBI 2A1AA 3A5ZB 1A3UA 4JI8Q 2JA7G 4JI2L 3GV6A 1HRJA 1BOSA 2Q8TA 4BWGB 1OXTA 2LXJA 3DEPA 3X3MA 2NVQH 4BS9A 1Q86C 4KD3A 5FLMH 4X65L 2NVYB 3QOJA 4CDFC 3J80c 1L1OA 5FLXL 1H9JA 3KOJA 1RIPA 1ESRA 3I73A 3FEWX 2MUYA 4R9WA 2NZHA 3R2IA 3FVQA 2F4IA 4LUZA 1JC7A 4K2KA 2XNAC 3CMAA 1EY5A 5FLXE 4A3KB 4K8IA 4JBWA 1LACA 1CSPA 4LF8L 5T1IA 1VQFA 1TXYA 4B3SQ 1UE5A 3K0XA 4QB4A 2N88A 2JA6G 4K5WA 2K28A 2PNHA 3M4PA 3M4OB 1AW7A 4XDXA 2JE6I 4B9WA 1K8AC 3KYHC 1QNUA 4TRDA 4PZ7A 4LFAL 3I4NH 2K5VA 3I4LA 5I6WA 4JI3Q 4B3RL 1UEAB 2L11A 1AE3A 2RHQB 1KQSA 4Q5VA 2K33A 5F2DA 1G51A 1HXYD 1XNRL 3S14H 3K5OA 4BA1I 2F0PA 1XMQQ 2JJQA 5IYDH 4B08A 4BA2I 3I56A 5JJIA 1HNZQ 4NXNL 1GM5A 4JW0A 4S3SA 2R61A 3MWYW 2NN6G 4X3TA 3NP8A 4C2MH 1J9OA 3KLSX 4Q0FA 4JBKA 1SMYC 2E74C 2KUMA 3HKZB 5M5XH 3I90A 3EJIA 4KTAA 1A3VA 4CJ1B 1JOQA 2K05A 1FVIA 5CV6A 2ES2A 4BBRB 4RHSA 4RAUC 3CHBD 1U4MA 3U4ZA 5DNFA 3L0OA 3T1HL 2I07B 1RKNA 3QO2A 4YHHQ 3PO2H 1TY2A 4EX5A 2JA5B 5ISRA 3AB9A 2O5JC 2H5XA 3OMCA 5IWAQ 3BS1A 2PQAA 5CORA 5C44B 5DLQE 2CFMA 1HTLD 2XRQD 1KRTA 2VQEQ 2F3WA 1E2WA 3MZ5A 3W2DA 3ZJYC 3BG3A 4HJAA 4LW1A 1PTOB 3PUZA 2L55A 3JAMc 3H3VC 4ZUIA 2HIXA 4KKSA 4RG1A 2VW9A 2YU9H
chains in the Genus database with same CATH topology
3U9SA 2EY6A 3LWEA 3EQLC 3SXHA 3NTKA 2RKSA 2AUJD 1TT2A 4R8IA 1V1PB 1J8IA 1O7YA 2Q8RE 1O7ZA 1DM0B 4ULLA 1G6ZA 3C46A 2CW0C 3KUPA 4A3DB 5C5MA 1TS4A 3CRKC 1W6JA 2VB3X 2XRSD 5JEAG 4ILWA 3HOWB 1TS5A 1RD9D 3HS0C 3QIAA 1OXVA 2QKIC 3P1HA 4F7XA 3H0GB 1GHKA 2M00A 1JWUD 4F8MA 3BDLA 5JJZA 1CZGA 2RSNA 1R4QB 1X3QA 1B53A 4RKLA 1SNDA 1KDAA 5CV7A 2A68D 1BNZA 1KABA 1OXSC 1YNND 2I46A 1RTNA 4TSSA 1IYUA 1ENAA 5C3XA 4WFN3 1D5XC 3R3OA 5J1ZA 2Q8IB 4G4KA 1PRTB 2D5DA 2IX1A 4A3FB 2B2TA 1DOKA 5K36G 3ZYYX 5IGFA 1ZYRC 4B9XA 2LS01 4IUVA 5C4XB 2F0GA 3OPOA 3T4AC 1U4LA 5D3DA 4FF4A 4ZRZA 2VXWA 2C9OA 4P2CB 2AQ1B 3VYTA 1WD0A 3NUCA 4M1UB 3T56B 2NVQB 3S9WA 2F0JA 2F0SA 2D2CC 1LTRD 3OIPA 5C0XJ 3TSSA 2XIWA 2ZXRA 4FXDA 2CVRA 3SHLA 4FNFA 3VYSA 3OSOA 3WOFA 2AQ2B 3VYUA 1HPCA 1S5CD 5JPNC 4IFDH 5D3IB 1U4RA 2HCCA 1TWGB 1SE2A 4HMJA 2WIIB 5M3FB 3L9AX 2F0OA 4ZLTF 3R93A 2K5QA 1STNA 2EYFA 3UI2A 3KK7A 2NN6I 1OXUA 3I4NB 1U4PA 5E4XA 3K58A 3A55A 4XTCS 1K8MA 5LHY1 3S2HB 5ELEA 3I4MB 2B39A 3T51B 1JB3A 4HEDA 2F0TA 1S5FD 5EJWA 2F1MA 2HCIA 3E6ZX 1AZQA 3CU7A 1EEID 1PZJD 4KN7C 1EY4A 4XT3B 5M5XB 4RGTA 3VA7A 1QJOA 1PTOC 3RD4A 2KJXA 4KY6A 1C8CA 2X69A 4OL7A 2A69D 4G57A 4CJ2C 5EKKA 4U68A 3NE5B 5K5PA 3DEOA 4X3KA 3HP3A 1HUNA 4KHVA 3TP8A 2QILA 2JP1A 1GJXA 4K8JA 2BE5C 2KCCA 3PV0A 4CKBA 3MFGA 4RFBA 2A5HA 2YU9B 4J1MA 2QF7A 1EZ6A 2K5WA 3I8ZA 2X6GA 3KBXA 4V0BA 3R8BA 1EFID 1O78A 1EY7A 4QCLA 3Q6SA 3NWSA 2EOTA 4EQOA 1G291 5CBAE 2B8GA 4O1NA 1KDCA 5KNCA 4H44C 3K59A 3R2TA 2KECA 3KLSA 1LTID 1KDBA 2R92B 1SE4A 4XYOA 1PRTC 3OIQA 4KD4A 1CTMA 3H6MA 2RDGA 2NUCA 3N6RA 2EYMA 2E2HB 2PCFB 2XN9C 1I4QA 1I6VC 2B2YA 2L5TA 3GTOB 3VR3A 1SXTA 3OWEB 5I6YA 2E76C 5D65A 2J7ZA 2KA7A 2EPBA 1Z47A 1RJTA 2F0UA 4DN4M 4PMBA 5C4HA 2KVMA 4DFAA 1SNCA 5I2YA 1B3AA 2F0LA 1LT6D 4K5XA 4XYQA 4K14A 2PW7A 2F0MA 2PZWA 2HDMA 1TR5A 3DMUA 5G3LF 2X6LA 4H13C 4BY1B 3MVVA 2DNEA 4RA8A 5CYUA 3SK8A 3IFDA 1Y1VB 4PQXA 4NP5A 5IGCA 1KNAA 4F88A 3S1NB 5E4WC 5G3LD 2C5CA 1ZEQX 2N55A 3SR1A 1CA5A 1G2SA 1S5DD 5CV5A 4FYDA 2KCNA 4WRDA 1RTOA 4QMGA 3O13A 1CM9A 1TS2A 2K03A 1H9MA 3HG9A 5CV9A 5T1GA 1Y8NB 4KI0A 1D1IA 1VCIA 3A8JE 5M3MB 2E75C 2E2IB 1H9SB 5M9OA 3I3CA 1SYCA 2NB0A 3VR2A 3D4RA 1DD2A 1RDPD 5DM63 4HAEA 3Q23A 1PFBA 2A6HD 1CQFA 3C3LA 1CQVA 3QWNA 1B4OA 2XWJB 3ND8A 4IUTA 3BZDB 1ML0D 3PIO3 3GTKB 1Q1BA 4KK7A 1LABA 5ELBA 4OIKA 4RH6A 1GHJA 2IPKD 4A3BB 1EWHA 3QOLA 2RSOA 4L63B 4YIJA 2DY8A 4FF1A 3HOUB 1WTQA 3IFTA 4IUPA 1MBYA 1AN8A 1SYFA 1EY8A 4QIWB 3MTSA 4XQQA 1JR0D 2A6ED 3PUWA 3OW7A 3GP7A 3DWQA 5C4ZA 3ONAB 4ZK9B 4KJOA 2EJMA 2K5DA 1SYEA 3S1QB 2LMCB 1M4VA 3JAML 2DN8A 2OXPA 3JAME 2EXZA 3SEBA 1BXTA 1MSHA 2EDGA 2SDFA 2F0KA 1M8AA 1WTXA 3K7AB 1B1ZA 1CZWA 5IT9L 2WP8J 4R8NA 5DEHA 3MEHA 3TP6A 1WTRA 1I4HA 3DM1A 2O5IC 5IT9E 3DWAA 3PUXA 1G8ZD 4NW2A 5NUCA 4L6TB 3F2UA 1VMCA 1EL0A 1ONLA 4F87A 2Z1CA 1VMPA 1JCKB 1YNJC 3NQTA 2M2LA 2JA8B 1IW7D 1EYAA 3BYTB 3J7YW 1WCMB 3BVMA 1LTTD 5JEAJ 2PZTA 2F0VA 3I91A 2F03A 1U9RA 2EYPA 4IURA 5AFWA 3VR6A 2O2LD 4ODGA 4ZQ3A 2KQ3A 3BYYB 1K8OA 4J8QA 1DXMA 2F0HA 3G7LA 1I4PA 1TS3A 4C3JB 2VB2X 4OIJA 4OO1H 1FYCA 4CHTB 4MHEA 3FPUB 5TSSA 1D1KA 1O80A 5KYIA 5C5LA 3MXGA 5CV4A 1JICA 1PZID 1PXUA 2ZXOA 3Q22A 4FXGC 1STBA 4C3HG 3HGBA 5M5YB 2H4OA 1HTPA 3HRZC 2FHTA 2Y0SB 5KRUA 3LNNA 2PMZB 4A93B 1JE4A 5IGEA 1O7LA 3VA5A 1KLUD 4CBVA 2F0FA 2B2UA 3NWTA 5C3WA 1CT1D 4XQNA 5HURA 3IAYA 3U9OA 4IFDJ 2DY7A 3NHHA 1QB5D 1X32A 2EYOA 2SNMA 2ZXPA 1A15A 1BUVT 4XT1B 2EZVA 1V43A 4MN3A 3FMCA 2MJ8A 3TMEA 4CKCA 1TVXA 4HSPA 1B50A 2J0TD 1A6XA 2MGSA 1PLFA 2ZT9C 3GTGB 1VF7A 1CI3M 1DONA 1LTSD 1OXXK 1AP0A 3ND9A 1S4ZA 2AWOA 1GUGA 1G91A 4IFDG 3D8GA 2TMPA 3C1FA 3DWPA 2FMMA 2WV6D 3S1RB 3M3YB 5KYLA 1OO9B 3OOCA 3QG1A 2F0EA 4HSVA 4ZAIA 2EY1A 3V2TA 4BBSB 5ELCA 1WTPA 4HR7B 4K6DA 2JXMB 3WDNA 1ICWA 1G2TA 1X3PA 2EYHA 1EZ8A 1IKLA 1CFMA 3ITPA 3HOVB 1A2TA 2WAQB 2B2WC 2CQAA 1Y8OB 3PUVA 3LWUA 3HOZB 2OF1A 1Q12A 3E5SA 3D4DA 1KAAA 3E0JA 3FPPA 5IGGA 4RKBA 2IX3A 1EQVA 3NTHA 5C4JB 4LAAA 1NUCA 4KKTA 3I72A 4DGZA 3V05A 1SMYD 2LKVA 1SE3A 4XQJA 2Z8LA 4HCEA 3HEJA 1FD7D 2Z4HA 4IZ8A 1EY6A 3GD7A 4KN4C 4DAPA 2A74C 4HCSA 1NR2A 3MC0B 1XXGA 2FFKB 3MAQA 1HA5A 3T53B 1AZPA 1STGA 3NBIA 5JPMC 1TU2B 2VNUD 4QUFA 1EU3A 1H9RA 3TZUA 1Q3LA 3T13A 1GUNA 4IUQA 5C0XH 1F9RA 4HMIA 4DAYA 4KY5A 2TSSA 3NSWA 2ICEC 1TQOA 4HN7A 3GO5A 3A7AB 1R9TB 1R4PB 3FKIB 3OMGA 2WKDA 1F77A 3EVQA 1WTVA 2RA4A 2WACA 1Y69U 1JWMD 1HFGA 1BDOA 5HGTA 2H1EA 1DOLA 2AQ3B 5EKIA 1GUTA 5BN3A 2RVLA 1XYIA 1PFMA 1Q90A 4GZYC 2PYKA 3BDOA 3RLFA 5LL6X 4E6IA 5J39A 2HDLA 3HZXA 2EJFC 4TKOB 2FJ2A 3C2PA 5CV8A 1V1OA 3OWFA 1I3QB 4I65A 3SVMA 4FF3A 4IFDI 4UAIA 3TP5A 5COYA 2NTTA 1JWSD 2ID0A 2RBMA 1IYVA 4N9TA 1QG7A 3W3AA 2JYOA 1MGSA 2ICIA 5FKAC 1EY0A 1SJED 1H9SA 1BQQT 1EQTA 1SBBB 2Z4IA 1MSGA 1L0YB 4IUNA 1BCPF 4DNTB 1II3A 1LO5D 4ZUJA 3M4YA 2E2DC 2B2VC 3NBHA 4RCOA 3KF8A 5E1FA 1ENCA 4C1NI 1NR4A 2V4DA 5I9OA 1I4XA 1BCPD 5CBEE 2E2JB 1EWCA 2EYJA 3GTLB 1FNVA 1B9MA 1STEA 3D6CA 5I2XA 5JVG3 2FMCA 3BVZA 1SDFA 4O42A 4U673 1I50B 4CKEA 1ET6A 3TDQA 3S16B 3Q24A 4DXFA 4G7ZC 3M7GA 4KHZA 1KTKA 1JQYD 2QDBA 1ENFA 1EY9A 5CR3A 1JORA 3S15B 4NKLA 5KEEA 1GUWA 2J4XA 3A7LA 1CHPD 3X3NA 3AMUA 1MD2D 4A3EB 3KLRA 3PMFA 1DOMA 3L3OC 1T5EA 4UDUC 3NXWA 1PDQA 1PTOF 2A68C 1YNNC 5EBCA 2L0CA 4RHRA 3RMHA 2G9DA 2K7VA 3SE0A 5EBDA 3NTIA 4IALA 4RCNA 4ZYSA 1ESFA 5A35A 2XVSA 1PTOD 2PPBC 3AU7A 4K6LA 1I6HB 3RZDB 4V190 4J6HA 4CGYB 1AFPA 1SAPA 2BE5D 1LT5D 4A3GB 1HQRD 2JSOA 5E3FA 1LT3D 3TN2A 1TKWB 1LTBD 2SNSA 1ZXTA 3K5MA 1NSNS 4KMUC 4MIUA 4CJ0B 2LY7A 2K01A 3S17B 1F2ZA 1I4RA 2G9HD 1PFNA 1ILPA 2K6AA 3DHQA 1LT4D 3EA6A 4HTHA 1PRTF 1NAPA 2L12A 2R6GA 3D4WA 5KIXA 4FO2A 1F2YA 4A3IB 5EKLA 1QILA 3HOYB 2BOSA 3HOXB 1ZKOA 4OHJA 1BCPB 1PRTD 1F2LA 3D3RA 3GQBA 3MHBA 1BF4A 1V1PA 4IN3A 1GUOA 1EIGA 4DK0A 1GUSA 1TWCB 2KEDA 3TZDA 5EPKA 4PMWA 5FOBB 4NMZA 1GXDC 1B2TA 4OO1G 4I7ZC 1RCVD 3EROA 2LFNA 2B8FA 1C4QA 1XWEA 1MI2A 3GV3A 1JOKA 3PO3B 2IW3A 4L8JA 1F9SA 4G7OC 1TWFB 2A69C 5BN4A 2K04A 3CRLC 4DA2A 2HQEA 2NZ1D 3IKJA 4QUCA 1FNUA 5IOCA 5IGBA 1H9KA 1FNWA 2PNRC 2L1BA 2B2YC 4EVOA 5KGUA 1SNQA 4C56C 3S2DB 2D62A 1DCZA 1Z7TA 3FRPB 3K57A 1HQMC 2NN6H 1CHQD 1STHA 2R93B 5FO9B 2F0IA 4PMCA 1Z6HA 4ME5A 3G6JB 3GTPB 4A3JB 3H91A 4RGOS 2EE1A 4LK1C 4K5VA 2KOLA 1QOHA 2MHVA 3A8KE 2PQEA 1STAA 4G7HC 1TWHB 1B44D 5C3EB 1JOOA 1Y8PB 4AYBB 1D2BA 2WINB 1IL8A 3K5LA 1SJHD 1UUPA 3A54A 1DJRD 1UAPA 3P20A 1QNKA 4C3IB 3MA2B 2VUMB 1LTGD 4TQUS 5DM73 4FVMA 3D6WA 2GA4B 4Y7NB 1PMRA 2RDFA 1CK1A 3QJYA 4DAVA 4ZKBB 3DXJC 1WD1A 2BA1A 3T16A 5J22A 2YYZA 5DAUA 1WTWA 3Q0AA 4JK1C 4M8AA 2F3VA 5JOBA 5M5WB 2B2VA 5JEAH 3MFYA 1IKMA 1C48A 2EY2A 1IHZA 1FR3A 1AEXA 2O4XA 3A56A 3DUZA 4WORA 2F0QA 2EVBA 5KNBA 4FF2A 1HUMA 1NCVA 2QCPX 5CGKA 1E0BA 1DZ1A 4OGQC 3H94A 4WJWA 4ABNA 1SSOA 5LL6S 3OHXC 2OT2A 2PO4A 1W6KA 2CHBD 5K36H 3SK6A 5CMDA 2SEBD 2ENBA 1RHPA 1BCPC 4KKUA 3N52A 5KNDA 2NBFA 1T5XD 1SYDA 1ET9A 1VF5C 2JEAI 1PZKD 1BO0A 1HA6A 1HHVA 4IQZA 4OO1I 2RQXA 4KY7A 2KEEA 5FK9C 2JA7B 3VR5A 1L0XB 5EPJA 3SK4A 2F0WA 4XIGS 3NK9A 3S14B 2A6HC 1LTAD 5FO7B 4IUUA 3URYA 3K6OA 5C0XG 1F2MA 1YNJD 2F0NA 3A8IE 1KLGD 3S1MB 2IWHA 1D5ZC 4N9PA 4C2MB 2JA6B 3IL8A 3GTJB 3PIP3 3VR4A 4LJZC 5BN5A 2NTSA 2AUKA 2IL8A 3P7JA 2EY5A 5JVH3 3P75A 3BVGA 1XTCD 5ELFA 3PO2B 3EFXD 5D14A 3J81L 2BCOA 2FINB 1SYGA 2PW5A 1TY0A 1EYDA 3J81E 4RWSC 3M7NA 2K32A 3NQIA 3I70A 2A6EC 3NPPA 4K2LA 1SNOA 1SYBA 4Z9CB 2SOBA 2HUGA 2CW0D 1B9NA 1F9QA 4XXEA 1SEBD 1DYQA 5C6AA 5JAVA 1KNEA 4EQPA 1VDZA 1SFOB 2K1BA 4DF7A 2NVXB 1EEFD 1D5MC 1EU4A 4H7BA 3J7AF 2MP1A 3H09A 1UNSA 2M9VA 3PUYA 1QCBD 2WKCA 2RDHA 5IODA 1PYWD 4ID6A 4PV1C 4C3JG 1STYA 1EIHA 4RGMA 4RGNA 2EJGC 4FXKC 4KV6A 3SK5A 1HFNA 4C3HB 1I4GA 1ZYRD 2BDNA 1IW7C 2EYLA 3GTQB 1HCZA 1GOZA 1BBXC 3BDCA 1K83B 2IT1A 2B2UC 2BDOA 4FP5D 4DK1A 4X3SA 3GTMB 4NDXA 2B63B 3D31A 3L7ZC 3MXNA 3TBIB 3MXUA 3VYRA 5EQ0A 5IGDA 1PTOH 2IX0A 2NWGA 1A3TA 3TP7A 4C3IG 1V8QA 1EOTA 4EGVA 4PNYA 2WB1B 2B2TC 1TWAB 2R7ZB 1Q1EA 2L9HA 3SDZA 3M85A 2BA0A 4QF4A 1E2VA 3K5NA 4A3MB 1SNPA 3WOEA 5ELDA 1SNMA 3CKIB 5EGTA 5I4DA 2XSCA 1A2UA 2XWBB 1LLRD 1F9PA 4C1NK 3ERQA 4DU9A 1RODA 1WVLA 2DNCA 2MPMA 3MXPA 1S5BD 3CQZB 1QE6A 4DXGA 5A2QL 3J80L 5C0XI 3K0YA 1LV9A 2KHSA 5I9PA 1QWYA 4KJNA 5A2QE 2R3ZA 2D9UA 3J80E 2NVTB 4BY7B 1FGBD 1XX8A 2A73B 2IJ0A 3RZOB 1Y1WB 5CC4A 3KBGA 3FDTA 1EYCA 1WTOA 4DNRB 3RUZA 4H0LC 1BR9A 5FO8B 4ZKCB 1E2ZA 3LX0A 1RF2D 1ILQA 3V96A 4EQNA 1S5ED 2PZUA 5IIFA 5EPLA 4X3UA 1Q8IA 2QEJC 2OEOA 2F0DA 2NYZD 3J7AV 2B2WA 4LMQD 1D6EC 3C1EA 3QB3A 1TIID 1CA6A 2L4NA 2AWNA 2JEBI 1A3UA 3GV6A 1HRJA 1BOSA 2Q8TA 4BWGB 1OXTA 3DEPA 3X3MA 4BS9A 4KD3A 2NVYB 3QOJA 5FLXL 1H9JA 1ESRA 3I73A 3FEWX 2MUYA 4R9WA 3R2IA 3FVQA 2F4IA 1JC7A 4K2KA 2XNAC 1EY5A 5FLXE 4A3KB 4K8IA 4JBWA 1LACA 5T1IA 4QB4A 2N88A 4K5WA 2K28A 3M4OB 1AW7A 4XDXA 2JE6I 4B9WA 1QNUA 4TRDA 3I4LA 5I6WA 1UEAB 2L11A 4Q5VA 2K33A 5F2DA 1HXYD 3K5OA 4BA1I 2F0PA 4B08A 4BA2I 4S3SA 2R61A 3MWYW 2NN6G 4X3TA 3NP8A 1J9OA 3KLSX 4Q0FA 1SMYC 2E74C 2KUMA 3HKZB 3I90A 3EJIA 4KTAA 1A3VA 4CJ1B 1JOQA 2K05A 5CV6A 4BBRB 4RHSA 4RAUC 3CHBD 1U4MA 5DNFA 2I07B 1RKNA 3QO2A 1TY2A 2JA5B 5ISRA 3AB9A 2O5JC 3OMCA 3BS1A 5CORA 5C44B 1HTLD 2XRQD 2F3WA 1E2WA 3MZ5A 3W2DA 3BG3A 1PTOB 3PUZA 2L55A 3H3VC 4ZUIA 4KKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JVH 3;  5DM7 3;  3PIO 3;  3PIP 3;  5JVG 3;  4WFN 3;  5DM6 3;  4U67 3; 
#chains in the Genus database with same CATH topology
 1SRU A;  3U9S A;  2EY6 A;  4LF4 Q;  3LWE A;  3EQL C;  2OQ0 A;  3SXH A;  3NTK A;  2RKS A;  2AUJ D;  1TT2 A;  4R8I A;  1V1P B;  1J8I A;  1O7Y A;  1IXR A;  2Q8R E;  1O7Z A;  1KC8 C;  1DM0 B;  2AKW B;  4ULL A;  2F4V L;  1SFO H;  1G6Z A;  3C46 A;  4AYB E;  2CW0 C;  1WTH A;  3KUP A;  4A3D B;  3ULJ A;  5C5M A;  2XTI A;  1TS4 A;  3CRK C;  3KDF A;  1W6J A;  2VB3 X;  2XRS D;  5JEA G;  4R4O A;  4POF A;  1VQG A;  2QW7 A;  4ILW A;  3UDX A;  3HOW B;  1TS5 A;  4HID A;  1RD9 D;  3HS0 C;  3QIA A;  1OXV A;  4LWC A;  2QKI C;  3P1H A;  2R92 H;  4F7X A;  3H0G B;  1GHK A;  2M00 A;  1JWU D;  4F8M A;  3BDL A;  5JJZ A;  4UP8 A;  2B63 G;  1CZG A;  2RSN A;  1R4Q B;  2E5L Q;  1X3Q A;  1B53 A;  4DV2 Q;  4RKL A;  1SND A;  2E2H H;  1KDA A;  5CV7 A;  2A68 D;  1BNZ A;  1KAB A;  2DJF C;  1OXS C;  1YNN D;  2I46 A;  1RTN A;  4NXM L;  4TSS A;  1IYU A;  1ENA A;  5C3X A;  4WFN 3;  1D5X C;  3R3O A;  5J1Z A;  1KL9 A;  4C3H H;  5IYC G;  2Q8I B;  4DR4 Q;  1YJN A;  4G4K A;  1PRT B;  2D5D A;  1PH8 A;  2IX1 A;  4A3F B;  3GTQ H;  2B2T A;  1DOK A;  5K36 G;  4FDB A;  1K83 H;  3ZYY X;  5IGF A;  1ZYR C;  1D8L A;  1Z9F A;  4B9X A;  2LS0 1;  4A3M G;  3KF6 B;  1A0I A;  1E22 A;  4IUV A;  5C4X B;  2F0G A;  3OPO A;  3T4A C;  1U4L A;  5D3D A;  3AYH B;  4FF4 A;  4ZRZ A;  1K0R A;  2VXW A;  3AEV A;  1N36 L;  2C9O A;  1LTL A;  4P2C B;  1CKM A;  2AQ1 B;  3VYT A;  4BY1 H;  5GAH C;  1WD0 A;  3NUC A;  2R7Z H;  4KHP L;  4M1U B;  1UE1 A;  2UXD L;  2RHS B;  3E3X A;  1CUK A;  1QUQ B;  1EQQ A;  3T56 B;  1KXL A;  1Y1V H;  4DV4 L;  1HZB A;  2NVQ B;  3S9W A;  2F0J A;  2F0S A;  3S1N H;  1B7Y B;  2WAQ E;  2D2C C;  1LTR D;  1MIU A;  3OIP A;  5C0X J;  3BZK A;  1IBL Q;  3TSS A;  1EIY B;  2XIW A;  2UXC Q;  2VL6 A;  3F8T A;  2ZXR A;  1Y1W G;  4FXD A;  2CVR A;  3SHL A;  4FNF A;  3VYS A;  3OSO A;  3WOF A;  1NY4 A;  2AQ2 B;  3VYU A;  1HPC A;  1S5C D;  3F2D A;  2B29 A;  5JPN C;  4IFD H;  5D3I B;  3TRE A;  1U4R A;  2HCC A;  1TWG B;  1SE2 A;  3CAM A;  4HMJ A;  4OEL B;  2WII B;  5M3F B;  3L9A X;  1YJW A;  2F0O A;  4AIM A;  4ZLT F;  5AJ3 Q;  3R93 A;  2K5Q A;  1STN A;  4X6A H;  2EYF A;  4R4C A;  1IZ6 A;  3UI2 A;  3KK7 A;  2NN6 I;  1OXU A;  3I4N B;  1U4P A;  5E4X A;  3K58 A;  5M3M H;  4APV A;  2E2I H;  1VQC A;  3A55 A;  4XTC S;  3E0E A;  4A3G G;  1K8M A;  5LHY 1;  3S2H B;  3RZO H;  2G5D A;  5ELE A;  3I4M B;  2B39 A;  3T51 B;  1JB3 A;  1ICF B;  4HED A;  3A5U A;  2F0T A;  1S5F D;  5EJW A;  2F1M A;  2HCI A;  3E6Z X;  4NB3 A;  1AZQ A;  3CU7 A;  1EEI D;  1PZJ D;  4KN7 C;  4JI3 L;  3GTK H;  1EY4 A;  4XT3 B;  5M5X B;  4RGT A;  3VA7 A;  4JC0 A;  4DV1 Q;  1QJO A;  1PTO C;  3RD4 A;  1SLJ A;  2KJX A;  4KY6 A;  1X3G A;  1HNZ L;  1C8C A;  2X69 A;  4OL7 A;  2A69 D;  4G57 A;  3J81 i;  4CJ2 C;  2JQO A;  5EKK A;  4U68 A;  1PVO A;  3NE5 B;  4A3B H;  5K5P A;  3G48 A;  3DEO A;  4X3K A;  1N9W A;  3HP3 A;  4A3I G;  4LF6 Q;  1I94 L;  1HUN A;  4KHV A;  2D0P A;  3TP8 A;  2QIL A;  3ULP A;  3HOY G;  2JP1 A;  3CCJ A;  4K8J A;  2BE5 C;  1K3B C;  2KCC A;  2N78 A;  1GJX A;  3PV0 A;  1B3Q A;  3MFG A;  4CKB A;  3HOU H;  4DR6 Q;  4RFB A;  3UE1 A;  4WJ3 M;  1WFQ A;  4A3C H;  2A5H A;  2YU9 B;  1PHJ A;  4J1M A;  2QF7 A;  4YHH L;  1EZ6 A;  2K5W A;  3I8Z A;  1E1O A;  2X6G A;  3PF5 A;  3KBX A;  5IWA L;  4V0B A;  3RR5 A;  1N33 Q;  2HD3 A;  3R8B A;  2CKZ B;  2VQE L;  1EFI D;  1O78 A;  4OEM B;  1EY7 A;  4A3K H;  4QCL A;  1VQ5 A;  3Q6S A;  1L0W A;  3NWS A;  1XMO L;  2C35 B;  4LF4 L;  2EOT A;  4EQO A;  2RCF A;  2CH4 A;  1G29 1;  4KLK A;  5CBA E;  2B8G A;  4O1N A;  1KDC A;  1LYL A;  5KNC A;  4H44 C;  3K59 A;  3R2T A;  2ZM6 Q;  4HIM A;  2KEC A;  4UHV A;  1VQO A;  3KLS A;  1LTI D;  1KDB A;  2R92 B;  1SE4 A;  4XYO A;  1PRT C;  3OIQ A;  4KD4 A;  5IP9 H;  1CTM A;  3H6M A;  5C44 G;  1VQE A;  2RDG A;  2NUC A;  1UEB A;  3N6R A;  4A3L H;  4HIK A;  2EYM A;  4JI4 Q;  2E2H B;  2PCF B;  2XN9 C;  1I4Q A;  2KHI A;  3AQQ A;  1I6V C;  2B2Y A;  2L5T A;  3GTO B;  3H3V I;  3OYY A;  2HHH Q;  3VR3 A;  1SXT A;  3OWE B;  4R4T A;  5I6Y A;  2I5L X;  3UDF A;  1E1T A;  2E76 C;  5D65 A;  2J7Z A;  2HIV A;  2KA7 A;  1JJC B;  4DAY B;  5LMU Q;  4A75 A;  4A3J G;  2EPB A;  1XNQ Q;  1Z47 A;  4BBR H;  4DV6 L;  1PFS A;  2UU9 Q;  1RJT A;  2F0U A;  2Q2I A;  4DN4 M;  4PMB A;  5C4H A;  4A4I A;  2CH4 W;  4DV2 L;  2KVM A;  4DFA A;  1SNC A;  5I2Y A;  4MZ9 A;  4YY3 L;  2GVB A;  1B3A A;  2JA5 H;  5GQO A;  1N32 Q;  2B3G A;  3ER0 A;  5H1S E;  1Y14 B;  2F0L A;  1VQM A;  1LT6 D;  4K5X A;  4XYQ A;  5C3E G;  2K75 A;  4K14 A;  4JG2 A;  4DR4 L;  4P71 A;  2PW7 A;  2F0M A;  2PZW A;  1MJC A;  2HDM A;  1TR5 A;  1VQ4 A;  3HOW G;  1VQK A;  4BXX G;  3DMU A;  4P74 A;  5G3L F;  2X6L A;  4H13 C;  4DV0 L;  3MVV A;  4BY1 B;  1FGU A;  1NTG A;  2DNE A;  4RA8 A;  5CYU A;  4OX9 Q;  3SK8 A;  1DGS A;  3IFD A;  1Y1V B;  4PQX A;  4NP5 A;  5IGC A;  1KNA A;  4F88 A;  4DUZ Q;  3S1N B;  1K3R A;  1L2F A;  5E4W C;  1VQ6 A;  5G3L D;  2C5C A;  1ZEQ X;  2N55 A;  3T1Y Q;  4A3D H;  3SR1 A;  1CA5 A;  1KAW A;  2OQK A;  1G2S A;  1S5D D;  5CV5 A;  1JJ2 A;  4HJ5 A;  4FYD A;  2KCN A;  4WRD A;  1RTO A;  2DUD A;  4QMG A;  4JI6 Q;  3O13 A;  4OWX B;  3PIP A;  1CM9 A;  1YI2 A;  1NBW A;  3BZC A;  4A3F G;  1TS2 A;  5LMN L;  1D7Q A;  3J80 i;  2K03 A;  2CCZ A;  3CPW A;  1H9M A;  3CF5 A;  3H0G H;  3TS0 A;  1IBL L;  4PZ6 A;  3HG9 A;  5CV9 A;  5T1G A;  1Y8N B;  2YTY A;  4AQY Q;  1MJE A;  4KI0 A;  3ICE A;  1D1I A;  1VCI A;  3A8J E;  4JI5 Q;  5M3M B;  2E75 C;  2E2I B;  1VQN A;  1H9S B;  5M9O A;  2I5M X;  3I3C A;  1X54 A;  1SYC A;  2NB0 A;  3VR2 A;  3BU2 A;  4LF7 Q;  3D4R A;  1DD2 A;  1RDP D;  2Z6B A;  4N8X 1;  5DM6 3;  4HAE A;  2HT1 A;  3Q23 A;  1PFB A;  1YVC A;  2A6H D;  4DK6 C;  5AJ3 L;  1G6P A;  2KBN A;  1IBK Q;  1CQF A;  2HQL A;  3KFU A;  3C3L A;  2Z0S A;  1CQV A;  3QWN A;  4JOI C;  4B3T L;  1B4O A;  3KF8 B;  2XWJ B;  3ND8 A;  3GTG H;  4IUT A;  3BZD B;  1ML0 D;  3PIO 3;  3GTK B;  3CPF A;  1Q1B A;  5FLM G;  1YIT A;  3CCQ A;  4KK7 A;  3E9I A;  1LAB A;  5ELB A;  1SRO A;  5C4X H;  3ERS X;  4JBM A;  2K5H A;  4OIK A;  2KEN A;  4RH6 A;  1YIJ A;  4UY8 C;  2VZA A;  1GHJ A;  2IPK D;  1HZC A;  4A3B B;  1EWH A;  3QOL A;  2RSO A;  2OTL A;  4K0K Q;  4L63 B;  3FP9 A;  4YIJ A;  3S1R H;  3M3Y H;  3WWV A;  2DY8 A;  4FF1 A;  3HOU B;  1WTQ A;  1W2B A;  3IFT A;  1QVG A;  4GKK Q;  4IUP A;  4O2D A;  1MBY A;  1RL2 A;  1AN8 A;  1SYF A;  1EY8 A;  4QIW B;  3MTS A;  4XQQ A;  1WJJ A;  1JR0 D;  2A6E D;  3PUW A;  3OW7 A;  4JYA L;  1E7Z A;  3GP7 A;  4LF6 L;  4BBS H;  3DWQ A;  5C4Z A;  5GAE C;  4LNQ A;  3TEH B;  3ONA B;  4ZK9 B;  4KJO A;  2EJM A;  2K5D A;  2ASB A;  1SYE A;  3S1Q B;  1VQH A;  2LMC B;  1M4V A;  2CQO A;  3JAM L;  2EIF A;  1TWG H;  4QJF A;  1LM0 A;  2DN8 A;  5M3F H;  2OXP A;  3CCM A;  3JAM E;  2EXZ A;  2BH2 A;  3SEB A;  1BXT A;  1MSH A;  2EDG A;  1FJG Q;  2SDF A;  2F0K A;  1M8A A;  1WTX A;  3K7A B;  1B1Z A;  1CZW A;  5IT9 L;  2WP8 J;  4N8F A;  1SE8 A;  4R8N A;  5DEH A;  3MEH A;  3J7A 5;  3PO2 G;  3S2H H;  3TP6 A;  3OTO Q;  1WTR A;  4DR5 Q;  1I4H A;  1QVC A;  3DM1 A;  1K8G A;  2O5I C;  3I4M H;  1A8V A;  5IT9 E;  4JI7 L;  3DWA A;  3PUX A;  1G8Z D;  2R7D A;  4NW2 A;  5NUC A;  2ZM6 L;  4QQB X;  1K73 C;  1EYG A;  4JCV E;  4L6T B;  2P5Z X;  3F2U A;  3I4O A;  3CCR A;  1VMC A;  1EL0 A;  1ONL A;  4F87 A;  3KJO A;  2Z1C A;  1VMP A;  1JCK B;  1YNJ C;  3RNU A;  3NQT A;  4EQ5 A;  2M2L A;  4IPD A;  3CCV A;  2JA8 B;  1BKB A;  1IW7 D;  1EYA A;  4JI4 L;  1YHB A;  3BYT B;  3J7Y W;  1WCM B;  3BVM A;  1LTT D;  5JEA J;  1M90 C;  2PZT A;  2F0V A;  3I91 A;  2F03 A;  1U9R A;  4P73 A;  1N8R C;  5LMU L;  2EYP A;  4IUR A;  5AFW A;  2UU9 L;  3VR6 A;  2O2L D;  4ODG A;  4ZQ3 A;  5IYB H;  2KQ3 A;  3BYY B;  3Q8D A;  5BR8 Q;  4DR2 Q;  3W1G A;  1K8O A;  5HY6 A;  4J8Q A;  1DXM A;  2F0H A;  3G7L A;  1I4P A;  1PH5 A;  1PH2 A;  1N32 L;  1TS3 A;  3TS2 A;  4C3J B;  1QZG A;  2VB2 X;  4OIJ A;  4OO1 H;  1FYC A;  5IT9 c;  3M4Q A;  1K0S A;  4CHT B;  2GN5 A;  4LFC Q;  4LFB L;  4MHE A;  3FPU B;  4H02 A;  5TSS A;  1D1K A;  4JPB W;  1O80 A;  5KYI A;  5C5L A;  3MXG A;  1VQJ A;  5CV4 A;  3FKI H;  1JIC A;  1C7Y A;  1PZI D;  1PXU A;  4JI0 L;  2ZXO A;  3Q22 A;  4FXG C;  1STB A;  4C3H G;  3HGB A;  5M5Y B;  2F3I A;  2H4O A;  1UE6 A;  1HTP A;  4DR7 L;  3HRZ C;  2FHT A;  4DUZ L;  2Y0S B;  5KRU A;  3LNN A;  3MEF A;  2PMZ B;  4A93 B;  4DR1 L;  1JE4 A;  5IGE A;  1X6O A;  1O7L A;  3VA5 A;  3T1Y L;  1KLU D;  4IOA A;  4CBV A;  2F0F A;  1HNX Q;  2B2U A;  3NWT A;  5C3W A;  1CT1 D;  4XQN A;  4JI6 L;  5HUR A;  3IAY A;  1EUJ A;  3U9O A;  1S3O A;  3RN2 A;  4IFD J;  2DY7 A;  3NHH A;  4X66 Q;  4YCV A;  5IP7 G;  1NJI C;  1VS0 A;  1QB5 D;  1X32 A;  2EYO A;  2SNM A;  2ZXP A;  4GNX A;  3GTO H;  2PQA B;  1A15 A;  1BUV T;  4XT1 B;  4CDE C;  2EZV A;  1V43 A;  4MN3 A;  2WB1 G;  3FMC A;  2MJ8 A;  3TME A;  4ALP A;  3TRZ A;  4CKC A;  1TVX A;  4HSP A;  1YJ9 A;  4AQY L;  1B50 A;  2R7Z G;  2J0T D;  1A6X A;  1I3Q H;  2MGS A;  1PLF A;  2VQF Q;  2ZT9 C;  1Y1V G;  3GTG B;  1VF7 A;  1PA6 A;  1CI3 M;  1DON A;  1LTS D;  1OXX K;  2E8G A;  4JV5 Q;  1AP0 A;  4JI1 Q;  3ND9 A;  1YEZ A;  1S4Z A;  2AWO A;  1GUG A;  3PF4 A;  4LUV A;  4DV5 Q;  1G91 A;  2ALY B;  4WJ4 A;  5GRO A;  1PYB A;  1WOC A;  4IFD G;  4AH6 A;  3D8G A;  2TMP A;  3C1F A;  3DWP A;  2FMM A;  2WV6 D;  3KDF B;  3S1R B;  5KYL A;  3M3Y B;  4DV3 L;  1OO9 B;  3OOC A;  3QG1 A;  2F0E A;  5M3M G;  4HSV A;  4ZAI A;  4BY7 G;  2EY1 A;  3V2T A;  4K0K L;  1JE5 A;  4JVZ A;  5ELC A;  4BBS B;  1JMC A;  3B6Y A;  1WTP A;  3STB D;  3LGJ A;  4HR7 B;  4K6D A;  2JXM B;  2E2J H;  3WDN A;  1ICW A;  1G2T A;  1X3P A;  1FL0 A;  4JI8 L;  2EYH A;  4DV7 Q;  1PH9 A;  3GTL H;  2Z9H A;  1EZ8 A;  4GKK L;  1IKL A;  1CFM A;  3ITP A;  4R4Q A;  1NE3 A;  3HOV B;  2A8V A;  1I50 H;  1A2T A;  2WAQ B;  4JOI A;  2B2W C;  4GOP A;  3S16 H;  2CQA A;  1Y8O B;  3PUV A;  4YCU A;  3LWU A;  4B3M Q;  3HOZ B;  2OF1 A;  5JJK A;  2I5H A;  3F2C A;  1CSQ A;  1Q12 A;  3E5S A;  3D4D A;  1KAA A;  1KRS A;  4A3B G;  3E0J A;  3FPP A;  5IGG A;  4B3S L;  1I5F A;  1EQR A;  4RKB A;  4A3E H;  2IX3 A;  1N34 Q;  4DUY Q;  3CC2 A;  1EQV A;  3NTH A;  3PGZ A;  3HOU G;  3HFZ B;  2Q2H A;  2ATW A;  2OTJ A;  4A3C G;  5C4J B;  2N3S A;  1NUC A;  4LAA A;  1HH2 P;  3VDY A;  1HR0 Q;  1UWV A;  4P75 A;  4KKT A;  3I72 A;  4DR5 L;  4DGZ A;  3V05 A;  1SMY D;  1S72 A;  1QVF A;  3OW2 A;  2LKV A;  2QA4 A;  1XMQ L;  1SE3 A;  4XQJ A;  2CWA A;  2Z8L A;  3ULL A;  4HCE A;  3HEJ A;  1JJG A;  1E24 A;  1FD7 D;  2Z4H A;  4IZ8 A;  4A3K G;  1EY6 A;  3GD7 A;  4KN4 C;  2A74 C;  1NMF A;  4DAP A;  4HCS A;  1NR2 A;  2ZTD A;  2NZO A;  3MC0 B;  1XXG A;  2FFK B;  3MAQ A;  1I6H H;  1HA5 A;  4LF9 Q;  4L5R C;  2QDL A;  1VQ9 A;  3T53 B;  2VS1 A;  1AZP A;  1STG A;  3NBI A;  5JPM C;  4A3G H;  4X65 Q;  1TU2 B;  2VNU D;  4QUF A;  1EU3 A;  1H9R A;  3TZU A;  1VQ7 A;  1Q3L A;  3T13 A;  1GUN A;  4IUQ A;  5C0X H;  1F9R A;  5IP9 G;  4HMI A;  2YTV A;  4DAY A;  4KY5 A;  1OTC A;  2OCE A;  2TSS A;  3S1Q H;  3S17 H;  4A3L G;  5BR8 L;  3UDI A;  3NSW A;  2EQS A;  2ICE C;  4LF8 Q;  1TQO A;  4HN7 A;  4QL5 A;  3GO5 A;  3A7A B;  1PH4 A;  1R9T B;  4GN3 B;  1R4P B;  3FKI B;  3OMG A;  2WKD A;  1F77 A;  3EVQ A;  4DKA C;  3HKZ G;  4I7A A;  5EAY A;  5L37 A;  1WTV A;  2RA4 A;  2WAC A;  1Y69 U;  1JWM D;  1HFG A;  1BDO A;  5HGT A;  2H1E A;  3F1Z A;  1DOL A;  2AQ3 B;  5EKI A;  4BBR G;  1GUT A;  3F2B A;  5BN3 A;  2RVL A;  4B3R Q;  2CWP A;  1XYI A;  3K7A H;  1PFM A;  1Q90 A;  4GKJ Q;  4GZY C;  2K4K A;  2PYK A;  2AHO B;  2JA5 G;  3HOX H;  1SR3 A;  2RF4 A;  3BDO A;  3RLF A;  5LL6 X;  4E6I A;  4NXN Q;  5J39 A;  2HDL A;  1XTD A;  2UXB Q;  2JK8 A;  4YWM A;  3HZX A;  2EJF C;  4TKO B;  2FJ2 A;  2K5N A;  3C2P A;  1TWC H;  5CV8 A;  1V1O A;  3OWF A;  1HNX L;  1GD7 A;  3T1H Q;  1I3Q B;  2E5L L;  4I65 A;  1GO3 E;  1CKN A;  3SVM A;  4FF3 A;  2JA8 H;  4IFD I;  2OWO A;  1MKH A;  2IHF A;  3J81 c;  4IPG A;  1J6Q A;  1WCM H;  1WI5 A;  4MNO A;  4UAI A;  3TP5 A;  2Q2U A;  5COY A;  2NTT A;  1JWS D;  2ID0 A;  2RBM A;  1IYV A;  4N9T A;  2WFW A;  1QG7 A;  2YTX A;  3I2Z A;  4A3D G;  3PO3 H;  2DGY A;  1PV4 A;  5IE8 A;  3W3A A;  2JYO A;  1MGS A;  1TWF H;  4IPC A;  4YWL A;  2ICI A;  2N49 A;  2WB1 E;  5IY0 A;  5FKA C;  1HNW Q;  3GDE A;  2VQF L;  1EY0 A;  1AH9 A;  1SJE D;  1H9S A;  1BQQ T;  1EQT A;  2Y0S G;  3CC4 A;  1SBB B;  4JV5 L;  2Z4I A;  3H0G G;  4C3J H;  1MSG A;  1L0Y B;  4IUN A;  1BCP F;  3S2D H;  4DNT B;  1II3 A;  1LO5 D;  1UE7 A;  4ZUJ A;  3M4Y A;  2E2D C;  2B2V C;  3EN2 A;  2R93 H;  1PH6 A;  3NBH A;  4RCO A;  3CD6 A;  3KF8 A;  5E1F A;  1ENC A;  4C1N I;  3GTP H;  1NR4 A;  2V4D A;  5I9O A;  1I4X A;  3AFP A;  1A63 A;  3RLO A;  1BCP D;  4O0A A;  5CBE E;  1EWC A;  2E2J B;  2EYJ A;  5M5Y H;  4IJL A;  5FJ8 H;  3GTL B;  1FNV A;  1B9M A;  1STE A;  3D6C A;  5I2X A;  5JVG 3;  2FMC A;  1T9H A;  1X9N A;  3BVZ A;  1SDF A;  4O42 A;  2MFI A;  4A93 H;  1U0L A;  4U67 3;  1I50 B;  4CKE A;  1ET6 A;  3TDQ A;  2UXC L;  3S16 B;  3Q24 A;  4DXF A;  4G7Z C;  5C4X G;  3M7G A;  4KHZ A;  5GAG C;  1KTK A;  1JQY D;  4CDC C;  4C3I H;  2QDB A;  1ENF A;  1EY9 A;  2VUM H;  5CR3 A;  1JOR A;  3S15 B;  4NKL A;  5KEE A;  1GUW A;  3MXN B;  2J4X A;  3A7L A;  4NPS A;  1CHP D;  3X3N A;  3RLN A;  3AMU A;  4IPH A;  1MD2 D;  4A3E B;  1IYJ B;  3KLR A;  1YBY A;  3PMF A;  1DOM A;  3L3O C;  4MTK A;  1T5E A;  4UDU C;  3NXW A;  4B3M L;  1PDQ A;  1VQA A;  1PTO F;  2A68 C;  1YNN C;  5EBC A;  3U58 A;  2L0C A;  4GLX A;  2K50 A;  3I7F A;  4RHR A;  5GAD C;  1C0A A;  3RMH A;  1IBM Q;  2G9D A;  2K7V A;  2K52 A;  5M5W H;  1EOV A;  2ZJP A;  3SE0 A;  5EBD A;  3NTI A;  4IAL A;  4RCN A;  4ZYS A;  1ESF A;  5A35 A;  2XVS A;  1N34 L;  1PTO D;  2PPB C;  1PH3 A;  4DNI A;  4DUY L;  1MHW C;  3AU7 A;  1N36 Q;  4RMF A;  4K6L A;  4L5S A;  3J81 j;  1HR0 L;  1XJV A;  1I6H B;  2UUA Q;  5M3F G;  4DV1 L;  2LSS A;  3RZD B;  2UXD Q;  2WAQ G;  4V19 0;  4J6H A;  3NEM A;  4CGY B;  1AFP A;  1P8L A;  1HR0 W;  1SAP A;  2BE5 D;  1LT5 D;  4A3G B;  3I4N G;  1HQR D;  2JSO A;  5E3F A;  1LT3 D;  3TN2 A;  1TKW B;  2GVA A;  1LTB D;  2SNS A;  3S24 A;  1ZXT A;  3K5M A;  1NSN S;  2KHJ A;  4KMU C;  4MIU A;  1U5K A;  1Q7Y C;  3I4M G;  4CJ0 B;  2LY7 A;  5IYD G;  4DR6 L;  3JAM i;  2UUB Q;  2K01 A;  3S17 B;  4LUO A;  3HOV H;  3STB C;  4A76 A;  1F2Z A;  1I4R A;  2G9H D;  1N33 L;  1PFN A;  1O7I A;  1ILP A;  2K6A A;  3DHQ A;  1LT4 D;  3EA6 A;  4HTH A;  1PRT F;  1NAP A;  2L12 A;  1YHA A;  3HOZ H;  3G4S A;  3K8A A;  4DPG A;  2R6G A;  3D4W A;  4X62 Q;  4CDD C;  5KIX A;  4FO2 A;  1F2Y A;  4HJ9 A;  4A3I B;  5EKL A;  1QIL A;  3HOY B;  2BOS A;  3CCU A;  3HOX B;  1H95 A;  1ZKO A;  4OHJ A;  2BH8 A;  2JA7 H;  1BCP B;  1PRT D;  1F2L A;  3D3R A;  3GQB A;  1LUZ A;  3HKZ E;  3MHB A;  1BF4 A;  1V1P A;  5IYB G;  4IN3 A;  1C9O A;  3NEN A;  5C4J H;  1GUO A;  3E9H A;  5ELN A;  1EIG A;  4UP9 A;  3JC6 6;  4DK0 A;  4GKJ L;  1GUS A;  1TWC B;  2KED A;  3TZD A;  5EPK A;  2MO1 A;  4PMW A;  2QEX A;  4UPA A;  5FOB B;  4NMZ A;  1GXD C;  1B2T A;  4OO1 G;  4I7Z C;  1RCV D;  3ERO A;  1L1O B;  2LFN A;  3S1M H;  2B8F A;  2UXB L;  2HHH L;  1C4Q A;  2JA6 H;  3GTJ H;  1I94 Q;  3FKI G;  1XWE A;  1MI2 A;  3GV3 A;  1JOK A;  3PO3 B;  2IW3 A;  4L8J A;  1F9S A;  1XNQ L;  4G7O C;  1TWF B;  2A69 C;  5BN4 A;  2K04 A;  3CRL C;  4DA2 A;  5FLX c;  2HQE A;  2NZ1 D;  3IKJ A;  4QUC A;  1FNU A;  4LF5 Q;  5IOC A;  3J7Z C;  2KCT A;  5IGB A;  1H9K A;  1FNW A;  3UE0 A;  2PNR C;  2R92 G;  2L1B A;  2B2Y C;  4EVO A;  5KGU A;  1SNQ A;  2K14 A;  4C56 C;  2D62 A;  1DCZ A;  3S2D B;  1Z7T A;  3FRP B;  3K57 A;  1AE2 A;  1HQM C;  2NN6 H;  1CHQ D;  1STH A;  3W1B A;  1VQP A;  2R93 B;  1HNW L;  2D0O A;  5FO9 B;  2F0I A;  2KCM A;  1Q46 A;  4PMC A;  3U4V A;  1XMO Q;  1R9T H;  1Z6H A;  4ME5 A;  3G6J B;  3GTP B;  4DR3 Q;  4A3J B;  3H91 A;  4RGO S;  2EE1 A;  3PIO A;  3M9B A;  3CXC A;  4LK1 C;  3KF6 A;  4OX9 L;  2Y0S E;  4K5V A;  5J3B A;  2PMZ E;  3CCE A;  2KOL A;  1QOH A;  2MHV A;  3A8K E;  3H15 A;  2PQE A;  1STA A;  4G7H C;  1J5E Q;  1VQL A;  3QR8 A;  1TWH B;  1B44 D;  4PG3 A;  5C3E B;  2UUC Q;  1JOO A;  1Y8P B;  4AYB B;  2NVX H;  1D2B A;  1B8A A;  2WIN B;  1IL8 A;  3K5L A;  1SJH D;  1UUP A;  2FXQ A;  3A54 A;  1DJR D;  1UAP A;  3P20 A;  1QNK A;  1QUQ A;  4C3I B;  3MA2 B;  2VUM B;  1Q8K A;  1LTG D;  4TQU S;  5DM7 3;  2ZTC A;  4IJH A;  3K81 C;  4FVM A;  3D6W A;  4ZCK A;  2L15 A;  2GA4 B;  4L5T A;  4BY1 G;  4Y7N B;  1PMR A;  4DV6 Q;  2RDF A;  1CK1 A;  3QJY A;  4DAV A;  4ZKB B;  3DXJ C;  1WD1 A;  2BA1 A;  4JI5 L;  3T16 A;  2YYZ A;  5J22 A;  5DAU A;  1WTW A;  3Q0A A;  4YY3 Q;  4JK1 C;  4M8A A;  4DAM A;  2F3V A;  1WYD A;  4LF7 L;  5JOB A;  5M5W B;  2B2V A;  2I0Q A;  5JEA H;  3MFY A;  1IKM A;  1C48 A;  1HZA A;  4GS3 A;  1IBK L;  2EY2 A;  1IHZ A;  1FR3 A;  1X3F A;  1YZ6 A;  1AEX A;  2O4X A;  1P16 A;  3A56 A;  3DUZ A;  4WOR A;  2F0Q A;  4DV0 Q;  2EVB A;  5KNB A;  3GTM H;  2N8N A;  2B63 H;  4FF2 A;  1IBM L;  4R1J A;  1HUM A;  1NCV A;  2QCP X;  4ME3 A;  5CGK A;  1QZH A;  1E0B A;  1DZ1 A;  3HKS A;  4OGQ C;  2ZTE A;  3H94 A;  5IP7 H;  1PH7 A;  4WJW A;  4ABN A;  3CP0 A;  1SSO A;  3CCS A;  3A74 A;  1EWI A;  5LL6 S;  1HZ9 A;  5IYC H;  2UUA L;  1TWA H;  4TVA B;  3OHX C;  2Z6K C;  2OT2 A;  3FHW A;  2PO4 A;  1W6K A;  3UDG A;  2Q2T A;  1KD1 C;  4A3E G;  2CHB D;  5K36 H;  4GNX B;  3SK6 A;  1VQ8 A;  2EXD A;  1NNX A;  5CMD A;  2SEB D;  2ENB A;  1RHP A;  5LMN Q;  4X64 Q;  3H3V H;  4A3M H;  1BCP C;  2DJG C;  4KKU A;  3N52 A;  3W5O A;  5KND A;  2NBF A;  1T5X D;  1S40 A;  1V9P A;  1SYD A;  2UUB L;  1ET9 A;  1VF5 C;  3PSI A;  2JEA I;  1PZK D;  1BO0 A;  2IY5 B;  2JA9 A;  1Q82 C;  3KLW A;  1HA6 A;  3CQZ H;  3S15 H;  3D0F A;  1HHV A;  3IRB A;  4IQZ A;  1BBU A;  1JB7 A;  3K7U C;  1X3E A;  1XPU A;  4OO1 I;  2RQX A;  4KY7 A;  2KEE A;  5FK9 C;  2JA7 B;  1KHI A;  1L1O C;  3VR5 A;  1L0X B;  4OXP A;  2MNA A;  1FJG L;  5EPJ A;  3SK4 A;  4B3T Q;  4HIO A;  2NVT H;  4X62 L;  2F0W A;  5HGQ A;  4XIG S;  4BY7 H;  3NK9 A;  3S14 B;  4GN5 A;  2A6H C;  3OTO L;  1LTA D;  5FO7 B;  1Y1W H;  5JJL A;  1K28 A;  2PI2 A;  4IUU A;  3A0J A;  3URY A;  3K6O A;  4IO9 A;  1PYS B;  5C0X G;  1XPO A;  1M1K C;  1F2M A;  1YNJ D;  2F0N A;  3A8I E;  1KLG D;  3S1M B;  2IWH A;  1D5Z C;  4N9P A;  4C2M B;  2JA6 B;  3IL8 A;  3GTJ B;  1CKO A;  3PIP 3;  1EIF A;  3VR4 A;  4LJZ C;  5BN5 A;  2NTS A;  2AUK A;  5E7N A;  3AFQ A;  3RZD H;  2IL8 A;  3P7J A;  2EY5 A;  1SN8 A;  4JI2 Q;  2JN4 A;  5JVH 3;  2A19 A;  2LXK A;  3P75 A;  3BVG A;  4QGU A;  1XTC D;  5ELF A;  3PO2 B;  3EFX D;  5D14 A;  3J81 L;  2BCO A;  4JYA Q;  2FIN B;  1SYG A;  4GOP B;  2PW5 A;  3I55 A;  1TY0 A;  4IOC A;  3HOX G;  1EYD A;  3CW2 C;  3J81 E;  4RWS C;  2PI2 E;  3M7N A;  2K32 A;  3NQI A;  3U50 C;  3I70 A;  2A6E C;  3NPP A;  4Y52 H;  4DR2 L;  3PQI A;  4K2L A;  1SNO A;  1SYB A;  4Z9C B;  2NVY H;  4YCW A;  2SOB A;  4LF5 L;  4P72 A;  1B70 B;  2HUG A;  1VQD A;  2CW0 D;  3TQY A;  1B9N A;  1F9Q A;  4XXE A;  1SEB D;  1DYQ A;  3SGI A;  4MTN A;  1W3S A;  5C6A A;  4LFA Q;  5JAV A;  1KNE A;  4EQP A;  1VDZ A;  4LFC L;  2JA8 G;  1SFO B;  2K1B A;  1GKH A;  1XNR Q;  4A3I H;  2QGQ A;  2ZJR A;  1WCM G;  4DF7 A;  3CCL A;  3HOY H;  4DR3 L;  2NVX B;  1EEF D;  1D5M C;  4JI7 Q;  1GVP A;  1EU4 A;  3M4O H;  4H7B A;  3J7A F;  3PO3 G;  3K80 C;  3PCO B;  2MP1 A;  1K9M C;  1J5E L;  3H09 A;  1BVS A;  1UNS A;  2M9V A;  2F52 A;  3PUY A;  1QCB D;  2WKC A;  2RDH A;  3KJP A;  1JT8 A;  5IOD A;  1PYW D;  3L2P A;  2UUC L;  1A62 A;  4ID6 A;  4L5Q A;  4PV1 C;  4C3J G;  1KIX A;  1STY A;  1EIH A;  2R7F A;  4RGM A;  4RGN A;  2EJG C;  4X66 L;  4FXK C;  3DM3 A;  4KV6 A;  1PH1 A;  1E3P A;  2R93 G;  2AMC B;  4DK3 C;  3SK5 A;  4POG A;  1HFN A;  4C3H B;  1I4G A;  1ZYR D;  2ZJQ A;  2BDN A;  1IW7 C;  2EYL A;  1ASZ A;  1VQI A;  3EIV A;  3GTQ B;  3EBE A;  1HCZ A;  5FJ8 G;  1GOZ A;  1BBX C;  3BDC A;  1K83 B;  2IT1 A;  2B2U C;  1YNX A;  2BDO A;  4FP5 D;  3DLL A;  4DK1 A;  4X3S A;  3GTM B;  4NDX A;  5C44 H;  2B63 B;  4A93 G;  4PZ8 A;  3D31 A;  3L7Z C;  3MXN A;  3TBI B;  4JI1 L;  4GNX C;  3MXU A;  3VYR A;  4YWK A;  4AYB G;  5EQ0 A;  2IHE A;  5IGD A;  1PTO H;  2IX0 A;  4LFB Q;  4OWW B;  2F4V Q;  4DV5 L;  2NWG A;  2MO0 A;  1A3T A;  3TP7 A;  3CME A;  4C3I G;  1V8Q A;  1EOT A;  4EGV A;  2VUM G;  2MQH A;  4PNY A;  1HJP A;  2WB1 B;  4A3J H;  4JI0 Q;  1V1Q A;  2B2T C;  1TWA B;  2R7Z B;  2RCN A;  1Q1E A;  2L9H A;  4JBJ A;  3SDZ A;  3M85 A;  2VY3 A;  1XPR A;  4DR7 Q;  2BA0 A;  4QF4 A;  4HJ8 A;  2YV5 A;  1E2V A;  3K5N A;  4DR1 Q;  1Q81 C;  1TWH H;  4A3M B;  1SNP A;  3WOE A;  1ASY A;  5ELD A;  1SNM A;  5C3E H;  3CKI B;  5EGT A;  5I4D A;  2XSC A;  1A2U A;  2XWB B;  1YHQ A;  1LLR D;  1F9P A;  1CKN B;  3ERQ A;  4C1N K;  5ELO A;  4DV7 L;  4DU9 A;  1ROD A;  1WVL A;  2DNC A;  3HOW H;  2MPM A;  3MXP A;  1SMX A;  4BXX H;  1S5B D;  3CQZ B;  1EFW A;  4NXM Q;  1QE6 A;  4DXG A;  4GLV B;  4X64 L;  5A2Q L;  4QY7 A;  3J80 L;  3G6E A;  5C0X I;  3K0Y A;  1LV9 A;  4Y7N H;  2KHS A;  5LMN W;  5I9P A;  1QWY A;  4KJN A;  5A2Q E;  2R3Z A;  2D9U A;  4GLA C;  3J80 E;  2NVT B;  4BY7 B;  1FGB D;  1XX8 A;  2A73 B;  2IJ0 A;  3RZO B;  1Y1W B;  5CC4 A;  1NMG A;  3RN5 A;  4HJ7 A;  3KBG A;  3FDT A;  1EYC A;  4BBS G;  1WTO A;  4DNR B;  3RUZ A;  4H0L C;  1X56 A;  3CC7 A;  1BR9 A;  5FO8 B;  4ZKC B;  4A3F H;  3NBH B;  1E2Z A;  1X65 A;  3LX0 A;  1RF2 D;  1ILQ A;  4GOP C;  2Z6K A;  3V96 A;  4EQN A;  2XGT A;  1S5E D;  4UP7 A;  3HOV G;  2PZU A;  4GN4 B;  5IIF A;  3NEL A;  5EPL A;  4R4I A;  4DV3 Q;  4KHP Q;  3G71 A;  4J15 A;  3BJU A;  4QIW E;  1BBW A;  1IL2 A;  4X3U A;  1Q8I A;  4DV4 Q;  2QEJ C;  2OEO A;  4OON A;  3HOZ G;  2F0D A;  2NYZ D;  3J7A V;  2B2W A;  1VQB A;  4LMQ D;  1D6E C;  3C1E A;  3QB3 A;  1TII D;  4OWT B;  1CA6 A;  2L4N A;  2AWN A;  4LF9 L;  1X55 A;  2V1C C;  2JEB I;  2A1A A;  3A5Z B;  1A3U A;  4JI8 Q;  2JA7 G;  4JI2 L;  3GV6 A;  1HRJ A;  1BOS A;  2Q8T A;  4BWG B;  1OXT A;  2LXJ A;  3DEP A;  3X3M A;  2NVQ H;  4BS9 A;  1Q86 C;  4KD3 A;  5FLM H;  4X65 L;  2NVY B;  3QOJ A;  4CDF C;  3J80 c;  1L1O A;  5FLX L;  1H9J A;  3KOJ A;  1RIP A;  1ESR A;  3I73 A;  3FEW X;  2MUY A;  4R9W A;  2NZH A;  3R2I A;  3FVQ A;  2F4I A;  4LUZ A;  1JC7 A;  4K2K A;  2XNA C;  3CMA A;  1EY5 A;  5FLX E;  4A3K B;  4K8I A;  4JBW A;  1LAC A;  1CSP A;  4LF8 L;  5T1I A;  1VQF A;  1TXY A;  4B3S Q;  1UE5 A;  3K0X A;  4QB4 A;  2N88 A;  2JA6 G;  4K5W A;  2K28 A;  2PNH A;  3M4P A;  3M4O B;  1AW7 A;  4XDX A;  2JE6 I;  4B9W A;  1K8A C;  3KYH C;  1QNU A;  4TRD A;  4PZ7 A;  4LFA L;  3I4N H;  2K5V A;  3I4L A;  5I6W A;  4JI3 Q;  4B3R L;  1UEA B;  2L11 A;  1AE3 A;  2RHQ B;  1KQS A;  4Q5V A;  2K33 A;  5F2D A;  1G51 A;  1HXY D;  1XNR L;  3S14 H;  3K5O A;  4BA1 I;  2F0P A;  1XMQ Q;  2JJQ A;  5IYD H;  4B08 A;  4BA2 I;  3I56 A;  5JJI A;  1HNZ Q;  4NXN L;  1GM5 A;  4JW0 A;  4S3S A;  2R61 A;  3MWY W;  2NN6 G;  4X3T A;  3NP8 A;  4C2M H;  1J9O A;  3KLS X;  4Q0F A;  4JBK A;  1SMY C;  2E74 C;  2KUM A;  3HKZ B;  5M5X H;  3I90 A;  3EJI A;  4KTA A;  1A3V A;  4CJ1 B;  1JOQ A;  2K05 A;  1FVI A;  5CV6 A;  2ES2 A;  4BBR B;  4RHS A;  4RAU C;  3CHB D;  1U4M A;  3U4Z A;  5DNF A;  3L0O A;  3T1H L;  2I07 B;  1RKN A;  3QO2 A;  4YHH Q;  3PO2 H;  1TY2 A;  4EX5 A;  2JA5 B;  5ISR A;  3AB9 A;  2O5J C;  2H5X A;  3OMC A;  5IWA Q;  3BS1 A;  2PQA A;  5COR A;  5C44 B;  5DLQ E;  2CFM A;  1HTL D;  2XRQ D;  1KRT A;  2VQE Q;  2F3W A;  1E2W A;  3MZ5 A;  3W2D A;  3ZJY C;  3BG3 A;  4HJA A;  4LW1 A;  1PTO B;  3PUZ A;  2L55 A;  3JAM c;  3H3V C;  4ZUI A;  2HIX A;  4KKS A;  4RG1 A;  2VW9 A;  2YU9 H; 
#chains in the Genus database with same CATH homology
 3U9S A;  2EY6 A;  3LWE A;  3EQL C;  3SXH A;  3NTK A;  2RKS A;  2AUJ D;  1TT2 A;  4R8I A;  1V1P B;  1J8I A;  1O7Y A;  2Q8R E;  1O7Z A;  1DM0 B;  4ULL A;  1G6Z A;  3C46 A;  2CW0 C;  3KUP A;  4A3D B;  5C5M A;  1TS4 A;  3CRK C;  1W6J A;  2VB3 X;  2XRS D;  5JEA G;  4ILW A;  3HOW B;  1TS5 A;  1RD9 D;  3HS0 C;  3QIA A;  1OXV A;  2QKI C;  3P1H A;  4F7X A;  3H0G B;  1GHK A;  2M00 A;  1JWU D;  4F8M A;  3BDL A;  5JJZ A;  1CZG A;  2RSN A;  1R4Q B;  1X3Q A;  1B53 A;  4RKL A;  1SND A;  1KDA A;  5CV7 A;  2A68 D;  1BNZ A;  1KAB A;  1OXS C;  1YNN D;  2I46 A;  1RTN A;  4TSS A;  1IYU A;  1ENA A;  5C3X A;  4WFN 3;  1D5X C;  3R3O A;  5J1Z A;  2Q8I B;  4G4K A;  1PRT B;  2D5D A;  2IX1 A;  4A3F B;  2B2T A;  1DOK A;  5K36 G;  3ZYY X;  5IGF A;  1ZYR C;  4B9X A;  2LS0 1;  4IUV A;  5C4X B;  2F0G A;  3OPO A;  3T4A C;  1U4L A;  5D3D A;  4FF4 A;  4ZRZ A;  2VXW A;  2C9O A;  4P2C B;  2AQ1 B;  3VYT A;  1WD0 A;  3NUC A;  4M1U B;  3T56 B;  2NVQ B;  3S9W A;  2F0J A;  2F0S A;  2D2C C;  1LTR D;  3OIP A;  5C0X J;  3TSS A;  2XIW A;  2ZXR A;  4FXD A;  2CVR A;  3SHL A;  4FNF A;  3VYS A;  3OSO A;  3WOF A;  2AQ2 B;  3VYU A;  1HPC A;  1S5C D;  5JPN C;  4IFD H;  5D3I B;  1U4R A;  2HCC A;  1TWG B;  1SE2 A;  4HMJ A;  2WII B;  5M3F B;  3L9A X;  2F0O A;  4ZLT F;  3R93 A;  2K5Q A;  1STN A;  2EYF A;  3UI2 A;  3KK7 A;  2NN6 I;  1OXU A;  3I4N B;  1U4P A;  5E4X A;  3K58 A;  3A55 A;  4XTC S;  1K8M A;  5LHY 1;  3S2H B;  5ELE A;  3I4M B;  2B39 A;  3T51 B;  1JB3 A;  4HED A;  2F0T A;  1S5F D;  5EJW A;  2F1M A;  2HCI A;  3E6Z X;  1AZQ A;  3CU7 A;  1EEI D;  1PZJ D;  4KN7 C;  1EY4 A;  4XT3 B;  5M5X B;  4RGT A;  3VA7 A;  1QJO A;  1PTO C;  3RD4 A;  2KJX A;  4KY6 A;  1C8C A;  2X69 A;  4OL7 A;  2A69 D;  4G57 A;  4CJ2 C;  5EKK A;  4U68 A;  3NE5 B;  5K5P A;  3DEO A;  4X3K A;  3HP3 A;  1HUN A;  4KHV A;  3TP8 A;  2QIL A;  2JP1 A;  1GJX A;  4K8J A;  2BE5 C;  2KCC A;  3PV0 A;  4CKB A;  3MFG A;  4RFB A;  2A5H A;  2YU9 B;  4J1M A;  2QF7 A;  1EZ6 A;  2K5W A;  3I8Z A;  2X6G A;  3KBX A;  4V0B A;  3R8B A;  1EFI D;  1O78 A;  1EY7 A;  4QCL A;  3Q6S A;  3NWS A;  2EOT A;  4EQO A;  1G29 1;  5CBA E;  2B8G A;  4O1N A;  1KDC A;  5KNC A;  4H44 C;  3K59 A;  3R2T A;  2KEC A;  3KLS A;  1LTI D;  1KDB A;  2R92 B;  1SE4 A;  4XYO A;  1PRT C;  3OIQ A;  4KD4 A;  1CTM A;  3H6M A;  2RDG A;  2NUC A;  3N6R A;  2EYM A;  2E2H B;  2PCF B;  2XN9 C;  1I4Q A;  1I6V C;  2B2Y A;  2L5T A;  3GTO B;  3VR3 A;  1SXT A;  3OWE B;  5I6Y A;  2E76 C;  5D65 A;  2J7Z A;  2KA7 A;  2EPB A;  1Z47 A;  1RJT A;  2F0U A;  4DN4 M;  4PMB A;  5C4H A;  2KVM A;  4DFA A;  1SNC A;  5I2Y A;  1B3A A;  2F0L A;  1LT6 D;  4K5X A;  4XYQ A;  4K14 A;  2PW7 A;  2F0M A;  2PZW A;  2HDM A;  1TR5 A;  3DMU A;  5G3L F;  2X6L A;  4H13 C;  4BY1 B;  3MVV A;  2DNE A;  4RA8 A;  5CYU A;  3SK8 A;  3IFD A;  1Y1V B;  4PQX A;  4NP5 A;  5IGC A;  1KNA A;  4F88 A;  3S1N B;  5E4W C;  5G3L D;  2C5C A;  1ZEQ X;  2N55 A;  3SR1 A;  1CA5 A;  1G2S A;  1S5D D;  5CV5 A;  4FYD A;  2KCN A;  4WRD A;  1RTO A;  4QMG A;  3O13 A;  1CM9 A;  1TS2 A;  2K03 A;  1H9M A;  3HG9 A;  5CV9 A;  5T1G A;  1Y8N B;  4KI0 A;  1D1I A;  1VCI A;  3A8J E;  5M3M B;  2E75 C;  2E2I B;  1H9S B;  5M9O A;  3I3C A;  1SYC A;  2NB0 A;  3VR2 A;  3D4R A;  1DD2 A;  1RDP D;  5DM6 3;  4HAE A;  3Q23 A;  1PFB A;  2A6H D;  1CQF A;  3C3L A;  1CQV A;  3QWN A;  1B4O A;  2XWJ B;  3ND8 A;  4IUT A;  3BZD B;  1ML0 D;  3PIO 3;  3GTK B;  1Q1B A;  4KK7 A;  1LAB A;  5ELB A;  4OIK A;  4RH6 A;  1GHJ A;  2IPK D;  4A3B B;  1EWH A;  3QOL A;  2RSO A;  4L63 B;  4YIJ A;  2DY8 A;  4FF1 A;  3HOU B;  1WTQ A;  3IFT A;  4IUP A;  1MBY A;  1AN8 A;  1SYF A;  1EY8 A;  4QIW B;  3MTS A;  4XQQ A;  1JR0 D;  2A6E D;  3PUW A;  3OW7 A;  3GP7 A;  3DWQ A;  5C4Z A;  3ONA B;  4ZK9 B;  4KJO A;  2EJM A;  2K5D A;  1SYE A;  3S1Q B;  2LMC B;  1M4V A;  3JAM L;  2DN8 A;  2OXP A;  3JAM E;  2EXZ A;  3SEB A;  1BXT A;  1MSH A;  2EDG A;  2SDF A;  2F0K A;  1M8A A;  1WTX A;  3K7A B;  1B1Z A;  1CZW A;  5IT9 L;  2WP8 J;  4R8N A;  5DEH A;  3MEH A;  3TP6 A;  1WTR A;  1I4H A;  3DM1 A;  2O5I C;  5IT9 E;  3DWA A;  3PUX A;  1G8Z D;  4NW2 A;  5NUC A;  4L6T B;  3F2U A;  1VMC A;  1EL0 A;  1ONL A;  4F87 A;  2Z1C A;  1VMP A;  1JCK B;  1YNJ C;  3NQT A;  2M2L A;  2JA8 B;  1IW7 D;  1EYA A;  3BYT B;  3J7Y W;  1WCM B;  3BVM A;  1LTT D;  5JEA J;  2PZT A;  2F0V A;  3I91 A;  2F03 A;  1U9R A;  2EYP A;  4IUR A;  5AFW A;  3VR6 A;  2O2L D;  4ODG A;  4ZQ3 A;  2KQ3 A;  3BYY B;  1K8O A;  4J8Q A;  1DXM A;  2F0H A;  3G7L A;  1I4P A;  1TS3 A;  4C3J B;  2VB2 X;  4OIJ A;  4OO1 H;  1FYC A;  4CHT B;  4MHE A;  3FPU B;  5TSS A;  1D1K A;  1O80 A;  5KYI A;  5C5L A;  3MXG A;  5CV4 A;  1JIC A;  1PZI D;  1PXU A;  2ZXO A;  3Q22 A;  4FXG C;  1STB A;  4C3H G;  3HGB A;  5M5Y B;  2H4O A;  1HTP A;  3HRZ C;  2FHT A;  2Y0S B;  5KRU A;  3LNN A;  2PMZ B;  4A93 B;  1JE4 A;  5IGE A;  1O7L A;  3VA5 A;  1KLU D;  4CBV A;  2F0F A;  2B2U A;  3NWT A;  5C3W A;  1CT1 D;  4XQN A;  5HUR A;  3IAY A;  3U9O A;  4IFD J;  2DY7 A;  3NHH A;  1QB5 D;  1X32 A;  2EYO A;  2SNM A;  2ZXP A;  1A15 A;  1BUV T;  4XT1 B;  2EZV A;  1V43 A;  4MN3 A;  3FMC A;  2MJ8 A;  3TME A;  4CKC A;  1TVX A;  4HSP A;  1B50 A;  2J0T D;  1A6X A;  2MGS A;  1PLF A;  2ZT9 C;  3GTG B;  1VF7 A;  1CI3 M;  1DON A;  1LTS D;  1OXX K;  1AP0 A;  3ND9 A;  1S4Z A;  2AWO A;  1GUG A;  1G91 A;  4IFD G;  3D8G A;  2TMP A;  3C1F A;  3DWP A;  2FMM A;  2WV6 D;  3S1R B;  3M3Y B;  5KYL A;  1OO9 B;  3OOC A;  3QG1 A;  2F0E A;  4HSV A;  4ZAI A;  2EY1 A;  3V2T A;  4BBS B;  5ELC A;  1WTP A;  4HR7 B;  4K6D A;  2JXM B;  3WDN A;  1ICW A;  1G2T A;  1X3P A;  2EYH A;  1EZ8 A;  1IKL A;  1CFM A;  3ITP A;  3HOV B;  1A2T A;  2WAQ B;  2B2W C;  2CQA A;  1Y8O B;  3PUV A;  3LWU A;  3HOZ B;  2OF1 A;  1Q12 A;  3E5S A;  3D4D A;  1KAA A;  3E0J A;  3FPP A;  5IGG A;  4RKB A;  2IX3 A;  1EQV A;  3NTH A;  5C4J B;  4LAA A;  1NUC A;  4KKT A;  3I72 A;  4DGZ A;  3V05 A;  1SMY D;  2LKV A;  1SE3 A;  4XQJ A;  2Z8L A;  4HCE A;  3HEJ A;  1FD7 D;  2Z4H A;  4IZ8 A;  1EY6 A;  3GD7 A;  4KN4 C;  4DAP A;  2A74 C;  4HCS A;  1NR2 A;  3MC0 B;  1XXG A;  2FFK B;  3MAQ A;  1HA5 A;  3T53 B;  1AZP A;  1STG A;  3NBI A;  5JPM C;  1TU2 B;  2VNU D;  4QUF A;  1EU3 A;  1H9R A;  3TZU A;  1Q3L A;  3T13 A;  1GUN A;  4IUQ A;  5C0X H;  1F9R A;  4HMI A;  4DAY A;  4KY5 A;  2TSS A;  3NSW A;  2ICE C;  1TQO A;  4HN7 A;  3GO5 A;  3A7A B;  1R9T B;  1R4P B;  3FKI B;  3OMG A;  2WKD A;  1F77 A;  3EVQ A;  1WTV A;  2RA4 A;  2WAC A;  1Y69 U;  1JWM D;  1HFG A;  1BDO A;  5HGT A;  2H1E A;  1DOL A;  2AQ3 B;  5EKI A;  1GUT A;  5BN3 A;  2RVL A;  1XYI A;  1PFM A;  1Q90 A;  4GZY C;  2PYK A;  3BDO A;  3RLF A;  5LL6 X;  4E6I A;  5J39 A;  2HDL A;  3HZX A;  2EJF C;  4TKO B;  2FJ2 A;  3C2P A;  5CV8 A;  1V1O A;  3OWF A;  1I3Q B;  4I65 A;  3SVM A;  4FF3 A;  4IFD I;  4UAI A;  3TP5 A;  5COY A;  2NTT A;  1JWS D;  2ID0 A;  2RBM A;  1IYV A;  4N9T A;  1QG7 A;  3W3A A;  2JYO A;  1MGS A;  2ICI A;  5FKA C;  1EY0 A;  1SJE D;  1H9S A;  1BQQ T;  1EQT A;  1SBB B;  2Z4I A;  1MSG A;  1L0Y B;  4IUN A;  1BCP F;  4DNT B;  1II3 A;  1LO5 D;  4ZUJ A;  3M4Y A;  2E2D C;  2B2V C;  3NBH A;  4RCO A;  3KF8 A;  5E1F A;  1ENC A;  4C1N I;  1NR4 A;  2V4D A;  5I9O A;  1I4X A;  1BCP D;  5CBE E;  2E2J B;  1EWC A;  2EYJ A;  3GTL B;  1FNV A;  1B9M A;  1STE A;  3D6C A;  5I2X A;  5JVG 3;  2FMC A;  3BVZ A;  1SDF A;  4O42 A;  4U67 3;  1I50 B;  4CKE A;  1ET6 A;  3TDQ A;  3S16 B;  3Q24 A;  4DXF A;  4G7Z C;  3M7G A;  4KHZ A;  1KTK A;  1JQY D;  2QDB A;  1ENF A;  1EY9 A;  5CR3 A;  1JOR A;  3S15 B;  4NKL A;  5KEE A;  1GUW A;  2J4X A;  3A7L A;  1CHP D;  3X3N A;  3AMU A;  1MD2 D;  4A3E B;  3KLR A;  3PMF A;  1DOM A;  3L3O C;  1T5E A;  4UDU C;  3NXW A;  1PDQ A;  1PTO F;  2A68 C;  1YNN C;  5EBC A;  2L0C A;  4RHR A;  3RMH A;  2G9D A;  2K7V A;  3SE0 A;  5EBD A;  3NTI A;  4IAL A;  4RCN A;  4ZYS A;  1ESF A;  5A35 A;  2XVS A;  1PTO D;  2PPB C;  3AU7 A;  4K6L A;  1I6H B;  3RZD B;  4V19 0;  4J6H A;  4CGY B;  1AFP A;  1SAP A;  2BE5 D;  1LT5 D;  4A3G B;  1HQR D;  2JSO A;  5E3F A;  1LT3 D;  3TN2 A;  1TKW B;  1LTB D;  2SNS A;  1ZXT A;  3K5M A;  1NSN S;  4KMU C;  4MIU A;  4CJ0 B;  2LY7 A;  2K01 A;  3S17 B;  1F2Z A;  1I4R A;  2G9H D;  1PFN A;  1ILP A;  2K6A A;  3DHQ A;  1LT4 D;  3EA6 A;  4HTH A;  1PRT F;  1NAP A;  2L12 A;  2R6G A;  3D4W A;  5KIX A;  4FO2 A;  1F2Y A;  4A3I B;  5EKL A;  1QIL A;  3HOY B;  2BOS A;  3HOX B;  1ZKO A;  4OHJ A;  1BCP B;  1PRT D;  1F2L A;  3D3R A;  3GQB A;  3MHB A;  1BF4 A;  1V1P A;  4IN3 A;  1GUO A;  1EIG A;  4DK0 A;  1GUS A;  1TWC B;  2KED A;  3TZD A;  5EPK A;  4PMW A;  5FOB B;  4NMZ A;  1GXD C;  1B2T A;  4OO1 G;  4I7Z C;  1RCV D;  3ERO A;  2LFN A;  2B8F A;  1C4Q A;  1XWE A;  1MI2 A;  3GV3 A;  1JOK A;  3PO3 B;  2IW3 A;  4L8J A;  1F9S A;  4G7O C;  1TWF B;  2A69 C;  5BN4 A;  2K04 A;  3CRL C;  4DA2 A;  2HQE A;  2NZ1 D;  3IKJ A;  4QUC A;  1FNU A;  5IOC A;  5IGB A;  1H9K A;  1FNW A;  2PNR C;  2L1B A;  2B2Y C;  4EVO A;  5KGU A;  1SNQ A;  4C56 C;  3S2D B;  2D62 A;  1DCZ A;  1Z7T A;  3FRP B;  3K57 A;  1HQM C;  2NN6 H;  1CHQ D;  1STH A;  2R93 B;  5FO9 B;  2F0I A;  4PMC A;  1Z6H A;  4ME5 A;  3G6J B;  3GTP B;  4A3J B;  3H91 A;  4RGO S;  2EE1 A;  4LK1 C;  4K5V A;  2KOL A;  1QOH A;  2MHV A;  3A8K E;  2PQE A;  1STA A;  4G7H C;  1TWH B;  1B44 D;  5C3E B;  1JOO A;  1Y8P B;  4AYB B;  1D2B A;  2WIN B;  1IL8 A;  3K5L A;  1SJH D;  1UUP A;  3A54 A;  1DJR D;  1UAP A;  3P20 A;  1QNK A;  4C3I B;  3MA2 B;  2VUM B;  1LTG D;  4TQU S;  5DM7 3;  4FVM A;  3D6W A;  2GA4 B;  4Y7N B;  1PMR A;  2RDF A;  1CK1 A;  3QJY A;  4DAV A;  4ZKB B;  3DXJ C;  1WD1 A;  2BA1 A;  3T16 A;  5J22 A;  2YYZ A;  5DAU A;  1WTW A;  3Q0A A;  4JK1 C;  4M8A A;  2F3V A;  5JOB A;  5M5W B;  2B2V A;  5JEA H;  3MFY A;  1IKM A;  1C48 A;  2EY2 A;  1IHZ A;  1FR3 A;  1AEX A;  2O4X A;  3A56 A;  3DUZ A;  4WOR A;  2F0Q A;  2EVB A;  5KNB A;  4FF2 A;  1HUM A;  1NCV A;  2QCP X;  5CGK A;  1E0B A;  1DZ1 A;  4OGQ C;  3H94 A;  4WJW A;  4ABN A;  1SSO A;  5LL6 S;  3OHX C;  2OT2 A;  2PO4 A;  1W6K A;  2CHB D;  5K36 H;  3SK6 A;  5CMD A;  2SEB D;  2ENB A;  1RHP A;  1BCP C;  4KKU A;  3N52 A;  5KND A;  2NBF A;  1T5X D;  1SYD A;  1ET9 A;  1VF5 C;  2JEA I;  1PZK D;  1BO0 A;  1HA6 A;  1HHV A;  4IQZ A;  4OO1 I;  2RQX A;  4KY7 A;  2KEE A;  5FK9 C;  2JA7 B;  3VR5 A;  1L0X B;  5EPJ A;  3SK4 A;  2F0W A;  4XIG S;  3NK9 A;  3S14 B;  2A6H C;  1LTA D;  5FO7 B;  4IUU A;  3URY A;  3K6O A;  5C0X G;  1F2M A;  1YNJ D;  2F0N A;  3A8I E;  1KLG D;  3S1M B;  2IWH A;  1D5Z C;  4N9P A;  4C2M B;  2JA6 B;  3IL8 A;  3GTJ B;  3PIP 3;  3VR4 A;  4LJZ C;  5BN5 A;  2NTS A;  2AUK A;  2IL8 A;  3P7J A;  2EY5 A;  5JVH 3;  3P75 A;  3BVG A;  1XTC D;  5ELF A;  3PO2 B;  3EFX D;  5D14 A;  3J81 L;  2BCO A;  2FIN B;  1SYG A;  2PW5 A;  1TY0 A;  1EYD A;  3J81 E;  4RWS C;  3M7N A;  2K32 A;  3NQI A;  3I70 A;  2A6E C;  3NPP A;  4K2L A;  1SNO A;  1SYB A;  4Z9C B;  2SOB A;  2HUG A;  2CW0 D;  1B9N A;  1F9Q A;  4XXE A;  1SEB D;  1DYQ A;  5C6A A;  5JAV A;  1KNE A;  4EQP A;  1VDZ A;  1SFO B;  2K1B A;  4DF7 A;  2NVX B;  1EEF D;  1D5M C;  1EU4 A;  4H7B A;  3J7A F;  2MP1 A;  3H09 A;  1UNS A;  2M9V A;  3PUY A;  1QCB D;  2WKC A;  2RDH A;  5IOD A;  1PYW D;  4ID6 A;  4PV1 C;  4C3J G;  1STY A;  1EIH A;  4RGM A;  4RGN A;  2EJG C;  4FXK C;  4KV6 A;  3SK5 A;  1HFN A;  4C3H B;  1I4G A;  1ZYR D;  2BDN A;  1IW7 C;  2EYL A;  3GTQ B;  1HCZ A;  1GOZ A;  1BBX C;  3BDC A;  1K83 B;  2IT1 A;  2B2U C;  2BDO A;  4FP5 D;  4DK1 A;  4X3S A;  3GTM B;  4NDX A;  2B63 B;  3D31 A;  3L7Z C;  3MXN A;  3TBI B;  3MXU A;  3VYR A;  5EQ0 A;  5IGD A;  1PTO H;  2IX0 A;  2NWG A;  1A3T A;  3TP7 A;  4C3I G;  1V8Q A;  1EOT A;  4EGV A;  4PNY A;  2WB1 B;  2B2T C;  1TWA B;  2R7Z B;  1Q1E A;  2L9H A;  3SDZ A;  3M85 A;  2BA0 A;  4QF4 A;  1E2V A;  3K5N A;  4A3M B;  1SNP A;  3WOE A;  5ELD A;  1SNM A;  3CKI B;  5EGT A;  5I4D A;  2XSC A;  1A2U A;  2XWB B;  1LLR D;  1F9P A;  4C1N K;  3ERQ A;  4DU9 A;  1ROD A;  1WVL A;  2DNC A;  2MPM A;  3MXP A;  1S5B D;  3CQZ B;  1QE6 A;  4DXG A;  5A2Q L;  3J80 L;  5C0X I;  3K0Y A;  1LV9 A;  2KHS A;  5I9P A;  1QWY A;  4KJN A;  5A2Q E;  2R3Z A;  2D9U A;  3J80 E;  2NVT B;  4BY7 B;  1FGB D;  1XX8 A;  2A73 B;  2IJ0 A;  3RZO B;  1Y1W B;  5CC4 A;  3KBG A;  3FDT A;  1EYC A;  1WTO A;  4DNR B;  3RUZ A;  4H0L C;  1BR9 A;  5FO8 B;  4ZKC B;  1E2Z A;  3LX0 A;  1RF2 D;  1ILQ A;  3V96 A;  4EQN A;  1S5E D;  2PZU A;  5IIF A;  5EPL A;  4X3U A;  1Q8I A;  2QEJ C;  2OEO A;  2F0D A;  2NYZ D;  3J7A V;  2B2W A;  4LMQ D;  1D6E C;  3C1E A;  3QB3 A;  1TII D;  1CA6 A;  2L4N A;  2AWN A;  2JEB I;  1A3U A;  3GV6 A;  1HRJ A;  1BOS A;  2Q8T A;  4BWG B;  1OXT A;  3DEP A;  3X3M A;  4BS9 A;  4KD3 A;  2NVY B;  3QOJ A;  5FLX L;  1H9J A;  1ESR A;  3I73 A;  3FEW X;  2MUY A;  4R9W A;  3R2I A;  3FVQ A;  2F4I A;  1JC7 A;  4K2K A;  2XNA C;  1EY5 A;  5FLX E;  4A3K B;  4K8I A;  4JBW A;  1LAC A;  5T1I A;  4QB4 A;  2N88 A;  4K5W A;  2K28 A;  3M4O B;  1AW7 A;  4XDX A;  2JE6 I;  4B9W A;  1QNU A;  4TRD A;  3I4L A;  5I6W A;  1UEA B;  2L11 A;  4Q5V A;  2K33 A;  5F2D A;  1HXY D;  3K5O A;  4BA1 I;  2F0P A;  4B08 A;  4BA2 I;  4S3S A;  2R61 A;  3MWY W;  2NN6 G;  4X3T A;  3NP8 A;  1J9O A;  3KLS X;  4Q0F A;  1SMY C;  2E74 C;  2KUM A;  3HKZ B;  3I90 A;  3EJI A;  4KTA A;  1A3V A;  4CJ1 B;  1JOQ A;  2K05 A;  5CV6 A;  4BBR B;  4RHS A;  4RAU C;  3CHB D;  1U4M A;  5DNF A;  2I07 B;  1RKN A;  3QO2 A;  1TY2 A;  2JA5 B;  5ISR A;  3AB9 A;  2O5J C;  3OMC A;  3BS1 A;  5COR A;  5C44 B;  1HTL D;  2XRQ D;  2F3W A;  1E2W A;  3MZ5 A;  3W2D A;  3BG3 A;  1PTO B;  3PUZ A;  2L55 A;  3H3V C;  4ZUI A;  4KKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...