4WFN3

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22 in complex with erythromycin
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
59
structure length
59
Chain Sequence
THKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2
total genus 3
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4wfn300
5DM73 3PIP3 5JVH3 4U673 4WFN3 5JVG3 3PIO3 5DM63
chains in the Genus database with same CATH superfamily
4JI6Q 3DWAA 5EBCA 1K0RA 4GKKQ 4DF7A 3QO2A 1AN8A 3HKSA 2EY2A 1KRTA 3DWQA 2ZXOA 5IP7H 5G3LD 4A76A 4UP9A 2QILA 4DK1A 1KAAA 1Q1BA 5C44B 1ILQA 3MXNB 3NEMA 3PO2B 3O13A 5A2QE 1BNZA 4DR5Q 2JA8B 1GVPA 1SROA 3H3VC 3AB9A 2D62A 3SXHA 2J0TD 4FF3A 3GTQB 2WAQE 3F1ZA 4A3CH 2VUMB 3PUWA 2DN8A 1N34Q 3CCEA 1F9QA 3GTPB 1SYFA 1YEZA 4DR6L 4P74A 1J9OA 4KHPQ 1BF4A 3D3RA 1Y1WG 1NTGA 2AUJD 3M3YB 4LFBL 5IT9c 3L2PA 4B3MQ 1PLFA 1M4VA 1Q8IA 4YCVA 5EPLA 3S1QH 2PCFB 2YU9B 4A3DB 5DAUA 2JXMB 4YWMA 4A3CG 4RGOS 1PTOB 2M9VA 3T51B 1STHA 1YBYA 1UAPA 2EJGC 1EIYB 1SSOA 3A7LA 3FP9A 2E5LL 2OEOA 4RG1A 2Q2HA 2O5JC 1OXXK 2IX3A 4XQQA 2KENA 5DM63 1QVCA 3MEHA 5FLXE 1I6HB 2NVYB 4JYAQ 4OHJA 3U58A 2RSNA 4EVOA 4NDXA 3GTGH 2KQ3A 4A3FH 4ME5A 3PF4A 3HOXH 5GADC 3J80E 5C44G 1PH1A 2RBMA 3K57A 1FJGL 4RGMA 3S1RH 2ENBA 3SDZA 5FJ8G 2K5VA 1EZ6A 4JI7L 2BDOA 1E3PA 1AW7A 2KCMA 4MTNA 4J1MA 4XT1B 1MJCA 4AYBG 1I50B 4A93G 1CQVA 1OXSC 4JI8L 1KHIA 1MJEA 2FHTA 3AFQA 4TKOB 3I4NB 3NP8A 2M2LA 3LX0A 5M9OA 1IL8A 4I7ZC 2F4VQ 1XMQL 5CGKA 1HA6A 2WB1B 3NTHA 3J81E 5FJ8H 4A3MG 1F9SA 3R2TA 1YVCA 3Q6SA 2VB3X 1XX8A 1L0YB 4Y7NB 1JC7A 4LF9L 5EPJA 3VA7A 2JYOA 5C4HA 4C3HB 5IGEA 5GQOA 2EYMA 1EFID 3R2IA 3CCUA 1Q3LA 1QUQB 2A6HD 4XT3B 1JJGA 3T1HQ 1SEBD 2K1BA 1B3AA 3TQYA 5M5XB 4L5SA 2CQAA 5CV8A 1S5DD 1B50A 1EZ8A 4KKUA 4A3MH 1J5EQ 4CKCA 3S1RB 1HUMA 1A2TA 5I2XA 2BE5D 4IO9A 3UDGA 4JI4L 3K80C 3N6RA 2F0NA 2F3VA 2CW0D 3TP5A 2KUMA 3PUXA 2NZOA 1ENCA 3S17B 2H5XA 3HFZB 1Z47A 5D65A 4PMCA 2JA7G 4S3SA 4OELB 1WTWA 1KC8C 2K4KA 2HQLA 4UP8A 5FOBB 2JJQA 1SFOH 2PQEA 4G7OC 4JG2A 3CQZB 2WP8J 2A6HC 2Q8RE 3EQLC 1SBBB 3VYRA 1SDFA 1PH2A 1JJCB 2Z8LA 4P72A 2A8VA 3VYUA 1CM9A 2QA4A 3TDQA 4PNYA 1EUJA 3A5UA 4BWGB 1OXUA 4Y7NH 3KF8A 2OTJA 2K5WA 1L0WA 1U4MA 2IWHA 4QIWB 1V43A 4WFN3 1UE1A 1LV9A 3K59A 1LT6D 2K5NA 3PIPA 2F3WA 2Q8TA 3OTOQ 4A93B 1U4LA 3CC4A 4DV3Q 3A54A 2BE5C 2XRQD 3J81j 1DONA 5M3FG 4DN4M 3M7GA 2NZ1D 2QEJC 3TREA 2LXJA 4BY1B 1CZWA 5GAGC 1EWCA 3W3AA 5JVH3 5M5WB 3KBGA 2MUYA 2KA7A 3S1MH 1RD9D 5FKAC 1VQHA 5C3XA 4OWTB 4BXXG 4G57A 4QY7A 3KFUA 2K33A 1BBWA 3IAYA 1SNPA 4R4TA 1LTSD 5CMDA 2K28A 5I2YA 1F2ZA 2IHEA 2NTTA 5C0XG 3TN2A 1Q46A 4FXGC 4KV6A 1SMYC 3DEPA 2R93H 2NVXH 1Q1EA 3KLWA 3M4OH 2Z9HA 2ZJRA 2Y0SB 2VB2X 1BCPB 2F0PA 2GVAA 3AQQA 5H1SE 5JOBA 1K73C 2KJXA 4NXNQ 3C1EA 3UI2A 4JBWA 1Q7YC 1UE6A 2NVTB 2PI2A 4MIUA 4EQ5A 4F8MA 1S4ZA 3E5SA 2IT1A 2A1AA 4DK3C 1UE7A 5E4WC 5IYCH 2V1CC 3PSIA 5IYDG 2ICIA 5I9PA 1VQMA 1DZ1A 3I4OA 3HOYG 3H09A 3D31A 5FLXc 1JICA 4C3IG 3VR4A 4CBVA 3KLSA 3CCQA 4L6TB 4ZKBB 1O7LA 1XXGA 2F1MA 1YHQA 4JI6L 2HD3A 2F0OA 2B2YC 5C0XJ 2A68C 2WFWA 1A63A 1TS5A 1I94Q 3S2HB 2EJMA 2GN5A 3FEWX 5IYDH 1PYSB 1SE8A 4R4OA 1PH3A 1VQAA 2K75A 3MC0B 1YITA 2XRSD 3E0JA 1SYGA 4XYOA 4LFCL 4DNIA 1EOVA 1XNQQ 3EROA 4DR3Q 3J7YW 1F2LA 4U673 3JAML 1SYDA 1IYJB 1KL9A 1O80A 3HP3A 1TWCB 3U9SA 1SE4A 3J81L 1PTOF 3MAQA 3HRZC 1LT4D 4J15A 1K0SA 1N33Q 1PZKD 1YZ6A 1PYBA 2D9UA 3E3XA 3CP0A 3SK5A 4RMFA 1CA6A 3KLSX 2LXKA 3J81i 2Z6KC 1GUSA 4JBKA 2FFKB 5I6YA 3J81c 1EY6A 1BOSA 2ALYB 3CCSA 3RR5A 1EY8A 1HJPA 1LTID 4L5RC 3B6YA 3HG9A 2UUAL 1CK1A 2Z4HA 2A68D 2CHBD 1HFGA 1W6JA 2K03A 4WJ3M 1O7YA 1LTGD 1K8AC 5IGDA 2R3ZA 3J7AF 1TR5A 2F3IA 1TXYA 3MXNA 1X56A 4P75A 5IP9H 2MHVA 2Z4IA 2B29A 2XWJB 1TWHB 1HNZQ 1V1QA 2CWPA 4QIWE 4NXNL 1U5KA 3MWYW 2Q8IB 3ICEA 1SNOA 3MVVA 3PO3H 4QJFA 3STBD 1DOKA 3TP6A 4LF7Q 4PZ6A 5DLQE 2OCEA 1XJVA 2VL6A 4C3IB 4GKJQ 1FVIA 4ID6A 1VS0A 4KHVA 5C6AA 3HOYB 3CAMA 4JYAL 1I6HH 4POGA 4DV4Q 1ZEQX 2L5TA 3K81C 5K36H 5M5YH 3S17H 4DR5L 3KBXA 3HEJA 4JCVE 1CSPA 3CCLA 3GTJH 1D1KA 4DXGA 4QCLA 3A56A 1VQPA 4LF5Q 5KEEA 3NTKA 4A4IA 1GUNA 2EYHA 1ZKOA 5ELBA 1K3BC 3RN2A 2SOBA 1RDPD 4X66Q 2K50A 4G7HC 4XIGS 2R61A 4GKKL 3NE5B 4KTAA 1M90C 2A5HA 2XSCA 1M8AA 1UWVA 2RHSB 2B2YA 5C3EB 1HCZA 3PUVA 5J1ZA 2Z0SA 2KCTA 4IN3A 2HIVA 5I9OA 2Q2TA 3QR8A 3S2DH 2F0LA 2RQXA 3RMHA 2WKCA 4X3SA 3I91A 3SK8A 1X3QA 5HURA 2VZAA 1CKOA 3D4DA 3JAMc 1TT2A 1NCVA 5D14A 3OOCA 1BBUA 2F0HA 1B7YB 4HN7A 4KHZA 4LF4Q 1D5MC 4BBRG 3NBHB 3BVGA 4WRDA 1SYCA 1RF2D 1IYUA 1KIXA 3AFPA 4CDDC 4C1NI 2F4IA 3I70A 1Y1VB 4DUYL 1BUVT 4UDUC 1MIUA 2DY7A 1RODA 4LUZA 5KIXA 5J22A 1G2SA 1BCPC 1K8GA 4HEDA 2JEAI 2A19A 5D3DA 1PH5A 1N32Q 2I46A 1JOOA 1GUGA 1MGSA 1WTHA 4PQXA 2NBFA 1HHVA 5HGQA 2AQ3B 1H9JA 1TQOA 4HIKA 3P1HA 1GJXA 1KNAA 1PXUA 4PV1C 3MZ5A 2UXBQ 1X3GA 3GV3A 2PNRC 1B9MA 3E6ZX 3QB3A 4DV6L 4BBSH 4O0AA 1RL2A 3P7JA 1EYCA 4Q0FA 4IFDG 4OIKA 4X64L 2HUGA 4N8FA 5BR8L 3BU2A 3K0XA 1T9HA 2PO4A 3RLOA 3IFDA 4J6HA 3JAMi 3GTOH 3CXCA 4V190 3S14H 1LUZA 3DM1A 2G5DA 1PFNA 1E2ZA 2N78A 5CR3A 1F2YA 4P71A 3EFXD 1E0BA 4ZUIA 3EJIA 5G3LF 2EYOA 3RLNA 4JI0Q 1IBML 1GHKA 4YIJA 1Y1WH 4QB4A 3OYYA 4DV2L 1EU3A 2XN9C 2JA5H 1W6KA 1JMCA 1JWUD 2XVSA 3SR1A 4BXXH 3UE1A 1Q86C 4K0KL 4GNXB 1MKHA 1SXTA 4B3SL 4OX9L 1ASZA 3I4NG 1B2TA 3QWNA 5E4XA 2EOTA 4K5VA 4ZUJA 1BDOA 2A6ED 2IPKD 5C3WA 3DHQA 2R93G 3I2ZA 5F2DA 1IBLL 4MN3A 3NHHA 1CFMA 4A3JG 5C4XB 3HOWG 4TQUS 3G48A 2FMCA 4DK6C 4YWKA 3K7UC 4LWCA 2AWNA 2EYJA 2NB0A 1STEA 2HDLA 4KHPL 3I4NH 1WJJA 3GTQH 4IUUA 2B2VA 2VQFL 2EY1A 1I3QB 2O2LD 1CHQD 1Q12A 2N88A 4C2MB 5IYCG 3NSWA 4ZK9B 1B3QA 1QVFA 1N9WA 2IHFA 2PYKA 1RHPA 4V0BA 4C3IH 1S5ED 1MD2D 2VY3A 3AMUA 1NR2A 3OPOA 4BA2I 3HGBA 4QUCA 1FD7D 4HMJA 4EQOA 2SEBD 2N3SA 2F0VA 1HFNA 2L9HA 1VQ6A 5IT9L 1NNXA 2E74C 3GP7A 2RA4A 2JSOA 4RFBA 1WTOA 1LTAD 3NWSA 4GN5A 5C5LA 4NXMQ 3K8AA 5LL6X 3DMUA 4EQPA 2L55A 5LHY1 4A3MB 5LL6S 1VF5C 4KD3A 3S16B 1F2MA 1KABA 4RGTA 2B2UA 4EX5A 3VR3A 4YY3L 4K2LA 3U4VA 1PV4A 5A2QL 4YHHL 3LGJA 2RVLA 1EEID 3RNUA 2LFNA 1SMYD 2C5CA 2UUAQ 3M7NA 1SE3A 3A55A 1FGBD 3F2BA 4C3JG 4KJNA 5IWAQ 3I7FA 1QILA 4HJAA 3GTGB 1JB3A 3DM3A 1FNWA 2QGQA 3R93A 4CDFC 3OMCA 5D3IB 4R4IA 4N9TA 3W1BA 2V4DA 4C2MH 3C46A 1P8LA 4O1NA 3H15A 4BY1G 1NY4A 3EIVA 4DUZL 4HJ7A 1HR0W 1BCPF 3KYHC 2JA7H 2NVQB 3D0FA 1PFBA 2D0PA 2OQKA 5JJIA 4A3EB 2DUDA 4C3JH 4WJ4A 4A3GG 4ULLA 4HIMA 5IP9G 2O4XA 1AZQA 5DNFA 2PQAA 1PRTB 3A7AB 1XTCD 3HOXB 5IGCA 4FVMA 2JA5G 4BY1H 2WINB 1WD0A 3S16H 1EIHA 3NBHA 3KK7A 2WB1G 5A35A 3SHLA 4AYBE 4A3KH 3QOLA 2QEXA 1K83H 2JEBI 5T1IA 5FLMG 3S1MB 5E7NA 3EN2A 4FXKC 1BCPD 5CV7A 4A75A 1AE3A 3ONAB 4Z9CB 4R4CA 1YJWA 1PYWD 3S24A 1ENAA 3GTKB 4GS3A 4GNXA 4ZAIA 1QB5D 3NPPA 1PTOD 5KNDA 2O5IC 2AKWB 4A3JH 4JV5Q 3I72A 3CHBD 3G4SA 1M1KC 4DUZQ 5C4JH 2BH2A 1YNJD 2NZHA 1D6EC 1TWFB 5KYLA 4AQYQ 1UE5A 4DR3L 2MNAA 1G291 4PZ8A 2B3GA 3L3OC 1F9PA 2H1EA 2E8GA 3MXUA 2YYZA 1EQTA 4F87A 1NBWA 2X69A 3GTOB 3BDCA 4UAIA 1S5BD 1R9TB 3MFGA 3T1YL 2BCOA 2HHHL 3UDXA 2UUBL 4K6DA 3TMEA 1QJOA 3VYSA 2RDFA 3H0GG 2ZTEA 4X3UA 3OW2A 1FJGQ 2XIWA 4H13C 4A3KB 4DR7L 5ELCA 2Y0SE 3GD7A 4FF2A 1BQQT 2B63H 5EBDA 4IJHA 1EY9A 1S72A 1GD7A 1N36L 1MBYA 1X3PA 2ZM6Q 3F8TA 4A3GB 2F0IA 2EPBA 3P75A 5LMNQ 4MTKA 4RAUC 3LWEA 4ZCKA 4X66L 2I5LX 3H0GH 1Y1VH 2QKIC 2Z1CA 2ZM6L 1SRUA 2PNHA 2YV5A 2Z6KA 2RSOA 4DU9A 4YWLA 4MHEA 5NUCA 1KQSA 4GOPA 1CA5A 2B63G 1A8VA 1C4QA 4JI2L 3GTPH 2E5LQ 5EKIA 1L1OA 4R8NA 4CKBA 1HNXQ 4GLAC 3KDFB 2EYPA 5BN3A 3M3YH 3D6CA 3SE0A 2UUBQ 1A3UA 1VQ8A 1JOQA 1X65A 4JBMA 4B3ML 5CORA 3A5ZB 3FDTA 4GLVB 3OHXC 4X65Q 2JE6I 3CW2C 4BBSG 4PZ7A 4M1UB 2EYLA 1QZGA 2E2JB 3L9AX 4KK7A 4G7ZC 2L15A 4HJ9A 3I4MH 1J5EL 5JEAH 3W1GA 1BVSA 2B2UC 4FNFA 1EY5A 4OIJA 1GO3E 4A3KG 2OXPA 2J4XA 4IPGA 5JPMC 5KGUA 1HZ9A 4KKTA 3HOUG 3H0GB 5FLMH 5LMUL 1HRJA 3EBEA 2KHSA 5DM73 3PO3B 2A69C 4K8JA 4LF8L 5TSSA 2YTVA 4DA2A 3ULPA 1R4PB 4JI1L 1DM0B 3A74A 4LF6Q 2EXZA 2F0EA 2Y0SG 1CHPD 4IOCA 2L11A 4X62L 2VS1A 3BS1A 4DV4L 2DGYA 2BDNA 3GTLH 2HHHQ 1DYQA 1VQBA 4LF6L 3FHWA 1Z7TA 2C9OA 3G6JB 2A6EC 3QJYA 2PMZB 1UUPA 3I3CA 1WI5A 4A3IH 4DV0Q 3K5MA 1B9NA 1VQCA 5K36G 2ZXRA 3T4AC 4JI3Q 3HS0C 1C7YA 1STBA 4JK1C 3V2TA 4F7XA 1G6ZA 3KJOA 1SNMA 1V1PB 4DFAA 4DAVA 2NVQH 3HOWH 1ZYRC 1L1OB 1KXLA 1HZBA 2HCCA 2B2TC 4DV2Q 4A3EH 2C35B 2NN6G 2NWGA 3S1QB 2VQEL 1KLUD 5HY6A 1SN8A 2YU9H 4A3DH 4N9PA 2AQ2B 1JT8A 2HDMA 2H4OA 4RCNA 5DEHA 4DXFA 4K5XA 1Q8KA 1GUTA 4G4KA 4DR4Q 3D4RA 3F2UA 4A3LH 4LK1C 4RGNA 1GUOA 4OO1G 1QNKA 2B39A 1STGA 2R7FA 4AH6A 3SEBA 4JI5L 2QCPX 4A3EG 3C3LA 3DUZA 3IRBA 4X65L 1I6VC 2MP1A 1D7QA 3U9OA 3TSSA 2M00A 1MI2A 5GROA 4YHHQ 1TWGH 3FKIB 3VR5A 3J7AV 1PZID 3WWVA 3M4YA 4EQNA 1Z6HA 3Q8DA 1PH9A 1FL0A 3HOZB 1RIPA 1PRTF 4OO1H 3K5NA 3WOEA 2HCIA 1YNJC 3CC2A 1HQMC 1CT1D 4YCUA 4KY5A 4DV1Q 5KYIA 2VNUD 2JA9A 3OIQA 3Q23A 1N32L 3K6OA 1NAPA 1KAWA 4IUVA 4IFDJ 2BH8A 1XTDA 3VA5A 1HNWL 3QG1A 4KN7C 4BS9A 4APVA 4FDBA 3F2DA 5T1GA 4DK0A 4K14A 4B3RQ 1EYGA 1A15A 2GVBA 1RJTA 3SVMA 3QOJA 3OIPA 4NXML 3S1NH 3W2DA 4DV5Q 2UXCL 2NYZD 1K9MC 1NMGA 1I5FA 1QNUA 1RKNA 1VMPA 2BOSA 2K5QA 4NKLA 2UXCQ 4J8QA 3T56B 4A3GH 1H9KA 4IFDH 1EY0A 1YJ9A 1IBLQ 4OL7A 2PI2E 3NENA 1JCKB 4IZ8A 2L12A 5J39A 1D1IA 4CJ0B 3PUYA 4H7BA 3CCJA 4ZRZA 5LMNL 3TS0A 1IBKL 2F0UA 3FVQA 1A3TA 2MGSA 4IPHA 1ESFA 4K5WA 1EOTA 1JR0D 2MJ8A 5EGTA 1OO9B 1TIID 2VQFQ 3PQIA 1IKMA 3S15B 1PRTD 4L5TA 1H9SB 1CZGA 4A3IG 1ENFA 1EL0A 4A3JB 1JOKA 1WVLA 3M4PA 4KD4A 4LF9Q 1ILPA 1I94L 2QDLA 1VQKA 2PZTA 4FO2A 3LWUA 1EYAA 2K14A 4PG3A 3IKJA 2E2IH 1CQFA 4LW1A 3T53B 1KLGD 1WOCA 2MFIA 3I8ZA 4HSPA 5K5PA 2XGTA 4LAAA 5EKKA 1VCIA 3A8IE 2ASBA 1V1OA 3K0YA 3KLRA 1IYVA 1TS3A 5CYUA 4LNQA 2X6GA 1U0LA 1SNQA 3NQIA 4A3LG 3VR2A 1H9RA 1WTPA 1KRSA 2MO0A 3GV6A 3UE0A 1R4QB 4ABNA 3ND9A 5L37A 1HR0L 3PIP3 1SLJA 3NK9A 1EEFD 1B44D 2F0KA 1SE2A 1J8IA 2VQEQ 1EIGA 1LABA 4AYBB 4LFCQ 1X3EA 2B2WA 3PO2G 2JK8A 1NJIC 2EY6A 3S15H 5IGFA 1UNSA 3G71A 1TWAH 1JORA 1OXTA 3ZJYC 4OGQC 2L4NA 2KVMA 5BN5A 4RHSA 2NVXB 1XPUA 2F0GA 1D8LA 1N8RC 1HTLD 2IY5B 1HNXL 1RTNA 3PO2H 4LJZC 5FO8B 3HOWB 3S14B 2JA8H 3KOJA 2PW7A 2B2TA 3MXGA 2ZJQA 1NUCA 1E2VA 5IE8A 3G6EA 2I07B 3NQTA 1NMFA 3NXWA 1NSNS 1Z9FA 3X3NA 1B8AA 1G51A 1VQOA 1XNRQ 3RZOB 4I7AA 1LT5D 4MNOA 4DNTB 2MQHA 1Y1WB 3K5LA 1DD2A 4OWWB 5CV9A 4PMWA 1PVOA 1W3SA 3H3VI 1HUNA 2TMPA 3KF6B 3URYA 3LNNA 1EQRA 1PHJA 2WV6D 5ELDA 4DUYQ 1HH2P 3I4MG 4JW0A 3GO5A 4DR1L 1TWAB 4DV5L 1T5EA 4DV7Q 1CKMA 1F9RA 1TWGB 1BXTA 2XTIA 5M3MB 1OXVA 5M5XH 1N34L 3H91A 4Y52H 4H02A 1E1OA 3HOUH 1KNEA 2I5MX 3TRZA 4JI5Q 3CU7A 4DR6Q 4DV7L 3STBC 4FXDA 2EVBA 4DAMA 1Y8OB 4GOPC 1EWHA 1SAPA 4R1JA 1TY2A 1PH8A 1GOZA 2OQ0A 3BVMA 3PMFA 1LTTD 3SK4A 5IODA 3R8BA 4R8IA 2A73B 1ML0D 2D0OA 4BY7G 3PF5A 2F0MA 5FO9B 5C3EH 4XQJA 3J80c 3I90A 1I3QH 3M9BA 4JOIA 5ELEA 3TZDA 1VQIA 1V9PA 4JI0L 5EKLA 4GN4B 2MO1A 3DLLA 1N36Q 2R92B 2R7DA 4HIOA 3KJPA 3HOVH 1I50H 2B2VC 1HZAA 1WTXA 5CV5A 2OWOA 2A69D 2OF1A 4IUPA 3ITPA 4XTCS 1OTCA 1X54A 2A74C 3F2CA 4HTHA 4JI4Q 2JA6H 2F0DA 1YNXA 5M3MH 4IQZA 4X64Q 2G9DA 1ZXTA 3K7AH 4BBRB 3RLFA 1SJHD 1VQ5A 4HCEA 1VQ9A 2L1BA 2UXDQ 3E9IA 3MXPA 2HQEA 5CC4A 1QG7A 3C1FA 4M8AA 4JI1Q 1YIJA 4JI7Q 2F0SA 2KOLA 4B08A 1XNRL 5IIFA 5AJ3Q 1IBMQ 3GTMH 5JEAJ 4JC0A 1ESRA 4A3BH 1AH9A 3FKIH 1LTRD 4F88A 2EE1A 3MTSA 2F4VL 4OONA 4JI3L 1VQNA 4RCOA 2IX1A 1K8MA 2FINB 1ICWA 3BVZA 2QDBA 1PFSA 3HOZH 1BO0A 1S3OA 3TZUA 1JE5A 1YJNA 2EYFA 2RDGA 4LMQD 1LTBD 5ELOA 5BN4A 2AHOB 5FO7B 3AYHB 4YY3Q 4LF8Q 1JWSD 4DR4L 2HT1A 2BA1A 4L63B 4FF1A 1A62A 1SNDA 1Y1VG 4CJ1B 1P16A 5LMUQ 4UPAA 2B2WC 4BY7B 4IJLA 5BR8Q 1YNND 3DEOA 5C4JB 2PZWA 1X9NA 1AZPA 3HKZG 1XPOA 3HOZG 2K04A 2N49A 4QL5A 3WDNA 2NTSA 5HGTA 1PH6A 3Q22A 1QCBD 2E2JH 1LO5D 3MEFA 2EDGA 3FPUB 1HQRD 4DR2Q 1HNWQ 3V96A 4UY8C 1SJED 1B53A 3V05A 1MSHA 4CDEC 1RCVD 1GHJA 2YTXA 3AEVA 2PQAB 1GXDC 1QWYA 1K28A 4B9WA 4B9XA 4RHRA 3I55A 4X6AH 1YI2A 1WCMH 4FF4A 2ID0A 1XMQQ 2CW0C 5M5WH 2XNAC 3NWTA 2AWOA 4H0LC 1TKWB 5JEAG 1XMOL 2CQOA 2CH4A 3VYTA 3KF6A 2DNEA 4IFDI 2F52A 1TWCH 2WKDA 2D5DA 3CPWA 4B3TQ 4OWXB 3H3VH 1R9TH 4JOIC 1B70B 2RHQB 1RTOA 1WCMG 5IT9E 1STAA 3ER0A 3BYYB 2QF7A 3L0OA 1H9MA 1EU4A 1LLRD 4UP7A 1PTOH 1B4OA 1UEAB 4A3IB 1VQ4A 1WD1A 3VDYA 4DR2L 1L0XB 1FYCA 1D2BA 1F77A 1KTKA 4AQYL 3CRKC 1XPRA 1UEBA 3H94A 4HR7B 5M3MG 4CHTB 3IL8A 5FK9C 4LFAQ 3HKZE 4RKBA 3BZCA 3K58A 2OTLA 1KDAA 1PMRA 2UU9L 4DV1L 3OMGA 1PA6A 3UDFA 4GNXC 4IALA 3J7A5 1I4HA 1Y69U 3M4QA 4GZYC 4UHVA 3FRPB 2EIFA 1NR4A 3HOUB 3D6WA 4YCWA 2AMCB 4HJ8A 2FXQA 3CCVA 2YTYA 2WB1E 2NN6H 1AEXA 1YHBA 3TBIB 2R7ZH 3CMEA 4A3DG 2ZT9C 1TVXA 3CMAA 4RA8A 2DY8A 4ILWA 4CGYB 5JJZA 3DWPA 3S2HH 2Q2UA 2AUKA 1YHAA 3U4ZA 1QOHA 1U4PA 1S5CD 5EPKA 4QQBX 3GDEA 4I65A 3TP8A 1Y8NB 1DGSA 1SR3A 3RD4A 2RF4A 4LUOA 4QF4A 3ULJA 5C4XH 1VQJA 1JJ2A 5E3FA 1CSQA 2XWBB 2JA7B 1HA5A 4OO1I 5COYA 2K05A 4P73A 3U50C 2DJFC 1A6XA 4JV5L 4DNRB 2JA8G 1CKNA 2K5DA 2DNCA 3DXJC 3CQZH 3JC66 2JA6B 2SDFA 4DAYA 4XXEA 1XYIA 4O42A 3PV0A 3S2DB 1A0IA 5C4XG 1PH4A 5E1FA 4C1NK 3EA6A 4RH6A 3HKZB 2I5HA 3ULLA 2UXBL 1K83B 3I56A 5KNCA 1N33L 2F0JA 4X62Q 4POFA 1Q82C 5C4ZA 1VF7A 3CRLC 4C56C 1T5XD 3KUPA 3D4WA 2KECA 2LMCB 4FP5D 1TWHH 4OXPA 2K52A 3GTMB 1G91A 2RKSA 1G6PA 4A93H 1C48A 4A3BB 1XNQL 4JI2Q 2N55A 4A3FB 3ERQA 4TRDA 3T13A 1HR0Q 3BJUA 2R92G 1BBXC 4H44C 2B8FA 4K8IA 4TVAB 1J6QA 5GAEC 1AP0A 1IW7D 2TSSA 2ZTCA 3BYTB 1CKNB 1O7ZA 1SMXA 3H6MA 1HPCA 4IPCA 4GOPB 5IWAL 4ALPA 2AQ1B 4KY7A 3VR6A 1D5XC 4NB3A 2EY5A 4CKEA 4P2CB 3GTJB 4L5QA 2LY7A 5I6WA 3R3OA 1G8ZD 2CCZA 4HIDA 2UUCQ 4BY7H 4DPGA 4QGUA 1YNNC 1O7IA 2KEEA 3K5OA 2BA0A 1PRTC 1JE4A 2IL8A 4JBJA 3HOVB 4B3RL 2UUCL 4NMZA 2EXDA 1PH7A 2PPBC 2DJGC 3T1YQ 4C3HH 3HOVG 4DV3L 4MZ9A 5IYBG 4C3JB 4GKJL 4KI0A 2B63B 2NVTH 4O2DA 1I4PA 4HCSA 1WTVA 1K8OA 1DOLA 5EQ0A 4AIMA 5M3FB 1WYDA 1CI3M 2E76C 2E2HH 5JPNC 1O78A 5LMNW 5JVG3 4KJOA 4ODGA 1WFQA 1SNCA 2R7ZG 2R93B 1JB7A 2K01A 3FPPA 4XQNA 3RZDH 1ET6A 3OWEB 4QMGA 4C3HG 1Y8PB 5EAYA 1V8QA 4LF4L 2E75C 2LSSA 3J7ZC 1D5ZC 5KNBA 2RCNA 4BA1I 2SNMA 3A8KE 3JAME 3GTKH 5CBAE 3CD6A 3GQBA 4KKSA 2CH4W 2ICEC 1KDBA 1KD1C 1EWIA 3ND8A 4JVZA 1I4QA 1LT3D 2F0TA 4A3BG 1EIFA 4IOAA 3NBIA 1DJRD 1LTLA 2PW5A 2VUMH 1EQVA 1TU2B 4XYQA 1EFWA 2EJFC 2RCFA 4ZKCB 1S5FD 1VMCA 1I4XA 1W2BA 2F0WA 1V1PA 4E6IA 3WOFA 2RDHA 2KEDA 3Q0AA 1QUQA 3PIOA 3I4MB 1HTPA 2NN6I 1EY7A 2WAQG 5AJ3L 2E2HB 2Q2IA 2P5ZX 5J3BA 1VQFA 3M85A 3TEHB 3W5OA 1PTOC 2IW3A 3BDLA 3L7ZC 4KMUC 2E2IB 1XWEA 4QUFA 3HZXA 1STYA 5JJLA 3SK6A 1FNVA 4IUQA 1II3A 2Z6BA 4KLKA 1NE3A 2K5HA 3CPFA 5IGGA 2VW9A 1EYDA 4OEMB 1U4RA 2NVYH 5EJWA 4JI8Q 2D2CC 5FLXL 4X3TA 4A3FG 4WJWA 1GUWA 3OSOA 1WCMB 3HOXG 2ZTDA 5ELFA 5IGBA 1ONLA 1SYBA 5ISRA 3Q24A 5ELNA 4EGVA 3KF8B 4PMBA 3T1HL 4X3KA 1WTRA 3J80L 3ERSX 4K6LA 4ZYSA 3HOYH 1DCZA 1BR9A 1E7ZA 3CCRA 1SYEA 4DKAC 1HXYD 3PUZA 1IBKQ 2EQSA 2K7VA 3PGZA 1JWMD 3MHBA 3ZYYX 1HZCA 1I4RA 4ZQ3A 1VQ7A 4L8JA 3MFYA 2F0FA 3NELA 1E22A 5IYBH 2SNSA 4HJ5A 3EVQA 1Q81C 1X32A 2OT2A 3G7LA 3X3MA 2KCNA 1AFPA 3KDFA 1CUKA 4DAYB 3I73A 3QIAA 1H9SA 5C3EG 1MSGA 1KDCA 1IL2A 4CDCC 4KY6A 2UU9Q 4LUVA 1IHZA 4DV6Q 1QZHA 3RN5A 4NP5A 1ICFB 5M5YB 5CBEE 1TY0A 3E0EA 3OW7A 2VXWA 3RUZA 3J80i 4RKLA 1IXRA 1TS2A 1XMOQ 3RZOH 2WACA 4DR1Q 2I0QA 2WIIB 2N8NA 2LKVA 4HMIA 2CFMA 4RWSC 5I4DA 1I4GA 4HSVA 3C2PA 2ZJPA 1MHWC 1PDQA 2QW7A 1ASYA 2R7ZB 2UXDL 1QE6A 4B3SQ 4OX9Q 4LFAL 1EQQA 3CCMA 2JA6G 1VQGA 4B3TL 1X3FA 3GTLB 5KRUA 3N52A 4IURA 2IJ0A 2CWAA 4LF5L 2VUMG 1C0AA 4XDXA 2CVRA 2PMZE 3SGIA 4WORA 3CF5A 1H95A 1X6OA 1VQDA 4LFBQ 4CJ2C 2IX0A 3S9WA 1C8CA 1GM5A 5C5MA 2K32A 3S1NB 1L1OC 5JJKA 4R9WA 1G2TA 3PO3G 3OWFA 1K3RA 3FKIG 1TS4A 4FYDA 2KHIA 1B1ZA 1PFMA 2GA4B 2JP1A 3AU7A 1U9RA 1LM0A 1GKHA 1WTQA 5M3FH 2JN4A 2KBNA 2NUCA 2G9HD 2KHJA 3OTOL 4NPSA 2R6GA 1DXMA 2J7ZA 3I4LA 1X55A 4LF7L 3CKIB 1LACA 3MA2B 1FNUA 3NUCA 4IPDA 4JPBW 3BZKA 4N8X1 4U68A 1ZYRD 3RZDB 4K0KQ 1FGUA 4DR7Q 1ET9A 4KN4C 1Q90A 2KCCA 1S40A 3BDOA 2CKZB 4IUNA 5IY0A 4DV0L 1AE2A 5C0XH 3T16A 1FR3A 4TSSA 1STNA 1DOMA 1CTMA 1VDZA 4R4QA 4ME3A 2ZXPA 3A8JE 3IFTA 1E1TA 1Y14B 2ATWA 3FMCA 3BG3A 1C9OA 2HIXA 5JAVA 2F03A 4BBSB 3P20A 2ES2A 2R92H 3M4OB 2FMMA 1A3VA 4ZLTF 2WAQB 4NW2A 4K2KA 1IKLA 4GN3B 1L2FA 4DAPA 1E2WA 2FJ2A 5C44H 5CV6A 4Q5VA 4HAEA 4GLXA 3PCOB 2F0QA 1SFOB 1LYLA 5IOCA 2MPMA 1IZ6A 1HNZL 2B8GA 1QVGA 2X6LA 3A0JA 1A2UA 3K7AB 4BBRH 1TWFH 1BKBA 1PZJD 2LS01 5AFWA 3CC7A 1VQLA 2EZVA 5CV4A 2E2DC 2PZUA 5IP7G 3UDIA 2JQOA 3E9HA 1E24A 3NTIA 2L0CA 5GAHC 5C0XI 1EY4A 1VQEA 3PIO3 3TP7A 4IUTA 3BZDB 2JA5B 1IW7C 2K6AA 1JQYD 4DGZA 3TS2A 3D8GA
chains in the Genus database with same CATH topology
3DWAA 5EBCA 4DF7A 3QO2A 1AN8A 2EY2A 3DWQA 2ZXOA 5G3LD 2QILA 4DK1A 1KAAA 1Q1BA 5C44B 1ILQA 3PO2B 3O13A 5A2QE 1BNZA 2JA8B 3H3VC 3AB9A 2D62A 3SXHA 2J0TD 4FF3A 3GTQB 2VUMB 3PUWA 2DN8A 1F9QA 3GTPB 1SYFA 1J9OA 1BF4A 3D3RA 2AUJD 3M3YB 1PLFA 1M4VA 1Q8IA 5EPLA 2PCFB 2YU9B 4A3DB 5DAUA 2JXMB 4RGOS 1PTOB 2M9VA 3T51B 1STHA 1UAPA 2EJGC 1SSOA 3A7LA 2OEOA 2O5JC 1OXXK 2IX3A 4XQQA 5DM63 3MEHA 5FLXE 1I6HB 2NVYB 4OHJA 2RSNA 4EVOA 4NDXA 2KQ3A 4ME5A 3J80E 2RBMA 3K57A 4RGMA 2ENBA 3SDZA 1EZ6A 2BDOA 4XT1B 1AW7A 4J1MA 1I50B 1CQVA 1OXSC 2FHTA 4TKOB 3I4NB 3NP8A 2M2LA 3LX0A 5M9OA 1IL8A 4I7ZC 5CGKA 1HA6A 2WB1B 3NTHA 3J81E 1F9SA 3R2TA 3Q6SA 2VB3X 1XX8A 1L0YB 4Y7NB 1JC7A 5EPJA 3VA7A 2JYOA 5C4HA 4C3HB 5IGEA 2EYMA 1EFID 3R2IA 1Q3LA 2A6HD 4XT3B 1SEBD 2K1BA 1B3AA 5M5XB 2CQAA 5CV8A 1S5DD 1B50A 1EZ8A 4KKUA 4CKCA 3S1RB 1HUMA 1A2TA 5I2XA 2BE5D 3N6RA 2F0NA 2F3VA 2CW0D 3TP5A 2KUMA 3PUXA 1ENCA 3S17B 5D65A 1Z47A 4PMCA 4S3SA 1WTWA 5FOBB 4G7OC 2PQEA 3CQZB 2WP8J 2A6HC 2Q8RE 3EQLC 1SBBB 3VYRA 1SDFA 2Z8LA 3VYUA 1CM9A 3TDQA 4PNYA 4BWGB 1OXUA 3KF8A 2K5WA 1U4MA 2IWHA 4QIWB 1V43A 4WFN3 1LV9A 3K59A 1LT6D 2F3WA 2Q8TA 4A93B 1U4LA 3A54A 2BE5C 2XRQD 1DONA 4DN4M 3M7GA 2NZ1D 2QEJC 4BY1B 1CZWA 1EWCA 3W3AA 5JVH3 5M5WB 3KBGA 2MUYA 2KA7A 1RD9D 5FKAC 5C3XA 4G57A 2K33A 3IAYA 1SNPA 1LTSD 5CMDA 2K28A 5I2YA 1F2ZA 2NTTA 5C0XG 3TN2A 4KV6A 4FXGC 1SMYC 3DEPA 1Q1EA 2Y0SB 2VB2X 1BCPB 2F0PA 5JOBA 2KJXA 3C1EA 3UI2A 4JBWA 2NVTB 4MIUA 4F8MA 1S4ZA 3E5SA 2IT1A 5E4WC 2ICIA 5I9PA 1DZ1A 3H09A 3D31A 1JICA 4C3IG 3VR4A 4CBVA 3KLSA 4L6TB 4ZKBB 1O7LA 1XXGA 2F1MA 2F0OA 2B2YC 5C0XJ 2A68C 1TS5A 3S2HB 2EJMA 3FEWX 3MC0B 2XRSD 3E0JA 1SYGA 4XYOA 3EROA 3J7YW 1F2LA 4U673 3JAML 1SYDA 1O80A 3HP3A 1TWCB 3U9SA 1SE4A 3J81L 1PTOF 3MAQA 3HRZC 1LT4D 1PZKD 2D9UA 3SK5A 1CA6A 3KLSX 1GUSA 2FFKB 5I6YA 1EY6A 1BOSA 1EY8A 1LTID 3HG9A 1CK1A 2Z4HA 2A68D 2CHBD 1HFGA 1W6JA 2K03A 1O7YA 1LTGD 5IGDA 2R3ZA 3J7AF 1TR5A 3MXNA 2MHVA 2Z4IA 2XWJB 1TWHB 3MWYW 2Q8IB 1SNOA 3MVVA 1DOKA 3TP6A 4C3IB 4ID6A 4KHVA 5C6AA 3HOYB 1ZEQX 2L5TA 5K36H 3KBXA 3HEJA 1D1KA 4DXGA 4QCLA 3A56A 5KEEA 3NTKA 1GUNA 2EYHA 1ZKOA 5ELBA 2SOBA 1RDPD 4G7HC 4XIGS 2R61A 3NE5B 4KTAA 2A5HA 2XSCA 1M8AA 2B2YA 5C3EB 1HCZA 3PUVA 5J1ZA 4IN3A 5I9OA 2F0LA 2RQXA 3RMHA 2WKCA 4X3SA 3I91A 3SK8A 1X3QA 5HURA 3D4DA 1TT2A 1NCVA 5D14A 3OOCA 2F0HA 4HN7A 4KHZA 1D5MC 3BVGA 4WRDA 1SYCA 1RF2D 1IYUA 4C1NI 2F4IA 3I70A 1Y1VB 1BUVT 4UDUC 5KIXA 2DY7A 1RODA 5J22A 1G2SA 1BCPC 4HEDA 2JEAI 5D3DA 2I46A 1JOOA 1GUGA 1MGSA 4PQXA 2NBFA 1HHVA 2AQ3B 1TQOA 1H9JA 3P1HA 1GJXA 1KNAA 1PXUA 4PV1C 3MZ5A 3GV3A 2PNRC 1B9MA 3E6ZX 3QB3A 3P7JA 1EYCA 4Q0FA 4IFDG 4OIKA 2HUGA 2PO4A 3IFDA 4J6HA 4V190 3DM1A 1PFNA 1E2ZA 5CR3A 1F2YA 3EFXD 1E0BA 4ZUIA 3EJIA 5G3LF 2EYOA 1GHKA 4YIJA 4QB4A 1EU3A 2XN9C 1W6KA 1JWUD 2XVSA 3SR1A 1SXTA 1B2TA 3QWNA 5E4XA 2EOTA 4K5VA 4ZUJA 1BDOA 2A6ED 2IPKD 5C3WA 3DHQA 5F2DA 4MN3A 3NHHA 1CFMA 5C4XB 4TQUS 2FMCA 2AWNA 2EYJA 2NB0A 1STEA 2HDLA 4IUUA 2B2VA 2EY1A 1I3QB 2O2LD 1CHQD 1Q12A 2N88A 4C2MB 3NSWA 4ZK9B 2PYKA 1RHPA 4V0BA 1S5ED 1MD2D 3AMUA 1NR2A 3OPOA 4BA2I 3HGBA 4QUCA 1FD7D 4HMJA 4EQOA 2SEBD 2F0VA 1HFNA 2L9HA 5IT9L 2E74C 3GP7A 2RA4A 2JSOA 4RFBA 1WTOA 1LTAD 3NWSA 5C5LA 5LL6X 3DMUA 4EQPA 2L55A 5LHY1 4A3MB 5LL6S 1VF5C 4KD3A 3S16B 1F2MA 1KABA 4RGTA 2B2UA 3VR3A 4K2LA 5A2QL 2RVLA 1EEID 2LFNA 1SMYD 2C5CA 3M7NA 1SE3A 3A55A 1FGBD 4C3JG 4KJNA 1QILA 3GTGB 1JB3A 1FNWA 3R93A 3OMCA 5D3IB 4N9TA 2V4DA 3C46A 4O1NA 1BCPF 2NVQB 1PFBA 4A3EB 4ULLA 2O4XA 1AZQA 5DNFA 1PRTB 3A7AB 1XTCD 3HOXB 5IGCA 4FVMA 2WINB 1WD0A 1EIHA 3KK7A 3NBHA 5A35A 3SHLA 3QOLA 2JEBI 5T1IA 3S1MB 4FXKC 1BCPD 5CV7A 3ONAB 4Z9CB 1PYWD 1ENAA 3GTKB 4ZAIA 1QB5D 3NPPA 1PTOD 5KNDA 2O5IC 3I72A 3CHBD 1YNJD 1D6EC 1TWFB 5KYLA 1G291 3L3OC 1F9PA 2H1EA 3MXUA 3GTOB 2YYZA 1EQTA 4F87A 2X69A 3BDCA 4UAIA 1S5BD 1R9TB 3MFGA 2BCOA 4K6DA 3TMEA 1QJOA 3VYSA 2RDFA 4X3UA 2XIWA 4H13C 4A3KB 5ELCA 3GD7A 4FF2A 1BQQT 5EBDA 1EY9A 1MBYA 1X3PA 4A3GB 2F0IA 2EPBA 3P75A 4RAUC 3LWEA 2QKIC 2Z1CA 2RSOA 4DU9A 4MHEA 5NUCA 1CA5A 1C4QA 5EKIA 4R8NA 4CKBA 2EYPA 5BN3A 3D6CA 3SE0A 1A3UA 1JOQA 5CORA 3FDTA 3OHXC 2JE6I 4M1UB 2EYLA 2E2JB 3L9AX 4KK7A 4G7ZC 5JEAH 2B2UC 4FNFA 1EY5A 4OIJA 2OXPA 2J4XA 5JPMC 5KGUA 4KKTA 3H0GB 1HRJA 2KHSA 5DM73 3PO3B 2A69C 4K8JA 5TSSA 4DA2A 1R4PB 1DM0B 2EXZA 2F0EA 1CHPD 2L11A 3BS1A 2BDNA 1DYQA 1Z7TA 2C9OA 3G6JB 2A6EC 3QJYA 2PMZB 1UUPA 3I3CA 3K5MA 1B9NA 5K36G 2ZXRA 3T4AC 3HS0C 1STBA 4JK1C 3V2TA 4F7XA 1G6ZA 1SNMA 1V1PB 4DFAA 4DAVA 1ZYRC 2HCCA 2B2TC 2NN6G 2NWGA 3S1QB 1KLUD 4N9PA 2AQ2B 2HDMA 2H4OA 4RCNA 5DEHA 4DXFA 4K5XA 1GUTA 4G4KA 3D4RA 3F2UA 4LK1C 4RGNA 1GUOA 4OO1G 1QNKA 2B39A 1STGA 3SEBA 2QCPX 3C3LA 3DUZA 1I6VC 2MP1A 3U9OA 3TSSA 2M00A 1MI2A 3FKIB 3VR5A 3J7AV 1PZID 3M4YA 4EQNA 1Z6HA 3HOZB 1PRTF 4OO1H 3K5NA 3WOEA 2HCIA 1YNJC 1HQMC 1CT1D 4KY5A 5KYIA 2VNUD 3OIQA 3Q23A 3K6OA 1NAPA 4IUVA 4IFDJ 3VA5A 3QG1A 4KN7C 4BS9A 5T1GA 4DK0A 4K14A 1A15A 1RJTA 3SVMA 3QOJA 3OIPA 3W2DA 2NYZD 1QNUA 1RKNA 1VMPA 2BOSA 2K5QA 4NKLA 4J8QA 3T56B 1H9KA 4IFDH 1EY0A 4OL7A 1JCKB 4IZ8A 2L12A 5J39A 1D1IA 4CJ0B 3PUYA 4H7BA 4ZRZA 2F0UA 3FVQA 1A3TA 2MGSA 1ESFA 4K5WA 1EOTA 1JR0D 2MJ8A 5EGTA 1OO9B 1TIID 1IKMA 3S15B 1PRTD 1H9SB 1CZGA 1ENFA 1EL0A 4A3JB 1JOKA 1WVLA 4KD4A 1ILPA 2PZTA 4FO2A 3LWUA 1EYAA 3IKJA 1CQFA 3T53B 1KLGD 3I8ZA 4HSPA 5K5PA 4LAAA 5EKKA 1VCIA 3A8IE 1V1OA 3K0YA 3KLRA 1IYVA 1TS3A 5CYUA 2X6GA 1SNQA 3NQIA 3VR2A 1H9RA 1WTPA 3GV6A 1R4QB 4ABNA 3ND9A 3PIP3 3NK9A 1EEFD 1B44D 2F0KA 1SE2A 1J8IA 1EIGA 1LABA 4AYBB 2B2WA 2EY6A 5IGFA 1UNSA 1JORA 1OXTA 4OGQC 2L4NA 2KVMA 5BN5A 4RHSA 2NVXB 2F0GA 1HTLD 1RTNA 4LJZC 5FO8B 3HOWB 3S14B 2PW7A 2B2TA 3MXGA 1NUCA 1E2VA 2I07B 3NQTA 3NXWA 1NSNS 3X3NA 3RZOB 1LT5D 4DNTB 1Y1WB 3K5LA 1DD2A 5CV9A 4PMWA 1HUNA 2TMPA 3URYA 3LNNA 2WV6D 5ELDA 3GO5A 1TWAB 1T5EA 1F9RA 1TWGB 1BXTA 5M3MB 1OXVA 3H91A 1KNEA 3CU7A 4FXDA 2EVBA 1Y8OB 1EWHA 1SAPA 1TY2A 1GOZA 3BVMA 3PMFA 1LTTD 3SK4A 5IODA 3R8BA 4R8IA 2A73B 1ML0D 2F0MA 5FO9B 4XQJA 3I90A 5ELEA 3TZDA 5EKLA 2R92B 2B2VC 1WTXA 5CV5A 2A69D 2OF1A 4IUPA 3ITPA 4XTCS 2A74C 4HTHA 2F0DA 4IQZA 2G9DA 1ZXTA 4BBRB 3RLFA 1SJHD 4HCEA 2L1BA 3MXPA 2HQEA 5CC4A 1QG7A 3C1FA 4M8AA 2F0SA 2KOLA 4B08A 5IIFA 5JEAJ 1ESRA 1LTRD 4F88A 2EE1A 3MTSA 4RCOA 2IX1A 1K8MA 2FINB 1ICWA 3BVZA 2QDBA 1BO0A 3TZUA 2EYFA 2RDGA 4LMQD 1LTBD 5BN4A 5FO7B 1JWSD 2BA1A 4L63B 4FF1A 1SNDA 4CJ1B 2B2WC 4BY7B 1YNND 3DEOA 5C4JB 2PZWA 1AZPA 2K04A 3WDNA 2NTSA 5HGTA 3Q22A 1QCBD 1LO5D 2EDGA 3FPUB 1HQRD 3V96A 1SJED 1B53A 3V05A 1MSHA 1RCVD 1GHJA 1GXDC 1QWYA 4B9WA 4B9XA 4RHRA 4FF4A 2ID0A 2CW0C 2XNAC 3NWTA 2AWOA 4H0LC 1TKWB 5JEAG 3VYTA 2DNEA 4IFDI 2WKDA 2D5DA 1RTOA 5IT9E 1STAA 3BYYB 2QF7A 1H9MA 1EU4A 1LLRD 1PTOH 1B4OA 1UEAB 4A3IB 1WD1A 1L0XB 1FYCA 1D2BA 1F77A 1KTKA 3CRKC 3H94A 4HR7B 4CHTB 3IL8A 5FK9C 3K58A 4RKBA 1KDAA 1PMRA 3OMGA 4IALA 1I4HA 1Y69U 4GZYC 3FRPB 1NR4A 3HOUB 3D6WA 2NN6H 1AEXA 3TBIB 2ZT9C 1TVXA 4RA8A 2DY8A 4ILWA 4CGYB 5JJZA 3DWPA 2AUKA 1QOHA 1U4PA 1S5CD 5EPKA 4I65A 3TP8A 1Y8NB 3RD4A 4QF4A 5E3FA 2XWBB 2JA7B 1HA5A 4OO1I 5COYA 2K05A 1A6XA 4DNRB 2K5DA 2DNCA 3DXJC 2JA6B 2SDFA 4DAYA 4XXEA 1XYIA 4O42A 3PV0A 3S2DB 5E1FA 4C1NK 3EA6A 4RH6A 3HKZB 1K83B 5KNCA 2F0JA 5C4ZA 1VF7A 3CRLC 4C56C 1T5XD 3KUPA 3D4WA 2KECA 2LMCB 4FP5D 3GTMB 1G91A 2RKSA 1C48A 4A3BB 2N55A 4A3FB 3ERQA 4TRDA 3T13A 1BBXC 4H44C 2B8FA 4K8IA 1AP0A 1IW7D 2TSSA 3BYTB 1O7ZA 3H6MA 1HPCA 2AQ1B 4KY7A 3VR6A 1D5XC 2EY5A 4CKEA 4P2CB 3GTJB 2LY7A 5I6WA 3R3OA 1G8ZD 1YNNC 2KEEA 3K5OA 2BA0A 1PRTC 1JE4A 2IL8A 3HOVB 4NMZA 2PPBC 4C3JB 4KI0A 2B63B 1I4PA 4HCSA 1WTVA 1K8OA 1DOLA 5EQ0A 5M3FB 2E76C 1CI3M 5JPNC 1O78A 5JVG3 4KJOA 4ODGA 1SNCA 2R93B 2K01A 3FPPA 4XQNA 1ET6A 3OWEB 4QMGA 4C3HG 1Y8PB 1V8QA 2E75C 1D5ZC 5KNBA 4BA1I 2SNMA 3A8KE 3JAME 5CBAE 3GQBA 4KKSA 2ICEC 1KDBA 3ND8A 1I4QA 1LT3D 2F0TA 3NBIA 1DJRD 2PW5A 1EQVA 1TU2B 4XYQA 2EJFC 4ZKCB 1S5FD 1VMCA 1I4XA 2F0WA 1V1PA 4E6IA 3WOFA 2RDHA 2KEDA 3Q0AA 3I4MB 1HTPA 2NN6I 1EY7A 2E2HB 3M85A 1PTOC 2IW3A 3BDLA 3L7ZC 4KMUC 2E2IB 1XWEA 4QUFA 3HZXA 1STYA 3SK6A 1FNVA 4IUQA 1II3A 5IGGA 1EYDA 1U4RA 5EJWA 2D2CC 5FLXL 4X3TA 4WJWA 1GUWA 3OSOA 1WCMB 5ELFA 5IGBA 1ONLA 1SYBA 5ISRA 3Q24A 4EGVA 4PMBA 4X3KA 1WTRA 3J80L 4K6LA 4ZYSA 1DCZA 1BR9A 1SYEA 1HXYD 3PUZA 2K7VA 1JWMD 3MHBA 3ZYYX 1I4RA 4ZQ3A 4L8JA 3MFYA 2F0FA 2SNSA 3EVQA 1X32A 2OT2A 3G7LA 3X3MA 2KCNA 1AFPA 3I73A 3QIAA 1H9SA 1MSGA 1KDCA 4KY6A 1IHZA 4NP5A 5M5YB 5CBEE 1TY0A 3OW7A 2VXWA 3RUZA 4RKLA 1TS2A 2WACA 2WIIB 2LKVA 4HMIA 4RWSC 5I4DA 1I4GA 4HSVA 3C2PA 1PDQA 2R7ZB 1QE6A 3GTLB 5KRUA 3N52A 4IURA 2IJ0A 4XDXA 2CVRA 4WORA 4CJ2C 2IX0A 3S9WA 1C8CA 5C5MA 2K32A 3S1NB 4R9WA 1G2TA 3OWFA 1TS4A 4FYDA 1B1ZA 1PFMA 2GA4B 2JP1A 3AU7A 1U9RA 1WTQA 2NUCA 2G9HD 2R6GA 1DXMA 2J7ZA 3I4LA 3CKIB 1LACA 3MA2B 1FNUA 3NUCA 4U68A 1ZYRD 3RZDB 1ET9A 4KN4C 1Q90A 2KCCA 3BDOA 4IUNA 5C0XH 3T16A 1FR3A 4TSSA 1STNA 1DOMA 1CTMA 1VDZA 2ZXPA 3A8JE 3IFTA 3FMCA 3BG3A 5JAVA 4BBSB 2F03A 3P20A 3M4OB 2FMMA 1A3VA 4ZLTF 2WAQB 4NW2A 4K2KA 1IKLA 4DAPA 1E2WA 2FJ2A 5CV6A 4Q5VA 4HAEA 2F0QA 1SFOB 5IOCA 2MPMA 2B8GA 2X6LA 1A2UA 3K7AB 1PZJD 2LS01 5AFWA 2EZVA 5CV4A 2E2DC 2PZUA 3NTIA 5C0XI 2L0CA 1EY4A 3PIO3 3TP7A 4IUTA 3BZDB 2JA5B 1IW7C 2K6AA 1JQYD 4DGZA 3D8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM7 3;  3PIP 3;  5JVH 3;  4U67 3;  4WFN 3;  5JVG 3;  3PIO 3;  5DM6 3; 
#chains in the Genus database with same CATH topology
 4JI6 Q;  3DWA A;  5EBC A;  1K0R A;  4GKK Q;  4DF7 A;  3QO2 A;  1AN8 A;  3HKS A;  2EY2 A;  1KRT A;  3DWQ A;  2ZXO A;  5IP7 H;  5G3L D;  4A76 A;  4UP9 A;  2QIL A;  4DK1 A;  1KAA A;  1Q1B A;  5C44 B;  1ILQ A;  3MXN B;  3NEM A;  3PO2 B;  3O13 A;  5A2Q E;  1BNZ A;  4DR5 Q;  2JA8 B;  1GVP A;  1SRO A;  3H3V C;  3AB9 A;  2D62 A;  3SXH A;  2J0T D;  4FF3 A;  3GTQ B;  2WAQ E;  3F1Z A;  4A3C H;  2VUM B;  3PUW A;  2DN8 A;  1N34 Q;  3CCE A;  1F9Q A;  3GTP B;  1SYF A;  1YEZ A;  4DR6 L;  4P74 A;  1J9O A;  4KHP Q;  1BF4 A;  3D3R A;  1Y1W G;  1NTG A;  2AUJ D;  3M3Y B;  4LFB L;  5IT9 c;  3L2P A;  4B3M Q;  1PLF A;  1M4V A;  1Q8I A;  4YCV A;  5EPL A;  3S1Q H;  2PCF B;  2YU9 B;  4A3D B;  5DAU A;  2JXM B;  4YWM A;  4A3C G;  4RGO S;  1PTO B;  2M9V A;  3T51 B;  1STH A;  1YBY A;  1UAP A;  2EJG C;  1EIY B;  1SSO A;  3A7L A;  3FP9 A;  2E5L L;  2OEO A;  4RG1 A;  2Q2H A;  2O5J C;  1OXX K;  2IX3 A;  4XQQ A;  2KEN A;  5DM6 3;  1QVC A;  3MEH A;  5FLX E;  1I6H B;  2NVY B;  4JYA Q;  4OHJ A;  3U58 A;  2RSN A;  4EVO A;  4NDX A;  3GTG H;  2KQ3 A;  4A3F H;  4ME5 A;  3PF4 A;  3HOX H;  5GAD C;  3J80 E;  5C44 G;  1PH1 A;  2RBM A;  3K57 A;  1FJG L;  4RGM A;  3S1R H;  2ENB A;  3SDZ A;  5FJ8 G;  2K5V A;  1EZ6 A;  4JI7 L;  2BDO A;  1E3P A;  1AW7 A;  2KCM A;  4MTN A;  4J1M A;  4XT1 B;  1MJC A;  4AYB G;  1I50 B;  4A93 G;  1CQV A;  1OXS C;  4JI8 L;  1KHI A;  1MJE A;  2FHT A;  3AFQ A;  4TKO B;  3I4N B;  3NP8 A;  2M2L A;  3LX0 A;  5M9O A;  1IL8 A;  4I7Z C;  2F4V Q;  1XMQ L;  5CGK A;  1HA6 A;  2WB1 B;  3NTH A;  3J81 E;  5FJ8 H;  4A3M G;  1F9S A;  3R2T A;  1YVC A;  3Q6S A;  2VB3 X;  1XX8 A;  1L0Y B;  4Y7N B;  1JC7 A;  4LF9 L;  5EPJ A;  3VA7 A;  2JYO A;  5C4H A;  4C3H B;  5IGE A;  5GQO A;  2EYM A;  1EFI D;  3R2I A;  3CCU A;  1Q3L A;  1QUQ B;  2A6H D;  4XT3 B;  1JJG A;  3T1H Q;  1SEB D;  2K1B A;  1B3A A;  3TQY A;  5M5X B;  4L5S A;  2CQA A;  5CV8 A;  1S5D D;  1B50 A;  1EZ8 A;  4KKU A;  4A3M H;  1J5E Q;  4CKC A;  3S1R B;  1HUM A;  1A2T A;  5I2X A;  2BE5 D;  4IO9 A;  3UDG A;  4JI4 L;  3K80 C;  3N6R A;  2F0N A;  2F3V A;  2CW0 D;  3TP5 A;  2KUM A;  3PUX A;  2NZO A;  1ENC A;  3S17 B;  2H5X A;  3HFZ B;  1Z47 A;  5D65 A;  4PMC A;  2JA7 G;  4S3S A;  4OEL B;  1WTW A;  1KC8 C;  2K4K A;  2HQL A;  4UP8 A;  5FOB B;  2JJQ A;  1SFO H;  2PQE A;  4G7O C;  4JG2 A;  3CQZ B;  2WP8 J;  2A6H C;  2Q8R E;  3EQL C;  1SBB B;  3VYR A;  1SDF A;  1PH2 A;  1JJC B;  2Z8L A;  4P72 A;  2A8V A;  3VYU A;  1CM9 A;  2QA4 A;  3TDQ A;  4PNY A;  1EUJ A;  3A5U A;  4BWG B;  1OXU A;  4Y7N H;  3KF8 A;  2OTJ A;  2K5W A;  1L0W A;  1U4M A;  2IWH A;  4QIW B;  1V43 A;  4WFN 3;  1UE1 A;  1LV9 A;  3K59 A;  1LT6 D;  2K5N A;  3PIP A;  2F3W A;  2Q8T A;  3OTO Q;  4A93 B;  1U4L A;  3CC4 A;  4DV3 Q;  3A54 A;  2BE5 C;  2XRQ D;  3J81 j;  1DON A;  5M3F G;  4DN4 M;  3M7G A;  2NZ1 D;  2QEJ C;  3TRE A;  2LXJ A;  4BY1 B;  1CZW A;  5GAG C;  1EWC A;  3W3A A;  5JVH 3;  5M5W B;  3KBG A;  2MUY A;  2KA7 A;  3S1M H;  1RD9 D;  5FKA C;  1VQH A;  5C3X A;  4OWT B;  4BXX G;  4G57 A;  4QY7 A;  3KFU A;  2K33 A;  1BBW A;  3IAY A;  1SNP A;  4R4T A;  1LTS D;  5CMD A;  2K28 A;  5I2Y A;  1F2Z A;  2IHE A;  2NTT A;  5C0X G;  3TN2 A;  1Q46 A;  4FXG C;  4KV6 A;  1SMY C;  3DEP A;  2R93 H;  2NVX H;  1Q1E A;  3KLW A;  3M4O H;  2Z9H A;  2ZJR A;  2Y0S B;  2VB2 X;  1BCP B;  2F0P A;  2GVA A;  3AQQ A;  5H1S E;  5JOB A;  1K73 C;  2KJX A;  4NXN Q;  3C1E A;  3UI2 A;  4JBW A;  1Q7Y C;  1UE6 A;  2NVT B;  2PI2 A;  4MIU A;  4EQ5 A;  4F8M A;  1S4Z A;  3E5S A;  2IT1 A;  2A1A A;  4DK3 C;  1UE7 A;  5E4W C;  5IYC H;  2V1C C;  3PSI A;  5IYD G;  2ICI A;  5I9P A;  1VQM A;  1DZ1 A;  3I4O A;  3HOY G;  3H09 A;  3D31 A;  5FLX c;  1JIC A;  4C3I G;  3VR4 A;  4CBV A;  3KLS A;  3CCQ A;  4L6T B;  4ZKB B;  1O7L A;  1XXG A;  2F1M A;  1YHQ A;  4JI6 L;  2HD3 A;  2F0O A;  2B2Y C;  5C0X J;  2A68 C;  2WFW A;  1A63 A;  1TS5 A;  1I94 Q;  3S2H B;  2EJM A;  2GN5 A;  3FEW X;  5IYD H;  1PYS B;  1SE8 A;  4R4O A;  1PH3 A;  1VQA A;  2K75 A;  3MC0 B;  1YIT A;  2XRS D;  3E0J A;  1SYG A;  4XYO A;  4LFC L;  4DNI A;  1EOV A;  1XNQ Q;  3ERO A;  4DR3 Q;  3J7Y W;  1F2L A;  4U67 3;  3JAM L;  1SYD A;  1IYJ B;  1KL9 A;  1O80 A;  3HP3 A;  1TWC B;  3U9S A;  1SE4 A;  3J81 L;  1PTO F;  3MAQ A;  3HRZ C;  1LT4 D;  4J15 A;  1K0S A;  1N33 Q;  1PZK D;  1YZ6 A;  1PYB A;  2D9U A;  3E3X A;  3CP0 A;  3SK5 A;  4RMF A;  1CA6 A;  3KLS X;  2LXK A;  3J81 i;  2Z6K C;  1GUS A;  4JBK A;  2FFK B;  5I6Y A;  3J81 c;  1EY6 A;  1BOS A;  2ALY B;  3CCS A;  3RR5 A;  1EY8 A;  1HJP A;  1LTI D;  4L5R C;  3B6Y A;  3HG9 A;  2UUA L;  1CK1 A;  2Z4H A;  2A68 D;  2CHB D;  1HFG A;  1W6J A;  2K03 A;  4WJ3 M;  1O7Y A;  1LTG D;  1K8A C;  5IGD A;  2R3Z A;  3J7A F;  1TR5 A;  2F3I A;  1TXY A;  3MXN A;  1X56 A;  4P75 A;  5IP9 H;  2MHV A;  2Z4I A;  2B29 A;  2XWJ B;  1TWH B;  1HNZ Q;  1V1Q A;  2CWP A;  4QIW E;  4NXN L;  1U5K A;  3MWY W;  2Q8I B;  3ICE A;  1SNO A;  3MVV A;  3PO3 H;  4QJF A;  3STB D;  1DOK A;  3TP6 A;  4LF7 Q;  4PZ6 A;  5DLQ E;  2OCE A;  1XJV A;  2VL6 A;  4C3I B;  4GKJ Q;  1FVI A;  4ID6 A;  1VS0 A;  4KHV A;  5C6A A;  3HOY B;  3CAM A;  4JYA L;  1I6H H;  4POG A;  4DV4 Q;  1ZEQ X;  2L5T A;  3K81 C;  5K36 H;  5M5Y H;  3S17 H;  4DR5 L;  3KBX A;  3HEJ A;  4JCV E;  1CSP A;  3CCL A;  3GTJ H;  1D1K A;  4DXG A;  4QCL A;  3A56 A;  1VQP A;  4LF5 Q;  5KEE A;  3NTK A;  4A4I A;  1GUN A;  2EYH A;  1ZKO A;  5ELB A;  1K3B C;  3RN2 A;  2SOB A;  1RDP D;  4X66 Q;  2K50 A;  4G7H C;  4XIG S;  2R61 A;  4GKK L;  3NE5 B;  4KTA A;  1M90 C;  2A5H A;  2XSC A;  1M8A A;  1UWV A;  2RHS B;  2B2Y A;  5C3E B;  1HCZ A;  3PUV A;  5J1Z A;  2Z0S A;  2KCT A;  4IN3 A;  2HIV A;  5I9O A;  2Q2T A;  3QR8 A;  3S2D H;  2F0L A;  2RQX A;  3RMH A;  2WKC A;  4X3S A;  3I91 A;  3SK8 A;  1X3Q A;  5HUR A;  2VZA A;  1CKO A;  3D4D A;  3JAM c;  1TT2 A;  1NCV A;  5D14 A;  3OOC A;  1BBU A;  2F0H A;  1B7Y B;  4HN7 A;  4KHZ A;  4LF4 Q;  1D5M C;  4BBR G;  3NBH B;  3BVG A;  4WRD A;  1SYC A;  1RF2 D;  1IYU A;  1KIX A;  3AFP A;  4CDD C;  4C1N I;  2F4I A;  3I70 A;  1Y1V B;  4DUY L;  1BUV T;  4UDU C;  1MIU A;  2DY7 A;  1ROD A;  4LUZ A;  5KIX A;  5J22 A;  1G2S A;  1BCP C;  1K8G A;  4HED A;  2JEA I;  2A19 A;  5D3D A;  1PH5 A;  1N32 Q;  2I46 A;  1JOO A;  1GUG A;  1MGS A;  1WTH A;  4PQX A;  2NBF A;  1HHV A;  5HGQ A;  2AQ3 B;  1H9J A;  1TQO A;  4HIK A;  3P1H A;  1GJX A;  1KNA A;  1PXU A;  4PV1 C;  3MZ5 A;  2UXB Q;  1X3G A;  3GV3 A;  2PNR C;  1B9M A;  3E6Z X;  3QB3 A;  4DV6 L;  4BBS H;  4O0A A;  1RL2 A;  3P7J A;  1EYC A;  4Q0F A;  4IFD G;  4OIK A;  4X64 L;  2HUG A;  4N8F A;  5BR8 L;  3BU2 A;  3K0X A;  1T9H A;  2PO4 A;  3RLO A;  3IFD A;  4J6H A;  3JAM i;  3GTO H;  3CXC A;  4V19 0;  3S14 H;  1LUZ A;  3DM1 A;  2G5D A;  1PFN A;  1E2Z A;  2N78 A;  5CR3 A;  1F2Y A;  4P71 A;  3EFX D;  1E0B A;  4ZUI A;  3EJI A;  5G3L F;  2EYO A;  3RLN A;  4JI0 Q;  1IBM L;  1GHK A;  4YIJ A;  1Y1W H;  4QB4 A;  3OYY A;  4DV2 L;  1EU3 A;  2XN9 C;  2JA5 H;  1W6K A;  1JMC A;  1JWU D;  2XVS A;  3SR1 A;  4BXX H;  3UE1 A;  1Q86 C;  4K0K L;  4GNX B;  1MKH A;  1SXT A;  4B3S L;  4OX9 L;  1ASZ A;  3I4N G;  1B2T A;  3QWN A;  5E4X A;  2EOT A;  4K5V A;  4ZUJ A;  1BDO A;  2A6E D;  2IPK D;  5C3W A;  3DHQ A;  2R93 G;  3I2Z A;  5F2D A;  1IBL L;  4MN3 A;  3NHH A;  1CFM A;  4A3J G;  5C4X B;  3HOW G;  4TQU S;  3G48 A;  2FMC A;  4DK6 C;  4YWK A;  3K7U C;  4LWC A;  2AWN A;  2EYJ A;  2NB0 A;  1STE A;  2HDL A;  4KHP L;  3I4N H;  1WJJ A;  3GTQ H;  4IUU A;  2B2V A;  2VQF L;  2EY1 A;  1I3Q B;  2O2L D;  1CHQ D;  1Q12 A;  2N88 A;  4C2M B;  5IYC G;  3NSW A;  4ZK9 B;  1B3Q A;  1QVF A;  1N9W A;  2IHF A;  2PYK A;  1RHP A;  4V0B A;  4C3I H;  1S5E D;  1MD2 D;  2VY3 A;  3AMU A;  1NR2 A;  3OPO A;  4BA2 I;  3HGB A;  4QUC A;  1FD7 D;  4HMJ A;  4EQO A;  2SEB D;  2N3S A;  2F0V A;  1HFN A;  2L9H A;  1VQ6 A;  5IT9 L;  1NNX A;  2E74 C;  3GP7 A;  2RA4 A;  2JSO A;  4RFB A;  1WTO A;  1LTA D;  3NWS A;  4GN5 A;  5C5L A;  4NXM Q;  3K8A A;  5LL6 X;  3DMU A;  4EQP A;  2L55 A;  5LHY 1;  4A3M B;  5LL6 S;  1VF5 C;  4KD3 A;  3S16 B;  1F2M A;  1KAB A;  4RGT A;  2B2U A;  4EX5 A;  3VR3 A;  4YY3 L;  4K2L A;  3U4V A;  1PV4 A;  5A2Q L;  4YHH L;  3LGJ A;  2RVL A;  1EEI D;  3RNU A;  2LFN A;  1SMY D;  2C5C A;  2UUA Q;  3M7N A;  1SE3 A;  3A55 A;  1FGB D;  3F2B A;  4C3J G;  4KJN A;  5IWA Q;  3I7F A;  1QIL A;  4HJA A;  3GTG B;  1JB3 A;  3DM3 A;  1FNW A;  2QGQ A;  3R93 A;  4CDF C;  3OMC A;  5D3I B;  4R4I A;  4N9T A;  3W1B A;  2V4D A;  4C2M H;  3C46 A;  1P8L A;  4O1N A;  3H15 A;  4BY1 G;  1NY4 A;  3EIV A;  4DUZ L;  4HJ7 A;  1HR0 W;  1BCP F;  3KYH C;  2JA7 H;  2NVQ B;  3D0F A;  1PFB A;  2D0P A;  2OQK A;  5JJI A;  4A3E B;  2DUD A;  4C3J H;  4WJ4 A;  4A3G G;  4ULL A;  4HIM A;  5IP9 G;  2O4X A;  1AZQ A;  5DNF A;  2PQA A;  1PRT B;  3A7A B;  1XTC D;  3HOX B;  5IGC A;  4FVM A;  2JA5 G;  4BY1 H;  2WIN B;  1WD0 A;  3S16 H;  1EIH A;  3NBH A;  3KK7 A;  2WB1 G;  5A35 A;  3SHL A;  4AYB E;  4A3K H;  3QOL A;  2QEX A;  1K83 H;  2JEB I;  5T1I A;  5FLM G;  3S1M B;  5E7N A;  3EN2 A;  4FXK C;  1BCP D;  5CV7 A;  4A75 A;  1AE3 A;  3ONA B;  4Z9C B;  4R4C A;  1YJW A;  1PYW D;  3S24 A;  1ENA A;  3GTK B;  4GS3 A;  4GNX A;  4ZAI A;  1QB5 D;  3NPP A;  1PTO D;  5KND A;  2O5I C;  2AKW B;  4A3J H;  4JV5 Q;  3I72 A;  3CHB D;  3G4S A;  1M1K C;  4DUZ Q;  5C4J H;  2BH2 A;  1YNJ D;  2NZH A;  1D6E C;  1TWF B;  5KYL A;  4AQY Q;  1UE5 A;  4DR3 L;  2MNA A;  1G29 1;  4PZ8 A;  2B3G A;  3L3O C;  1F9P A;  2H1E A;  2E8G A;  3MXU A;  2YYZ A;  1EQT A;  4F87 A;  1NBW A;  2X69 A;  3GTO B;  3BDC A;  4UAI A;  1S5B D;  1R9T B;  3MFG A;  3T1Y L;  2BCO A;  2HHH L;  3UDX A;  2UUB L;  4K6D A;  3TME A;  1QJO A;  3VYS A;  2RDF A;  3H0G G;  2ZTE A;  4X3U A;  3OW2 A;  1FJG Q;  2XIW A;  4H13 C;  4A3K B;  4DR7 L;  5ELC A;  2Y0S E;  3GD7 A;  4FF2 A;  1BQQ T;  2B63 H;  5EBD A;  4IJH A;  1EY9 A;  1S72 A;  1GD7 A;  1N36 L;  1MBY A;  1X3P A;  2ZM6 Q;  3F8T A;  4A3G B;  2F0I A;  2EPB A;  3P75 A;  5LMN Q;  4MTK A;  4RAU C;  3LWE A;  4ZCK A;  4X66 L;  2I5L X;  3H0G H;  1Y1V H;  2QKI C;  2Z1C A;  2ZM6 L;  1SRU A;  2PNH A;  2YV5 A;  2Z6K A;  2RSO A;  4DU9 A;  4YWL A;  4MHE A;  5NUC A;  1KQS A;  4GOP A;  1CA5 A;  2B63 G;  1A8V A;  1C4Q A;  4JI2 L;  3GTP H;  2E5L Q;  5EKI A;  1L1O A;  4R8N A;  4CKB A;  1HNX Q;  4GLA C;  3KDF B;  2EYP A;  5BN3 A;  3M3Y H;  3D6C A;  3SE0 A;  2UUB Q;  1A3U A;  1VQ8 A;  1JOQ A;  1X65 A;  4JBM A;  4B3M L;  5COR A;  3A5Z B;  3FDT A;  4GLV B;  3OHX C;  4X65 Q;  2JE6 I;  3CW2 C;  4BBS G;  4PZ7 A;  4M1U B;  2EYL A;  1QZG A;  2E2J B;  3L9A X;  4KK7 A;  4G7Z C;  2L15 A;  4HJ9 A;  3I4M H;  1J5E L;  5JEA H;  3W1G A;  1BVS A;  2B2U C;  4FNF A;  1EY5 A;  4OIJ A;  1GO3 E;  4A3K G;  2OXP A;  2J4X A;  4IPG A;  5JPM C;  5KGU A;  1HZ9 A;  4KKT A;  3HOU G;  3H0G B;  5FLM H;  5LMU L;  1HRJ A;  3EBE A;  2KHS A;  5DM7 3;  3PO3 B;  2A69 C;  4K8J A;  4LF8 L;  5TSS A;  2YTV A;  4DA2 A;  3ULP A;  1R4P B;  4JI1 L;  1DM0 B;  3A74 A;  4LF6 Q;  2EXZ A;  2F0E A;  2Y0S G;  1CHP D;  4IOC A;  2L11 A;  4X62 L;  2VS1 A;  3BS1 A;  4DV4 L;  2DGY A;  2BDN A;  3GTL H;  2HHH Q;  1DYQ A;  1VQB A;  4LF6 L;  3FHW A;  1Z7T A;  2C9O A;  3G6J B;  2A6E C;  3QJY A;  2PMZ B;  1UUP A;  3I3C A;  1WI5 A;  4A3I H;  4DV0 Q;  3K5M A;  1B9N A;  1VQC A;  5K36 G;  2ZXR A;  3T4A C;  4JI3 Q;  3HS0 C;  1C7Y A;  1STB A;  4JK1 C;  3V2T A;  4F7X A;  1G6Z A;  3KJO A;  1SNM A;  1V1P B;  4DFA A;  4DAV A;  2NVQ H;  3HOW H;  1ZYR C;  1L1O B;  1KXL A;  1HZB A;  2HCC A;  2B2T C;  4DV2 Q;  4A3E H;  2C35 B;  2NN6 G;  2NWG A;  3S1Q B;  2VQE L;  1KLU D;  5HY6 A;  1SN8 A;  2YU9 H;  4A3D H;  4N9P A;  2AQ2 B;  1JT8 A;  2HDM A;  2H4O A;  4RCN A;  5DEH A;  4DXF A;  4K5X A;  1Q8K A;  1GUT A;  4G4K A;  4DR4 Q;  3D4R A;  3F2U A;  4A3L H;  4LK1 C;  4RGN A;  1GUO A;  4OO1 G;  1QNK A;  2B39 A;  1STG A;  2R7F A;  4AH6 A;  3SEB A;  4JI5 L;  2QCP X;  4A3E G;  3C3L A;  3DUZ A;  3IRB A;  4X65 L;  1I6V C;  2MP1 A;  1D7Q A;  3U9O A;  3TSS A;  2M00 A;  1MI2 A;  5GRO A;  4YHH Q;  1TWG H;  3FKI B;  3VR5 A;  3J7A V;  1PZI D;  3WWV A;  3M4Y A;  4EQN A;  1Z6H A;  3Q8D A;  1PH9 A;  1FL0 A;  3HOZ B;  1RIP A;  1PRT F;  4OO1 H;  3K5N A;  3WOE A;  2HCI A;  1YNJ C;  3CC2 A;  1HQM C;  1CT1 D;  4YCU A;  4KY5 A;  4DV1 Q;  5KYI A;  2VNU D;  2JA9 A;  3OIQ A;  3Q23 A;  1N32 L;  3K6O A;  1NAP A;  1KAW A;  4IUV A;  4IFD J;  2BH8 A;  1XTD A;  3VA5 A;  1HNW L;  3QG1 A;  4KN7 C;  4BS9 A;  4APV A;  4FDB A;  3F2D A;  5T1G A;  4DK0 A;  4K14 A;  4B3R Q;  1EYG A;  1A15 A;  2GVB A;  1RJT A;  3SVM A;  3QOJ A;  3OIP A;  4NXM L;  3S1N H;  3W2D A;  4DV5 Q;  2UXC L;  2NYZ D;  1K9M C;  1NMG A;  1I5F A;  1QNU A;  1RKN A;  1VMP A;  2BOS A;  2K5Q A;  4NKL A;  2UXC Q;  4J8Q A;  3T56 B;  4A3G H;  1H9K A;  4IFD H;  1EY0 A;  1YJ9 A;  1IBL Q;  4OL7 A;  2PI2 E;  3NEN A;  1JCK B;  4IZ8 A;  2L12 A;  5J39 A;  1D1I A;  4CJ0 B;  3PUY A;  4H7B A;  3CCJ A;  4ZRZ A;  5LMN L;  3TS0 A;  1IBK L;  2F0U A;  3FVQ A;  1A3T A;  2MGS A;  4IPH A;  1ESF A;  4K5W A;  1EOT A;  1JR0 D;  2MJ8 A;  5EGT A;  1OO9 B;  1TII D;  2VQF Q;  3PQI A;  1IKM A;  3S15 B;  1PRT D;  4L5T A;  1H9S B;  1CZG A;  4A3I G;  1ENF A;  1EL0 A;  4A3J B;  1JOK A;  1WVL A;  3M4P A;  4KD4 A;  4LF9 Q;  1ILP A;  1I94 L;  2QDL A;  1VQK A;  2PZT A;  4FO2 A;  3LWU A;  1EYA A;  2K14 A;  4PG3 A;  3IKJ A;  2E2I H;  1CQF A;  4LW1 A;  3T53 B;  1KLG D;  1WOC A;  2MFI A;  3I8Z A;  4HSP A;  5K5P A;  2XGT A;  4LAA A;  5EKK A;  1VCI A;  3A8I E;  2ASB A;  1V1O A;  3K0Y A;  3KLR A;  1IYV A;  1TS3 A;  5CYU A;  4LNQ A;  2X6G A;  1U0L A;  1SNQ A;  3NQI A;  4A3L G;  3VR2 A;  1H9R A;  1WTP A;  1KRS A;  2MO0 A;  3GV6 A;  3UE0 A;  1R4Q B;  4ABN A;  3ND9 A;  5L37 A;  1HR0 L;  3PIP 3;  1SLJ A;  3NK9 A;  1EEF D;  1B44 D;  2F0K A;  1SE2 A;  1J8I A;  2VQE Q;  1EIG A;  1LAB A;  4AYB B;  4LFC Q;  1X3E A;  2B2W A;  3PO2 G;  2JK8 A;  1NJI C;  2EY6 A;  3S15 H;  5IGF A;  1UNS A;  3G71 A;  1TWA H;  1JOR A;  1OXT A;  3ZJY C;  4OGQ C;  2L4N A;  2KVM A;  5BN5 A;  4RHS A;  2NVX B;  1XPU A;  2F0G A;  1D8L A;  1N8R C;  1HTL D;  2IY5 B;  1HNX L;  1RTN A;  3PO2 H;  4LJZ C;  5FO8 B;  3HOW B;  3S14 B;  2JA8 H;  3KOJ A;  2PW7 A;  2B2T A;  3MXG A;  2ZJQ A;  1NUC A;  1E2V A;  5IE8 A;  3G6E A;  2I07 B;  3NQT A;  1NMF A;  3NXW A;  1NSN S;  1Z9F A;  3X3N A;  1B8A A;  1G51 A;  1VQO A;  1XNR Q;  3RZO B;  4I7A A;  1LT5 D;  4MNO A;  4DNT B;  2MQH A;  1Y1W B;  3K5L A;  1DD2 A;  4OWW B;  5CV9 A;  4PMW A;  1PVO A;  1W3S A;  3H3V I;  1HUN A;  2TMP A;  3KF6 B;  3URY A;  3LNN A;  1EQR A;  1PHJ A;  2WV6 D;  5ELD A;  4DUY Q;  1HH2 P;  3I4M G;  4JW0 A;  3GO5 A;  4DR1 L;  1TWA B;  4DV5 L;  1T5E A;  4DV7 Q;  1CKM A;  1F9R A;  1TWG B;  1BXT A;  2XTI A;  5M3M B;  1OXV A;  5M5X H;  1N34 L;  3H91 A;  4Y52 H;  4H02 A;  1E1O A;  3HOU H;  1KNE A;  2I5M X;  3TRZ A;  4JI5 Q;  3CU7 A;  4DR6 Q;  4DV7 L;  3STB C;  4FXD A;  2EVB A;  4DAM A;  1Y8O B;  4GOP C;  1EWH A;  1SAP A;  4R1J A;  1TY2 A;  1PH8 A;  1GOZ A;  2OQ0 A;  3BVM A;  3PMF A;  1LTT D;  3SK4 A;  5IOD A;  3R8B A;  4R8I A;  2A73 B;  1ML0 D;  2D0O A;  4BY7 G;  3PF5 A;  2F0M A;  5FO9 B;  5C3E H;  4XQJ A;  3J80 c;  3I90 A;  1I3Q H;  3M9B A;  4JOI A;  5ELE A;  3TZD A;  1VQI A;  1V9P A;  4JI0 L;  5EKL A;  4GN4 B;  2MO1 A;  3DLL A;  1N36 Q;  2R92 B;  2R7D A;  4HIO A;  3KJP A;  3HOV H;  1I50 H;  2B2V C;  1HZA A;  1WTX A;  5CV5 A;  2OWO A;  2A69 D;  2OF1 A;  4IUP A;  3ITP A;  4XTC S;  1OTC A;  1X54 A;  2A74 C;  3F2C A;  4HTH A;  4JI4 Q;  2JA6 H;  2F0D A;  1YNX A;  5M3M H;  4IQZ A;  4X64 Q;  2G9D A;  1ZXT A;  3K7A H;  4BBR B;  3RLF A;  1SJH D;  1VQ5 A;  4HCE A;  1VQ9 A;  2L1B A;  2UXD Q;  3E9I A;  3MXP A;  2HQE A;  5CC4 A;  1QG7 A;  3C1F A;  4M8A A;  4JI1 Q;  1YIJ A;  4JI7 Q;  2F0S A;  2KOL A;  4B08 A;  1XNR L;  5IIF A;  5AJ3 Q;  1IBM Q;  3GTM H;  5JEA J;  4JC0 A;  1ESR A;  4A3B H;  1AH9 A;  3FKI H;  1LTR D;  4F88 A;  2EE1 A;  3MTS A;  2F4V L;  4OON A;  4JI3 L;  1VQN A;  4RCO A;  2IX1 A;  1K8M A;  2FIN B;  1ICW A;  3BVZ A;  2QDB A;  1PFS A;  3HOZ H;  1BO0 A;  1S3O A;  3TZU A;  1JE5 A;  1YJN A;  2EYF A;  2RDG A;  4LMQ D;  1LTB D;  5ELO A;  5BN4 A;  2AHO B;  5FO7 B;  3AYH B;  4YY3 Q;  4LF8 Q;  1JWS D;  4DR4 L;  2HT1 A;  2BA1 A;  4L63 B;  4FF1 A;  1A62 A;  1SND A;  1Y1V G;  4CJ1 B;  1P16 A;  5LMU Q;  4UPA A;  2B2W C;  4BY7 B;  4IJL A;  5BR8 Q;  1YNN D;  3DEO A;  5C4J B;  2PZW A;  1X9N A;  1AZP A;  3HKZ G;  1XPO A;  3HOZ G;  2K04 A;  2N49 A;  4QL5 A;  3WDN A;  2NTS A;  5HGT A;  1PH6 A;  3Q22 A;  1QCB D;  2E2J H;  1LO5 D;  3MEF A;  2EDG A;  3FPU B;  1HQR D;  4DR2 Q;  1HNW Q;  3V96 A;  4UY8 C;  1SJE D;  1B53 A;  3V05 A;  1MSH A;  4CDE C;  1RCV D;  1GHJ A;  2YTX A;  3AEV A;  2PQA B;  1GXD C;  1QWY A;  1K28 A;  4B9W A;  4B9X A;  4RHR A;  3I55 A;  4X6A H;  1YI2 A;  1WCM H;  4FF4 A;  2ID0 A;  1XMQ Q;  2CW0 C;  5M5W H;  2XNA C;  3NWT A;  2AWO A;  4H0L C;  1TKW B;  5JEA G;  1XMO L;  2CQO A;  2CH4 A;  3VYT A;  3KF6 A;  2DNE A;  4IFD I;  2F52 A;  1TWC H;  2WKD A;  2D5D A;  3CPW A;  4B3T Q;  4OWX B;  3H3V H;  1R9T H;  4JOI C;  1B70 B;  2RHQ B;  1RTO A;  1WCM G;  5IT9 E;  1STA A;  3ER0 A;  3BYY B;  2QF7 A;  3L0O A;  1H9M A;  1EU4 A;  1LLR D;  4UP7 A;  1PTO H;  1B4O A;  1UEA B;  4A3I B;  1VQ4 A;  1WD1 A;  3VDY A;  4DR2 L;  1L0X B;  1FYC A;  1D2B A;  1F77 A;  1KTK A;  4AQY L;  3CRK C;  1XPR A;  1UEB A;  3H94 A;  4HR7 B;  5M3M G;  4CHT B;  3IL8 A;  5FK9 C;  4LFA Q;  3HKZ E;  4RKB A;  3BZC A;  3K58 A;  2OTL A;  1KDA A;  1PMR A;  2UU9 L;  4DV1 L;  3OMG A;  1PA6 A;  3UDF A;  4GNX C;  4IAL A;  3J7A 5;  1I4H A;  1Y69 U;  3M4Q A;  4GZY C;  4UHV A;  3FRP B;  2EIF A;  1NR4 A;  3HOU B;  3D6W A;  4YCW A;  2AMC B;  4HJ8 A;  2FXQ A;  3CCV A;  2YTY A;  2WB1 E;  2NN6 H;  1AEX A;  1YHB A;  3TBI B;  2R7Z H;  3CME A;  4A3D G;  2ZT9 C;  1TVX A;  3CMA A;  4RA8 A;  2DY8 A;  4ILW A;  4CGY B;  5JJZ A;  3DWP A;  3S2H H;  2Q2U A;  2AUK A;  1YHA A;  3U4Z A;  1QOH A;  1U4P A;  1S5C D;  5EPK A;  4QQB X;  3GDE A;  4I65 A;  3TP8 A;  1Y8N B;  1DGS A;  1SR3 A;  3RD4 A;  2RF4 A;  4LUO A;  4QF4 A;  3ULJ A;  5C4X H;  1VQJ A;  1JJ2 A;  5E3F A;  1CSQ A;  2XWB B;  2JA7 B;  1HA5 A;  4OO1 I;  5COY A;  2K05 A;  4P73 A;  3U50 C;  2DJF C;  1A6X A;  4JV5 L;  4DNR B;  2JA8 G;  1CKN A;  2K5D A;  2DNC A;  3DXJ C;  3CQZ H;  3JC6 6;  2JA6 B;  2SDF A;  4DAY A;  4XXE A;  1XYI A;  4O42 A;  3PV0 A;  3S2D B;  1A0I A;  5C4X G;  1PH4 A;  5E1F A;  4C1N K;  3EA6 A;  4RH6 A;  3HKZ B;  2I5H A;  3ULL A;  2UXB L;  1K83 B;  3I56 A;  5KNC A;  1N33 L;  2F0J A;  4X62 Q;  4POF A;  1Q82 C;  5C4Z A;  1VF7 A;  3CRL C;  4C56 C;  1T5X D;  3KUP A;  3D4W A;  2KEC A;  2LMC B;  4FP5 D;  1TWH H;  4OXP A;  2K52 A;  3GTM B;  1G91 A;  2RKS A;  1G6P A;  4A93 H;  1C48 A;  4A3B B;  1XNQ L;  4JI2 Q;  2N55 A;  4A3F B;  3ERQ A;  4TRD A;  3T13 A;  1HR0 Q;  3BJU A;  2R92 G;  1BBX C;  4H44 C;  2B8F A;  4K8I A;  4TVA B;  1J6Q A;  5GAE C;  1AP0 A;  1IW7 D;  2TSS A;  2ZTC A;  3BYT B;  1CKN B;  1O7Z A;  1SMX A;  3H6M A;  1HPC A;  4IPC A;  4GOP B;  5IWA L;  4ALP A;  2AQ1 B;  4KY7 A;  3VR6 A;  1D5X C;  4NB3 A;  2EY5 A;  4CKE A;  4P2C B;  3GTJ B;  4L5Q A;  2LY7 A;  5I6W A;  3R3O A;  1G8Z D;  2CCZ A;  4HID A;  2UUC Q;  4BY7 H;  4DPG A;  4QGU A;  1YNN C;  1O7I A;  2KEE A;  3K5O A;  2BA0 A;  1PRT C;  1JE4 A;  2IL8 A;  4JBJ A;  3HOV B;  4B3R L;  2UUC L;  4NMZ A;  2EXD A;  1PH7 A;  2PPB C;  2DJG C;  3T1Y Q;  4C3H H;  3HOV G;  4DV3 L;  4MZ9 A;  5IYB G;  4C3J B;  4GKJ L;  4KI0 A;  2B63 B;  2NVT H;  4O2D A;  1I4P A;  4HCS A;  1WTV A;  1K8O A;  1DOL A;  5EQ0 A;  4AIM A;  5M3F B;  1WYD A;  1CI3 M;  2E76 C;  2E2H H;  5JPN C;  1O78 A;  5LMN W;  5JVG 3;  4KJO A;  4ODG A;  1WFQ A;  1SNC A;  2R7Z G;  2R93 B;  1JB7 A;  2K01 A;  3FPP A;  4XQN A;  3RZD H;  1ET6 A;  3OWE B;  4QMG A;  4C3H G;  1Y8P B;  5EAY A;  1V8Q A;  4LF4 L;  2E75 C;  2LSS A;  3J7Z C;  1D5Z C;  5KNB A;  2RCN A;  4BA1 I;  2SNM A;  3A8K E;  3JAM E;  3GTK H;  5CBA E;  3CD6 A;  3GQB A;  4KKS A;  2CH4 W;  2ICE C;  1KDB A;  1KD1 C;  1EWI A;  3ND8 A;  4JVZ A;  1I4Q A;  1LT3 D;  2F0T A;  4A3B G;  1EIF A;  4IOA A;  3NBI A;  1DJR D;  1LTL A;  2PW5 A;  2VUM H;  1EQV A;  1TU2 B;  4XYQ A;  1EFW A;  2EJF C;  2RCF A;  4ZKC B;  1S5F D;  1VMC A;  1I4X A;  1W2B A;  2F0W A;  1V1P A;  4E6I A;  3WOF A;  2RDH A;  2KED A;  3Q0A A;  1QUQ A;  3PIO A;  3I4M B;  1HTP A;  2NN6 I;  1EY7 A;  2WAQ G;  5AJ3 L;  2E2H B;  2Q2I A;  2P5Z X;  5J3B A;  1VQF A;  3M85 A;  3TEH B;  3W5O A;  1PTO C;  2IW3 A;  3BDL A;  3L7Z C;  4KMU C;  2E2I B;  1XWE A;  4QUF A;  3HZX A;  1STY A;  5JJL A;  3SK6 A;  1FNV A;  4IUQ A;  1II3 A;  2Z6B A;  4KLK A;  1NE3 A;  2K5H A;  3CPF A;  5IGG A;  2VW9 A;  1EYD A;  4OEM B;  1U4R A;  2NVY H;  5EJW A;  4JI8 Q;  2D2C C;  5FLX L;  4X3T A;  4A3F G;  4WJW A;  1GUW A;  3OSO A;  1WCM B;  3HOX G;  2ZTD A;  5ELF A;  5IGB A;  1ONL A;  1SYB A;  5ISR A;  3Q24 A;  5ELN A;  4EGV A;  3KF8 B;  4PMB A;  3T1H L;  4X3K A;  1WTR A;  3J80 L;  3ERS X;  4K6L A;  4ZYS A;  3HOY H;  1DCZ A;  1BR9 A;  1E7Z A;  3CCR A;  1SYE A;  4DKA C;  1HXY D;  3PUZ A;  1IBK Q;  2EQS A;  2K7V A;  3PGZ A;  1JWM D;  3MHB A;  3ZYY X;  1HZC A;  1I4R A;  4ZQ3 A;  1VQ7 A;  4L8J A;  3MFY A;  2F0F A;  3NEL A;  1E22 A;  5IYB H;  2SNS A;  4HJ5 A;  3EVQ A;  1Q81 C;  1X32 A;  2OT2 A;  3G7L A;  3X3M A;  2KCN A;  1AFP A;  3KDF A;  1CUK A;  4DAY B;  3I73 A;  3QIA A;  1H9S A;  5C3E G;  1MSG A;  1KDC A;  1IL2 A;  4CDC C;  4KY6 A;  2UU9 Q;  4LUV A;  1IHZ A;  4DV6 Q;  1QZH A;  3RN5 A;  4NP5 A;  1ICF B;  5M5Y B;  5CBE E;  1TY0 A;  3E0E A;  3OW7 A;  2VXW A;  3RUZ A;  3J80 i;  4RKL A;  1IXR A;  1TS2 A;  1XMO Q;  3RZO H;  2WAC A;  4DR1 Q;  2I0Q A;  2WII B;  2N8N A;  2LKV A;  4HMI A;  2CFM A;  4RWS C;  5I4D A;  1I4G A;  4HSV A;  3C2P A;  2ZJP A;  1MHW C;  1PDQ A;  2QW7 A;  1ASY A;  2R7Z B;  2UXD L;  1QE6 A;  4B3S Q;  4OX9 Q;  4LFA L;  1EQQ A;  3CCM A;  2JA6 G;  1VQG A;  4B3T L;  1X3F A;  3GTL B;  5KRU A;  3N52 A;  4IUR A;  2IJ0 A;  2CWA A;  4LF5 L;  2VUM G;  1C0A A;  4XDX A;  2CVR A;  2PMZ E;  3SGI A;  4WOR A;  3CF5 A;  1H95 A;  1X6O A;  1VQD A;  4LFB Q;  4CJ2 C;  2IX0 A;  3S9W A;  1C8C A;  1GM5 A;  5C5M A;  2K32 A;  3S1N B;  1L1O C;  5JJK A;  4R9W A;  1G2T A;  3PO3 G;  3OWF A;  1K3R A;  3FKI G;  1TS4 A;  4FYD A;  2KHI A;  1B1Z A;  1PFM A;  2GA4 B;  2JP1 A;  3AU7 A;  1U9R A;  1LM0 A;  1GKH A;  1WTQ A;  5M3F H;  2JN4 A;  2KBN A;  2NUC A;  2G9H D;  2KHJ A;  3OTO L;  4NPS A;  2R6G A;  1DXM A;  2J7Z A;  3I4L A;  1X55 A;  4LF7 L;  3CKI B;  1LAC A;  3MA2 B;  1FNU A;  3NUC A;  4IPD A;  4JPB W;  3BZK A;  4N8X 1;  4U68 A;  1ZYR D;  3RZD B;  4K0K Q;  1FGU A;  4DR7 Q;  1ET9 A;  4KN4 C;  1Q90 A;  2KCC A;  1S40 A;  3BDO A;  2CKZ B;  4IUN A;  5IY0 A;  4DV0 L;  1AE2 A;  5C0X H;  3T16 A;  1FR3 A;  4TSS A;  1STN A;  1DOM A;  1CTM A;  1VDZ A;  4R4Q A;  4ME3 A;  2ZXP A;  3A8J E;  3IFT A;  1E1T A;  1Y14 B;  2ATW A;  3FMC A;  3BG3 A;  1C9O A;  2HIX A;  5JAV A;  2F03 A;  4BBS B;  3P20 A;  2ES2 A;  2R92 H;  3M4O B;  2FMM A;  1A3V A;  4ZLT F;  2WAQ B;  4NW2 A;  4K2K A;  1IKL A;  4GN3 B;  1L2F A;  4DAP A;  1E2W A;  2FJ2 A;  5C44 H;  5CV6 A;  4Q5V A;  4HAE A;  4GLX A;  3PCO B;  2F0Q A;  1SFO B;  1LYL A;  5IOC A;  2MPM A;  1IZ6 A;  1HNZ L;  2B8G A;  1QVG A;  2X6L A;  3A0J A;  1A2U A;  3K7A B;  4BBR H;  1TWF H;  1BKB A;  1PZJ D;  2LS0 1;  5AFW A;  3CC7 A;  1VQL A;  2EZV A;  5CV4 A;  2E2D C;  2PZU A;  5IP7 G;  3UDI A;  2JQO A;  3E9H A;  1E24 A;  3NTI A;  2L0C A;  5GAH C;  5C0X I;  1EY4 A;  1VQE A;  3PIO 3;  3TP7 A;  4IUT A;  3BZD B;  2JA5 B;  1IW7 C;  2K6A A;  1JQY D;  4DGZ A;  3TS2 A;  3D8G A; 
#chains in the Genus database with same CATH homology
 3DWA A;  5EBC A;  4DF7 A;  3QO2 A;  1AN8 A;  2EY2 A;  3DWQ A;  2ZXO A;  5G3L D;  2QIL A;  4DK1 A;  1KAA A;  1Q1B A;  5C44 B;  1ILQ A;  3PO2 B;  3O13 A;  5A2Q E;  1BNZ A;  2JA8 B;  3H3V C;  3AB9 A;  2D62 A;  3SXH A;  2J0T D;  4FF3 A;  3GTQ B;  2VUM B;  3PUW A;  2DN8 A;  1F9Q A;  3GTP B;  1SYF A;  1J9O A;  1BF4 A;  3D3R A;  2AUJ D;  3M3Y B;  1PLF A;  1M4V A;  1Q8I A;  5EPL A;  2PCF B;  2YU9 B;  4A3D B;  5DAU A;  2JXM B;  4RGO S;  1PTO B;  2M9V A;  3T51 B;  1STH A;  1UAP A;  2EJG C;  1SSO A;  3A7L A;  2OEO A;  2O5J C;  1OXX K;  2IX3 A;  4XQQ A;  5DM6 3;  3MEH A;  5FLX E;  1I6H B;  2NVY B;  4OHJ A;  2RSN A;  4EVO A;  4NDX A;  2KQ3 A;  4ME5 A;  3J80 E;  2RBM A;  3K57 A;  4RGM A;  2ENB A;  3SDZ A;  1EZ6 A;  2BDO A;  4XT1 B;  1AW7 A;  4J1M A;  1I50 B;  1CQV A;  1OXS C;  2FHT A;  4TKO B;  3I4N B;  3NP8 A;  2M2L A;  3LX0 A;  5M9O A;  1IL8 A;  4I7Z C;  5CGK A;  1HA6 A;  2WB1 B;  3NTH A;  3J81 E;  1F9S A;  3R2T A;  3Q6S A;  2VB3 X;  1XX8 A;  1L0Y B;  4Y7N B;  1JC7 A;  5EPJ A;  3VA7 A;  2JYO A;  5C4H A;  4C3H B;  5IGE A;  2EYM A;  1EFI D;  3R2I A;  1Q3L A;  2A6H D;  4XT3 B;  1SEB D;  2K1B A;  1B3A A;  5M5X B;  2CQA A;  5CV8 A;  1S5D D;  1B50 A;  1EZ8 A;  4KKU A;  4CKC A;  3S1R B;  1HUM A;  1A2T A;  5I2X A;  2BE5 D;  3N6R A;  2F0N A;  2F3V A;  2CW0 D;  3TP5 A;  2KUM A;  3PUX A;  1ENC A;  3S17 B;  5D65 A;  1Z47 A;  4PMC A;  4S3S A;  1WTW A;  5FOB B;  4G7O C;  2PQE A;  3CQZ B;  2WP8 J;  2A6H C;  2Q8R E;  3EQL C;  1SBB B;  3VYR A;  1SDF A;  2Z8L A;  3VYU A;  1CM9 A;  3TDQ A;  4PNY A;  4BWG B;  1OXU A;  3KF8 A;  2K5W A;  1U4M A;  2IWH A;  4QIW B;  1V43 A;  4WFN 3;  1LV9 A;  3K59 A;  1LT6 D;  2F3W A;  2Q8T A;  4A93 B;  1U4L A;  3A54 A;  2BE5 C;  2XRQ D;  1DON A;  4DN4 M;  3M7G A;  2NZ1 D;  2QEJ C;  4BY1 B;  1CZW A;  1EWC A;  3W3A A;  5JVH 3;  5M5W B;  3KBG A;  2MUY A;  2KA7 A;  1RD9 D;  5FKA C;  5C3X A;  4G57 A;  2K33 A;  3IAY A;  1SNP A;  1LTS D;  5CMD A;  2K28 A;  5I2Y A;  1F2Z A;  2NTT A;  5C0X G;  3TN2 A;  4KV6 A;  4FXG C;  1SMY C;  3DEP A;  1Q1E A;  2Y0S B;  2VB2 X;  1BCP B;  2F0P A;  5JOB A;  2KJX A;  3C1E A;  3UI2 A;  4JBW A;  2NVT B;  4MIU A;  4F8M A;  1S4Z A;  3E5S A;  2IT1 A;  5E4W C;  2ICI A;  5I9P A;  1DZ1 A;  3H09 A;  3D31 A;  1JIC A;  4C3I G;  3VR4 A;  4CBV A;  3KLS A;  4L6T B;  4ZKB B;  1O7L A;  1XXG A;  2F1M A;  2F0O A;  2B2Y C;  5C0X J;  2A68 C;  1TS5 A;  3S2H B;  2EJM A;  3FEW X;  3MC0 B;  2XRS D;  3E0J A;  1SYG A;  4XYO A;  3ERO A;  3J7Y W;  1F2L A;  4U67 3;  3JAM L;  1SYD A;  1O80 A;  3HP3 A;  1TWC B;  3U9S A;  1SE4 A;  3J81 L;  1PTO F;  3MAQ A;  3HRZ C;  1LT4 D;  1PZK D;  2D9U A;  3SK5 A;  1CA6 A;  3KLS X;  1GUS A;  2FFK B;  5I6Y A;  1EY6 A;  1BOS A;  1EY8 A;  1LTI D;  3HG9 A;  1CK1 A;  2Z4H A;  2A68 D;  2CHB D;  1HFG A;  1W6J A;  2K03 A;  1O7Y A;  1LTG D;  5IGD A;  2R3Z A;  3J7A F;  1TR5 A;  3MXN A;  2MHV A;  2Z4I A;  2XWJ B;  1TWH B;  3MWY W;  2Q8I B;  1SNO A;  3MVV A;  1DOK A;  3TP6 A;  4C3I B;  4ID6 A;  4KHV A;  5C6A A;  3HOY B;  1ZEQ X;  2L5T A;  5K36 H;  3KBX A;  3HEJ A;  1D1K A;  4DXG A;  4QCL A;  3A56 A;  5KEE A;  3NTK A;  1GUN A;  2EYH A;  1ZKO A;  5ELB A;  2SOB A;  1RDP D;  4G7H C;  4XIG S;  2R61 A;  3NE5 B;  4KTA A;  2A5H A;  2XSC A;  1M8A A;  2B2Y A;  5C3E B;  1HCZ A;  3PUV A;  5J1Z A;  4IN3 A;  5I9O A;  2F0L A;  2RQX A;  3RMH A;  2WKC A;  4X3S A;  3I91 A;  3SK8 A;  1X3Q A;  5HUR A;  3D4D A;  1TT2 A;  1NCV A;  5D14 A;  3OOC A;  2F0H A;  4HN7 A;  4KHZ A;  1D5M C;  3BVG A;  4WRD A;  1SYC A;  1RF2 D;  1IYU A;  4C1N I;  2F4I A;  3I70 A;  1Y1V B;  1BUV T;  4UDU C;  5KIX A;  2DY7 A;  1ROD A;  5J22 A;  1G2S A;  1BCP C;  4HED A;  2JEA I;  5D3D A;  2I46 A;  1JOO A;  1GUG A;  1MGS A;  4PQX A;  2NBF A;  1HHV A;  2AQ3 B;  1TQO A;  1H9J A;  3P1H A;  1GJX A;  1KNA A;  1PXU A;  4PV1 C;  3MZ5 A;  3GV3 A;  2PNR C;  1B9M A;  3E6Z X;  3QB3 A;  3P7J A;  1EYC A;  4Q0F A;  4IFD G;  4OIK A;  2HUG A;  2PO4 A;  3IFD A;  4J6H A;  4V19 0;  3DM1 A;  1PFN A;  1E2Z A;  5CR3 A;  1F2Y A;  3EFX D;  1E0B A;  4ZUI A;  3EJI A;  5G3L F;  2EYO A;  1GHK A;  4YIJ A;  4QB4 A;  1EU3 A;  2XN9 C;  1W6K A;  1JWU D;  2XVS A;  3SR1 A;  1SXT A;  1B2T A;  3QWN A;  5E4X A;  2EOT A;  4K5V A;  4ZUJ A;  1BDO A;  2A6E D;  2IPK D;  5C3W A;  3DHQ A;  5F2D A;  4MN3 A;  3NHH A;  1CFM A;  5C4X B;  4TQU S;  2FMC A;  2AWN A;  2EYJ A;  2NB0 A;  1STE A;  2HDL A;  4IUU A;  2B2V A;  2EY1 A;  1I3Q B;  2O2L D;  1CHQ D;  1Q12 A;  2N88 A;  4C2M B;  3NSW A;  4ZK9 B;  2PYK A;  1RHP A;  4V0B A;  1S5E D;  1MD2 D;  3AMU A;  1NR2 A;  3OPO A;  4BA2 I;  3HGB A;  4QUC A;  1FD7 D;  4HMJ A;  4EQO A;  2SEB D;  2F0V A;  1HFN A;  2L9H A;  5IT9 L;  2E74 C;  3GP7 A;  2RA4 A;  2JSO A;  4RFB A;  1WTO A;  1LTA D;  3NWS A;  5C5L A;  5LL6 X;  3DMU A;  4EQP A;  2L55 A;  5LHY 1;  4A3M B;  5LL6 S;  1VF5 C;  4KD3 A;  3S16 B;  1F2M A;  1KAB A;  4RGT A;  2B2U A;  3VR3 A;  4K2L A;  5A2Q L;  2RVL A;  1EEI D;  2LFN A;  1SMY D;  2C5C A;  3M7N A;  1SE3 A;  3A55 A;  1FGB D;  4C3J G;  4KJN A;  1QIL A;  3GTG B;  1JB3 A;  1FNW A;  3R93 A;  3OMC A;  5D3I B;  4N9T A;  2V4D A;  3C46 A;  4O1N A;  1BCP F;  2NVQ B;  1PFB A;  4A3E B;  4ULL A;  2O4X A;  1AZQ A;  5DNF A;  1PRT B;  3A7A B;  1XTC D;  3HOX B;  5IGC A;  4FVM A;  2WIN B;  1WD0 A;  1EIH A;  3KK7 A;  3NBH A;  5A35 A;  3SHL A;  3QOL A;  2JEB I;  5T1I A;  3S1M B;  4FXK C;  1BCP D;  5CV7 A;  3ONA B;  4Z9C B;  1PYW D;  1ENA A;  3GTK B;  4ZAI A;  1QB5 D;  3NPP A;  1PTO D;  5KND A;  2O5I C;  3I72 A;  3CHB D;  1YNJ D;  1D6E C;  1TWF B;  5KYL A;  1G29 1;  3L3O C;  1F9P A;  2H1E A;  3MXU A;  3GTO B;  2YYZ A;  1EQT A;  4F87 A;  2X69 A;  3BDC A;  4UAI A;  1S5B D;  1R9T B;  3MFG A;  2BCO A;  4K6D A;  3TME A;  1QJO A;  3VYS A;  2RDF A;  4X3U A;  2XIW A;  4H13 C;  4A3K B;  5ELC A;  3GD7 A;  4FF2 A;  1BQQ T;  5EBD A;  1EY9 A;  1MBY A;  1X3P A;  4A3G B;  2F0I A;  2EPB A;  3P75 A;  4RAU C;  3LWE A;  2QKI C;  2Z1C A;  2RSO A;  4DU9 A;  4MHE A;  5NUC A;  1CA5 A;  1C4Q A;  5EKI A;  4R8N A;  4CKB A;  2EYP A;  5BN3 A;  3D6C A;  3SE0 A;  1A3U A;  1JOQ A;  5COR A;  3FDT A;  3OHX C;  2JE6 I;  4M1U B;  2EYL A;  2E2J B;  3L9A X;  4KK7 A;  4G7Z C;  5JEA H;  2B2U C;  4FNF A;  1EY5 A;  4OIJ A;  2OXP A;  2J4X A;  5JPM C;  5KGU A;  4KKT A;  3H0G B;  1HRJ A;  2KHS A;  5DM7 3;  3PO3 B;  2A69 C;  4K8J A;  5TSS A;  4DA2 A;  1R4P B;  1DM0 B;  2EXZ A;  2F0E A;  1CHP D;  2L11 A;  3BS1 A;  2BDN A;  1DYQ A;  1Z7T A;  2C9O A;  3G6J B;  2A6E C;  3QJY A;  2PMZ B;  1UUP A;  3I3C A;  3K5M A;  1B9N A;  5K36 G;  2ZXR A;  3T4A C;  3HS0 C;  1STB A;  4JK1 C;  3V2T A;  4F7X A;  1G6Z A;  1SNM A;  1V1P B;  4DFA A;  4DAV A;  1ZYR C;  2HCC A;  2B2T C;  2NN6 G;  2NWG A;  3S1Q B;  1KLU D;  4N9P A;  2AQ2 B;  2HDM A;  2H4O A;  4RCN A;  5DEH A;  4DXF A;  4K5X A;  1GUT A;  4G4K A;  3D4R A;  3F2U A;  4LK1 C;  4RGN A;  1GUO A;  4OO1 G;  1QNK A;  2B39 A;  1STG A;  3SEB A;  2QCP X;  3C3L A;  3DUZ A;  1I6V C;  2MP1 A;  3U9O A;  3TSS A;  2M00 A;  1MI2 A;  3FKI B;  3VR5 A;  3J7A V;  1PZI D;  3M4Y A;  4EQN A;  1Z6H A;  3HOZ B;  1PRT F;  4OO1 H;  3K5N A;  3WOE A;  2HCI A;  1YNJ C;  1HQM C;  1CT1 D;  4KY5 A;  5KYI A;  2VNU D;  3OIQ A;  3Q23 A;  3K6O A;  1NAP A;  4IUV A;  4IFD J;  3VA5 A;  3QG1 A;  4KN7 C;  4BS9 A;  5T1G A;  4DK0 A;  4K14 A;  1A15 A;  1RJT A;  3SVM A;  3QOJ A;  3OIP A;  3W2D A;  2NYZ D;  1QNU A;  1RKN A;  1VMP A;  2BOS A;  2K5Q A;  4NKL A;  4J8Q A;  3T56 B;  1H9K A;  4IFD H;  1EY0 A;  4OL7 A;  1JCK B;  4IZ8 A;  2L12 A;  5J39 A;  1D1I A;  4CJ0 B;  3PUY A;  4H7B A;  4ZRZ A;  2F0U A;  3FVQ A;  1A3T A;  2MGS A;  1ESF A;  4K5W A;  1EOT A;  1JR0 D;  2MJ8 A;  5EGT A;  1OO9 B;  1TII D;  1IKM A;  3S15 B;  1PRT D;  1H9S B;  1CZG A;  1ENF A;  1EL0 A;  4A3J B;  1JOK A;  1WVL A;  4KD4 A;  1ILP A;  2PZT A;  4FO2 A;  3LWU A;  1EYA A;  3IKJ A;  1CQF A;  3T53 B;  1KLG D;  3I8Z A;  4HSP A;  5K5P A;  4LAA A;  5EKK A;  1VCI A;  3A8I E;  1V1O A;  3K0Y A;  3KLR A;  1IYV A;  1TS3 A;  5CYU A;  2X6G A;  1SNQ A;  3NQI A;  3VR2 A;  1H9R A;  1WTP A;  3GV6 A;  1R4Q B;  4ABN A;  3ND9 A;  3PIP 3;  3NK9 A;  1EEF D;  1B44 D;  2F0K A;  1SE2 A;  1J8I A;  1EIG A;  1LAB A;  4AYB B;  2B2W A;  2EY6 A;  5IGF A;  1UNS A;  1JOR A;  1OXT A;  4OGQ C;  2L4N A;  2KVM A;  5BN5 A;  4RHS A;  2NVX B;  2F0G A;  1HTL D;  1RTN A;  4LJZ C;  5FO8 B;  3HOW B;  3S14 B;  2PW7 A;  2B2T A;  3MXG A;  1NUC A;  1E2V A;  2I07 B;  3NQT A;  3NXW A;  1NSN S;  3X3N A;  3RZO B;  1LT5 D;  4DNT B;  1Y1W B;  3K5L A;  1DD2 A;  5CV9 A;  4PMW A;  1HUN A;  2TMP A;  3URY A;  3LNN A;  2WV6 D;  5ELD A;  3GO5 A;  1TWA B;  1T5E A;  1F9R A;  1TWG B;  1BXT A;  5M3M B;  1OXV A;  3H91 A;  1KNE A;  3CU7 A;  4FXD A;  2EVB A;  1Y8O B;  1EWH A;  1SAP A;  1TY2 A;  1GOZ A;  3BVM A;  3PMF A;  1LTT D;  3SK4 A;  5IOD A;  3R8B A;  4R8I A;  2A73 B;  1ML0 D;  2F0M A;  5FO9 B;  4XQJ A;  3I90 A;  5ELE A;  3TZD A;  5EKL A;  2R92 B;  2B2V C;  1WTX A;  5CV5 A;  2A69 D;  2OF1 A;  4IUP A;  3ITP A;  4XTC S;  2A74 C;  4HTH A;  2F0D A;  4IQZ A;  2G9D A;  1ZXT A;  4BBR B;  3RLF A;  1SJH D;  4HCE A;  2L1B A;  3MXP A;  2HQE A;  5CC4 A;  1QG7 A;  3C1F A;  4M8A A;  2F0S A;  2KOL A;  4B08 A;  5IIF A;  5JEA J;  1ESR A;  1LTR D;  4F88 A;  2EE1 A;  3MTS A;  4RCO A;  2IX1 A;  1K8M A;  2FIN B;  1ICW A;  3BVZ A;  2QDB A;  1BO0 A;  3TZU A;  2EYF A;  2RDG A;  4LMQ D;  1LTB D;  5BN4 A;  5FO7 B;  1JWS D;  2BA1 A;  4L63 B;  4FF1 A;  1SND A;  4CJ1 B;  2B2W C;  4BY7 B;  1YNN D;  3DEO A;  5C4J B;  2PZW A;  1AZP A;  2K04 A;  3WDN A;  2NTS A;  5HGT A;  3Q22 A;  1QCB D;  1LO5 D;  2EDG A;  3FPU B;  1HQR D;  3V96 A;  1SJE D;  1B53 A;  3V05 A;  1MSH A;  1RCV D;  1GHJ A;  1GXD C;  1QWY A;  4B9W A;  4B9X A;  4RHR A;  4FF4 A;  2ID0 A;  2CW0 C;  2XNA C;  3NWT A;  2AWO A;  4H0L C;  1TKW B;  5JEA G;  3VYT A;  2DNE A;  4IFD I;  2WKD A;  2D5D A;  1RTO A;  5IT9 E;  1STA A;  3BYY B;  2QF7 A;  1H9M A;  1EU4 A;  1LLR D;  1PTO H;  1B4O A;  1UEA B;  4A3I B;  1WD1 A;  1L0X B;  1FYC A;  1D2B A;  1F77 A;  1KTK A;  3CRK C;  3H94 A;  4HR7 B;  4CHT B;  3IL8 A;  5FK9 C;  3K58 A;  4RKB A;  1KDA A;  1PMR A;  3OMG A;  4IAL A;  1I4H A;  1Y69 U;  4GZY C;  3FRP B;  1NR4 A;  3HOU B;  3D6W A;  2NN6 H;  1AEX A;  3TBI B;  2ZT9 C;  1TVX A;  4RA8 A;  2DY8 A;  4ILW A;  4CGY B;  5JJZ A;  3DWP A;  2AUK A;  1QOH A;  1U4P A;  1S5C D;  5EPK A;  4I65 A;  3TP8 A;  1Y8N B;  3RD4 A;  4QF4 A;  5E3F A;  2XWB B;  2JA7 B;  1HA5 A;  4OO1 I;  5COY A;  2K05 A;  1A6X A;  4DNR B;  2K5D A;  2DNC A;  3DXJ C;  2JA6 B;  2SDF A;  4DAY A;  4XXE A;  1XYI A;  4O42 A;  3PV0 A;  3S2D B;  5E1F A;  4C1N K;  3EA6 A;  4RH6 A;  3HKZ B;  1K83 B;  5KNC A;  2F0J A;  5C4Z A;  1VF7 A;  3CRL C;  4C56 C;  1T5X D;  3KUP A;  3D4W A;  2KEC A;  2LMC B;  4FP5 D;  3GTM B;  1G91 A;  2RKS A;  1C48 A;  4A3B B;  2N55 A;  4A3F B;  3ERQ A;  4TRD A;  3T13 A;  1BBX C;  4H44 C;  2B8F A;  4K8I A;  1AP0 A;  1IW7 D;  2TSS A;  3BYT B;  1O7Z A;  3H6M A;  1HPC A;  2AQ1 B;  4KY7 A;  3VR6 A;  1D5X C;  2EY5 A;  4CKE A;  4P2C B;  3GTJ B;  2LY7 A;  5I6W A;  3R3O A;  1G8Z D;  1YNN C;  2KEE A;  3K5O A;  2BA0 A;  1PRT C;  1JE4 A;  2IL8 A;  3HOV B;  4NMZ A;  2PPB C;  4C3J B;  4KI0 A;  2B63 B;  1I4P A;  4HCS A;  1WTV A;  1K8O A;  1DOL A;  5EQ0 A;  5M3F B;  2E76 C;  1CI3 M;  5JPN C;  1O78 A;  5JVG 3;  4KJO A;  4ODG A;  1SNC A;  2R93 B;  2K01 A;  3FPP A;  4XQN A;  1ET6 A;  3OWE B;  4QMG A;  4C3H G;  1Y8P B;  1V8Q A;  2E75 C;  1D5Z C;  5KNB A;  4BA1 I;  2SNM A;  3A8K E;  3JAM E;  5CBA E;  3GQB A;  4KKS A;  2ICE C;  1KDB A;  3ND8 A;  1I4Q A;  1LT3 D;  2F0T A;  3NBI A;  1DJR D;  2PW5 A;  1EQV A;  1TU2 B;  4XYQ A;  2EJF C;  4ZKC B;  1S5F D;  1VMC A;  1I4X A;  2F0W A;  1V1P A;  4E6I A;  3WOF A;  2RDH A;  2KED A;  3Q0A A;  3I4M B;  1HTP A;  2NN6 I;  1EY7 A;  2E2H B;  3M85 A;  1PTO C;  2IW3 A;  3BDL A;  3L7Z C;  4KMU C;  2E2I B;  1XWE A;  4QUF A;  3HZX A;  1STY A;  3SK6 A;  1FNV A;  4IUQ A;  1II3 A;  5IGG A;  1EYD A;  1U4R A;  5EJW A;  2D2C C;  5FLX L;  4X3T A;  4WJW A;  1GUW A;  3OSO A;  1WCM B;  5ELF A;  5IGB A;  1ONL A;  1SYB A;  5ISR A;  3Q24 A;  4EGV A;  4PMB A;  4X3K A;  1WTR A;  3J80 L;  4K6L A;  4ZYS A;  1DCZ A;  1BR9 A;  1SYE A;  1HXY D;  3PUZ A;  2K7V A;  1JWM D;  3MHB A;  3ZYY X;  1I4R A;  4ZQ3 A;  4L8J A;  3MFY A;  2F0F A;  2SNS A;  3EVQ A;  1X32 A;  2OT2 A;  3G7L A;  3X3M A;  2KCN A;  1AFP A;  3I73 A;  3QIA A;  1H9S A;  1MSG A;  1KDC A;  4KY6 A;  1IHZ A;  4NP5 A;  5M5Y B;  5CBE E;  1TY0 A;  3OW7 A;  2VXW A;  3RUZ A;  4RKL A;  1TS2 A;  2WAC A;  2WII B;  2LKV A;  4HMI A;  4RWS C;  5I4D A;  1I4G A;  4HSV A;  3C2P A;  1PDQ A;  2R7Z B;  1QE6 A;  3GTL B;  5KRU A;  3N52 A;  4IUR A;  2IJ0 A;  4XDX A;  2CVR A;  4WOR A;  4CJ2 C;  2IX0 A;  3S9W A;  1C8C A;  5C5M A;  2K32 A;  3S1N B;  4R9W A;  1G2T A;  3OWF A;  1TS4 A;  4FYD A;  1B1Z A;  1PFM A;  2GA4 B;  2JP1 A;  3AU7 A;  1U9R A;  1WTQ A;  2NUC A;  2G9H D;  2R6G A;  1DXM A;  2J7Z A;  3I4L A;  3CKI B;  1LAC A;  3MA2 B;  1FNU A;  3NUC A;  4U68 A;  1ZYR D;  3RZD B;  1ET9 A;  4KN4 C;  1Q90 A;  2KCC A;  3BDO A;  4IUN A;  5C0X H;  3T16 A;  1FR3 A;  4TSS A;  1STN A;  1DOM A;  1CTM A;  1VDZ A;  2ZXP A;  3A8J E;  3IFT A;  3FMC A;  3BG3 A;  5JAV A;  4BBS B;  2F03 A;  3P20 A;  3M4O B;  2FMM A;  1A3V A;  4ZLT F;  2WAQ B;  4NW2 A;  4K2K A;  1IKL A;  4DAP A;  1E2W A;  2FJ2 A;  5CV6 A;  4Q5V A;  4HAE A;  2F0Q A;  1SFO B;  5IOC A;  2MPM A;  2B8G A;  2X6L A;  1A2U A;  3K7A B;  1PZJ D;  2LS0 1;  5AFW A;  2EZV A;  5CV4 A;  2E2D C;  2PZU A;  3NTI A;  5C0X I;  2L0C A;  1EY4 A;  3PIO 3;  3TP7 A;  4IUT A;  3BZD B;  2JA5 B;  1IW7 C;  2K6A A;  1JQY D;  4DGZ A;  3D8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...