4WFN3

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22 in complex with erythromycin
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
59
structure length
59
Chain Sequence
THKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2
total genus 3
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4wfn300
3PIO3 5DM73 4U673 5JVH3 5DM63 5JVG3 3PIP3 4WFN3
chains in the Genus database with same CATH superfamily
1SN8A 3HOYB 4R4OA 2WB1B 4X65Q 2WAQG 3VYSA 3GTPH 4RHRA 1KQSA 3KUPA 4KV6A 5IY0A 4JI0Q 1MGSA 3CKIB 3CHBD 1FGBD 2PI2A 3MZ5A 3P75A 3S1MB 2SNSA 4UP8A 1FNWA 5BN3A 3KF8B 1Y1VB 3KFUA 2F0FA 2O2LD 4GKJL 3MXNB 1C0AA 4K2LA 2FMCA 3D4DA 1II3A 4LF7Q 4QJFA 1KXLA 1SNPA 4C3JG 1BO0A 1PFBA 3CC4A 1BR9A 3I4NB 2F0QA 2OQKA 5EBDA 2EY5A 4RG1A 3GV3A 2CKZB 2FFKB 4GLXA 2K5WA 4A93G 4KN7C 5JVG3 4C3IB 1STAA 3NWTA 3GTLH 2F3VA 1S5ED 4DPGA 1WCMG 3STBC 4BBRB 4BY1H 4DV4L 1LV9A 1IXRA 4A3IG 4B08A 2RF4A 3HEJA 1HUMA 5CV5A 2RDGA 5I2YA 3KJOA 4WJWA 1IBLQ 3HOYH 1LYLA 2K05A 4DUZQ 5D3DA 5IGDA 4L5RC 3HG9A 4HJ8A 1FL0A 3BDLA 1IBMQ 2E2HB 1E2WA 3R93A 4L5QA 3VYTA 1Q46A 2IPKD 3NTIA 2Q2UA 1PA6A 2EOTA 2VNUD 3OOCA 1HPCA 1GUNA 3QIAA 4ZAIA 5M3MB 4ZUJA 1CSQA 2WB1G 1STGA 4FF1A 1X3QA 1CA5A 1IBKQ 2Z1CA 2ICIA 1TU2B 4JI6Q 1L0XB 2B3GA 4RGTA 2JA8H 3J81E 3BJUA 3J7ZC 4X3KA 1EWCA 4JBMA 3PUXA 4EVOA 2F0VA 4H02A 2YTYA 4DU9A 3TP5A 1EY8A 5LMUL 2UXBL 3T1HL 1UE6A 4L63B 1I94L 3NK9A 1G291 2VY3A 2V4DA 3G6JB 4JC0A 1S5DD 1GUTA 2Z9HA 1VDZA 5CMDA 1LT4D 2F0EA 3GTJH 4DR4Q 3VR2A 2BH2A 4MTNA 2HUGA 3JC66 4TKOB 4KMUC 4A3KB 1VQIA 5C5LA 3M85A 3R3OA 3EVQA 4POGA 2NVQB 1XMQL 2B2TA 1B50A 1SNDA 4ME3A 4C56C 3MAQA 5CC4A 2DY7A 2R92H 4PMWA 5FKAC 1FNUA 3ULPA 1B53A 2JA6H 3U4ZA 1M4VA 1TQOA 1RODA 1NUCA 5L37A 3GP7A 3OMGA 2KQ3A 3W1GA 3AMUA 2J4XA 1ESRA 5IYBH 2LSSA 3RZDH 3EA6A 2XN9C 1H9JA 2Q2TA 4RA8A 4GLVB 3KBGA 1JQYD 1B3AA 3IKJA 4BY7H 2VUMG 3GTKB 4K5VA 2YU9B 2F0GA 5CBEE 1DZ1A 2ZM6L 3S1RB 4N9TA 1LTTD 1CZGA 2EYJA 1K8GA 1L0WA 1HTPA 4YY3Q 5M5YB 4PG3A 3ZJYC 1HTLD 1VQBA 5EGTA 1PH8A 3GTMH 4LF6Q 4FXGC 4HMIA 4LFBQ 1CFMA 4ME5A 3Q22A 2A6ED 2TMPA 2FJ2A 4DNIA 2JYOA 2B39A 1EQVA 5IP7H 1WVLA 2PQEA 4TRDA 4IN3A 4KK7A 1FYCA 2NN6I 5JJIA 4RWSC 5ELOA 4NKLA 1B9MA 1SYCA 1GO3E 1EEFD 1KAAA 4HTHA 3W5OA 4A3CH 1I6HH 1CK1A 3VA7A 1VQ9A 3S1MH 5D14A 3DLLA 1N33Q 4YWMA 5KEEA 1DXMA 2I5LX 1H9SB 2M2LA 3W3AA 4GNXC 1X3EA 1W6JA 1DJRD 4A93H 1BBWA 1HNZL 2VUMH 2F4IA 2PMZB 2A1AA 2F4VL 1WFQA 4Y7NB 1QCBD 4JI7Q 1XMQQ 4A3GB 1A3UA 2IT1A 3QO2A 1S5CD 2KA7A 1F9QA 1G2SA 3MEFA 1A8VA 1X6OA 4ODGA 1VQGA 5IGGA 4G7HC 2E2JB 1HR0L 1DYQA 4WJ3M 1SYDA 3S17H 2LY7A 2FHTA 1WTWA 2ALYB 2A68D 2CWAA 1KRTA 1VQ6A 2HT1A 4TQUS 3E3XA 5IIFA 1LT5D 1QVFA 4XQJA 4IUQA 5IYCG 3PO3G 1PTOC 4MIUA 4U68A 1SDFA 3UE1A 4B3MQ 1GD7A 3S14B 3PO2B 4GKJQ 3JAMc 2WAQB 1QJOA 5M3MH 2N3SA 4PMCA 1X32A 3G6EA 1XXGA 4LF4Q 3A8KE 1RTNA 1LTRD 1LO5D 3CQZB 1SFOB 3J81i 2L9HA 4L5TA 1N32Q 1U0LA 4UHVA 2EYFA 5E3FA 4HJ9A 4OL7A 5DEHA 4QQBX 3PO2G 2PNRC 3UDGA 3BDCA 2PQAA 2KHSA 1LTID 3MTSA 2D0PA 2K1BA 3K7AH 4DUZL 2PPBC 2VB3X 1VQMA 3H3VC 5C0XH 3RN2A 1PH7A 4P2CB 4WJ4A 1EQTA 4Q5VA 1UUPA 5AJ3Q 4F88A 3I72A 2NZOA 1J9OA 3I4OA 1UE5A 1GKHA 2B29A 3NTHA 5J22A 3AQQA 1DOLA 3IFTA 5CV8A 5ELCA 2PMZE 1IW7D 2VB2X 2V1CC 3S1NB 4DV6L 4KLKA 2F4VQ 3CW2C 3EFXD 2WACA 5E4WC 4DN4M 2NVQH 1NAPA 4JI8L 4HCSA 1FGUA 1SE4A 1XTCD 3K81C 1HQRD 1M1KC 1AP0A 2EY1A 2KVMA 3T13A 3M4YA 2J7ZA 1A3VA 5C44B 1A2UA 5EPJA 4BBSB 1HR0Q 1OTCA 3SE0A 4IFDH 4IUPA 3KF8A 4JI4L 5KIXA 4IUNA 1AE3A 2D9UA 3A56A 2R93B 5FLXL 5JJZA 1GJXA 2Q8TA 4DK6C 2A5HA 4HN7A 1V8QA 2MP1A 3T1HQ 1XX8A 4F8MA 2HD3A 1G8ZD 1CZWA 1ZEQX 3V96A 2WAQE 4F87A 1C7YA 1PDQA 3I73A 3T53B 3NBHB 1PH2A 1JJCB 4DR4L 1LABA 1HA6A 3H09A 3HZXA 3D31A 3NENA 3E6ZX 2PCFB 1HNXQ 1SEBD 1A15A 2FXQA 2ES2A 4DR6L 2PI2E 2EYLA 1LT3D 3BZDB 1H9KA 1I4HA 3SVMA 2Z8LA 4XXEA 4N8FA 3QG1A 1S5BD 3KK7A 1F2MA 1GVPA 4DR1L 3STBD 1KAWA 4X66L 2R7ZH 4P71A 5C4HA 4HR7B 2F0JA 2L5TA 3I56A 4DV5L 2CW0C 3BVGA 2XRQD 2X6LA 4GOPA 3GTPB 2IJ0A 1A6XA 4HJ5A 4JI5L 4NP5A 4RMFA 2VL6A 2KCNA 1YBYA 4B3TL 1PRTC 3KDFA 4YCWA 3RZDB 1VQHA 2OTJA 5FJ8H 1FVIA 3K59A 1EYAA 1EY7A 1QG7A 3DXJC 4LF9Q 1I4GA 2AQ2B 2CH4A 3FP9A 2CVRA 4AYBG 4CDEC 3OWEB 3Q6SA 4NB3A 3IL8A 1R4PB 3M4PA 5T1IA 1HZ9A 2EYPA 1ONLA 1LTGD 4LFBL 1UWVA 3S16H 1OXVA 1PTOD 1FJGL 1BCPB 3VR3A 2E2JH 4JOIC 2B63G 1I4XA 3CAMA 4EGVA 1O7IA 3PUVA 1EL0A 5FLMH 4A3EG 5C3EH 3KLRA 2Q8RE 1B7YB 1ILPA 4YIJA 4ALPA 3Q24A 4K5XA 3PIOA 1D1KA 1JOQA 1VCIA 3WOFA 2HCIA 5CR3A 1GUOA 2D2CC 4BWGB 4A3BG 4A3IB 1ET9A 3K5MA 2O4XA 2K50A 3KDFB 3JAMi 3Q23A 1D2BA 1HZBA 1S3OA 4OO1G 2A19A 2WINB 1KNEA 2VW9A 4DNRB 4DAYA 1YVCA 2ZTDA 5CORA 3KLSX 5DM73 3D6WA 2EJMA 3F2BA 4J6HA 4R8IA 3HKZB 2L0CA 5GAGC 2BE5C 3M7NA 1K3RA 4OONA 1TWAH 3CCSA 3J80i 2HIXA 1GXDC 4KKSA 3RZOB 3ND8A 1A3TA 1V1PA 3NQIA 5A2QE 5C3EG 1YHQA 4HSVA 3A5UA 5M3MG 4A75A 1KDAA 1IBLL 1PYBA 2KCTA 5C44H 1GUSA 2AHOB 1F2LA 5FJ8G 1JJ2A 4LF9L 2R93H 4RGMA 1ASZA 1I3QH 1WCMH 2NVYB 1I4RA 4YHHQ 1Y1VH 1JT8A 2E75C 4NXNQ 3MFYA 1D5ZC 4DV1L 5EAYA 1CTMA 4IO9A 1QE6A 4IURA 1TR5A 1WOCA 4A3FB 1X9NA 4GOPC 1ENFA 3BZCA 2UUCQ 5LMNL 1D7QA 1TKWB 4F7XA 1SXTA 1D5XC 3PUZA 2D62A 3NUCA 3GTLB 2N88A 4EX5A 1UNSA 1NSNS 1SNQA 2EDGA 4RCOA 4IJLA 4PMBA 2CQAA 4AYBE 4AH6A 3WWVA 1PH9A 3M3YB 4NW2A 2JQOA 4KHPL 4K5WA 2R7ZG 3PIP3 1EY0A 3AFQA 1EU3A 1LLRD 1EUJA 3I90A 1VMCA 2F1MA 1EFWA 1MI2A 5CV9A 1BF4A 2J0TD 1K83H 1P16A 1K0RA 5C4JH 2I46A 2YU9H 1MKHA 5EKKA 2E5LQ 1UEBA 3TS0A 2R7DA 4IFDG 3V05A 2RQXA 1NJIC 3GTGH 1KLGD 4FDBA 2GVBA 1SMYC 4WFN3 2DUDA 1TWCH 2IX3A 2R61A 1HFNA 2K4KA 2QDBA 4FXKC 1HHVA 4MTKA 2EYOA 4CDFC 1XPOA 1CKNA 3MXGA 2F0WA 4R8NA 2EZVA 2I5MX 1SBBB 4Q0FA 5C4XH 1PZJD 5J39A 1AH9A 4DNTB 3O13A 4A3MG 1S40A 2F52A 4L8JA 3PV0A 1VQ8A 3ICEA 3G48A 1NR2A 1PH3A 2AQ3B 1Q8KA 4YHHL 4CDDC 4DR3Q 4NXNL 2EJGC 1R9TB 5TSSA 1PH6A 3UDFA 3R2IA 4JI2Q 3MXUA 2IWHA 4DV1Q 2R3ZA 5FLMG 2NVXH 3BZKA 3HOZB 2B63B 3OYYA 1DD2A 1HNWQ 3QOJA 1QB5D 2BE5D 2KEDA 4A3BH 1V1OA 2JK8A 4QY7A 2MGSA 5M5WB 4A3IH 3VR4A 1E22A 1NMGA 3EN2A 1XNRL 2EXDA 3E9HA 3PF4A 1AN8A 1HCZA 1HH2P 1B70B 2XSCA 4CKEA 3I4MB 1PTOB 5JEAG 1XMOQ 4JI3L 1CSPA 4S3SA 1Q3LA 4KY6A 5IYDH 2F0PA 3U9OA 4QUFA 2HDLA 4JK1C 1U4RA 4K8JA 4R1JA 2VQFL 4A3BB 3KJPA 2O5IC 1HXYD 1B9NA 2BA1A 2NVTB 3H15A 5JEAH 2BCOA 1KTKA 2UXCQ 4HCEA 4BY1G 1RDPD 3FKIG 5KNDA 3A74A 3RUZA 3TZDA 2IW3A 2PO4A 1LUZA 1A2TA 2KHIA 1Y69U 2JA5G 1JB3A 2BA0A 3KF6B 5G3LD 3CP0A 4JPBW 5IYCH 4C3HH 4JI7L 3PO3H 4C2MB 3T56B 2F0IA 2QKIC 4R4CA 2B2WA 1X3GA 4LAAA 3CCMA 2ATWA 4IQZA 1NY4A 2K32A 4JYAQ 2PNHA 1YHBA 4KY5A 5I9OA 3D4WA 4XQQA 2ZTEA 5EPKA 2E2IH 3K80C 1B4OA 3DUZA 4YWKA 4LW1A 2F3IA 4KKUA 4DV7L 2F0DA 3UE0A 1K73C 2VQEL 1JWMD 1QVGA 3BVZA 3N52A 4A3EH 3NELA 4JBKA 3CCLA 4IOAA 3HOVG 1YNJD 4ZQ3A 2DN8A 3A5ZB 3R8BA 1SJED 4DFAA 1SRUA 2K5VA 4NDXA 4A3LG 1BUVT 1I6VC 1BQQT 4C3JB 1SLJA 1LACA 4I65A 3S2DB 2HIVA 4DKAC 5FLXc 4NXML 1AE2A 1H9RA 4I7AA 2G9DA 3FMCA 4A3JG 3CRKC 2RCNA 1B1ZA 3C3LA 5FO8B 4A3FG 2Z0SA 3W2DA 4C1NK 5M5XH 5JPNC 4UP9A 3UDIA 3Q8DA 1X54A 1O80A 3HOWG 1STNA 5C5MA 1XMOL 3A54A 4GN5A 1J5EQ 1E2ZA 3EJIA 2B2VA 2CHBD 1P8LA 2F3WA 4EQPA 3C1FA 1WTHA 3J80c 1V9PA 2K6AA 2LS01 5C3XA 4GNXA 2A8VA 1C9OA 2QW7A 3HOVH 2ENBA 3QR8A 3DM1A 2ID0A 3H91A 1PHJA 3MEHA 4IPCA 1XWEA 2I07B 3PQIA 1I50B 1SJHD 2R92G 1TWHH 3RZOH 5M5XB 3DWPA 4PZ7A 2ZTCA 4IALA 1TWFH 5E1FA 3CCJA 1LTLA 3NE5B 4EQ5A 2UUCL 1OO9B 5KYIA 4OELB 4AQYQ 1AZPA 2Q8IB 1PMRA 1ILQA 4LUVA 1VQ7A 4YCUA 2GA4B 1J6QA 1MSHA 2CH4W 1J8IA 2VXWA 2UXDL 3NP8A 4JI4Q 3EQLC 1SYEA 3RMHA 1IL8A 1L2FA 5HY6A 4DV7Q 4CJ0B 1DGSA 3S15B 4U673 1XTDA 5ELEA 1DM0B 3GTKH 4ID6A 3U50C 3CD6A 1EY9A 2HQEA 2SDFA 2Z6KC 3K6OA 5HGTA 2XVSA 4K6LA 4ZLTF 2RHQB 4HJAA 4HMJA 1ASYA 4DR6Q 2Q2HA 2K5NA 1TIID 3BDOA 3KF6A 4NXMQ 2DJGC 4IPGA 3OTOQ 3CF5A 2BH8A 1L1OC 2CFMA 1T5XD 1JCKB 1WI5A 3AB9A 3RLOA 5I4DA 4DV4Q 4AYBB 1STEA 1CQFA 2N55A 1B8AA 2A68C 4X66Q 3CPWA 3LGJA 1JOKA 4V0BA 3I4LA 2JA9A 1QZGA 4Z9CB 1OXTA 3RLNA 1IBML 3W1BA 3P20A 2JA8G 3D8GA 1NR4A 2XIWA 3PO3B 1RL2A 1SSOA 2EY6A 2VZAA 5KNCA 2NTSA 4ABNA 5C3EB 1PH4A 4HIDA 1U4LA 2I0QA 1X55A 3T16A 4DAYB 4KHZA 5DNFA 2SNMA 1PYWD 4PNYA 1RJTA 5E7NA 3A8IE 3NEMA 1IBKL 4YCVA 3K0XA 2GN5A 1TY0A 3HOYG 2KOLA 3U9SA 1GUGA 3KLWA 4R4IA 4IUUA 4PZ6A 2QCPX 1VS0A 1FR3A 3TBIB 2PW5A 4MN3A 1VF7A 3PIPA 4K2KA 2JA5B 1QOHA 1JE5A 1DCZA 2JN4A 2MNAA 4UPAA 5M5WH 3DEPA 4A3DH 1SAPA 1D1IA 3X3MA 1GUWA 4QL5A 1C8CA 1X3PA 3SK8A 1X3FA 2LKVA 5JJKA 3ERSX 1M90C 2VQFQ 4A3MB 3E9IA 3FKIH 3CU7A 3JAME 4BBRH 1ET6A 4L6TB 5EBCA 1I3QB 2NVYH 2B8GA 1KD1C 3ER0A 2F0HA 3E0JA 2L15A 4KD4A 2Y0SB 5IYDG 3N6RA 2YTVA 1PTOH 2JA7B 3QWNA 2OCEA 3MXPA 3I3CA 4HAEA 3ULJA 3HKSA 3NWSA 4TVAB 1LTAD 2A69D 5C44G 5C0XG 5C4ZA 4GKKQ 3FKIB 3PIO3 2EYHA 3S2HB 3T51B 1YZ6A 2E8GA 4IUVA 5DM63 5IP9G 4KHVA 3TRZA 3A55A 3TMEA 1MJCA 4UY8C 1EY4A 1KHIA 4JOIA 4QCLA 3BS1A 5F2DA 3AYHB 3VDYA 2IL8A 3TP7A 2WKCA 4CDCC 3TP8A 2YYZA 3TEHB 2SOBA 4LMQD 3L0OA 3QOLA 1VQ4A 5A35A 1ZYRC 2F0MA 4A4IA 1EIHA 4A3JH 4M8AA 3MWYW 3HOUH 1WTPA 1ZKOA 4BS9A 4YY3L 3GTQB 2QDLA 4IFDI 3MA2B 4CKCA 3CC7A 4HIOA 4LJZC 4B3SL 2RSNA 1PTOF 4LF6L 3NBHA 2E2IB 1N34L 4LF5Q 4G7ZC 2TSSA 1QILA 2B8FA 1K28A 5M3FB 1Y8PB 2X69A 1R4QB 2HDMA 4LUOA 4GS3A 1CT1D 4A3KG 2BOSA 4OO1H 4WORA 5IGFA 1UAPA 3BYTB 3M4QA 2JP1A 3FPPA 3QJYA 2ZXPA 3M4OB 1O7LA 1RTOA 4OIJA 1V43A 2N8NA 1I4QA 3TSSA 4AIMA 1AFPA 3HOWB 3F8TA 1V1PB 1JR0D 2MQHA 3MHBA 1YHAA 2MO1A 1VQPA 2Y0SE 1E1TA 1IYUA 4CKBA 3H6MA 3A0JA 3V2TA 1A0IA 2KCCA 3I2ZA 2E5LL 1B44D 2MO0A 3J81j 1BCPF 1EU4A 3P1HA 4ZKCB 3MVVA 3CCQA 4DA2A 1NMFA 3PMFA 1PLFA 1VF5C 1VQDA 4FYDA 2RHSB 3MC0B 5KRUA 2GVAA 1EOTA 1ESFA 4JCVE 1NCVA 5KYLA 2KHJA 4HJ7A 2IX1A 1Y1WB 3C2PA 2IHEA 5EKIA 5IT9c 4OWWB 4ULLA 5M5YH 2JEBI 1U4MA 5FO7B 2PYKA 1WTQA 1O7YA 2XTIA 1NTGA 1WJJA 5IODA 3BYYB 2A6HD 3M3YH 2K33A 4RGNA 1KRSA 3UDXA 2A6HC 1OXXK 4OXPA 4LF4L 1SNOA 2QEJC 1H9MA 1MD2D 1TWGB 2B2TC 3EBEA 4H13C 4O0AA 4OGQC 4LF8Q 1PRTB 5JEAJ 3OTOL 3X3NA 1VQNA 1N32L 3B6YA 2RBMA 3GTJB 4JI2L 5LMNW 2QILA 3OIPA 1EY6A 2JJQA 2B2UC 5KGUA 4FF4A 3CCVA 3NTKA 3J81c 3L7ZC 2F0NA 1XNQL 4K0KL 5I9PA 2FMMA 1K8MA 4BBRG 4JVZA 4XYQA 2L12A 1EZ8A 2DJFC 1CI3M 1TS2A 3SEBA 5ISRA 1F9SA 1RD9D 2OT2A 3GDEA 3SK4A 1KABA 1RHPA 2B2WC 2DNCA 2OWOA 3FEWX 3KLSA 5K36H 3PF5A 5M9OA 1S5FD 4B9XA 5HGQA 3GQBA 4CGYB 1G51A 4TSSA 1YNXA 4X64L 3CXCA 4DV0L 1IKLA 2RA4A 1MJEA 1OXUA 4R4QA 2NN6H 3HFZB 5DLQE 1GOZA 1ICWA 4M1UB 3M7GA 2MFIA 4A3CG 3C1EA 4C3JH 1PYSB 1V1QA 2UXCL 1BBUA 3DEOA 5EPLA 1KL9A 5CV7A 4PQXA 3NQTA 5C6AA 2BDNA 1JMCA 2L1BA 4OWTB 3CMEA 4P73A 1EEID 5J3BA 2ASBA 1QNUA 4PZ8A 4DAVA 2KBNA 4RCNA 1Y8OB 2F0LA 1G2TA 1JORA 2A74C 4CJ2C 1PRTF 2Z6BA 2OXPA 1O7ZA 4IPHA 3IFDA 1WTXA 5FK9C 1HNXL 3IAYA 2VQEQ 3L2PA 2B2VC 2KCMA 3GTQH 1HJPA 5JAVA 1F2YA 2MJ8A 1PZKD 3K5NA 3D6CA 3U58A 2C35B 3D0FA 1F9PA 4DR1Q 2WV6D 2OEOA 5D65A 2H4OA 2JA6G 4GKKL 3P7JA 2DGYA 5FO9B 2ZM6Q 1TT2A 4DV2L 4Y7NH 4K0KQ 4DK1A 1JE4A 1VQFA 4DV5Q 1G91A 1BCPC 2WKDA 1GHKA 2X6GA 1CHPD 1XPRA 5K5PA 2AQ1B 3NPPA 3LNNA 3T1YQ 2K01A 3S1NH 1STYA 4LFCQ 4ZRZA 4XIGS 3H0GB 3U4VA 3SHLA 2F0KA 1Q1EA 3NXWA 1TWCB 2E76C 1QWYA 1J5EL 4BBSH 5GROA 4X64Q 4NMZA 4N8X1 1N36Q 2HHHQ 1EWIA 4DV0Q 1G6ZA 3GTOH 2XWJB 5ELNA 1SMXA 1VMPA 2PZTA 4A76A 2CCZA 1N33L 2WIIB 4NPSA 2UU9Q 3TZUA 1PV4A 2JA6B 4B3SQ 1LM0A 4JBWA 3S2HH 1DONA 4FO2A 1K9MC 3DMUA 1E3PA 2PQAB 1A63A 1XPUA 3CQZH 1AEXA 2AUKA 3OWFA 3L3OC 2DY8A 1CHQD 4XDXA 2JEAI 2NUCA 1JJGA 1BBXC 4AQYL 3HKZE 3H94A 2E2HH 3WDNA 5LL6S 1HZCA 5JPMC 4DV3Q 1ML0D 1X65A 1L1OA 4MNOA 3K7AB 1TVXA 3GO5A 4RAUC 1K8OA 4QUCA 5JJLA 5CGKA 2R7ZB 1WD0A 1KNAA 3GTMB 4DR7L 3ONAB 2EY2A 3D3RA 2N78A 3RR5A 1SE3A 2JXMB 1R9TH 3BG3A 2C9OA 3PUYA 3TDQA 4PV1C 4GNXB 2SEBD 4X3UA 1CKNB 2PW7A 2B63H 1LTSD 3K0YA 3PGZA 4A3LH 1PH1A 5K36G 2HCCA 3I70A 2MHVA 5A2QL 5IGBA 2I5HA 4CJ1B 4QF4A 4DUYQ 4H0LC 4OWXB 1H95A 3TP6A 1E24A 1KC8C 4HSPA 3HP3A 3SDZA 4OEMB 3T1YL 5I6WA 1PFMA 3KYHC 5CYUA 3I91A 2F0UA 4LFCL 3G7LA 1I5FA 3PCOB 4DAPA 4MHEA 1HFGA 4A3DG 2AUJD 3I4NG 4ZCKA 1RCVD 4R9WA 1NBWA 3BVMA 1XYIA 1ZYRD 1VQJA 1EYDA 1KLUD 3TN2A 2K7VA 2UU9L 4BBSG 1YJ9A 5BR8L 4FF2A 1LTBD 3K5LA 1W3SA 1YJNA 4G57A 5I2XA 2JSOA 2N49A 3VA5A 2XRSD 1Y1WH 1BXTA 3FPUB 1EIFA 4HIKA 1O78A 2IY5B 2WP8J 5LMNQ 3HOZH 4JI8Q 4LWCA 1MBYA 3S9WA 3BU2A 5BN4A 1OXSC 5EJWA 2F0SA 1IYVA 5ELFA 1E7ZA 3K7UC 1EYGA 4P74A 2CQOA 4BY7B 4X65L 1YEZA 2LXJA 3TS2A 4KHPQ 3ND9A 5LHY1 3J7AV 4OO1I 1QUQB 4QMGA 2KEEA 3I8ZA 2RCFA 1CM9A 1JOOA 4K6DA 2LXKA 4KTAA 1SYGA 3D4RA 2F03A 1BDOA 2IHFA 4K14A 3HOXG 1UEAB 3G4SA 3CPFA 4FVMA 1I4PA 1YNJC 2A6EC 2Z6KA 5C0XI 1VQ5A 1SFOH 4B9WA 1IZ6A 1HZAA 1PZID 4YWLA 1STHA 4IJHA 2JA5H 4LF7L 1SMYD 4OX9L 4DXGA 1HR0W 1HRJA 4GN3B 2K5HA 3H3VH 1JICA 3OMCA 2RVLA 4DXFA 2MPMA 4DUYL 4JI1Q 5IT9L 2VUMB 4LK1C 4OHJA 4EQNA 3OW7A 5M3FH 4XQNA 2EXZA 4CHTB 1SNCA 1HA5A 1Q8IA 4ZYSA 4JV5L 1SE2A 4BXXH 2AWOA 5T1GA 3ZYYX 1E1OA 1SYBA 2K5DA 1Q1BA 3HOZG 1IYJB 1EIYB 3OHXC 5I6YA 4K8IA 2E74C 3F2CA 2EJFC 4HEDA 3A8JE 4H44C 2Y0SG 2RDFA 2D0OA 1CKOA 3HOVB 1WD1A 4DR3L 1KDCA 3I4NH 1D6EC 3OPOA 2K04A 4C3HB 2RKSA 5CBAE 5BN5A 4A3EB 3S14H 1WYDA 4BY7G 5C3WA 3HRZC 4ILWA 1XJVA 4DV2Q 1IL2A 2Q2IA 1LT6D 1RF2D 4ZUIA 3SGIA 5D3IB 3FHWA 1CQVA 1EZ6A 2NBFA 4XYOA 2ZXRA 2M00A 5FLXE 4KJOA 3L9AX 2K75A 1N34Q 4LF5L 2NZHA 4B3RQ 4RKLA 2H5XA 4G4KA 2EE1A 4JI3Q 2R93G 5DAUA 5LMUQ 4C3HG 1MHWC 1L0YB 3S1QB 1B3QA 3J80L 1ICFB 4WRDA 2UXBQ 4G7OC 1CA6A 4DAMA 1YNND 3F2DA 3RN5A 2DNEA 1I94Q 2NWGA 3ULLA 3PSIA 2H1EA 1JWSD 1N8RC 4RGOS 2UUBQ 2JA7G 4OX9Q 3K57A 5JVH3 2EPBA 1RIPA 3C46A 1E2VA 4DR2L 3HOUB 1WCMB 3I55A 2Z4IA 5E4XA 2KECA 4JW0A 1X56A 4JI1L 4C3IG 1BNZA 2P5ZX 3NBIA 3OW2A 3CCRA 1TS4A 3M4OH 2ZJPA 3SXHA 1TWGH 3K8AA 3VR6A 3T4AC 1WTVA 2K03A 1Q82C 4L5SA 4JYAL 3MXNA 3J7A5 2EQSA 1EYCA 4QIWE 2JA8B 4Y52H 1JWUD 3UI2A 2K28A 1PH5A 1QUQA 1K83B 2Z4HA 4GN4B 4J1MA 1IW7C 1U4PA 3VR5A 4J8QA 3JAML 4DR7Q 1ENCA 1TWHB 4IUTA 3RLFA 4IFDJ 2OTLA 3K5OA 1Q7YC 1NE3A 1Y14B 3S1QH 4RH6A 3E5SA 1Z7TA 2B2YC 1AZQA 3SK5A 4I7ZC 2K5QA 4BA2I 2ICEC 1BVSA 1YIJA 1TS3A 2QF7A 4E6IA 1YJWA 3AFPA 3GV6A 3S16B 1ENAA 4HIMA 4LF8L 3LWUA 3SK6A 2NTTA 4UDUC 4A3MH 1BKBA 2OQ0A 4LUZA 3K58A 2L55A 3HKZG 3S15H 3OIQA 3MFGA 4A93B 2NZ1D 5EQ0A 5JOBA 1IKMA 5H1SE 1AW7A 3NSWA 3F2UA 1D5MC 3QB3A 1XNQQ 2R92B 2G5DA 3J7AF 3ITPA 5G3LF 4KJNA 1T5EA 5IE8A 2HQLA 3WOEA 3LX0A 4X62L 3RNUA 4XTCS 1T9HA 3AEVA 3GD7A 1Q86C 4H7BA 1SE8A 4ZK9B 1VQCA 2FINB 4DR5Q 4POFA 5BR8Q 4QIWB 1VQOA 5FOBB 2ZJQA 2D5DA 2NYZD 3H3VI 3PO2H 3R2TA 4APVA 4JBJA 1WTRA 2EVBA 1Q81C 1HNZQ 4BXXG 1U9RA 1Z9FA 5J1ZA 2WFWA 3PUWA 3EIVA 1KIXA 1SYFA 4DR2Q 3HOXB 4GLAC 2CW0D 5M3FG 1VQLA 1SR3A 2KUMA 1E0BA 3S2DH 2YTXA 2NVXB 1EQRA 1U5KA 1YI2A 3I4MH 4UP7A 4JG2A 1Z6HA 5EKLA 1FD7D 3G71A 2A69C 3AU7A 4XT1B 2VS1A 2M9VA 2UXDQ 3J7YW 1EY5A 2AMCB 5COYA 1N9WA 4P75A 3Q0AA 4P72A 5IWAQ 1QVCA 5LL6X 4O2DA 4RFBA 1L1OB 4DK3C 1S72A 4ZKBB 4RKBA 3HOUG 3KBXA 1SNMA 1CKMA 1I6HB 4B3ML 4IOCA 4A3FH 3EROA 3IRBA 4X3SA 1MSGA 1IHZA 4KY7A 4A3GG 1DOMA 2KENA 3DM3A 3H0GH 3TQYA 1Y1VG 5GADC 1VQEA 4C2MH 2QGQA 1EIGA 2NVTH 1TWFB 1JB7A 2NN6G 2RSOA 1F9RA 2LFNA 4JV5Q 1VQAA 3DHQA 1DOKA 1YNNC 1Y1WG 1UE7A 2B2UA 2K14A 3HOWH 4A3GH 4V190 4X6AH 5IP7G 3VYUA 1FNVA 1Q12A 5ELBA 1C4QA 1STBA 1HNWL 1D8LA 1BCPD 2XNAC 3FDTA 5IOCA 1EQQA 4N9PA 4JI6L 2LMCB 4RHSA 1SROA 4LFAQ 1WTOA 4DR5L 3KOJA 3DWAA 1A62A 1MIUA 1XNRQ 1PXUA 5AJ3L 2WB1E 2F0TA 1H9SA 4DK0A 5GAEC 1QZHA 4KD3A 2JA7H 1EWHA 2RDHA 3URYA 1N36L 2HHHL 3H0GG 3CCEA 5KNBA 2UUAQ 4FF3A 2EIFA 5IGEA 4DV6Q 1TWAB 4BY1B 5C4XB 1Z47A 4OIKA 3CMAA 3A7LA 3CC2A 2QEXA 5CV4A 4CBVA 5IYBG 2ZXOA 4A3JB 4EQOA 2AWNA 2QA4A 3I4MG 1EOVA 4B3RL 4KN4C 3ERQA 5CV6A 5NUCA 4BA1I 1PVOA 3J81L 4QB4A 2XGTA 3GTOB 1F77A 5IWAL 3NHHA 2C5CA 2A73B 1BOSA 2XWBB 1M8AA 1PRTD 4FXDA 3DWQA 4DV3L 1ZXTA 5C0XJ 2E2DC 5AFWA 3LWEA 4R4TA 5IGCA 1I50H 2JE6I 2AKWB 3F1ZA 4KKTA 2UUBL 4JI0L 3HS0C 2IX0A 4LNQA 3VYRA 3E0EA 5GQOA 3J80E 2KJXA 1G6PA 4QGUA 3S24A 4O1NA 1NNXA 1K8AC 2CWPA 1S4ZA 3FRPB 1JC7A 1RKNA 2MUYA 1TS5A 2PZUA 1W6KA 1C48A 2ZJRA 3CRLC 1QNKA 2L4NA 2BDOA 4C1NI 1CUKA 5HURA 5C4JB 1EFID 1PFSA 1GM5A 4GZYC 4LFAL 4O42A 2K52A 5GAHC 1TY2A 2PZWA 4JI5Q 4IPDA 3GTGB 4B3TQ 3HGBA 2B2YA 4A3KH 1B2TA 1W2BA 1K3BC 2L11A 3M9BA 2F0OA 4FP5D 1TXYA 1HQMC 3CCUA 4GOPB 1F2ZA 3HOXH 2UUAL 3A7AB 4A3DB 5C4XG 4DF7A 4IZ8A 1VQKA 4XT3B 3FVQA 4J15A 2R7FA 2OF1A 4X3TA 2O5JC 1KDBA 3TREA 1FJGQ 4UAIA 2G9HD 1Y8NB 2YV5A 3S1RH 1UE1A 1Q90A 3OSOA 4FNFA 1PFNA 5IP9H 2R6GA 4DGZA 4C3IH 2ZT9C 5ELDA 1K0SA 4X62Q 3S17B 3SR1A 4MZ9A 2EYMA 5IT9E 1YITA 2NB0A 3RD4A 1GHJA 1HUNA 3I7FA 4KI0A
chains in the Genus database with same CATH topology
3HOYB 2WB1B 3VYSA 4RHRA 3KUPA 4KV6A 1MGSA 3CKIB 3CHBD 1FGBD 3MZ5A 3P75A 3S1MB 2SNSA 5BN3A 1FNWA 1Y1VB 2F0FA 2O2LD 4K2LA 2FMCA 3D4DA 1II3A 1SNPA 4C3JG 1BO0A 1PFBA 3I4NB 1BR9A 2F0QA 5EBDA 2EY5A 3GV3A 2FFKB 2K5WA 4KN7C 5JVG3 4C3IB 1STAA 3NWTA 2F3VA 1S5ED 4BBRB 1LV9A 4B08A 3HEJA 5CV5A 1HUMA 2RDGA 5I2YA 4WJWA 2K05A 5D3DA 5IGDA 3HG9A 3BDLA 2E2HB 1E2WA 3R93A 3VYTA 2IPKD 3NTIA 2EOTA 2VNUD 3OOCA 1HPCA 1GUNA 3QIAA 4ZAIA 5M3MB 4ZUJA 1STGA 4FF1A 1X3QA 1CA5A 2Z1CA 2ICIA 1TU2B 1L0XB 4RGTA 3J81E 4X3KA 1EWCA 3PUXA 4EVOA 2F0VA 4DU9A 3TP5A 1EY8A 4L63B 1G291 3NK9A 2V4DA 3G6JB 1S5DD 1GUTA 1VDZA 5CMDA 1LT4D 2F0EA 3VR2A 2HUGA 4TKOB 4A3KB 4KMUC 5C5LA 3M85A 3R3OA 3EVQA 2NVQB 2B2TA 1B50A 1SNDA 4C56C 3MAQA 5CC4A 2DY7A 4PMWA 5FKAC 1FNUA 1B53A 1M4VA 1TQOA 1RODA 1NUCA 3GP7A 3OMGA 2KQ3A 3AMUA 2J4XA 1ESRA 3EA6A 2XN9C 1H9JA 4RA8A 3KBGA 1JQYD 1B3AA 3IKJA 3GTKB 4K5VA 2YU9B 2F0GA 5CBEE 1DZ1A 3S1RB 4N9TA 1LTTD 1CZGA 2EYJA 1HTPA 5M5YB 1HTLD 5EGTA 4FXGC 4HMIA 1CFMA 4ME5A 3Q22A 2A6ED 2TMPA 2FJ2A 2JYOA 2B39A 1EQVA 1WVLA 2PQEA 4TRDA 4IN3A 4KK7A 1FYCA 2NN6I 4RWSC 4NKLA 1B9MA 1SYCA 1EEFD 1KAAA 4HTHA 1CK1A 3VA7A 5D14A 5KEEA 1DXMA 1H9SB 2M2LA 3W3AA 1W6JA 1DJRD 2F4IA 2PMZB 4Y7NB 1QCBD 4A3GB 1A3UA 2IT1A 3QO2A 1S5CD 2KA7A 1F9QA 1G2SA 4ODGA 5IGGA 4G7HC 2E2JB 1DYQA 1SYDA 2LY7A 2FHTA 1WTWA 2A68D 4TQUS 5IIFA 1LT5D 4XQJA 4IUQA 1PTOC 4MIUA 4U68A 1SDFA 3PO2B 3S14B 2WAQB 1QJOA 4PMCA 1X32A 1XXGA 3A8KE 1RTNA 1LTRD 1LO5D 3CQZB 1SFOB 2L9HA 2EYFA 5E3FA 4OL7A 5DEHA 2PNRC 3BDCA 2KHSA 1LTID 3MTSA 2K1BA 2PPBC 2VB3X 3H3VC 5C0XH 4P2CB 1EQTA 4Q5VA 1UUPA 4F88A 3I72A 1J9OA 3NTHA 5J22A 1DOLA 3IFTA 5CV8A 5ELCA 2VB2X 1IW7D 3S1NB 3EFXD 2WACA 5E4WC 4DN4M 1NAPA 4HCSA 1SE4A 1XTCD 1HQRD 1AP0A 2EY1A 2KVMA 3T13A 3M4YA 2J7ZA 1A3VA 5C44B 1A2UA 5EPJA 4BBSB 3SE0A 4IFDH 4IUPA 3KF8A 5KIXA 4IUNA 2D9UA 2R93B 3A56A 5FLXL 5JJZA 1GJXA 2Q8TA 2A5HA 4HN7A 1V8QA 2MP1A 1XX8A 4F8MA 1G8ZD 1CZWA 1ZEQX 3V96A 4F87A 1PDQA 3I73A 3T53B 1LABA 1HA6A 3H09A 3HZXA 3D31A 3E6ZX 2PCFB 1SEBD 1A15A 2EYLA 1LT3D 3BZDB 1H9KA 1I4HA 3SVMA 2Z8LA 4XXEA 3QG1A 1S5BD 3KK7A 1F2MA 5C4HA 4HR7B 2F0JA 2L5TA 2CW0C 3BVGA 2XRQD 2X6LA 3GTPB 2IJ0A 1A6XA 4NP5A 2KCNA 1PRTC 3RZDB 3K59A 1EYAA 1EY7A 1QG7A 3DXJC 1I4GA 2AQ2B 2CVRA 3OWEB 3Q6SA 3IL8A 1R4PB 5T1IA 2EYPA 1ONLA 1LTGD 1OXVA 1PTOD 1BCPB 3VR3A 1I4XA 4EGVA 3PUVA 1EL0A 3KLRA 2Q8RE 1ILPA 4YIJA 3Q24A 4K5XA 1D1KA 1JOQA 1VCIA 3WOFA 2HCIA 5CR3A 1GUOA 2D2CC 4BWGB 4A3IB 1ET9A 3K5MA 2O4XA 3Q23A 1D2BA 4OO1G 2WINB 1KNEA 4DNRB 4DAYA 5CORA 3KLSX 5DM73 3D6WA 2EJMA 4J6HA 4R8IA 3HKZB 2L0CA 2BE5C 3M7NA 4KKSA 1GXDC 3RZOB 3ND8A 1A3TA 1V1PA 3NQIA 5A2QE 4HSVA 1KDAA 1GUSA 1F2LA 4RGMA 2NVYB 1I4RA 2E75C 3MFYA 1D5ZC 1CTMA 1QE6A 4IURA 1TR5A 4A3FB 1ENFA 1TKWB 4F7XA 1SXTA 1D5XC 3PUZA 2D62A 3NUCA 3GTLB 2N88A 1UNSA 1NSNS 1SNQA 2EDGA 4RCOA 4PMBA 2CQAA 3M3YB 4NW2A 4K5WA 3PIP3 1EY0A 1EU3A 1LLRD 3I90A 1VMCA 2F1MA 1MI2A 5CV9A 1BF4A 2J0TD 2I46A 5EKKA 4IFDG 3V05A 2RQXA 1KLGD 1SMYC 4WFN3 2IX3A 2R61A 1HFNA 2QDBA 4FXKC 1HHVA 2EYOA 3MXGA 2F0WA 4R8NA 2EZVA 1SBBB 4Q0FA 1PZJD 5J39A 4DNTB 3O13A 4L8JA 3PV0A 1NR2A 2AQ3B 1R9TB 2EJGC 5TSSA 3R2IA 3MXUA 2IWHA 2R3ZA 3HOZB 2B63B 1DD2A 3QOJA 1QB5D 2BE5D 2KEDA 1V1OA 2MGSA 5M5WB 3VR4A 1AN8A 1HCZA 2XSCA 4CKEA 3I4MB 1PTOB 5JEAG 4S3SA 1Q3LA 4KY6A 2F0PA 3U9OA 4QUFA 2HDLA 4JK1C 1U4RA 4K8JA 4A3BB 2O5IC 1HXYD 1B9NA 2BA1A 2NVTB 5JEAH 2BCOA 1KTKA 4HCEA 1RDPD 5KNDA 3TZDA 3RUZA 2IW3A 2PO4A 1A2TA 1Y69U 1JB3A 2BA0A 5G3LD 4C2MB 3T56B 2F0IA 2QKIC 2B2WA 4LAAA 4IQZA 2K32A 4KY5A 5I9OA 3D4WA 4XQQA 5EPKA 1B4OA 3DUZA 4KKUA 2F0DA 1JWMD 3BVZA 3N52A 1YNJD 4ZQ3A 2DN8A 3R8BA 1SJED 4DFAA 4NDXA 1BUVT 1I6VC 1BQQT 4C3JB 1LACA 4I65A 3S2DB 1H9RA 2G9DA 3FMCA 3CRKC 1B1ZA 3C3LA 5FO8B 3W2DA 4C1NK 5JPNC 1O80A 1STNA 5C5MA 3A54A 1E2ZA 3EJIA 2B2VA 2CHBD 2F3WA 4EQPA 3C1FA 2K6AA 2LS01 5C3XA 2ENBA 3DM1A 2ID0A 3H91A 3MEHA 1XWEA 2I07B 1I50B 1SJHD 5M5XB 3DWPA 4IALA 5E1FA 3NE5B 1OO9B 5KYIA 1AZPA 2Q8IB 1PMRA 1ILQA 2GA4B 1MSHA 1J8IA 2VXWA 3NP8A 3RMHA 1SYEA 3EQLC 1IL8A 4CJ0B 3S15B 4U673 5ELEA 1DM0B 4ID6A 1EY9A 2HQEA 2SDFA 3K6OA 5HGTA 2XVSA 4K6LA 4ZLTF 4HMJA 1TIID 3BDOA 1T5XD 1JCKB 3AB9A 5I4DA 4AYBB 1STEA 1CQFA 2N55A 2A68C 1JOKA 4V0BA 3I4LA 4Z9CB 1OXTA 3P20A 3D8GA 1NR4A 2XIWA 3PO3B 1SSOA 2EY6A 5KNCA 2NTSA 4ABNA 5C3EB 1U4LA 3T16A 4KHZA 5DNFA 2SNMA 1PYWD 4PNYA 1RJTA 3A8IE 1TY0A 2KOLA 3U9SA 1GUGA 4IUUA 2QCPX 1FR3A 3TBIB 2PW5A 4MN3A 1VF7A 4K2KA 2JA5B 1QOHA 1DCZA 3DEPA 1SAPA 1D1IA 3X3MA 1GUWA 1C8CA 1X3PA 3SK8A 2LKVA 4A3MB 3CU7A 3JAME 1ET6A 4L6TB 5EBCA 1I3QB 2B8GA 2F0HA 3E0JA 4KD4A 2Y0SB 3N6RA 2JA7B 1PTOH 3QWNA 3MXPA 3I3CA 4HAEA 3NWSA 1LTAD 2A69D 5C0XG 5C4ZA 3FKIB 3PIO3 2EYHA 3S2HB 3T51B 4IUVA 5DM63 4KHVA 3A55A 3TMEA 1EY4A 4QCLA 3BS1A 5F2DA 2IL8A 3TP7A 2WKCA 3TP8A 2YYZA 2SOBA 4LMQD 3QOLA 5A35A 1ZYRC 2F0MA 1EIHA 4M8AA 3MWYW 1WTPA 1ZKOA 4BS9A 3GTQB 4IFDI 3MA2B 4CKCA 4LJZC 2RSNA 1PTOF 3NBHA 2E2IB 4G7ZC 2TSSA 1QILA 2B8FA 5M3FB 1Y8PB 2X69A 1R4QB 2HDMA 1CT1D 2BOSA 4OO1H 4WORA 5IGFA 1UAPA 3BYTB 2JP1A 3FPPA 3QJYA 2ZXPA 3M4OB 1O7LA 1RTOA 4OIJA 1V43A 1I4QA 3TSSA 1AFPA 3HOWB 1V1PB 1JR0D 3MHBA 1IYUA 4CKBA 3H6MA 3V2TA 2KCCA 1B44D 1BCPF 1EU4A 3P1HA 4ZKCB 3MVVA 4DA2A 3PMFA 1PLFA 1VF5C 4FYDA 3MC0B 5KRUA 1EOTA 1ESFA 1NCVA 5KYLA 2IX1A 1Y1WB 3C2PA 5EKIA 4ULLA 2JEBI 1U4MA 5FO7B 1WTQA 2PYKA 1O7YA 5IODA 3BYYB 2A6HD 2K33A 4RGNA 2A6HC 1OXXK 1SNOA 2QEJC 1H9MA 1MD2D 1TWGB 2B2TC 4H13C 4OGQC 1PRTB 5JEAJ 3X3NA 2RBMA 3GTJB 2QILA 3OIPA 1EY6A 2B2UC 5KGUA 4FF4A 3NTKA 3L7ZC 2F0NA 5I9PA 2FMMA 1K8MA 4XYQA 2L12A 1EZ8A 1CI3M 1TS2A 3SEBA 5ISRA 1F9SA 1RD9D 2OT2A 3SK4A 1KABA 1RHPA 2B2WC 2DNCA 3FEWX 3KLSA 5K36H 5M9OA 1S5FD 4B9XA 3GQBA 4CGYB 4TSSA 1IKLA 2RA4A 1OXUA 2NN6H 1GOZA 1ICWA 4M1UB 3M7GA 3C1EA 3DEOA 5EPLA 5CV7A 4PQXA 3NQTA 5C6AA 2BDNA 2L1BA 1EEID 1QNUA 4DAVA 4RCNA 1Y8OB 2F0LA 1G2TA 1JORA 2A74C 4CJ2C 1PRTF 2OXPA 1O7ZA 3IFDA 1WTXA 5FK9C 3IAYA 2B2VC 5JAVA 1F2YA 2MJ8A 1PZKD 3K5NA 3D6CA 1F9PA 2WV6D 2OEOA 5D65A 2H4OA 3P7JA 5FO9B 1TT2A 4DK1A 1JE4A 1G91A 1GHKA 1BCPC 2WKDA 2X6GA 1CHPD 5K5PA 2AQ1B 3NPPA 3LNNA 2K01A 1STYA 4ZRZA 4XIGS 3H0GB 3SHLA 2F0KA 1Q1EA 3NXWA 1TWCB 2E76C 1QWYA 4NMZA 1G6ZA 2XWJB 1VMPA 2PZTA 2WIIB 3TZUA 2JA6B 4JBWA 1DONA 4FO2A 3DMUA 1AEXA 2AUKA 3OWFA 3L3OC 2DY8A 1CHQD 4XDXA 2JEAI 2NUCA 1BBXC 3H94A 3WDNA 5LL6S 5JPMC 1ML0D 3K7AB 1TVXA 4RAUC 3GO5A 1K8OA 4QUCA 5CGKA 2R7ZB 1WD0A 1KNAA 3GTMB 3ONAB 2EY2A 3D3RA 1SE3A 2JXMB 3BG3A 2C9OA 3PUYA 3TDQA 4PV1C 2SEBD 4X3UA 2PW7A 1LTSD 3K0YA 5K36G 2HCCA 3I70A 2MHVA 5A2QL 5IGBA 4CJ1B 4QF4A 4H0LC 3TP6A 4HSPA 3HP3A 3SDZA 5I6WA 1PFMA 5CYUA 3I91A 2F0UA 3G7LA 4DAPA 4MHEA 1HFGA 2AUJD 1RCVD 4R9WA 3BVMA 1XYIA 1ZYRD 1EYDA 1KLUD 3TN2A 2K7VA 4FF2A 1LTBD 3K5LA 4G57A 5I2XA 2JSOA 3VA5A 2XRSD 1BXTA 3FPUB 1O78A 2WP8J 1MBYA 3S9WA 5BN4A 1OXSC 5EJWA 2F0SA 1IYVA 5ELFA 4BY7B 3ND9A 5LHY1 3J7AV 4OO1I 4QMGA 2KEEA 3I8ZA 1CM9A 1JOOA 4K6DA 4KTAA 1SYGA 3D4RA 2F03A 1BDOA 4K14A 1UEAB 4FVMA 1I4PA 1YNJC 2A6EC 5C0XI 4B9WA 1PZID 1STHA 1SMYD 4DXGA 1HRJA 1JICA 3OMCA 2RVLA 4DXFA 2MPMA 5IT9L 2VUMB 4LK1C 4OHJA 4EQNA 3OW7A 4XQNA 2EXZA 4CHTB 1SNCA 1HA5A 1Q8IA 4ZYSA 1SE2A 2AWOA 5T1GA 3ZYYX 1SYBA 2K5DA 1Q1BA 3OHXC 5I6YA 4K8IA 2E74C 2EJFC 4HEDA 3A8JE 4H44C 2RDFA 3HOVB 1WD1A 1KDCA 1D6EC 3OPOA 2K04A 4C3HB 2RKSA 5CBAE 5BN5A 4A3EB 5C3WA 3HRZC 4ILWA 1LT6D 1RF2D 4ZUIA 5D3IB 1CQVA 1EZ6A 2NBFA 4XYOA 2ZXRA 2M00A 5FLXE 4KJOA 3L9AX 4RKLA 4G4KA 2EE1A 5DAUA 4C3HG 1L0YB 3S1QB 3J80L 4G7OC 4WRDA 1CA6A 1YNND 2DNEA 2NWGA 2H1EA 1JWSD 4RGOS 3K57A 5JVH3 2EPBA 3C46A 1E2VA 3HOUB 1WCMB 2Z4IA 5E4XA 2KECA 1BNZA 4C3IG 3NBIA 1TS4A 3SXHA 3VR6A 3T4AC 1WTVA 2K03A 3MXNA 1EYCA 2JA8B 1JWUD 3UI2A 2K28A 1K83B 2Z4HA 4J1MA 1U4PA 1IW7C 3VR5A 4J8QA 3JAML 1ENCA 1TWHB 4IUTA 3RLFA 4IFDJ 3K5OA 4RH6A 3E5SA 1Z7TA 2B2YC 1AZQA 3SK5A 4I7ZC 2K5QA 4BA2I 2ICEC 1TS3A 2QF7A 4E6IA 3GV6A 3S16B 1ENAA 3LWUA 3SK6A 2NTTA 4UDUC 3K58A 2L55A 3OIQA 3MFGA 4A93B 2NZ1D 5EQ0A 5JOBA 1IKMA 1AW7A 3NSWA 3F2UA 1D5MC 3QB3A 2R92B 3J7AF 3ITPA 5G3LF 4KJNA 1T5EA 3WOEA 3LX0A 4XTCS 3GD7A 4H7BA 4ZK9B 2FINB 4QIWB 5FOBB 2D5DA 2NYZD 3R2TA 1WTRA 2EVBA 1U9RA 5J1ZA 3PUWA 1SYFA 3HOXB 2CW0D 2KUMA 1E0BA 2NVXB 1Z6HA 5EKLA 1FD7D 2A69C 3AU7A 4XT1B 2M9VA 3J7YW 1EY5A 5COYA 3Q0AA 5LL6X 4RFBA 4ZKBB 4RKBA 3KBXA 1SNMA 1I6HB 3EROA 4X3SA 1MSGA 1IHZA 4KY7A 1DOMA 1EIGA 1TWFB 2NN6G 2RSOA 1F9RA 2LFNA 3DHQA 1DOKA 1YNNC 2B2UA 4V190 3VYUA 1FNVA 1Q12A 5ELBA 1C4QA 1STBA 1BCPD 2XNAC 3FDTA 5IOCA 4N9PA 2LMCB 4RHSA 1WTOA 3DWAA 1PXUA 2F0TA 1H9SA 4DK0A 4KD3A 1EWHA 2RDHA 3URYA 5KNBA 4FF3A 5IGEA 1TWAB 4BY1B 5C4XB 1Z47A 4OIKA 3A7LA 5CV4A 4CBVA 2ZXOA 4A3JB 4EQOA 2AWNA 4KN4C 3ERQA 5CV6A 5NUCA 4BA1I 3J81L 4QB4A 3GTOB 1F77A 3NHHA 2C5CA 2A73B 1BOSA 2XWBB 1M8AA 1PRTD 4FXDA 3DWQA 1ZXTA 5C0XJ 2E2DC 5AFWA 3LWEA 5IGCA 2JE6I 4KKTA 3HS0C 2IX0A 3VYRA 3J80E 2KJXA 4O1NA 1S4ZA 3FRPB 1JC7A 1RKNA 2MUYA 1TS5A 2PZUA 1W6KA 1C48A 3CRLC 1QNKA 2L4NA 2BDOA 4C1NI 5HURA 5C4JB 1EFID 4GZYC 4O42A 1TY2A 2PZWA 3GTGB 3HGBA 2B2YA 1B2TA 2L11A 2F0OA 4FP5D 1HQMC 1F2ZA 3A7AB 4A3DB 4DF7A 4IZ8A 4XT3B 3FVQA 4X3TA 2OF1A 2O5JC 1KDBA 4UAIA 2G9HD 1Y8NB 1Q90A 3OSOA 4FNFA 1PFNA 2R6GA 4DGZA 2ZT9C 5ELDA 3S17B 3SR1A 2EYMA 5IT9E 2NB0A 3RD4A 1GHJA 1HUNA 4KI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIO 3;  5DM7 3;  4U67 3;  5JVH 3;  5DM6 3;  5JVG 3;  3PIP 3;  4WFN 3; 
#chains in the Genus database with same CATH topology
 1SN8 A;  3HOY B;  4R4O A;  2WB1 B;  4X65 Q;  2WAQ G;  3VYS A;  3GTP H;  4RHR A;  1KQS A;  3KUP A;  4KV6 A;  5IY0 A;  4JI0 Q;  1MGS A;  3CKI B;  3CHB D;  1FGB D;  2PI2 A;  3MZ5 A;  3P75 A;  3S1M B;  2SNS A;  4UP8 A;  1FNW A;  5BN3 A;  3KF8 B;  1Y1V B;  3KFU A;  2F0F A;  2O2L D;  4GKJ L;  3MXN B;  1C0A A;  4K2L A;  2FMC A;  3D4D A;  1II3 A;  4LF7 Q;  4QJF A;  1KXL A;  1SNP A;  4C3J G;  1BO0 A;  1PFB A;  3CC4 A;  1BR9 A;  3I4N B;  2F0Q A;  2OQK A;  5EBD A;  2EY5 A;  4RG1 A;  3GV3 A;  2CKZ B;  2FFK B;  4GLX A;  2K5W A;  4A93 G;  4KN7 C;  5JVG 3;  4C3I B;  1STA A;  3NWT A;  3GTL H;  2F3V A;  1S5E D;  4DPG A;  1WCM G;  3STB C;  4BBR B;  4BY1 H;  4DV4 L;  1LV9 A;  1IXR A;  4A3I G;  4B08 A;  2RF4 A;  3HEJ A;  1HUM A;  5CV5 A;  2RDG A;  5I2Y A;  3KJO A;  4WJW A;  1IBL Q;  3HOY H;  1LYL A;  2K05 A;  4DUZ Q;  5D3D A;  5IGD A;  4L5R C;  3HG9 A;  4HJ8 A;  1FL0 A;  3BDL A;  1IBM Q;  2E2H B;  1E2W A;  3R93 A;  4L5Q A;  3VYT A;  1Q46 A;  2IPK D;  3NTI A;  2Q2U A;  1PA6 A;  2EOT A;  2VNU D;  3OOC A;  1HPC A;  1GUN A;  3QIA A;  4ZAI A;  5M3M B;  4ZUJ A;  1CSQ A;  2WB1 G;  1STG A;  4FF1 A;  1X3Q A;  1CA5 A;  1IBK Q;  2Z1C A;  2ICI A;  1TU2 B;  4JI6 Q;  1L0X B;  2B3G A;  4RGT A;  2JA8 H;  3J81 E;  3BJU A;  3J7Z C;  4X3K A;  1EWC A;  4JBM A;  3PUX A;  4EVO A;  2F0V A;  4H02 A;  2YTY A;  4DU9 A;  3TP5 A;  1EY8 A;  5LMU L;  2UXB L;  3T1H L;  1UE6 A;  4L63 B;  1I94 L;  3NK9 A;  1G29 1;  2VY3 A;  2V4D A;  3G6J B;  4JC0 A;  1S5D D;  1GUT A;  2Z9H A;  1VDZ A;  5CMD A;  1LT4 D;  2F0E A;  3GTJ H;  4DR4 Q;  3VR2 A;  2BH2 A;  4MTN A;  2HUG A;  3JC6 6;  4TKO B;  4KMU C;  4A3K B;  1VQI A;  5C5L A;  3M85 A;  3R3O A;  3EVQ A;  4POG A;  2NVQ B;  1XMQ L;  2B2T A;  1B50 A;  1SND A;  4ME3 A;  4C56 C;  3MAQ A;  5CC4 A;  2DY7 A;  2R92 H;  4PMW A;  5FKA C;  1FNU A;  3ULP A;  1B53 A;  2JA6 H;  3U4Z A;  1M4V A;  1TQO A;  1ROD A;  1NUC A;  5L37 A;  3GP7 A;  3OMG A;  2KQ3 A;  3W1G A;  3AMU A;  2J4X A;  1ESR A;  5IYB H;  2LSS A;  3RZD H;  3EA6 A;  2XN9 C;  1H9J A;  2Q2T A;  4RA8 A;  4GLV B;  3KBG A;  1JQY D;  1B3A A;  3IKJ A;  4BY7 H;  2VUM G;  3GTK B;  4K5V A;  2YU9 B;  2F0G A;  5CBE E;  1DZ1 A;  2ZM6 L;  3S1R B;  4N9T A;  1LTT D;  1CZG A;  2EYJ A;  1K8G A;  1L0W A;  1HTP A;  4YY3 Q;  5M5Y B;  4PG3 A;  3ZJY C;  1HTL D;  1VQB A;  5EGT A;  1PH8 A;  3GTM H;  4LF6 Q;  4FXG C;  4HMI A;  4LFB Q;  1CFM A;  4ME5 A;  3Q22 A;  2A6E D;  2TMP A;  2FJ2 A;  4DNI A;  2JYO A;  2B39 A;  1EQV A;  5IP7 H;  1WVL A;  2PQE A;  4TRD A;  4IN3 A;  4KK7 A;  1FYC A;  2NN6 I;  5JJI A;  4RWS C;  5ELO A;  4NKL A;  1B9M A;  1SYC A;  1GO3 E;  1EEF D;  1KAA A;  4HTH A;  3W5O A;  4A3C H;  1I6H H;  1CK1 A;  3VA7 A;  1VQ9 A;  3S1M H;  5D14 A;  3DLL A;  1N33 Q;  4YWM A;  5KEE A;  1DXM A;  2I5L X;  1H9S B;  2M2L A;  3W3A A;  4GNX C;  1X3E A;  1W6J A;  1DJR D;  4A93 H;  1BBW A;  1HNZ L;  2VUM H;  2F4I A;  2PMZ B;  2A1A A;  2F4V L;  1WFQ A;  4Y7N B;  1QCB D;  4JI7 Q;  1XMQ Q;  4A3G B;  1A3U A;  2IT1 A;  3QO2 A;  1S5C D;  2KA7 A;  1F9Q A;  1G2S A;  3MEF A;  1A8V A;  1X6O A;  4ODG A;  1VQG A;  5IGG A;  4G7H C;  2E2J B;  1HR0 L;  1DYQ A;  4WJ3 M;  1SYD A;  3S17 H;  2LY7 A;  2FHT A;  1WTW A;  2ALY B;  2A68 D;  2CWA A;  1KRT A;  1VQ6 A;  2HT1 A;  4TQU S;  3E3X A;  5IIF A;  1LT5 D;  1QVF A;  4XQJ A;  4IUQ A;  5IYC G;  3PO3 G;  1PTO C;  4MIU A;  4U68 A;  1SDF A;  3UE1 A;  4B3M Q;  1GD7 A;  3S14 B;  3PO2 B;  4GKJ Q;  3JAM c;  2WAQ B;  1QJO A;  5M3M H;  2N3S A;  4PMC A;  1X32 A;  3G6E A;  1XXG A;  4LF4 Q;  3A8K E;  1RTN A;  1LTR D;  1LO5 D;  3CQZ B;  1SFO B;  3J81 i;  2L9H A;  4L5T A;  1N32 Q;  1U0L A;  4UHV A;  2EYF A;  5E3F A;  4HJ9 A;  4OL7 A;  5DEH A;  4QQB X;  3PO2 G;  2PNR C;  3UDG A;  3BDC A;  2PQA A;  2KHS A;  1LTI D;  3MTS A;  2D0P A;  2K1B A;  3K7A H;  4DUZ L;  2PPB C;  2VB3 X;  1VQM A;  3H3V C;  5C0X H;  3RN2 A;  1PH7 A;  4P2C B;  4WJ4 A;  1EQT A;  4Q5V A;  1UUP A;  5AJ3 Q;  4F88 A;  3I72 A;  2NZO A;  1J9O A;  3I4O A;  1UE5 A;  1GKH A;  2B29 A;  3NTH A;  5J22 A;  3AQQ A;  1DOL A;  3IFT A;  5CV8 A;  5ELC A;  2PMZ E;  1IW7 D;  2VB2 X;  2V1C C;  3S1N B;  4DV6 L;  4KLK A;  2F4V Q;  3CW2 C;  3EFX D;  2WAC A;  5E4W C;  4DN4 M;  2NVQ H;  1NAP A;  4JI8 L;  4HCS A;  1FGU A;  1SE4 A;  1XTC D;  3K81 C;  1HQR D;  1M1K C;  1AP0 A;  2EY1 A;  2KVM A;  3T13 A;  3M4Y A;  2J7Z A;  1A3V A;  5C44 B;  1A2U A;  5EPJ A;  4BBS B;  1HR0 Q;  1OTC A;  3SE0 A;  4IFD H;  4IUP A;  3KF8 A;  4JI4 L;  5KIX A;  4IUN A;  1AE3 A;  2D9U A;  3A56 A;  2R93 B;  5FLX L;  5JJZ A;  1GJX A;  2Q8T A;  4DK6 C;  2A5H A;  4HN7 A;  1V8Q A;  2MP1 A;  3T1H Q;  1XX8 A;  4F8M A;  2HD3 A;  1G8Z D;  1CZW A;  1ZEQ X;  3V96 A;  2WAQ E;  4F87 A;  1C7Y A;  1PDQ A;  3I73 A;  3T53 B;  3NBH B;  1PH2 A;  1JJC B;  4DR4 L;  1LAB A;  1HA6 A;  3H09 A;  3HZX A;  3D31 A;  3NEN A;  3E6Z X;  2PCF B;  1HNX Q;  1SEB D;  1A15 A;  2FXQ A;  2ES2 A;  4DR6 L;  2PI2 E;  2EYL A;  1LT3 D;  3BZD B;  1H9K A;  1I4H A;  3SVM A;  2Z8L A;  4XXE A;  4N8F A;  3QG1 A;  1S5B D;  3KK7 A;  1F2M A;  1GVP A;  4DR1 L;  3STB D;  1KAW A;  4X66 L;  2R7Z H;  4P71 A;  5C4H A;  4HR7 B;  2F0J A;  2L5T A;  3I56 A;  4DV5 L;  2CW0 C;  3BVG A;  2XRQ D;  2X6L A;  4GOP A;  3GTP B;  2IJ0 A;  1A6X A;  4HJ5 A;  4JI5 L;  4NP5 A;  4RMF A;  2VL6 A;  2KCN A;  1YBY A;  4B3T L;  1PRT C;  3KDF A;  4YCW A;  3RZD B;  1VQH A;  2OTJ A;  5FJ8 H;  1FVI A;  3K59 A;  1EYA A;  1EY7 A;  1QG7 A;  3DXJ C;  4LF9 Q;  1I4G A;  2AQ2 B;  2CH4 A;  3FP9 A;  2CVR A;  4AYB G;  4CDE C;  3OWE B;  3Q6S A;  4NB3 A;  3IL8 A;  1R4P B;  3M4P A;  5T1I A;  1HZ9 A;  2EYP A;  1ONL A;  1LTG D;  4LFB L;  1UWV A;  3S16 H;  1OXV A;  1PTO D;  1FJG L;  1BCP B;  3VR3 A;  2E2J H;  4JOI C;  2B63 G;  1I4X A;  3CAM A;  4EGV A;  1O7I A;  3PUV A;  1EL0 A;  5FLM H;  4A3E G;  5C3E H;  3KLR A;  2Q8R E;  1B7Y B;  1ILP A;  4YIJ A;  4ALP A;  3Q24 A;  4K5X A;  3PIO A;  1D1K A;  1JOQ A;  1VCI A;  3WOF A;  2HCI A;  5CR3 A;  1GUO A;  2D2C C;  4BWG B;  4A3B G;  4A3I B;  1ET9 A;  3K5M A;  2O4X A;  2K50 A;  3KDF B;  3JAM i;  3Q23 A;  1D2B A;  1HZB A;  1S3O A;  4OO1 G;  2A19 A;  2WIN B;  1KNE A;  2VW9 A;  4DNR B;  4DAY A;  1YVC A;  2ZTD A;  5COR A;  3KLS X;  5DM7 3;  3D6W A;  2EJM A;  3F2B A;  4J6H A;  4R8I A;  3HKZ B;  2L0C A;  5GAG C;  2BE5 C;  3M7N A;  1K3R A;  4OON A;  1TWA H;  3CCS A;  3J80 i;  2HIX A;  1GXD C;  4KKS A;  3RZO B;  3ND8 A;  1A3T A;  1V1P A;  3NQI A;  5A2Q E;  5C3E G;  1YHQ A;  4HSV A;  3A5U A;  5M3M G;  4A75 A;  1KDA A;  1IBL L;  1PYB A;  2KCT A;  5C44 H;  1GUS A;  2AHO B;  1F2L A;  5FJ8 G;  1JJ2 A;  4LF9 L;  2R93 H;  4RGM A;  1ASZ A;  1I3Q H;  1WCM H;  2NVY B;  1I4R A;  4YHH Q;  1Y1V H;  1JT8 A;  2E75 C;  4NXN Q;  3MFY A;  1D5Z C;  4DV1 L;  5EAY A;  1CTM A;  4IO9 A;  1QE6 A;  4IUR A;  1TR5 A;  1WOC A;  4A3F B;  1X9N A;  4GOP C;  1ENF A;  3BZC A;  2UUC Q;  5LMN L;  1D7Q A;  1TKW B;  4F7X A;  1SXT A;  1D5X C;  3PUZ A;  2D62 A;  3NUC A;  3GTL B;  2N88 A;  4EX5 A;  1UNS A;  1NSN S;  1SNQ A;  2EDG A;  4RCO A;  4IJL A;  4PMB A;  2CQA A;  4AYB E;  4AH6 A;  3WWV A;  1PH9 A;  3M3Y B;  4NW2 A;  2JQO A;  4KHP L;  4K5W A;  2R7Z G;  3PIP 3;  1EY0 A;  3AFQ A;  1EU3 A;  1LLR D;  1EUJ A;  3I90 A;  1VMC A;  2F1M A;  1EFW A;  1MI2 A;  5CV9 A;  1BF4 A;  2J0T D;  1K83 H;  1P16 A;  1K0R A;  5C4J H;  2I46 A;  2YU9 H;  1MKH A;  5EKK A;  2E5L Q;  1UEB A;  3TS0 A;  2R7D A;  4IFD G;  3V05 A;  2RQX A;  1NJI C;  3GTG H;  1KLG D;  4FDB A;  2GVB A;  1SMY C;  4WFN 3;  2DUD A;  1TWC H;  2IX3 A;  2R61 A;  1HFN A;  2K4K A;  2QDB A;  4FXK C;  1HHV A;  4MTK A;  2EYO A;  4CDF C;  1XPO A;  1CKN A;  3MXG A;  2F0W A;  4R8N A;  2EZV A;  2I5M X;  1SBB B;  4Q0F A;  5C4X H;  1PZJ D;  5J39 A;  1AH9 A;  4DNT B;  3O13 A;  4A3M G;  1S40 A;  2F52 A;  4L8J A;  3PV0 A;  1VQ8 A;  3ICE A;  3G48 A;  1NR2 A;  1PH3 A;  2AQ3 B;  1Q8K A;  4YHH L;  4CDD C;  4DR3 Q;  4NXN L;  2EJG C;  1R9T B;  5TSS A;  1PH6 A;  3UDF A;  3R2I A;  4JI2 Q;  3MXU A;  2IWH A;  4DV1 Q;  2R3Z A;  5FLM G;  2NVX H;  3BZK A;  3HOZ B;  2B63 B;  3OYY A;  1DD2 A;  1HNW Q;  3QOJ A;  1QB5 D;  2BE5 D;  2KED A;  4A3B H;  1V1O A;  2JK8 A;  4QY7 A;  2MGS A;  5M5W B;  4A3I H;  3VR4 A;  1E22 A;  1NMG A;  3EN2 A;  1XNR L;  2EXD A;  3E9H A;  3PF4 A;  1AN8 A;  1HCZ A;  1HH2 P;  1B70 B;  2XSC A;  4CKE A;  3I4M B;  1PTO B;  5JEA G;  1XMO Q;  4JI3 L;  1CSP A;  4S3S A;  1Q3L A;  4KY6 A;  5IYD H;  2F0P A;  3U9O A;  4QUF A;  2HDL A;  4JK1 C;  1U4R A;  4K8J A;  4R1J A;  2VQF L;  4A3B B;  3KJP A;  2O5I C;  1HXY D;  1B9N A;  2BA1 A;  2NVT B;  3H15 A;  5JEA H;  2BCO A;  1KTK A;  2UXC Q;  4HCE A;  4BY1 G;  1RDP D;  3FKI G;  5KND A;  3A74 A;  3RUZ A;  3TZD A;  2IW3 A;  2PO4 A;  1LUZ A;  1A2T A;  2KHI A;  1Y69 U;  2JA5 G;  1JB3 A;  2BA0 A;  3KF6 B;  5G3L D;  3CP0 A;  4JPB W;  5IYC H;  4C3H H;  4JI7 L;  3PO3 H;  4C2M B;  3T56 B;  2F0I A;  2QKI C;  4R4C A;  2B2W A;  1X3G A;  4LAA A;  3CCM A;  2ATW A;  4IQZ A;  1NY4 A;  2K32 A;  4JYA Q;  2PNH A;  1YHB A;  4KY5 A;  5I9O A;  3D4W A;  4XQQ A;  2ZTE A;  5EPK A;  2E2I H;  3K80 C;  1B4O A;  3DUZ A;  4YWK A;  4LW1 A;  2F3I A;  4KKU A;  4DV7 L;  2F0D A;  3UE0 A;  1K73 C;  2VQE L;  1JWM D;  1QVG A;  3BVZ A;  3N52 A;  4A3E H;  3NEL A;  4JBK A;  3CCL A;  4IOA A;  3HOV G;  1YNJ D;  4ZQ3 A;  2DN8 A;  3A5Z B;  3R8B A;  1SJE D;  4DFA A;  1SRU A;  2K5V A;  4NDX A;  4A3L G;  1BUV T;  1I6V C;  1BQQ T;  4C3J B;  1SLJ A;  1LAC A;  4I65 A;  3S2D B;  2HIV A;  4DKA C;  5FLX c;  4NXM L;  1AE2 A;  1H9R A;  4I7A A;  2G9D A;  3FMC A;  4A3J G;  3CRK C;  2RCN A;  1B1Z A;  3C3L A;  5FO8 B;  4A3F G;  2Z0S A;  3W2D A;  4C1N K;  5M5X H;  5JPN C;  4UP9 A;  3UDI A;  3Q8D A;  1X54 A;  1O80 A;  3HOW G;  1STN A;  5C5M A;  1XMO L;  3A54 A;  4GN5 A;  1J5E Q;  1E2Z A;  3EJI A;  2B2V A;  2CHB D;  1P8L A;  2F3W A;  4EQP A;  3C1F A;  1WTH A;  3J80 c;  1V9P A;  2K6A A;  2LS0 1;  5C3X A;  4GNX A;  2A8V A;  1C9O A;  2QW7 A;  3HOV H;  2ENB A;  3QR8 A;  3DM1 A;  2ID0 A;  3H91 A;  1PHJ A;  3MEH A;  4IPC A;  1XWE A;  2I07 B;  3PQI A;  1I50 B;  1SJH D;  2R92 G;  1TWH H;  3RZO H;  5M5X B;  3DWP A;  4PZ7 A;  2ZTC A;  4IAL A;  1TWF H;  5E1F A;  3CCJ A;  1LTL A;  3NE5 B;  4EQ5 A;  2UUC L;  1OO9 B;  5KYI A;  4OEL B;  4AQY Q;  1AZP A;  2Q8I B;  1PMR A;  1ILQ A;  4LUV A;  1VQ7 A;  4YCU A;  2GA4 B;  1J6Q A;  1MSH A;  2CH4 W;  1J8I A;  2VXW A;  2UXD L;  3NP8 A;  4JI4 Q;  3EQL C;  1SYE A;  3RMH A;  1IL8 A;  1L2F A;  5HY6 A;  4DV7 Q;  4CJ0 B;  1DGS A;  3S15 B;  4U67 3;  1XTD A;  5ELE A;  1DM0 B;  3GTK H;  4ID6 A;  3U50 C;  3CD6 A;  1EY9 A;  2HQE A;  2SDF A;  2Z6K C;  3K6O A;  5HGT A;  2XVS A;  4K6L A;  4ZLT F;  2RHQ B;  4HJA A;  4HMJ A;  1ASY A;  4DR6 Q;  2Q2H A;  2K5N A;  1TII D;  3BDO A;  3KF6 A;  4NXM Q;  2DJG C;  4IPG A;  3OTO Q;  3CF5 A;  2BH8 A;  1L1O C;  2CFM A;  1T5X D;  1JCK B;  1WI5 A;  3AB9 A;  3RLO A;  5I4D A;  4DV4 Q;  4AYB B;  1STE A;  1CQF A;  2N55 A;  1B8A A;  2A68 C;  4X66 Q;  3CPW A;  3LGJ A;  1JOK A;  4V0B A;  3I4L A;  2JA9 A;  1QZG A;  4Z9C B;  1OXT A;  3RLN A;  1IBM L;  3W1B A;  3P20 A;  2JA8 G;  3D8G A;  1NR4 A;  2XIW A;  3PO3 B;  1RL2 A;  1SSO A;  2EY6 A;  2VZA A;  5KNC A;  2NTS A;  4ABN A;  5C3E B;  1PH4 A;  4HID A;  1U4L A;  2I0Q A;  1X55 A;  3T16 A;  4DAY B;  4KHZ A;  5DNF A;  2SNM A;  1PYW D;  4PNY A;  1RJT A;  5E7N A;  3A8I E;  3NEM A;  1IBK L;  4YCV A;  3K0X A;  2GN5 A;  1TY0 A;  3HOY G;  2KOL A;  3U9S A;  1GUG A;  3KLW A;  4R4I A;  4IUU A;  4PZ6 A;  2QCP X;  1VS0 A;  1FR3 A;  3TBI B;  2PW5 A;  4MN3 A;  1VF7 A;  3PIP A;  4K2K A;  2JA5 B;  1QOH A;  1JE5 A;  1DCZ A;  2JN4 A;  2MNA A;  4UPA A;  5M5W H;  3DEP A;  4A3D H;  1SAP A;  1D1I A;  3X3M A;  1GUW A;  4QL5 A;  1C8C A;  1X3P A;  3SK8 A;  1X3F A;  2LKV A;  5JJK A;  3ERS X;  1M90 C;  2VQF Q;  4A3M B;  3E9I A;  3FKI H;  3CU7 A;  3JAM E;  4BBR H;  1ET6 A;  4L6T B;  5EBC A;  1I3Q B;  2NVY H;  2B8G A;  1KD1 C;  3ER0 A;  2F0H A;  3E0J A;  2L15 A;  4KD4 A;  2Y0S B;  5IYD G;  3N6R A;  2YTV A;  1PTO H;  2JA7 B;  3QWN A;  2OCE A;  3MXP A;  3I3C A;  4HAE A;  3ULJ A;  3HKS A;  3NWS A;  4TVA B;  1LTA D;  2A69 D;  5C44 G;  5C0X G;  5C4Z A;  4GKK Q;  3FKI B;  3PIO 3;  2EYH A;  3S2H B;  3T51 B;  1YZ6 A;  2E8G A;  4IUV A;  5DM6 3;  5IP9 G;  4KHV A;  3TRZ A;  3A55 A;  3TME A;  1MJC A;  4UY8 C;  1EY4 A;  1KHI A;  4JOI A;  4QCL A;  3BS1 A;  5F2D A;  3AYH B;  3VDY A;  2IL8 A;  3TP7 A;  2WKC A;  4CDC C;  3TP8 A;  2YYZ A;  3TEH B;  2SOB A;  4LMQ D;  3L0O A;  3QOL A;  1VQ4 A;  5A35 A;  1ZYR C;  2F0M A;  4A4I A;  1EIH A;  4A3J H;  4M8A A;  3MWY W;  3HOU H;  1WTP A;  1ZKO A;  4BS9 A;  4YY3 L;  3GTQ B;  2QDL A;  4IFD I;  3MA2 B;  4CKC A;  3CC7 A;  4HIO A;  4LJZ C;  4B3S L;  2RSN A;  1PTO F;  4LF6 L;  3NBH A;  2E2I B;  1N34 L;  4LF5 Q;  4G7Z C;  2TSS A;  1QIL A;  2B8F A;  1K28 A;  5M3F B;  1Y8P B;  2X69 A;  1R4Q B;  2HDM A;  4LUO A;  4GS3 A;  1CT1 D;  4A3K G;  2BOS A;  4OO1 H;  4WOR A;  5IGF A;  1UAP A;  3BYT B;  3M4Q A;  2JP1 A;  3FPP A;  3QJY A;  2ZXP A;  3M4O B;  1O7L A;  1RTO A;  4OIJ A;  1V43 A;  2N8N A;  1I4Q A;  3TSS A;  4AIM A;  1AFP A;  3HOW B;  3F8T A;  1V1P B;  1JR0 D;  2MQH A;  3MHB A;  1YHA A;  2MO1 A;  1VQP A;  2Y0S E;  1E1T A;  1IYU A;  4CKB A;  3H6M A;  3A0J A;  3V2T A;  1A0I A;  2KCC A;  3I2Z A;  2E5L L;  1B44 D;  2MO0 A;  3J81 j;  1BCP F;  1EU4 A;  3P1H A;  4ZKC B;  3MVV A;  3CCQ A;  4DA2 A;  1NMF A;  3PMF A;  1PLF A;  1VF5 C;  1VQD A;  4FYD A;  2RHS B;  3MC0 B;  5KRU A;  2GVA A;  1EOT A;  1ESF A;  4JCV E;  1NCV A;  5KYL A;  2KHJ A;  4HJ7 A;  2IX1 A;  1Y1W B;  3C2P A;  2IHE A;  5EKI A;  5IT9 c;  4OWW B;  4ULL A;  5M5Y H;  2JEB I;  1U4M A;  5FO7 B;  2PYK A;  1WTQ A;  1O7Y A;  2XTI A;  1NTG A;  1WJJ A;  5IOD A;  3BYY B;  2A6H D;  3M3Y H;  2K33 A;  4RGN A;  1KRS A;  3UDX A;  2A6H C;  1OXX K;  4OXP A;  4LF4 L;  1SNO A;  2QEJ C;  1H9M A;  1MD2 D;  1TWG B;  2B2T C;  3EBE A;  4H13 C;  4O0A A;  4OGQ C;  4LF8 Q;  1PRT B;  5JEA J;  3OTO L;  3X3N A;  1VQN A;  1N32 L;  3B6Y A;  2RBM A;  3GTJ B;  4JI2 L;  5LMN W;  2QIL A;  3OIP A;  1EY6 A;  2JJQ A;  2B2U C;  5KGU A;  4FF4 A;  3CCV A;  3NTK A;  3J81 c;  3L7Z C;  2F0N A;  1XNQ L;  4K0K L;  5I9P A;  2FMM A;  1K8M A;  4BBR G;  4JVZ A;  4XYQ A;  2L12 A;  1EZ8 A;  2DJF C;  1CI3 M;  1TS2 A;  3SEB A;  5ISR A;  1F9S A;  1RD9 D;  2OT2 A;  3GDE A;  3SK4 A;  1KAB A;  1RHP A;  2B2W C;  2DNC A;  2OWO A;  3FEW X;  3KLS A;  5K36 H;  3PF5 A;  5M9O A;  1S5F D;  4B9X A;  5HGQ A;  3GQB A;  4CGY B;  1G51 A;  4TSS A;  1YNX A;  4X64 L;  3CXC A;  4DV0 L;  1IKL A;  2RA4 A;  1MJE A;  1OXU A;  4R4Q A;  2NN6 H;  3HFZ B;  5DLQ E;  1GOZ A;  1ICW A;  4M1U B;  3M7G A;  2MFI A;  4A3C G;  3C1E A;  4C3J H;  1PYS B;  1V1Q A;  2UXC L;  1BBU A;  3DEO A;  5EPL A;  1KL9 A;  5CV7 A;  4PQX A;  3NQT A;  5C6A A;  2BDN A;  1JMC A;  2L1B A;  4OWT B;  3CME A;  4P73 A;  1EEI D;  5J3B A;  2ASB A;  1QNU A;  4PZ8 A;  4DAV A;  2KBN A;  4RCN A;  1Y8O B;  2F0L A;  1G2T A;  1JOR A;  2A74 C;  4CJ2 C;  1PRT F;  2Z6B A;  2OXP A;  1O7Z A;  4IPH A;  3IFD A;  1WTX A;  5FK9 C;  1HNX L;  3IAY A;  2VQE Q;  3L2P A;  2B2V C;  2KCM A;  3GTQ H;  1HJP A;  5JAV A;  1F2Y A;  2MJ8 A;  1PZK D;  3K5N A;  3D6C A;  3U58 A;  2C35 B;  3D0F A;  1F9P A;  4DR1 Q;  2WV6 D;  2OEO A;  5D65 A;  2H4O A;  2JA6 G;  4GKK L;  3P7J A;  2DGY A;  5FO9 B;  2ZM6 Q;  1TT2 A;  4DV2 L;  4Y7N H;  4K0K Q;  4DK1 A;  1JE4 A;  1VQF A;  4DV5 Q;  1G91 A;  1BCP C;  2WKD A;  1GHK A;  2X6G A;  1CHP D;  1XPR A;  5K5P A;  2AQ1 B;  3NPP A;  3LNN A;  3T1Y Q;  2K01 A;  3S1N H;  1STY A;  4LFC Q;  4ZRZ A;  4XIG S;  3H0G B;  3U4V A;  3SHL A;  2F0K A;  1Q1E A;  3NXW A;  1TWC B;  2E76 C;  1QWY A;  1J5E L;  4BBS H;  5GRO A;  4X64 Q;  4NMZ A;  4N8X 1;  1N36 Q;  2HHH Q;  1EWI A;  4DV0 Q;  1G6Z A;  3GTO H;  2XWJ B;  5ELN A;  1SMX A;  1VMP A;  2PZT A;  4A76 A;  2CCZ A;  1N33 L;  2WII B;  4NPS A;  2UU9 Q;  3TZU A;  1PV4 A;  2JA6 B;  4B3S Q;  1LM0 A;  4JBW A;  3S2H H;  1DON A;  4FO2 A;  1K9M C;  3DMU A;  1E3P A;  2PQA B;  1A63 A;  1XPU A;  3CQZ H;  1AEX A;  2AUK A;  3OWF A;  3L3O C;  2DY8 A;  1CHQ D;  4XDX A;  2JEA I;  2NUC A;  1JJG A;  1BBX C;  4AQY L;  3HKZ E;  3H94 A;  2E2H H;  3WDN A;  5LL6 S;  1HZC A;  5JPM C;  4DV3 Q;  1ML0 D;  1X65 A;  1L1O A;  4MNO A;  3K7A B;  1TVX A;  3GO5 A;  4RAU C;  1K8O A;  4QUC A;  5JJL A;  5CGK A;  2R7Z B;  1WD0 A;  1KNA A;  3GTM B;  4DR7 L;  3ONA B;  2EY2 A;  3D3R A;  2N78 A;  3RR5 A;  1SE3 A;  2JXM B;  1R9T H;  3BG3 A;  2C9O A;  3PUY A;  3TDQ A;  4PV1 C;  4GNX B;  2SEB D;  4X3U A;  1CKN B;  2PW7 A;  2B63 H;  1LTS D;  3K0Y A;  3PGZ A;  4A3L H;  1PH1 A;  5K36 G;  2HCC A;  3I70 A;  2MHV A;  5A2Q L;  5IGB A;  2I5H A;  4CJ1 B;  4QF4 A;  4DUY Q;  4H0L C;  4OWX B;  1H95 A;  3TP6 A;  1E24 A;  1KC8 C;  4HSP A;  3HP3 A;  3SDZ A;  4OEM B;  3T1Y L;  5I6W A;  1PFM A;  3KYH C;  5CYU A;  3I91 A;  2F0U A;  4LFC L;  3G7L A;  1I5F A;  3PCO B;  4DAP A;  4MHE A;  1HFG A;  4A3D G;  2AUJ D;  3I4N G;  4ZCK A;  1RCV D;  4R9W A;  1NBW A;  3BVM A;  1XYI A;  1ZYR D;  1VQJ A;  1EYD A;  1KLU D;  3TN2 A;  2K7V A;  2UU9 L;  4BBS G;  1YJ9 A;  5BR8 L;  4FF2 A;  1LTB D;  3K5L A;  1W3S A;  1YJN A;  4G57 A;  5I2X A;  2JSO A;  2N49 A;  3VA5 A;  2XRS D;  1Y1W H;  1BXT A;  3FPU B;  1EIF A;  4HIK A;  1O78 A;  2IY5 B;  2WP8 J;  5LMN Q;  3HOZ H;  4JI8 Q;  4LWC A;  1MBY A;  3S9W A;  3BU2 A;  5BN4 A;  1OXS C;  5EJW A;  2F0S A;  1IYV A;  5ELF A;  1E7Z A;  3K7U C;  1EYG A;  4P74 A;  2CQO A;  4BY7 B;  4X65 L;  1YEZ A;  2LXJ A;  3TS2 A;  4KHP Q;  3ND9 A;  5LHY 1;  3J7A V;  4OO1 I;  1QUQ B;  4QMG A;  2KEE A;  3I8Z A;  2RCF A;  1CM9 A;  1JOO A;  4K6D A;  2LXK A;  4KTA A;  1SYG A;  3D4R A;  2F03 A;  1BDO A;  2IHF A;  4K14 A;  3HOX G;  1UEA B;  3G4S A;  3CPF A;  4FVM A;  1I4P A;  1YNJ C;  2A6E C;  2Z6K A;  5C0X I;  1VQ5 A;  1SFO H;  4B9W A;  1IZ6 A;  1HZA A;  1PZI D;  4YWL A;  1STH A;  4IJH A;  2JA5 H;  4LF7 L;  1SMY D;  4OX9 L;  4DXG A;  1HR0 W;  1HRJ A;  4GN3 B;  2K5H A;  3H3V H;  1JIC A;  3OMC A;  2RVL A;  4DXF A;  2MPM A;  4DUY L;  4JI1 Q;  5IT9 L;  2VUM B;  4LK1 C;  4OHJ A;  4EQN A;  3OW7 A;  5M3F H;  4XQN A;  2EXZ A;  4CHT B;  1SNC A;  1HA5 A;  1Q8I A;  4ZYS A;  4JV5 L;  1SE2 A;  4BXX H;  2AWO A;  5T1G A;  3ZYY X;  1E1O A;  1SYB A;  2K5D A;  1Q1B A;  3HOZ G;  1IYJ B;  1EIY B;  3OHX C;  5I6Y A;  4K8I A;  2E74 C;  3F2C A;  2EJF C;  4HED A;  3A8J E;  4H44 C;  2Y0S G;  2RDF A;  2D0O A;  1CKO A;  3HOV B;  1WD1 A;  4DR3 L;  1KDC A;  3I4N H;  1D6E C;  3OPO A;  2K04 A;  4C3H B;  2RKS A;  5CBA E;  5BN5 A;  4A3E B;  3S14 H;  1WYD A;  4BY7 G;  5C3W A;  3HRZ C;  4ILW A;  1XJV A;  4DV2 Q;  1IL2 A;  2Q2I A;  1LT6 D;  1RF2 D;  4ZUI A;  3SGI A;  5D3I B;  3FHW A;  1CQV A;  1EZ6 A;  2NBF A;  4XYO A;  2ZXR A;  2M00 A;  5FLX E;  4KJO A;  3L9A X;  2K75 A;  1N34 Q;  4LF5 L;  2NZH A;  4B3R Q;  4RKL A;  2H5X A;  4G4K A;  2EE1 A;  4JI3 Q;  2R93 G;  5DAU A;  5LMU Q;  4C3H G;  1MHW C;  1L0Y B;  3S1Q B;  1B3Q A;  3J80 L;  1ICF B;  4WRD A;  2UXB Q;  4G7O C;  1CA6 A;  4DAM A;  1YNN D;  3F2D A;  3RN5 A;  2DNE A;  1I94 Q;  2NWG A;  3ULL A;  3PSI A;  2H1E A;  1JWS D;  1N8R C;  4RGO S;  2UUB Q;  2JA7 G;  4OX9 Q;  3K57 A;  5JVH 3;  2EPB A;  1RIP A;  3C46 A;  1E2V A;  4DR2 L;  3HOU B;  1WCM B;  3I55 A;  2Z4I A;  5E4X A;  2KEC A;  4JW0 A;  1X56 A;  4JI1 L;  4C3I G;  1BNZ A;  2P5Z X;  3NBI A;  3OW2 A;  3CCR A;  1TS4 A;  3M4O H;  2ZJP A;  3SXH A;  1TWG H;  3K8A A;  3VR6 A;  3T4A C;  1WTV A;  2K03 A;  1Q82 C;  4L5S A;  4JYA L;  3MXN A;  3J7A 5;  2EQS A;  1EYC A;  4QIW E;  2JA8 B;  4Y52 H;  1JWU D;  3UI2 A;  2K28 A;  1PH5 A;  1QUQ A;  1K83 B;  2Z4H A;  4GN4 B;  4J1M A;  1IW7 C;  1U4P A;  3VR5 A;  4J8Q A;  3JAM L;  4DR7 Q;  1ENC A;  1TWH B;  4IUT A;  3RLF A;  4IFD J;  2OTL A;  3K5O A;  1Q7Y C;  1NE3 A;  1Y14 B;  3S1Q H;  4RH6 A;  3E5S A;  1Z7T A;  2B2Y C;  1AZQ A;  3SK5 A;  4I7Z C;  2K5Q A;  4BA2 I;  2ICE C;  1BVS A;  1YIJ A;  1TS3 A;  2QF7 A;  4E6I A;  1YJW A;  3AFP A;  3GV6 A;  3S16 B;  1ENA A;  4HIM A;  4LF8 L;  3LWU A;  3SK6 A;  2NTT A;  4UDU C;  4A3M H;  1BKB A;  2OQ0 A;  4LUZ A;  3K58 A;  2L55 A;  3HKZ G;  3S15 H;  3OIQ A;  3MFG A;  4A93 B;  2NZ1 D;  5EQ0 A;  5JOB A;  1IKM A;  5H1S E;  1AW7 A;  3NSW A;  3F2U A;  1D5M C;  3QB3 A;  1XNQ Q;  2R92 B;  2G5D A;  3J7A F;  3ITP A;  5G3L F;  4KJN A;  1T5E A;  5IE8 A;  2HQL A;  3WOE A;  3LX0 A;  4X62 L;  3RNU A;  4XTC S;  1T9H A;  3AEV A;  3GD7 A;  1Q86 C;  4H7B A;  1SE8 A;  4ZK9 B;  1VQC A;  2FIN B;  4DR5 Q;  4POF A;  5BR8 Q;  4QIW B;  1VQO A;  5FOB B;  2ZJQ A;  2D5D A;  2NYZ D;  3H3V I;  3PO2 H;  3R2T A;  4APV A;  4JBJ A;  1WTR A;  2EVB A;  1Q81 C;  1HNZ Q;  4BXX G;  1U9R A;  1Z9F A;  5J1Z A;  2WFW A;  3PUW A;  3EIV A;  1KIX A;  1SYF A;  4DR2 Q;  3HOX B;  4GLA C;  2CW0 D;  5M3F G;  1VQL A;  1SR3 A;  2KUM A;  1E0B A;  3S2D H;  2YTX A;  2NVX B;  1EQR A;  1U5K A;  1YI2 A;  3I4M H;  4UP7 A;  4JG2 A;  1Z6H A;  5EKL A;  1FD7 D;  3G71 A;  2A69 C;  3AU7 A;  4XT1 B;  2VS1 A;  2M9V A;  2UXD Q;  3J7Y W;  1EY5 A;  2AMC B;  5COY A;  1N9W A;  4P75 A;  3Q0A A;  4P72 A;  5IWA Q;  1QVC A;  5LL6 X;  4O2D A;  4RFB A;  1L1O B;  4DK3 C;  1S72 A;  4ZKB B;  4RKB A;  3HOU G;  3KBX A;  1SNM A;  1CKM A;  1I6H B;  4B3M L;  4IOC A;  4A3F H;  3ERO A;  3IRB A;  4X3S A;  1MSG A;  1IHZ A;  4KY7 A;  4A3G G;  1DOM A;  2KEN A;  3DM3 A;  3H0G H;  3TQY A;  1Y1V G;  5GAD C;  1VQE A;  4C2M H;  2QGQ A;  1EIG A;  2NVT H;  1TWF B;  1JB7 A;  2NN6 G;  2RSO A;  1F9R A;  2LFN A;  4JV5 Q;  1VQA A;  3DHQ A;  1DOK A;  1YNN C;  1Y1W G;  1UE7 A;  2B2U A;  2K14 A;  3HOW H;  4A3G H;  4V19 0;  4X6A H;  5IP7 G;  3VYU A;  1FNV A;  1Q12 A;  5ELB A;  1C4Q A;  1STB A;  1HNW L;  1D8L A;  1BCP D;  2XNA C;  3FDT A;  5IOC A;  1EQQ A;  4N9P A;  4JI6 L;  2LMC B;  4RHS A;  1SRO A;  4LFA Q;  1WTO A;  4DR5 L;  3KOJ A;  3DWA A;  1A62 A;  1MIU A;  1XNR Q;  1PXU A;  5AJ3 L;  2WB1 E;  2F0T A;  1H9S A;  4DK0 A;  5GAE C;  1QZH A;  4KD3 A;  2JA7 H;  1EWH A;  2RDH A;  3URY A;  1N36 L;  2HHH L;  3H0G G;  3CCE A;  5KNB A;  2UUA Q;  4FF3 A;  2EIF A;  5IGE A;  4DV6 Q;  1TWA B;  4BY1 B;  5C4X B;  1Z47 A;  4OIK A;  3CMA A;  3A7L A;  3CC2 A;  2QEX A;  5CV4 A;  4CBV A;  5IYB G;  2ZXO A;  4A3J B;  4EQO A;  2AWN A;  2QA4 A;  3I4M G;  1EOV A;  4B3R L;  4KN4 C;  3ERQ A;  5CV6 A;  5NUC A;  4BA1 I;  1PVO A;  3J81 L;  4QB4 A;  2XGT A;  3GTO B;  1F77 A;  5IWA L;  3NHH A;  2C5C A;  2A73 B;  1BOS A;  2XWB B;  1M8A A;  1PRT D;  4FXD A;  3DWQ A;  4DV3 L;  1ZXT A;  5C0X J;  2E2D C;  5AFW A;  3LWE A;  4R4T A;  5IGC A;  1I50 H;  2JE6 I;  2AKW B;  3F1Z A;  4KKT A;  2UUB L;  4JI0 L;  3HS0 C;  2IX0 A;  4LNQ A;  3VYR A;  3E0E A;  5GQO A;  3J80 E;  2KJX A;  1G6P A;  4QGU A;  3S24 A;  4O1N A;  1NNX A;  1K8A C;  2CWP A;  1S4Z A;  3FRP B;  1JC7 A;  1RKN A;  2MUY A;  1TS5 A;  2PZU A;  1W6K A;  1C48 A;  2ZJR A;  3CRL C;  1QNK A;  2L4N A;  2BDO A;  4C1N I;  1CUK A;  5HUR A;  5C4J B;  1EFI D;  1PFS A;  1GM5 A;  4GZY C;  4LFA L;  4O42 A;  2K52 A;  5GAH C;  1TY2 A;  2PZW A;  4JI5 Q;  4IPD A;  3GTG B;  4B3T Q;  3HGB A;  2B2Y A;  4A3K H;  1B2T A;  1W2B A;  1K3B C;  2L11 A;  3M9B A;  2F0O A;  4FP5 D;  1TXY A;  1HQM C;  3CCU A;  4GOP B;  1F2Z A;  3HOX H;  2UUA L;  3A7A B;  4A3D B;  5C4X G;  4DF7 A;  4IZ8 A;  1VQK A;  4XT3 B;  3FVQ A;  4J15 A;  2R7F A;  2OF1 A;  4X3T A;  2O5J C;  1KDB A;  3TRE A;  1FJG Q;  4UAI A;  2G9H D;  1Y8N B;  2YV5 A;  3S1R H;  1UE1 A;  1Q90 A;  3OSO A;  4FNF A;  1PFN A;  5IP9 H;  2R6G A;  4DGZ A;  4C3I H;  2ZT9 C;  5ELD A;  1K0S A;  4X62 Q;  3S17 B;  3SR1 A;  4MZ9 A;  2EYM A;  5IT9 E;  1YIT A;  2NB0 A;  3RD4 A;  1GHJ A;  1HUN A;  3I7F A;  4KI0 A; 
#chains in the Genus database with same CATH homology
 3HOY B;  2WB1 B;  3VYS A;  4RHR A;  3KUP A;  4KV6 A;  1MGS A;  3CKI B;  3CHB D;  1FGB D;  3MZ5 A;  3P75 A;  3S1M B;  2SNS A;  5BN3 A;  1FNW A;  1Y1V B;  2F0F A;  2O2L D;  4K2L A;  2FMC A;  3D4D A;  1II3 A;  1SNP A;  4C3J G;  1BO0 A;  1PFB A;  3I4N B;  1BR9 A;  2F0Q A;  5EBD A;  2EY5 A;  3GV3 A;  2FFK B;  2K5W A;  4KN7 C;  5JVG 3;  4C3I B;  1STA A;  3NWT A;  2F3V A;  1S5E D;  4BBR B;  1LV9 A;  4B08 A;  3HEJ A;  5CV5 A;  1HUM A;  2RDG A;  5I2Y A;  4WJW A;  2K05 A;  5D3D A;  5IGD A;  3HG9 A;  3BDL A;  2E2H B;  1E2W A;  3R93 A;  3VYT A;  2IPK D;  3NTI A;  2EOT A;  2VNU D;  3OOC A;  1HPC A;  1GUN A;  3QIA A;  4ZAI A;  5M3M B;  4ZUJ A;  1STG A;  4FF1 A;  1X3Q A;  1CA5 A;  2Z1C A;  2ICI A;  1TU2 B;  1L0X B;  4RGT A;  3J81 E;  4X3K A;  1EWC A;  3PUX A;  4EVO A;  2F0V A;  4DU9 A;  3TP5 A;  1EY8 A;  4L63 B;  1G29 1;  3NK9 A;  2V4D A;  3G6J B;  1S5D D;  1GUT A;  1VDZ A;  5CMD A;  1LT4 D;  2F0E A;  3VR2 A;  2HUG A;  4TKO B;  4A3K B;  4KMU C;  5C5L A;  3M85 A;  3R3O A;  3EVQ A;  2NVQ B;  2B2T A;  1B50 A;  1SND A;  4C56 C;  3MAQ A;  5CC4 A;  2DY7 A;  4PMW A;  5FKA C;  1FNU A;  1B53 A;  1M4V A;  1TQO A;  1ROD A;  1NUC A;  3GP7 A;  3OMG A;  2KQ3 A;  3AMU A;  2J4X A;  1ESR A;  3EA6 A;  2XN9 C;  1H9J A;  4RA8 A;  3KBG A;  1JQY D;  1B3A A;  3IKJ A;  3GTK B;  4K5V A;  2YU9 B;  2F0G A;  5CBE E;  1DZ1 A;  3S1R B;  4N9T A;  1LTT D;  1CZG A;  2EYJ A;  1HTP A;  5M5Y B;  1HTL D;  5EGT A;  4FXG C;  4HMI A;  1CFM A;  4ME5 A;  3Q22 A;  2A6E D;  2TMP A;  2FJ2 A;  2JYO A;  2B39 A;  1EQV A;  1WVL A;  2PQE A;  4TRD A;  4IN3 A;  4KK7 A;  1FYC A;  2NN6 I;  4RWS C;  4NKL A;  1B9M A;  1SYC A;  1EEF D;  1KAA A;  4HTH A;  1CK1 A;  3VA7 A;  5D14 A;  5KEE A;  1DXM A;  1H9S B;  2M2L A;  3W3A A;  1W6J A;  1DJR D;  2F4I A;  2PMZ B;  4Y7N B;  1QCB D;  4A3G B;  1A3U A;  2IT1 A;  3QO2 A;  1S5C D;  2KA7 A;  1F9Q A;  1G2S A;  4ODG A;  5IGG A;  4G7H C;  2E2J B;  1DYQ A;  1SYD A;  2LY7 A;  2FHT A;  1WTW A;  2A68 D;  4TQU S;  5IIF A;  1LT5 D;  4XQJ A;  4IUQ A;  1PTO C;  4MIU A;  4U68 A;  1SDF A;  3PO2 B;  3S14 B;  2WAQ B;  1QJO A;  4PMC A;  1X32 A;  1XXG A;  3A8K E;  1RTN A;  1LTR D;  1LO5 D;  3CQZ B;  1SFO B;  2L9H A;  2EYF A;  5E3F A;  4OL7 A;  5DEH A;  2PNR C;  3BDC A;  2KHS A;  1LTI D;  3MTS A;  2K1B A;  2PPB C;  2VB3 X;  3H3V C;  5C0X H;  4P2C B;  1EQT A;  4Q5V A;  1UUP A;  4F88 A;  3I72 A;  1J9O A;  3NTH A;  5J22 A;  1DOL A;  3IFT A;  5CV8 A;  5ELC A;  2VB2 X;  1IW7 D;  3S1N B;  3EFX D;  2WAC A;  5E4W C;  4DN4 M;  1NAP A;  4HCS A;  1SE4 A;  1XTC D;  1HQR D;  1AP0 A;  2EY1 A;  2KVM A;  3T13 A;  3M4Y A;  2J7Z A;  1A3V A;  5C44 B;  1A2U A;  5EPJ A;  4BBS B;  3SE0 A;  4IFD H;  4IUP A;  3KF8 A;  5KIX A;  4IUN A;  2D9U A;  2R93 B;  3A56 A;  5FLX L;  5JJZ A;  1GJX A;  2Q8T A;  2A5H A;  4HN7 A;  1V8Q A;  2MP1 A;  1XX8 A;  4F8M A;  1G8Z D;  1CZW A;  1ZEQ X;  3V96 A;  4F87 A;  1PDQ A;  3I73 A;  3T53 B;  1LAB A;  1HA6 A;  3H09 A;  3HZX A;  3D31 A;  3E6Z X;  2PCF B;  1SEB D;  1A15 A;  2EYL A;  1LT3 D;  3BZD B;  1H9K A;  1I4H A;  3SVM A;  2Z8L A;  4XXE A;  3QG1 A;  1S5B D;  3KK7 A;  1F2M A;  5C4H A;  4HR7 B;  2F0J A;  2L5T A;  2CW0 C;  3BVG A;  2XRQ D;  2X6L A;  3GTP B;  2IJ0 A;  1A6X A;  4NP5 A;  2KCN A;  1PRT C;  3RZD B;  3K59 A;  1EYA A;  1EY7 A;  1QG7 A;  3DXJ C;  1I4G A;  2AQ2 B;  2CVR A;  3OWE B;  3Q6S A;  3IL8 A;  1R4P B;  5T1I A;  2EYP A;  1ONL A;  1LTG D;  1OXV A;  1PTO D;  1BCP B;  3VR3 A;  1I4X A;  4EGV A;  3PUV A;  1EL0 A;  3KLR A;  2Q8R E;  1ILP A;  4YIJ A;  3Q24 A;  4K5X A;  1D1K A;  1JOQ A;  1VCI A;  3WOF A;  2HCI A;  5CR3 A;  1GUO A;  2D2C C;  4BWG B;  4A3I B;  1ET9 A;  3K5M A;  2O4X A;  3Q23 A;  1D2B A;  4OO1 G;  2WIN B;  1KNE A;  4DNR B;  4DAY A;  5COR A;  3KLS X;  5DM7 3;  3D6W A;  2EJM A;  4J6H A;  4R8I A;  3HKZ B;  2L0C A;  2BE5 C;  3M7N A;  4KKS A;  1GXD C;  3RZO B;  3ND8 A;  1A3T A;  1V1P A;  3NQI A;  5A2Q E;  4HSV A;  1KDA A;  1GUS A;  1F2L A;  4RGM A;  2NVY B;  1I4R A;  2E75 C;  3MFY A;  1D5Z C;  1CTM A;  1QE6 A;  4IUR A;  1TR5 A;  4A3F B;  1ENF A;  1TKW B;  4F7X A;  1SXT A;  1D5X C;  3PUZ A;  2D62 A;  3NUC A;  3GTL B;  2N88 A;  1UNS A;  1NSN S;  1SNQ A;  2EDG A;  4RCO A;  4PMB A;  2CQA A;  3M3Y B;  4NW2 A;  4K5W A;  3PIP 3;  1EY0 A;  1EU3 A;  1LLR D;  3I90 A;  1VMC A;  2F1M A;  1MI2 A;  5CV9 A;  1BF4 A;  2J0T D;  2I46 A;  5EKK A;  4IFD G;  3V05 A;  2RQX A;  1KLG D;  1SMY C;  4WFN 3;  2IX3 A;  2R61 A;  1HFN A;  2QDB A;  4FXK C;  1HHV A;  2EYO A;  3MXG A;  2F0W A;  4R8N A;  2EZV A;  1SBB B;  4Q0F A;  1PZJ D;  5J39 A;  4DNT B;  3O13 A;  4L8J A;  3PV0 A;  1NR2 A;  2AQ3 B;  1R9T B;  2EJG C;  5TSS A;  3R2I A;  3MXU A;  2IWH A;  2R3Z A;  3HOZ B;  2B63 B;  1DD2 A;  3QOJ A;  1QB5 D;  2BE5 D;  2KED A;  1V1O A;  2MGS A;  5M5W B;  3VR4 A;  1AN8 A;  1HCZ A;  2XSC A;  4CKE A;  3I4M B;  1PTO B;  5JEA G;  4S3S A;  1Q3L A;  4KY6 A;  2F0P A;  3U9O A;  4QUF A;  2HDL A;  4JK1 C;  1U4R A;  4K8J A;  4A3B B;  2O5I C;  1HXY D;  1B9N A;  2BA1 A;  2NVT B;  5JEA H;  2BCO A;  1KTK A;  4HCE A;  1RDP D;  5KND A;  3TZD A;  3RUZ A;  2IW3 A;  2PO4 A;  1A2T A;  1Y69 U;  1JB3 A;  2BA0 A;  5G3L D;  4C2M B;  3T56 B;  2F0I A;  2QKI C;  2B2W A;  4LAA A;  4IQZ A;  2K32 A;  4KY5 A;  5I9O A;  3D4W A;  4XQQ A;  5EPK A;  1B4O A;  3DUZ A;  4KKU A;  2F0D A;  1JWM D;  3BVZ A;  3N52 A;  1YNJ D;  4ZQ3 A;  2DN8 A;  3R8B A;  1SJE D;  4DFA A;  4NDX A;  1BUV T;  1I6V C;  1BQQ T;  4C3J B;  1LAC A;  4I65 A;  3S2D B;  1H9R A;  2G9D A;  3FMC A;  3CRK C;  1B1Z A;  3C3L A;  5FO8 B;  3W2D A;  4C1N K;  5JPN C;  1O80 A;  1STN A;  5C5M A;  3A54 A;  1E2Z A;  3EJI A;  2B2V A;  2CHB D;  2F3W A;  4EQP A;  3C1F A;  2K6A A;  2LS0 1;  5C3X A;  2ENB A;  3DM1 A;  2ID0 A;  3H91 A;  3MEH A;  1XWE A;  2I07 B;  1I50 B;  1SJH D;  5M5X B;  3DWP A;  4IAL A;  5E1F A;  3NE5 B;  1OO9 B;  5KYI A;  1AZP A;  2Q8I B;  1PMR A;  1ILQ A;  2GA4 B;  1MSH A;  1J8I A;  2VXW A;  3NP8 A;  3RMH A;  1SYE A;  3EQL C;  1IL8 A;  4CJ0 B;  3S15 B;  4U67 3;  5ELE A;  1DM0 B;  4ID6 A;  1EY9 A;  2HQE A;  2SDF A;  3K6O A;  5HGT A;  2XVS A;  4K6L A;  4ZLT F;  4HMJ A;  1TII D;  3BDO A;  1T5X D;  1JCK B;  3AB9 A;  5I4D A;  4AYB B;  1STE A;  1CQF A;  2N55 A;  2A68 C;  1JOK A;  4V0B A;  3I4L A;  4Z9C B;  1OXT A;  3P20 A;  3D8G A;  1NR4 A;  2XIW A;  3PO3 B;  1SSO A;  2EY6 A;  5KNC A;  2NTS A;  4ABN A;  5C3E B;  1U4L A;  3T16 A;  4KHZ A;  5DNF A;  2SNM A;  1PYW D;  4PNY A;  1RJT A;  3A8I E;  1TY0 A;  2KOL A;  3U9S A;  1GUG A;  4IUU A;  2QCP X;  1FR3 A;  3TBI B;  2PW5 A;  4MN3 A;  1VF7 A;  4K2K A;  2JA5 B;  1QOH A;  1DCZ A;  3DEP A;  1SAP A;  1D1I A;  3X3M A;  1GUW A;  1C8C A;  1X3P A;  3SK8 A;  2LKV A;  4A3M B;  3CU7 A;  3JAM E;  1ET6 A;  4L6T B;  5EBC A;  1I3Q B;  2B8G A;  2F0H A;  3E0J A;  4KD4 A;  2Y0S B;  3N6R A;  2JA7 B;  1PTO H;  3QWN A;  3MXP A;  3I3C A;  4HAE A;  3NWS A;  1LTA D;  2A69 D;  5C0X G;  5C4Z A;  3FKI B;  3PIO 3;  2EYH A;  3S2H B;  3T51 B;  4IUV A;  5DM6 3;  4KHV A;  3A55 A;  3TME A;  1EY4 A;  4QCL A;  3BS1 A;  5F2D A;  2IL8 A;  3TP7 A;  2WKC A;  3TP8 A;  2YYZ A;  2SOB A;  4LMQ D;  3QOL A;  5A35 A;  1ZYR C;  2F0M A;  1EIH A;  4M8A A;  3MWY W;  1WTP A;  1ZKO A;  4BS9 A;  3GTQ B;  4IFD I;  3MA2 B;  4CKC A;  4LJZ C;  2RSN A;  1PTO F;  3NBH A;  2E2I B;  4G7Z C;  2TSS A;  1QIL A;  2B8F A;  5M3F B;  1Y8P B;  2X69 A;  1R4Q B;  2HDM A;  1CT1 D;  2BOS A;  4OO1 H;  4WOR A;  5IGF A;  1UAP A;  3BYT B;  2JP1 A;  3FPP A;  3QJY A;  2ZXP A;  3M4O B;  1O7L A;  1RTO A;  4OIJ A;  1V43 A;  1I4Q A;  3TSS A;  1AFP A;  3HOW B;  1V1P B;  1JR0 D;  3MHB A;  1IYU A;  4CKB A;  3H6M A;  3V2T A;  2KCC A;  1B44 D;  1BCP F;  1EU4 A;  3P1H A;  4ZKC B;  3MVV A;  4DA2 A;  3PMF A;  1PLF A;  1VF5 C;  4FYD A;  3MC0 B;  5KRU A;  1EOT A;  1ESF A;  1NCV A;  5KYL A;  2IX1 A;  1Y1W B;  3C2P A;  5EKI A;  4ULL A;  2JEB I;  1U4M A;  5FO7 B;  1WTQ A;  2PYK A;  1O7Y A;  5IOD A;  3BYY B;  2A6H D;  2K33 A;  4RGN A;  2A6H C;  1OXX K;  1SNO A;  2QEJ C;  1H9M A;  1MD2 D;  1TWG B;  2B2T C;  4H13 C;  4OGQ C;  1PRT B;  5JEA J;  3X3N A;  2RBM A;  3GTJ B;  2QIL A;  3OIP A;  1EY6 A;  2B2U C;  5KGU A;  4FF4 A;  3NTK A;  3L7Z C;  2F0N A;  5I9P A;  2FMM A;  1K8M A;  4XYQ A;  2L12 A;  1EZ8 A;  1CI3 M;  1TS2 A;  3SEB A;  5ISR A;  1F9S A;  1RD9 D;  2OT2 A;  3SK4 A;  1KAB A;  1RHP A;  2B2W C;  2DNC A;  3FEW X;  3KLS A;  5K36 H;  5M9O A;  1S5F D;  4B9X A;  3GQB A;  4CGY B;  4TSS A;  1IKL A;  2RA4 A;  1OXU A;  2NN6 H;  1GOZ A;  1ICW A;  4M1U B;  3M7G A;  3C1E A;  3DEO A;  5EPL A;  5CV7 A;  4PQX A;  3NQT A;  5C6A A;  2BDN A;  2L1B A;  1EEI D;  1QNU A;  4DAV A;  4RCN A;  1Y8O B;  2F0L A;  1G2T A;  1JOR A;  2A74 C;  4CJ2 C;  1PRT F;  2OXP A;  1O7Z A;  3IFD A;  1WTX A;  5FK9 C;  3IAY A;  2B2V C;  5JAV A;  1F2Y A;  2MJ8 A;  1PZK D;  3K5N A;  3D6C A;  1F9P A;  2WV6 D;  2OEO A;  5D65 A;  2H4O A;  3P7J A;  5FO9 B;  1TT2 A;  4DK1 A;  1JE4 A;  1G91 A;  1GHK A;  1BCP C;  2WKD A;  2X6G A;  1CHP D;  5K5P A;  2AQ1 B;  3NPP A;  3LNN A;  2K01 A;  1STY A;  4ZRZ A;  4XIG S;  3H0G B;  3SHL A;  2F0K A;  1Q1E A;  3NXW A;  1TWC B;  2E76 C;  1QWY A;  4NMZ A;  1G6Z A;  2XWJ B;  1VMP A;  2PZT A;  2WII B;  3TZU A;  2JA6 B;  4JBW A;  1DON A;  4FO2 A;  3DMU A;  1AEX A;  2AUK A;  3OWF A;  3L3O C;  2DY8 A;  1CHQ D;  4XDX A;  2JEA I;  2NUC A;  1BBX C;  3H94 A;  3WDN A;  5LL6 S;  5JPM C;  1ML0 D;  3K7A B;  1TVX A;  4RAU C;  3GO5 A;  1K8O A;  4QUC A;  5CGK A;  2R7Z B;  1WD0 A;  1KNA A;  3GTM B;  3ONA B;  2EY2 A;  3D3R A;  1SE3 A;  2JXM B;  3BG3 A;  2C9O A;  3PUY A;  3TDQ A;  4PV1 C;  2SEB D;  4X3U A;  2PW7 A;  1LTS D;  3K0Y A;  5K36 G;  2HCC A;  3I70 A;  2MHV A;  5A2Q L;  5IGB A;  4CJ1 B;  4QF4 A;  4H0L C;  3TP6 A;  4HSP A;  3HP3 A;  3SDZ A;  5I6W A;  1PFM A;  5CYU A;  3I91 A;  2F0U A;  3G7L A;  4DAP A;  4MHE A;  1HFG A;  2AUJ D;  1RCV D;  4R9W A;  3BVM A;  1XYI A;  1ZYR D;  1EYD A;  1KLU D;  3TN2 A;  2K7V A;  4FF2 A;  1LTB D;  3K5L A;  4G57 A;  5I2X A;  2JSO A;  3VA5 A;  2XRS D;  1BXT A;  3FPU B;  1O78 A;  2WP8 J;  1MBY A;  3S9W A;  5BN4 A;  1OXS C;  5EJW A;  2F0S A;  1IYV A;  5ELF A;  4BY7 B;  3ND9 A;  5LHY 1;  3J7A V;  4OO1 I;  4QMG A;  2KEE A;  3I8Z A;  1CM9 A;  1JOO A;  4K6D A;  4KTA A;  1SYG A;  3D4R A;  2F03 A;  1BDO A;  4K14 A;  1UEA B;  4FVM A;  1I4P A;  1YNJ C;  2A6E C;  5C0X I;  4B9W A;  1PZI D;  1STH A;  1SMY D;  4DXG A;  1HRJ A;  1JIC A;  3OMC A;  2RVL A;  4DXF A;  2MPM A;  5IT9 L;  2VUM B;  4LK1 C;  4OHJ A;  4EQN A;  3OW7 A;  4XQN A;  2EXZ A;  4CHT B;  1SNC A;  1HA5 A;  1Q8I A;  4ZYS A;  1SE2 A;  2AWO A;  5T1G A;  3ZYY X;  1SYB A;  2K5D A;  1Q1B A;  3OHX C;  5I6Y A;  4K8I A;  2E74 C;  2EJF C;  4HED A;  3A8J E;  4H44 C;  2RDF A;  3HOV B;  1WD1 A;  1KDC A;  1D6E C;  3OPO A;  2K04 A;  4C3H B;  2RKS A;  5CBA E;  5BN5 A;  4A3E B;  5C3W A;  3HRZ C;  4ILW A;  1LT6 D;  1RF2 D;  4ZUI A;  5D3I B;  1CQV A;  1EZ6 A;  2NBF A;  4XYO A;  2ZXR A;  2M00 A;  5FLX E;  4KJO A;  3L9A X;  4RKL A;  4G4K A;  2EE1 A;  5DAU A;  4C3H G;  1L0Y B;  3S1Q B;  3J80 L;  4G7O C;  4WRD A;  1CA6 A;  1YNN D;  2DNE A;  2NWG A;  2H1E A;  1JWS D;  4RGO S;  3K57 A;  5JVH 3;  2EPB A;  3C46 A;  1E2V A;  3HOU B;  1WCM B;  2Z4I A;  5E4X A;  2KEC A;  1BNZ A;  4C3I G;  3NBI A;  1TS4 A;  3SXH A;  3VR6 A;  3T4A C;  1WTV A;  2K03 A;  3MXN A;  1EYC A;  2JA8 B;  1JWU D;  3UI2 A;  2K28 A;  1K83 B;  2Z4H A;  4J1M A;  1U4P A;  1IW7 C;  3VR5 A;  4J8Q A;  3JAM L;  1ENC A;  1TWH B;  4IUT A;  3RLF A;  4IFD J;  3K5O A;  4RH6 A;  3E5S A;  1Z7T A;  2B2Y C;  1AZQ A;  3SK5 A;  4I7Z C;  2K5Q A;  4BA2 I;  2ICE C;  1TS3 A;  2QF7 A;  4E6I A;  3GV6 A;  3S16 B;  1ENA A;  3LWU A;  3SK6 A;  2NTT A;  4UDU C;  3K58 A;  2L55 A;  3OIQ A;  3MFG A;  4A93 B;  2NZ1 D;  5EQ0 A;  5JOB A;  1IKM A;  1AW7 A;  3NSW A;  3F2U A;  1D5M C;  3QB3 A;  2R92 B;  3J7A F;  3ITP A;  5G3L F;  4KJN A;  1T5E A;  3WOE A;  3LX0 A;  4XTC S;  3GD7 A;  4H7B A;  4ZK9 B;  2FIN B;  4QIW B;  5FOB B;  2D5D A;  2NYZ D;  3R2T A;  1WTR A;  2EVB A;  1U9R A;  5J1Z A;  3PUW A;  1SYF A;  3HOX B;  2CW0 D;  2KUM A;  1E0B A;  2NVX B;  1Z6H A;  5EKL A;  1FD7 D;  2A69 C;  3AU7 A;  4XT1 B;  2M9V A;  3J7Y W;  1EY5 A;  5COY A;  3Q0A A;  5LL6 X;  4RFB A;  4ZKB B;  4RKB A;  3KBX A;  1SNM A;  1I6H B;  3ERO A;  4X3S A;  1MSG A;  1IHZ A;  4KY7 A;  1DOM A;  1EIG A;  1TWF B;  2NN6 G;  2RSO A;  1F9R A;  2LFN A;  3DHQ A;  1DOK A;  1YNN C;  2B2U A;  4V19 0;  3VYU A;  1FNV A;  1Q12 A;  5ELB A;  1C4Q A;  1STB A;  1BCP D;  2XNA C;  3FDT A;  5IOC A;  4N9P A;  2LMC B;  4RHS A;  1WTO A;  3DWA A;  1PXU A;  2F0T A;  1H9S A;  4DK0 A;  4KD3 A;  1EWH A;  2RDH A;  3URY A;  5KNB A;  4FF3 A;  5IGE A;  1TWA B;  4BY1 B;  5C4X B;  1Z47 A;  4OIK A;  3A7L A;  5CV4 A;  4CBV A;  2ZXO A;  4A3J B;  4EQO A;  2AWN A;  4KN4 C;  3ERQ A;  5CV6 A;  5NUC A;  4BA1 I;  3J81 L;  4QB4 A;  3GTO B;  1F77 A;  3NHH A;  2C5C A;  2A73 B;  1BOS A;  2XWB B;  1M8A A;  1PRT D;  4FXD A;  3DWQ A;  1ZXT A;  5C0X J;  2E2D C;  5AFW A;  3LWE A;  5IGC A;  2JE6 I;  4KKT A;  3HS0 C;  2IX0 A;  3VYR A;  3J80 E;  2KJX A;  4O1N A;  1S4Z A;  3FRP B;  1JC7 A;  1RKN A;  2MUY A;  1TS5 A;  2PZU A;  1W6K A;  1C48 A;  3CRL C;  1QNK A;  2L4N A;  2BDO A;  4C1N I;  5HUR A;  5C4J B;  1EFI D;  4GZY C;  4O42 A;  1TY2 A;  2PZW A;  3GTG B;  3HGB A;  2B2Y A;  1B2T A;  2L11 A;  2F0O A;  4FP5 D;  1HQM C;  1F2Z A;  3A7A B;  4A3D B;  4DF7 A;  4IZ8 A;  4XT3 B;  3FVQ A;  4X3T A;  2OF1 A;  2O5J C;  1KDB A;  4UAI A;  2G9H D;  1Y8N B;  1Q90 A;  3OSO A;  4FNF A;  1PFN A;  2R6G A;  4DGZ A;  2ZT9 C;  5ELD A;  3S17 B;  3SR1 A;  2EYM A;  5IT9 E;  2NB0 A;  3RD4 A;  1GHJ A;  1HUN A;  4KI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...