4WFNE

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22 in complex with erythromycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
171
Chain Sequence
GKQPIAVPSGVTVNAQDGVFKVKGPKGELTVPYNTELTVRQDGDQLLVERPSDAQKHRALHGLTRTLVANAVKGVSDGYTINLELRGVGFRAKLTGKALEMNIGYSHPVIIEPPAGVTFAVPEPTRIDVSGIDKQLVGQVAANVRKVRKPDAYHGKGVRFVGEQIALKAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 4wfnE02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 4wfnE01
1RL6A 3PIPE 1VQ4E 1N8RG 1S72E 1KQSE 1M1KG 1M90G 1YJ9E 3OW2E 5GAGG 1VQ6E 3PIOE 5DM6E 5H1SI 3G71E 4IO9E 1VQPE 3CCRE 1K8AG 4UY8G 1YIJE 4WF9E 5MLCH 1VQNE 3CD6E 1W2BE 1Q7YG 2QEXE 4U67E 3CPWE 1Q86G 3DLLE 1VQ7E 3CCME 1QVFE 3CC7E 4WFBE 1VQOE 1YHQE 5JVHE 4IOCE 1YITE 5HL7E 3CCLE 3CCSE 3CMAE 2OTLE 3G4SE 4WFNE 5AN9B 3CCQE 1KD1G 1VQKE 4IOAE 5GAEG 1VQME 3CC2E 1VQ8E 1YI2E 1VQ9E 3I56E 1NJIG 2OTJE 1JJ2E 3CCEE 1YJWE 5GADG 3J7ZG 1QVGE 5GAHG 5DM7E 1YJNE 2CQLA 1VQ5E 3G6EE 3CCVE 3CMEE 2ZJPE 3CCUE 1KC8G 1K9MG 3CXCE 3I55E 2ZJQE 1Q82G 1VQLE 2QA4E 4WFAE 2ZJRE 3CCJE 1Q81G 3CC4E 1K73G 5JVGE 3CF5E 4WCEE
chains in the Genus database with same CATH superfamily
2OY7A 2I5VO 1RL6A 3PIPE 1VQ4E 1N8RG 1S72E 1KQSE 3CKFA 2PI3O 1M1KG 1M90G 3IGEA 1YJ9E 3OW2E 5GAGG 1VQ6E 2OL6O 5H1SI 5DM6E 3PIOE 3G71E 4IO9E 1VQPE 3CCRE 3AUMO 1K8AG 4UY8G 5B2AO 1YIJE 4WF9E 5MLCH 1VQNE 1OSPO 2FKGA 3CD6E 1W2BE 1Q7YG 2QEXE 4U67E 3CPWE 1Q86G 3DLLE 1VQ7E 3CCME 1QVFE 5B10O 3CC7E 4WFBE 1VQOE 1YHQE 2OYBO 5JVHE 4IOCE 1YITE 2OY1O 5HL7E 3CCLE 3CCSE 3CMAE 2OTLE 3G4SE 4WFNE 5AN9B 3CCQE 1KD1G 1VQKE 4IOAE 2I5ZO 2G8CO 1P4PA 5GAEG 1VQME 3CC2E 1VQ8E 2AF5A 1YI2E 1VQ9E 5B11O 3CKGA 3I56E 1NJIG 2OTJE 1JJ2E 3CCEE 1YJWE 5GADG 3J7ZG 2HKDA 1QVGE 5GAHG 2FKJA 5DM7E 1YJNE 2CQLA 1VQ5E 3G6EE 3CCVE 3CMEE 2ZJPE 3CCUE 1KC8G 1K9MG 1RJLC 3CXCE 3EC5A 3IG9A 2OY5O 3I55E 2ZJQE 2OL7A 1Q82G 1VQLE 2QA4E 2OY8A 4WFAE 2ZJRE 3CCJE 1FJ1E 1Q81G 3CC4E 1K73G 5JVGE 3CF5E 4WCEE 5B3MO 2OL8O
chains in the Genus database with same CATH topology
1RL6A 3PIPE 1VQ4E 1N8RG 1S72E 1KQSE 1M1KG 1M90G 1YJ9E 3OW2E 5GAGG 1VQ6E 3PIOE 5DM6E 5H1SI 3G71E 4IO9E 1VQPE 3CCRE 1K8AG 4UY8G 1YIJE 4WF9E 5MLCH 1VQNE 3CD6E 1W2BE 1Q7YG 2QEXE 4U67E 3CPWE 1Q86G 3DLLE 1VQ7E 3CCME 1QVFE 3CC7E 4WFBE 1VQOE 1YHQE 5JVHE 4IOCE 1YITE 5HL7E 3CCLE 3CCSE 3CMAE 2OTLE 3G4SE 4WFNE 5AN9B 3CCQE 1KD1G 1VQKE 4IOAE 5GAEG 1VQME 3CC2E 1VQ8E 1YI2E 1VQ9E 3I56E 1NJIG 2OTJE 1JJ2E 3CCEE 1YJWE 5GADG 3J7ZG 1QVGE 5GAHG 5DM7E 1YJNE 2CQLA 1VQ5E 3G6EE 3CCVE 3CMEE 2ZJPE 3CCUE 1KC8G 1K9MG 3CXCE 3I55E 2ZJQE 1Q82G 1VQLE 2QA4E 4WFAE 2ZJRE 3CCJE 1Q81G 3CC4E 1K73G 5JVGE 3CF5E 4WCEE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RL6 A;  3PIP E;  1VQ4 E;  1N8R G;  1S72 E;  1KQS E;  1M1K G;  1M90 G;  1YJ9 E;  3OW2 E;  5GAG G;  1VQ6 E;  3PIO E;  5DM6 E;  5H1S I;  3G71 E;  4IO9 E;  1VQP E;  3CCR E;  1K8A G;  4UY8 G;  1YIJ E;  4WF9 E;  5MLC H;  1VQN E;  3CD6 E;  1W2B E;  1Q7Y G;  2QEX E;  4U67 E;  3CPW E;  1Q86 G;  3DLL E;  1VQ7 E;  3CCM E;  1QVF E;  3CC7 E;  4WFB E;  1VQO E;  1YHQ E;  5JVH E;  4IOC E;  1YIT E;  5HL7 E;  3CCL E;  3CCS E;  3CMA E;  2OTL E;  3G4S E;  4WFN E;  5AN9 B;  3CCQ E;  1KD1 G;  1VQK E;  4IOA E;  5GAE G;  1VQM E;  3CC2 E;  1VQ8 E;  1YI2 E;  1VQ9 E;  3I56 E;  1NJI G;  2OTJ E;  1JJ2 E;  3CCE E;  1YJW E;  5GAD G;  3J7Z G;  1QVG E;  5GAH G;  5DM7 E;  1YJN E;  2CQL A;  1VQ5 E;  3G6E E;  3CCV E;  3CME E;  2ZJP E;  3CCU E;  1KC8 G;  1K9M G;  3CXC E;  3I55 E;  2ZJQ E;  1Q82 G;  1VQL E;  2QA4 E;  4WFA E;  2ZJR E;  3CCJ E;  1Q81 G;  3CC4 E;  1K73 G;  5JVG E;  3CF5 E;  4WCE E; 
#chains in the Genus database with same CATH topology
 2OY7 A;  2I5V O;  1RL6 A;  3PIP E;  1VQ4 E;  1N8R G;  1S72 E;  1KQS E;  3CKF A;  2PI3 O;  1M1K G;  1M90 G;  3IGE A;  1YJ9 E;  3OW2 E;  5GAG G;  1VQ6 E;  2OL6 O;  5H1S I;  5DM6 E;  3PIO E;  3G71 E;  4IO9 E;  1VQP E;  3CCR E;  3AUM O;  1K8A G;  4UY8 G;  5B2A O;  1YIJ E;  4WF9 E;  5MLC H;  1VQN E;  1OSP O;  2FKG A;  3CD6 E;  1W2B E;  1Q7Y G;  2QEX E;  4U67 E;  3CPW E;  1Q86 G;  3DLL E;  1VQ7 E;  3CCM E;  1QVF E;  5B10 O;  3CC7 E;  4WFB E;  1VQO E;  1YHQ E;  2OYB O;  5JVH E;  4IOC E;  1YIT E;  2OY1 O;  5HL7 E;  3CCL E;  3CCS E;  3CMA E;  2OTL E;  3G4S E;  4WFN E;  5AN9 B;  3CCQ E;  1KD1 G;  1VQK E;  4IOA E;  2I5Z O;  2G8C O;  1P4P A;  5GAE G;  1VQM E;  3CC2 E;  1VQ8 E;  2AF5 A;  1YI2 E;  1VQ9 E;  5B11 O;  3CKG A;  3I56 E;  1NJI G;  2OTJ E;  1JJ2 E;  3CCE E;  1YJW E;  5GAD G;  3J7Z G;  2HKD A;  1QVG E;  5GAH G;  2FKJ A;  5DM7 E;  1YJN E;  2CQL A;  1VQ5 E;  3G6E E;  3CCV E;  3CME E;  2ZJP E;  3CCU E;  1KC8 G;  1K9M G;  1RJL C;  3CXC E;  3EC5 A;  3IG9 A;  2OY5 O;  3I55 E;  2ZJQ E;  2OL7 A;  1Q82 G;  1VQL E;  2QA4 E;  2OY8 A;  4WFA E;  2ZJR E;  3CCJ E;  1FJ1 E;  1Q81 G;  3CC4 E;  1K73 G;  5JVG E;  3CF5 E;  4WCE E;  5B3M O;  2OL8 O; 
#chains in the Genus database with same CATH homology
 1RL6 A;  3PIP E;  1VQ4 E;  1N8R G;  1S72 E;  1KQS E;  1M1K G;  1M90 G;  1YJ9 E;  3OW2 E;  5GAG G;  1VQ6 E;  3PIO E;  5DM6 E;  5H1S I;  3G71 E;  4IO9 E;  1VQP E;  3CCR E;  1K8A G;  4UY8 G;  1YIJ E;  4WF9 E;  5MLC H;  1VQN E;  3CD6 E;  1W2B E;  1Q7Y G;  2QEX E;  4U67 E;  3CPW E;  1Q86 G;  3DLL E;  1VQ7 E;  3CCM E;  1QVF E;  3CC7 E;  4WFB E;  1VQO E;  1YHQ E;  5JVH E;  4IOC E;  1YIT E;  5HL7 E;  3CCL E;  3CCS E;  3CMA E;  2OTL E;  3G4S E;  4WFN E;  5AN9 B;  3CCQ E;  1KD1 G;  1VQK E;  4IOA E;  5GAE G;  1VQM E;  3CC2 E;  1VQ8 E;  1YI2 E;  1VQ9 E;  3I56 E;  1NJI G;  2OTJ E;  1JJ2 E;  3CCE E;  1YJW E;  5GAD G;  3J7Z G;  1QVG E;  5GAH G;  5DM7 E;  1YJN E;  2CQL A;  1VQ5 E;  3G6E E;  3CCV E;  3CME E;  2ZJP E;  3CCU E;  1KC8 G;  1K9M G;  3CXC E;  3I55 E;  2ZJQ E;  1Q82 G;  1VQL E;  2QA4 E;  4WFA E;  2ZJR E;  3CCJ E;  1Q81 G;  3CC4 E;  1K73 G;  5JVG E;  3CF5 E;  4WCE E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...