4WFNL

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22 in complex with erythromycin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wfnL01
3CPWM 1N8RO 1KD1O 4WFBL 1Q86O 1VQ9N 2QA4N 1VQ6N 3CF5L 3CMAN 1K73O 5HL7L 3CCUN 1OVYA 4WFAL 3CD6N 3G6EN 1KC8O 1S72N 1VQON 5DM6L 4IOAL 5GAHP 1VQ4N 2OTLN 3PIPL 1VQMN 4WFNL 3CCEN 4U67L 5GAGP 3CC2N 1VQNN 1VQKN 5H1SQ 1QVGM 3CCSN 1YJ9N 1VQLN 1Q81O 2ZJRL 1YJWN 1K8AO 4IOCL 1M90O 1JJ2M 3OW2M 2OTJN 3CCRN 1Q7YO 4WCEL 5MLCQ 3CCMN 3CCLN 1VQPN 3CCVN 2ZJQL 3CCQN 5JVHL 1KQSM 3CXCM 1W2BM 1Q82O 1NJIO 4IO9L 1YHQN 1VQ7N 1ILYA 2QEXN 3PIOL 1YIJN 5JVGL 3I56N 3CMEN 3I55N 3CCJN 3CC7N 5GAEP 3CC4N 4WF9L 3DLLL 1QVFM 1YITN 3G71N 1YJNN 1M1KO 2ZJPL 4UY8O 1K9MO 3J7ZO 1VQ5N 1VQ8N 1YI2N 3G4SN 5GADP 5DM7L
chains in the Genus database with same CATH superfamily
3CJBA 3VETA 1XWLA 3J8AA 3QFUA 5FDLA 3PY8A 1N36K 1JCGA 5FRMA 1VQ6N 4JI7K 2PY5A 3HPOA 2RE2A 3W3DA 5BR9A 1T8EA 3RWUA 4KHWA 3OS0A 4L8RB 4DU4A 1OVYA 2P9IA 3VTHA 1J5OA 3OBYA 1KFDA 1JLFA 3M3ZA 2P5GA 2UUBK 1TL3A 4IOAL 3TSQA 4AHCA 3OYFA 4ZTFA 3AAPA 1HNWK 1T7PA 3WXJA 2HF3A 3M8SA 4JKFA 2HB5A 4PHTX 2HNZA 2HHSA 3HSTB 3LWMA 1YAGA 1OH6A 2P9PA 4GV9A 3V9XA 1TYQA 2NRRA 1SKRA 4H0YB 4KHPK 3MECA 3VGMA 3GL1A 1JLGA 4B8AB 2KZMA 2F96A 2ZF5O 1ZBSA 3VTIA 3WXLA 2O8BB 1TL1A 3AGRA 1R0AA 3CCLN 2IGIA 4OGEA 4ZHRA 4JD2A 3F73A 2YI1A 3D2FA 1KAZA 4DQRA 4B9TA 3I0SA 3V1RA 5JLHA 3SUNA 4HCBA 3JYTA 3NDKA 4W5TA 3FZLA 4E1MA 4JV5K 1RILA 1YTAA 3KLGA 3SUPA 5CYQA 1VQ7N 4LF8K 2BDPA 3NF7A 4AQYK 4CZKA 3CQYA 4ISFA 2GEMA 4J2EA 1IBLK 3VENA 1GOAA 2ZGYA 2HMPA 4KO0A 5AFUH 1M1KO 3ZSZA 3LP0A 3S9HA 3I8BA 2ITGA 4AM6A 1JLQA 3LWLA 3L3UA 4DR2K 4NXMK 5F0XA 2QM1A 3AVKA 5KI6A 1QQCA 1N8RO 3AO3A 3BDPA 2FBYA 2PYLA 4JK9A 2KKZA 2PAVA 3L2UA 3MX2A 4N56A 4WQ5C 3CHWA 2NLXA 4FOIA 4CBWA 3CMAN 3AY9A 1A5XA 2I7PA 4WFAL 2JGUA 1WN7A 1YXQA 3A8YA 1SKSA 1S72N 1J9AA 4CD3A 1J5EK 1P90A 3C65A 3D6RA 3BF1A 3U3YA 3QNNA 2R7YA 4M42A 1GLJO 1KVBA 2A1RA 2KZZA 1RBRA 3D2FB 4FWKA 4DR4K 3KVGA 1TUYA 3LALA 4ELVA 4EAHD 3FFIA 3HO1A 3SI6A 1RT7A 1XC3A 4E7HA 1TVRA 2PZSA 4LF9K 5C42A 2D0OA 1YUWA 1IKYA 1J6ZA 2XHBA 4BDYA 4DTMA 4C8OA 1XQSC 1EETA 2GELA 2O8CB 4H5VA 2NRHA 2UXBK 2G8FA 5AJ3K 1JL1A 4IJNA 2VQEK 1WBBA 4B08A 3UKUB 1O13A 4CW7B 1XHZA 2E2OA 1ZXOA 3K57A 4JHDA 3KK3A 1YHQN 2YKNA 3MEGA 1C0GA 1YVUA 3VQAA 3TR8A 5JS2A 3F9MA 3ID8A 4CF8A 4DQQA 1HNXK 3WXIA 3J81O 3AAQA 4FLTA 3AO2A 2OPRA 4ILGB 3CCJN 3DXKB 4CJEA 3OJUA 3QB0A 3OYIA 4OGCA 5K14A 4DFPA 2WFBA 3SPYA 5FPMA 2ZGZA 2HHUA 4OKJA 4DHYA 3AVBA 3SQ2A 5E41A 1JLAA 2FBXA 3NF9A 4XH4A 4DSIA 3FZMA 3WXKA 1KD1O 1NMDA 1Z6RA 3KWIA 1WSGA 1RTJA 1K8KA 5LMNK 2DPNA 3E9PA 5KGXA 1U6ZA 2VGNA 3OYDA 5I3UA 2P1JA 4B1WB 3D2EA 4CEOA 4LFBK 3O4WA 1FW6A 4BR0A 3SJHA 1TK0A 4FJMA 4I7FA 5F2RA 2P9LA 4JKCA 1VQ4N 5HRNA 5AQVA 4DFKA 1J53A 3DAWA 4ISEA 4NLCA 1NNEA 3CCEN 2DFEA 3WXMB 3MX5A 1S1XA 1TGOA 3QEWA 1U2VB 2IVNA 4FM0A 1RT1A 2HMIA 1SV5A 4MLEA 4KKOA 4FLUA 4N47A 2P9PB 4CIGA 5BREA 4U7BA 3QLHA 4X62K 4DTRA 1FJGK 5AQRA 1E3MA 1KVCA 1RTDA 1RFQA 4C8KA 4FM1A 3OYJA 5MLCQ 1JLEA 2E6MA 1OVQA 3DXKA 4I9LA 3PSIA 1WSHA 3P4IA 4BC4A 3OBWA 1TK5A 4B9SA 3RR8A 1T6DA 3V4IA 1ZC6A 3A5OC 3DXMB 3LP3A 1UWBA 2OCEA 3FFKB 1U4BA 1TKDA 1VSKA 3NGYA 5BRHA 4CHPA 2WOMA 2VG5A 5KGWA 1NK6A 5HBMA 3VQ9A 2YNGA 2AA4A 4LSLA 3ZSXA 3NHGA 2A6AA 4PQUA 3I55N 3P31A 3HRGA 4FVMA 4DV3K 3KZBA 1J54A 4IFYA 2X78A 1K8KB 3QICA 1WSFA 5FLXO 5KPRA 2ZQBA 4AHTA 4FPBA 1REVA 1LV5A 3TAPA 2IS3A 4A5BA 3G4SN 2A3ZA 4Z4EA 4FLVA 2YHAA 4O5BA 3UIQA 3U9ZA 3THYA 4F3OA 4DR5K 1OH7A 1YTUA 1KFSA 3TAGA 3H3OB 4QOZB 4OPKA 4B3MK 1V4SA 1NGDA 5J2MA 4CF1A 1NK0A 4QCLA 2IVOA 3ZCMA 2XY8A 4DCHA 3MXIA 3P5JA 5CE3A 3DI6A 4FJ5A 3O4NA 2IOCA 2GWKA 3H08A 5AQPA 4OPJA 1IKWA 1T03A 2CGJA 3VQ8A 5HLFA 3OYBA 1QQOA 3KK7A 4MFBA 4FZXC 3FZHA 3HTVA 4JI6K 4JHDB 4JKEA 1JLCA 4CJTA 3H46O 5BPLA 4CJSA 4M3UA 4WQ4C 3ATVA 1NMNA 4C1NI 3DLEA 3U3GA 3H45C 3TANA 4JD2B 1KAXA 3BUZB 4CK3A 1ZBHA 1TYQB 1Y64A 4WE1A 4DR3K 3GBTA 3VQEA 2QXLA 3O80A 4A2AA 4YNQA 5DK5A 3EE8A 5JVHL 4KHNA 5AQKA 5KPZA 5M1FA 3R6MA 1W9HA 4M3WA 3LM2A 1Z05A 5ADXA 3RMAA 2Q97A 4XEIA 4QS7A 4IWVA 2YHYA 3VQ4A 3DLRA 4RW4A 4CHZA 4AHRA 3E66A 1SKWA 3ZLJA 1MDUB 4FK4A 4B3TK 3ITHA 3SJJA 1B9DA 3EN9A 3TI0A 4UQGA 4KI6A 5BRFA 4K8ZA 2P9KA 3ENHA 1KTQA 3M6GA 4H4OA 3K0SA 2VQFK 5GADP 3AVLA 3RSEA 4CIEA 1RNHA 3RSEB 2AJQA 3MWTA 3GE1A 3GG4A 4X64K 5AZJB 2BANA 1K73O 3LDPA 2D5RA 4O5FA 2OPPA 3O1BA 4A5AA 4KTQA 3V1OA 3CD6N 2FLOA 1U49A 3ZX0A 4CERA 4JKBA 3ALYA 4Q5VA 5CZ1A 3LDQA 4IEEA 1QHTA 1VQMN 4NB4A 2YNIA 1UOCA 3KD1E 4JN4A 1L3VA 3L8BA 2EHGA 1LAWA 4DF4A 3E01A 1T44A 2P9SA 1HNVA 1NGAA 4KAZA 3CCSN 1N34K 4BRPA 3UKRB 1Q81O 1BCOA 1HKGA 4BC5A 5EVZA 1L3TA 4ELTA 3EO3A 3MCAB 5AQOA 4X65K 3SYZA 4M3XA 4FW2A 5KRSA 1GLAG 3BZCA 3V81A 3CCRN 5FPEA 3VA3A 2O8FA 4BRFA 2HHTA 3CERA 4H0VB 1FK9A 3CG7A 1D9DA 1RGIA 4B8CA 1BI4A 4E7KA 3DLGA 3MEEA 4YOXA 3L2WA 4AHVA 4DMNA 4C1NK 2VWJA 4KB0A 1OKJA 5AQWA 5CY4A 2UU9K 3K9JA 3DYAA 4CBXA 3TABA 5C10A 4JRQA 3RMCA 3VQCA 4IJAA 4MQ3A 2OANA 2HBKA 3SMPA 1XUPO 2HBJA 4CIFA 3K5OA 3VQ5A 2CH5A 5C12A 1YVNA 2F8SA 3GOIA 3J7YP 4B9MA 2YHBA 3VF2A 1NGHA 4B9UA 2YV0X 4G9ZA 1A5WA 3K5LA 4CEQA 2YKMA 1HYZA 1TAUA 4W5NA 1C1BA 4IFEA 2UYTA 2E2PA 4WFBL 4DTOA 1LCUA 1VQ9N 5HOOA 3K58A 4KI4A 4DG1A 3VQPA 3OYEA 3SZ2A 3TU5A 4DLEA 4BY9C 4AHSA 4W5OA 2O8DA 1A5VA 4CHQA 3DMJA 4IDKA 3Q7CA 3HYFA 5GINA 1T6CA 2P9NB 5GAHP 4BDPA 3OS1A 2NRXA 3V9SA 1S1WA 4U67L 3RMDA 4CGDA 2E1YA 3LPTA 5AQQA 3I33A 4BRQA 5EY4A 1X1PA 3FZKA 3OHRA 4BGAA 4J2AA 5DMRA 4EHUA 1VSLA 3VOVA 3IDHA 5C0YA 3HZ6A 2KHOA 5SZTA 4E7LA 2GUIA 4YORA 1HJOA 1RDCA 5CR4A 4M63C 5C25A 2XY7A 3AVAA 1W0HA 5I9EB 1Q7YO 1N33K 3QIOA 1Z26A 4OVLA 3LM9A 4BRNA 2KW4A 4KTWA 3PX4A 4EIAA 1WLJA 1RT2A 4IZ9A 5TKYA 3EY1A 5D3GA 3G10A 3E1YA 3ZSOA 3O08A 3KIOA 5T7BA 3VEZA 5HRPA 1I3AA 3PIOL 3R8EA 4CZEA 2YNFA 4GV3A 3HVRA 5J2NA 4DKWA 4MO5A 3O5BA 4WQ4A 3LL3A 2A42A 2DFHA 1K9MO 3SPZA 4XIUA 1WAJA 3CETA 4E19A 2E88A 1HKCA 1ASUA 4PA1A 3QERA 2RKIA 3GDQA 1XMOK 4B1VA 4OLBA 4TSXA 4XH5A 2XRIA 2QA4N 4O44A 1LAVA 1TUUA 1XC9A 3CCUN 2P5OA 5J1EA 4YFUA 3G6EN 2CGKA 1TKZA 1L5UA 3ZX2A 4DQPA 2QWLA 2NZTA 2KLAA 1HYSA 4KH5A 2HHWA 4JKDA 3P39A 1NGCA 1EXQA 3QIPA 3AVMA 4CZHA 1OH5A 4DSLA 1NWKA 4Z0UA 3LAKA 1G99A 3L2VA 3UKUA 3RVCA 1VQLN 1E4GT 3SLCA 3FLCO 4DV2K 3THXA 4DV1K 4CF9A 1TK8A 3A5NC 3OW2M 1NK7A 2A1SA 3J7AP 4LF7K 3O9QA 3KD5E 2UUCK 1VQPN 1QTMA 2BH1A 4JEPA 3AO5A 2GWJA 3KHYA 1KQSM 4CEDA 2VCPA 3NCIA 1Q82O 2FXUA 3BGRA 1GOBA 3WEEB 3KLEA 3PV8A 3LZIA 1S9GA 1X9MA 2VWBA 1BA1A 1NGBA 5AQZA 5AQJA 2I7NA 1QZ6A 1WUAA 4YOUA 2RPIA 1QHAA 4JI4K 3DJCA 5HRRA 2P9SB 2HSTA 3KK2A 3KWGA 1IG8A 3QBWA 3VPZA 1QSYA 4AF1A 2ZJPL 3MWPA 3TTCA 4WQ5A 3O9UA 1CXQA 2PYJA 1X9WA 2QXFA 3NVMA 4IG3A 3DLHA 3U4LA 1KCFA 4CJ5A 4DV6K 3VF4A 4CESA 4EZ9A 1X9SA 4BVPA 1S1VA 2HHQA 1ZBUA 4BQZA 3ZT1A 3THWB 1B92A 4BWMA 3DRPA 1RDBA 1Q9XA 4DB3A 4G1QA 1NKCA 2J4RA 1S1TA 2VG6A 3CF5L 1SAZA 4LFCK 3NH2A 1BIUA 3P83D 1ZBFA 4CGJA 3HPGA 3ZSWA 1NK9A 4CECA 2RHKA 5FPDA 4Z94A 1KAYA 4DWIA 1VQON 1FXXA 5KQ8A 4GKJK 4CZJA 4CJUA 3QINA 5KRTA 1C1CA 3PIPL 4ID5A 4KBOA 1HQUA 5HP1A 3CFOA 3U9DA 2PFUA 2BE2A 1F21A 4NO7A 4H4MA 4OLAA 4HUGA 2O8EB 2QWMA 4NCAA 3VGKA 1CLQA 4BDZA 2X74A 3ZSYA 4HUEA 2DTUA 4OX9K 2BTFA 1C0FA 4CJLA 3KJVA 3FZFA 4DUZK 1HRHA 1IBKK 2E4LA 1WSEA 3IS9A 5IT9O 4A2BA 4ZTJA 1Y97A 2ZJQL 4FXDA 1R59O 4H0OA 1E4FT 1ESVA 4DTJA 4F2RA 1DTTA 4ILHA 4DFMA 3DOLA 2YJEA 3AO4A 3C6UA 4F4KA 4NCGA 5LJWA 3O9TA 1W97L 2P9UB 5JVGL 3CMEN 1Q18A 1RBUA 1TKXA 3CC7N 5GAEP 3CC4N 4B1YB 3EL2A 3T19A 4CFBA 4FYDA 2B6AA 3NVKA 4CJKA 3MN7A 4CHYA 4DTNA 3CJ7A 2RN2A 2ASPA 3HSCA 4DTUA 3VQQA 4JKAA 4E3SA 3NMUA 2F4VK 2D0CA 4GNIA 4BRDA 3ID6A 2Q2RA 4M3ZA 2W6KA 1GLDG 3PUFA 1BGXT 3AVNA 4DLGA 4M41A 1IKXA 1MWKA 3ENBA 1D9FA 4JI2K 1G15A 2GUPA 4B1UB 4I2QA 3OYGA 1HNIA 4CJPA 3L0QA 3DXMA 1NOZA 4DR6K 3IFRA 4BVOA 3LDSA 2QTDA 5DM6L 2VYPA 1RCHA 4B1XB 1IJJA 3VMFB 4BG9A 4CZMA 3OJSA 1RT4A 1RTIA 1YT3A 3AVGA 4BROA 4BWJA 3A5LC 4PWDA 3RR7A 5BPMA 1DGKN 1LOTB 2IC3A 4HTUA 5AZIB 1VQKN 2QI2A 1RBVA 5AQUA 2HNYA 2YHWA 2V7ZA 4JYAK 1BIZA 2D0PA 2A40A 4C8MA 4PL7A 4BE2A 3EE9A 4Y0WA 1Q9YA 4QAGA 1QS4A 3BF3A 4WCEL 3CCMN 2IAJA 4PL8A 4N41A 1ASWA 3C7NA 3ZYYX 1NOYA 4O0JA 2OZMA 3CCQN 4FCYA 4FO0A 4NYFA 4QS8A 3C6TA 5M1PA 1W2BM 1NJIO 4K25A 5FPNA 4E1JA 4DSFA 2KQ2A 3VERA 1KLNA 3IRXA 5F1XA 2CH6A 4BRMA 4F2SA 2X6SA 1SS6A 3NBPA 4AHUA 1MA9B 2F9TA 2EX3A 4FWLA 4CEFA 2Z1HA 4Z4FA 1GOCA 3I0RA 3JXUA 4DV7K 3DLBA 2D0BA 1JCFA 4BREA 4KH4A 4CF0A 1K6YA 3SQ4A 1C6VA 1YI2N 4CVNE 3AA5X 4YDUA 4BRGA 2D0AA 3S3OA 1VSMA 5DM7L 4CJ4A 2E20A 1NG9A 1NJWA 1NGJA 3EKUA 1HNZK 3C6HA 1IV0A 1VK0A 3H6EA 1N32K 1NKEA 3MK6A 2OA8A 4DQ8A 1KRPA 5C2FA 3CJAA 3J80O 4OKKA 4HVJA 4OKEA 2H3GX 4CGHA 5AQNA 4FZZA 1GLCG 2WTUA 1HX1A 3A2FA 3ASMA 3EKSA 4YDUC 4BRKA 4IOXA 4DFJA 1LWEA 2ZM6K 4Z4GA 5JMVA 4BACA 1RBTA 5GAGP 3CC2N 2IDOA 4LF4K 1Z25A 3S3NA 4JLHA 4K41A 3QETA 2E5LK 4B1ZA 3WQUA 4RW6A 3T69A 3B6OA 2XY5A 1I39A 1LWFA 4FK2A 1M90O 4J2BA 4DQIA 3NH1A 4ILJA 3MEDA 3O1WA 1CZ9A 4NLBA 1X3MA 4CBUA 3QO9A 4DSJA 1NU0A 1NJYA 5AZIA 3LPUA 2O8CA 2VWKA 3SQ1A 3AVJA 3ZSQA 3ZX3A 3QEIA 3MN9A 3THVA 5JICA 1CZBA 4FJHA 1LW0A 4FWOA 4AH9A 1O1WA 2O8EA 1S3XA 4LH5A 4H5RA 5GIOA 3ATUA 3KKRA 5AQHA 3ULEB 1LW2A 4DTPA 1S5JA 2HW3A 3AA2A 5J2QA 3TTDA 1VSIA 3O3HA 4B9LA 4EFHA 3T1HK 1IG9A 1QVFM 4B9QA 3H3NO 3T3FA 2KFNA 3F5TA 1HYVA 2WBNA 3O3GA 1KLMA 2HBMA 1I94K 3J7ZO 3TAEA 4Z4IA 4IBNA 4PY5A 4OO1J 1DLOA 2GX9A 4HWIA 3LZJA 4LD0A 2BUPA 3CIPA 4CF2A 4CGIA 2Q31A 4RTFD 3NAEA 2FF3B 4Q0BA 4YOWA 4FSVA 4X66K 4GKKK 1NJXA 1SL0A 4E7JA 5TKWA 2QK9A 3KLIA 3WQTA 4I9QA 5BPNA 1RDUA 4DUYK 3M5RA 3T1AA 1T05A 4CGFA 4JKGA 5CZ2A 3SK3A 4ICLA 3SQ0A 1NBWA 2O4GA 3AVCA 4I6MA 1C0MA 2OYQA 3K5MA 5C24A 3HM8A 2QW9A 2P9UA 3OYHA 4HTLA 4CK2A 4FJ8A 2OTLN 4PKHA 3THYB 4H5WA 3TAMA 1BOTO 2QWNA 3S41A 2E8AA 5C2DA 3VEYA 3NH0A 4H0PA 2QWRA 2E6LA 3AVHA 4LC9B 4CD1A 1U04A 4CHNA 3SAFA 1IBMK 3C95A 3ENOA 3ZEUB 1EQYA 1UAXA 3K9KA 2OPQA 4LH4A 4H0TB 4F9OA 2WC9A 1WB9A 2A5XA 4EP5A 4CE9A 2E2NA 3AV9A 3D7EO 4H0XB 1EO1A 4RW8A 3UE5A 1XNQK 3IKMA 4YY3K 1QE1A 3CQ8A 4O8UA 3UB5A 1YF5L 4I2PA 3P38A 3SNNA 4DS4A 4B9VA 4DQSA 1JKHA 3O4QA 4RCHA 4JAXA 2QEXN 1IKVA 3O8MA 4BR2A 3PSFA 5J2PA 4CJFA 1YIJN 2IVPA 5AQLA 4F3TA 1S6QA 5KTQA 3AA4A 5EOYA 3HOTA 4WF9L 4DV4K 3T1YK 2FBVA 2KTQA 2XO7A 2E1ZA 3ISNC 4LF5K 4NCBA 4LF6K 1NGGA 3C7NB 3M8RA 4CK1A 1WAFA 4CZIA 3QDKA 4WYBA 4A59A 2UXDK 3KLFA 3MAQA 3R1XA 4CZLA 2Z1JA 3DM2A 4BG8A 3SV4A 3CM6A 1Q86O 4KHYA 1BU6O 3OA9A 4RG8A 2ATQA 1KSPA 3A0IX 4OPHA 5HL7L 3WEEA 5I42A 5C15A 4Y1CA 3WUHA 2O8DB 4H8KA 2F7TA 3AARA 2HNDA 4GVMA 1MU2A 1NK4A 1N5YA 5ADXH 3EYZA 3U8XA 1NKBA 3OVNA 4CI6A 3SMSA 4EZ6A 4FJNA 2NUBA 2V7YA 1T3VA 3F9KA 5AQSA 4AILC 2CGLA 2D4WA 1JLBA 4EP4A 2ZD1A 1QSSA 3LAMA 3HT3A 4FJXA 3EZWA 2Q36A 3QFPA 1U47A 1YJ9N 3R3LA 1DEJA 3P1GA 4O55A 2Q0RA 5FROA 2ZJRL 4BR4A 1VRTA 3V6DA 4H5TA 1SL2A 4NXNK 3THWA 3OYCA 3OYKA 1JXBA 1HJRA 3L6QA 1WBDA 4J2DA 2YHXA 2XY6A 1OH8A 2JWKA 3R9PA 3JSMA 3TSPA 4IEIA 1HPMA 3KTQA 3DRSA 1VAZA 2JWLA 1VSEA 5SWMA 3V9ZA 5KQDA 3CQXA 3ZEUA 3LP1A 3TSUA 3MXMA 3HJFA 1BA0A 2W6LA 5CYMA 4HHTA 5HRSA 1ILYA 3SUOA 1VSDA 4BC2A 3FGUA 2FC0A 4JKGB 1UA1A 3VN5A 3DLLL 1W7AA 3Q7BA 4FJGA 4IDHA 4KV8A 3ZT4A 1BHLA 1JXEA 1H1VA 1NGIA 2FBTA 3MCPA 3PLAA 2Z1GA 1BQNA 5BN9A 4IKFA 3AVFA 3TAFA 4CEBA 5M1NA 4CFDA 4QS9A 5M1QA 2YJFA 4CZFA 3V9WA 3LDOA 3EEQA 3VEOA 2QWPA 3QEXA 3LDNA 4BQLA 2D1KA 5AQFA 4JI8K 3DRRA 2UUAK 1RDWX 4DR1K 4FWPA 4K42A 3VQBA 4CJ3A 4JI0K 4GVEA 3PX6A 1IH7A 3V1QA 3HK2A 1WOQA 4O0IA 3VA0A 3IUCA 3DWLA 3M8QA 1L3SA 3O9SA 3PX0A 4JI3K 4Z4CA 4FW1A 4CGGA 4CCHA 2V51B 4R5PA 4JS4A 1GLLO 1CZAN 2P9IB 2OTJN 2X6NA 2WONA 3N4QA 2OZSA 3C6AA 1DTQA 4FJLA 2AP1A 4OPAA 4M7XA 4O4GA 1BDGA 1C0TA 3OYNA 2NNWA 5AQGA 1N6QA 3RRGA 1HQEA 3O6WA 5JS1A 3G0ZA 2YNHA 2HBLA 4BE0A 1MWMA 3QNOA 2HHHK 1BG3A 4YOYA 4JI5K 1BQMA 3WT0A 3I8DA 3G25A 3ZETB 2G8WA 3L3VA 4BR5A 3OY9A 2HVIA 3ULDA 3H1VX 5AQYA 3KK1A 3AVIA 4C8LA 4AM7A 3QESA 4KHUA 3ULEA 4IFVA 2O8BA 1TKTA 1ZYQA 2P51A 4IG0A 4RW7A 4DSKA 1YJNN 5EX5A 4JRPA 3TAQA 4Z4HA 4EHTA 3VQ6A 1RT6A 3HBTA 4JI1K 1VQ8N 4FLXA 4CZGA 3OTOK 3OS2A 2KFZA 4FWRA 1VSJA 1ATSA 1HLUA 1QQMA 5LMUK 3HL8A 1BISA 4CEAA 3BEXA 1RDAA 4M3YA 4J8FA 2G8VA 3O9RA 5E84A 3VESA 4JK7A 1TAQA 1D5AA 1S1UA 3CJ9A 1KC8O 4CJ7A 1ZBIA 2P9NA 3H1QA 3JAMO 3A5MC 4ISGA 2F8TA 3OYLA 4GMJB 1P8ZA 2FSKA 4WFNL 5BR8K 3HP9A 2O8FB 3LANA 1UA0A 4YHHK 4A57A 3OYAA 1CXUA 4E89A 4NYNA 3K2PA 1RBSA 1JL2A 1HUXA 1QVGM 2QWOA 1YJWN 3LDLA 4BE1A 1K8AO 3SUQA 3NF8A 3ZSVA 4FWSA 1Q8IA 4DV0K 4CJQA 3B8AX 5LJVA 5LL6Z 2FSNA 4FLWA 3N4PA 3C0BA 4DSEA 2DY4A 4PKGA 3M1FA 4KHSA 2GV9A 1XHXA 2ASMA 2V52B 5IWAK 1QZ5A 5AR0A 4HCCA 4LY7A 3CJCA 3NE6A 4H03B 4IO9L 4Y1DA 1WSIA 4FL9A 3TWHA 4DTSA 5FRNA 2NRWA 4K0KK 3NGIA 1HR0K 4DU1A 3ZSRA 4E1NA 4C23A 1NLVA 3DLKA 3K5NA 3VGLA 4BRLA 3VEXA 5AZJA 3RRHA 4KPYA 4KHQA 3O3FA 3V9UA 3G71N 5ELZA 2HHXA 4BR9A 4UY8O 1VSHA 2W40A 4CJWA 3BY5A 4FWMA 3PO4A 3RMBA 2IIRA 3FR0A 4IO8A 4OJRA 4B9NA 4RW9A 1VRUA 1U2VA 2OPSA 2FF6A 4CEZA 2VGMA 3ZT2A 1U48A 2B4JA 4BRHA 1EWQA 4H5NA 4MO4A 4BRIA 1NJZA 4DTXA 4RWTA 1SQKA 4C8NA 3IAYA 3L2RA 4BGBA 2O4IA 5BN8A 3CYMA 3WNEA 1ITGA 4YOVA 4HUFA 4DF8A 1WSJA 1L3UA 1GLFO 1BWFO 2I5JA 4CJVA 5KPTA 4XH1A 1EX4A 5AQIA 1GLEG 1NGFA 4A62A 4ELUA 2ZE2A 3MDQA 3IMXA 3HXMA 3M8PA 4FWQA 3AO1A 1LWCA 4GW6A 3JS6A 2W41A 5EXWA 5H1SQ 1BO5O 1B9FA 3CM5A 3L4QA 3UKRA 4A61A 3ZETA 5M1OA 3VF6A 2Z1IA 4FJ7A 2F9WA 3MMVA 4K8XA 1DKGD 3MN5A 3K59A 3RTVA 4FVUA 2VG7A 1KVAA 4BC3A 2B5JA 3IG1A 4N76A 4I6MB 5LY3A 1V4TA 5BRDA 3CFRA 2DFFA 4YOTA 3QBXA 4N5SA 3VEWA 3F2KA 3WNGA 2RF2A 2EWSA 4W5QA 2G8UA 3TTFA 3W0LA 3NGZA 1JCEA 3CXCM 4B3OA 3SBTA 2E2QA 2HF4A 4KFBA 3CFPA 4IXCA 3C94A 2BGGA 1D8YA 3FE1A 5M1KA 1X9JA 1XI1A 1SL1A 3HP6A 2W42A 2YX6A 4JK8A 2NRTA 3QMLA 2G8KA 1D4XA 3ZT3A 3E9OA 3VQDA 1HPZA 1RT5A 4JKHA 4CJRA 3WNHA 3HVTA 1BCMA 1NM1A 4E0DA 4JS5A 4FLZA 1BUPA 2PBDA 2ETJA 2HOEA 1HKBA 3VQ7A 4FLYA 4FJJA 3U6FA 2P9KB 1TV6A 4CHOA 4LFAK 1X3NA 4ID1A 4R79A 2WUSA 4MLHA 2YCHA 3SBGA 3NFAA 4M7YA 1RT3A 1FKOA 1NK5A 2LSNA 3WNFA 1VHXA 3PO5A 3CPWM 2NRVA 4LSNA 2GBZA 3HOSA 4F8RA 4DS5A 3AGKA 1IO2A 2QKKA 3CJ1A 5AFUA 2Y1JA 1ATRA 4GY2B 4PKIA 2Y1IA 4K43A 5AQMA 1XNRK 5GIPA 3EZ5A 4DR7K 4FJ9A 1S22A 4BRAA 4FWNA 3AA3A 3THXB 2HHVA 3HPHA 1C1AA 3VEVA 3CPEA 1BL3A 1ASVA 1SZ2A 3KKSA 3D2EB 3MN6A 5AQTA 1KXPA 5HROA 3KLHA 1RTHA 2FSJA 2Q1NA 4M3RA 5CHIA 1NK8A 1EWRA 4E7IA 3SAGA 1VQNN 2ITMA 2Q0UA 4KTZA 4FZYA 4B3RK 1SUQA 1HMVA 1ATNA 4DV5K 3DOKA 5E26A 3T7ZA 1QSLA 4JNEA 4KRFA 4M3TA 3B6PA 1FKPA 4IOCL 3TPQA 1JJ2M 3QEPA 4FJIA 1EP4A 4FPAA 3E9LA 4DU3A 2Q3SA 1NGEA 3L4IA 2A41A 4MDAA 3CI5A 3MXJA 4BRCA 4FK0A 2QKBA 1QQNA 3CCVN 5EU7A 5B8HA 1GLBG 2JLEA 4KREA 1RDDA 3D45A 1WNSA 2ZWHA 5JLFA 1S6PA 3NF6A 4M45A 4PUOA 4MDBA 1BI4B 3BP8A 5A2QO 3LP2A 2HVHA 1S9EA 4CEEA 3TARA 3OYMA 1ZBLA 1XMQK 4V19S 2G8IA 4W5RA 2P9LB 3I56N 4CFAA 3ZT0A 4FJKA 1C0UA 1U45A 4GV6A 3HM9A 4B3SK 3S3MA 2NRZA 3BZKA 1YITN 1DT9A 4L3QA 2ASOA 4FM2A 4KH6A 3D0PA 4KB1A 3HI0A 3SV3A 1EKEA 1VQ5N 4BR7A 4FOEA 1VSFA 2G8HA 5AQXA 2GTDA 3SAHA 3L2QA 4O8KA 3QEVA 4CFCA 2QWQA 2UXCK 3SCXA
chains in the Genus database with same CATH topology
3CJBA 3VETA 3RSEA 3NMUA 3RSEB 3J8AA 4GNIA 4BRDA 3ID6A 3MWTA 2Q2RA 5M1NA 3QFUA 1GLDG 3GE1A 4QS9A 5M1QA 2YJFA 4CZFA 3GG4A 1JCGA 3LDOA 1VQ6N 5AZJB 3VEOA 1MWKA 2QWPA 2RE2A 3ENBA 3W3DA 5BR9A 1K73O 3LDPA 2GUPA 4B1UB 1OVYA 2P9IA 3O1BA 4O5FA 4A5AA 3VTHA 3CD6N 3OBYA 3L0QA 2FLOA 3DXMA 3ZX0A 3M3ZA 4JKBA 3LDNA 4BQLA 3IFRA 2D1KA 5AQFA 4BVOA 2QTDA 5DM6L 4IOAL 2VYPA 3LDQA 1RDWX 4IEEA 3TSQA 4FWPA 4K42A 4B1XB 4GVEA 1IJJA 1VQMN 4NB4A 3VMFB 4BG9A 4CZMA 3AAPA 4JN4A 4BROA 3A5LC 1WOQA 5BPMA 3WXJA 1DGKN 1LOTB 2HF3A 3IUCA 4JKFA 3DWLA 5AZIB 1VQKN 1T44A 2QI2A 4PHTX 2P9SA 3O9SA 5AQUA 2YHWA 1NGAA 2V7ZA 3CCSN 1YAGA 4BRPA 2P9PA 3UKRB 1Q81O 4GV9A 2D0PA 2A40A 1HKGA 1TYQA 2NRRA 5EVZA 4BC5A 4PL7A 2V51B 4H0YB 3EO3A 3EE9A 3MCAB 5AQOA 1GLLO 1CZAN 2P9IB 4Y0WA 2OTJN 3VGMA 3GL1A 3N4QA 1GLAG 3C6AA 2ZF5O 3WXLA 1ZBSA 3VTIA 3CCRN 3AGRA 5FPEA 3BF3A 4WCEL 3CCMN 3CCLN 4BRFA 2AP1A 4JD2A 4OPAA 4M7XA 2YI1A 4PL8A 3D2FA 3CERA 1KAZA 4H0VB 1BDGA 3C7NA 5JLHA 3ZYYX 1RGIA 2NNWA 5AQGA 3CCQN 3O6WA 4FO0A 4YOXA 1S72N 3FZLA 2HBLA 4QS8A 5M1PA 4C1NK 1MWMA 1W2BM 1OKJA 5AQWA 1NJIO 1BG3A 4YOYA 3K9JA 4K25A 5FPNA 4CBXA 4E1JA 1VQ7N 3VERA 3WT0A 5C10A 3G25A 3ZETB 5F1XA 4BR5A 2CH6A 4CZKA 3CQYA 4BRMA 4ISFA 3H1VX 5AQYA 2GEMA 4IJAA 4AM7A 1SS6A 3ULEA 3VENA 2OANA 2HBKA 1MA9B 3SMPA 1XUPO 2F9TA 2HBJA 2ZGYA 2HMPA 2CH5A 5AFUH 4FWLA 1YJNN 5C12A 1M1KO 1YVNA 3GOIA 5EX5A 3I8BA 3JXUA 4EHTA 4AM6A 1JCFA 3HBTA 4KH4A 4BREA 3VF2A 1NGHA 1VQ8N 1YI2N 4CZGA 4G9ZA 4YDUA 4BRGA 5F0XA 4FWRA 2QM1A 5DM7L 2E20A 1N8RO 4IFEA 2UYTA 1ATSA 2E2PA 1NGJA 3EKUA 3C6HA 1HLUA 4WFBL 1QQMA 3H6EA 1LCUA 1VQ9N 5HOOA 3MK6A 4DQ8A 3BEXA 2KKZA 4JK9A 2PAVA 3MX2A 4WQ5C 3CHWA 5C2FA 3CJAA 4J8FA 2NLXA 4FOIA 4CBWA 3CMAN 3O9RA 5E84A 3TU5A 3VESA 4BY9C 3AY9A 4JK7A 2I7PA 2H3GX 4WFAL 5AQNA 3CJ9A 1YXQA 3A8YA 1KC8O 4CJ7A 3Q7CA 5GINA 1T6CA 1GLCG 2P9NA 3A5MC 3H1QA 4CD3A 2P9NB 1HX1A 4ISGA 5GAHP 1P90A 3EKSA 3C65A 3D6RA 4YDUC 4BRKA 4IOXA 1P8ZA 3BF1A 2NRXA 2FSKA 5JMVA 4WFNL 1GLJO 5GAGP 4U67L 2E1YA 3CC2N 5AQQA 3I33A 4BRQA 3D2FB 4FWKA 5EY4A 4A57A 3FZKA 3OHRA 3KVGA 1TUYA 4BGAA 4EAHD 4EHUA 3VOVA 4K41A 3IDHA 5C0YA 4B1ZA 1HUXA 3HZ6A 3WQUA 2KHOA 1QVGM 4YORA 3T69A 1HJOA 2QWOA 1YJWN 1XC3A 3LDLA 1K8AO 5CR4A 1M90O 2D0OA 1YUWA 4ILJA 4M63C 4FWSA 3O1WA 1J6ZA 4NLBA 1X3MA 4CBUA 5I9EB 3B8AX 1Q7YO 1XQSC 5LJVA 5AZIA 3LM9A 4BRNA 2GELA 2FSNA 4H5VA 2NRHA 3N4PA 3C0BA 3ZX3A 4PKGA 3MN9A 3M1FA 4IJNA 3UKUB 5JICA 2ASMA 1O13A 2V52B 1QZ5A 4FWOA 5AR0A 4EIAA 2E2OA 1ZXOA 4IZ9A 5TKYA 3CJCA 4JHDA 4H03B 4IO9L 1YHQN 1S3XA 3E1YA 4FL9A 1C0GA 4H5RA 5GIOA 3ATUA 3O08A 2NRWA 5AQHA 3ULEB 3VEZA 4C23A 3PIOL 3F9MA 3ID8A 1NLVA 3TTDA 3WXIA 3R8EA 4CZEA 3VGLA 4BRLA 3VEXA 3AAQA 5AZJA 4GV3A 4EFHA 4ILGB 3CCJN 3DXKB 4DKWA 3QB0A 4MO5A 1QVFM 4B9QA 3H3NO 3O5BA 3F5TA 3G71N 2WBNA 5ELZA 2WFBA 4WQ4A 3LL3A 2A42A 5FPMA 4BR9A 4UY8O 2W40A 2HBMA 1K9MO 2ZGZA 3J7ZO 4DHYA 4FWMA 3CETA 4HWIA 2GX9A 4OO1J 2E88A 2BUPA 1HKCA 3CIPA 2Q31A 4RTFD 2IIRA 3FR0A 4XH4A 2FF3B 4IO8A 3FZMA 4FSVA 3WXKA 4YOWA 1KD1O 1NMDA 1Z6RA 1U2VA 2FF6A 3GDQA 2VGMA 5TKWA 4B1VA 3KWIA 3WQTA 5BPNA 4BRHA 1RDUA 4XH5A 3M5RA 4H5NA 1K8KA 4MO4A 4BRIA 2QA4N 4RWTA 4JKGA 1SQKA 2DPNA 3E9PA 3SK3A 1TUUA 4BGBA 1U6ZA 2VGNA 5BN8A 3CCUN 1NBWA 4YOVA 4B1WB 3D2EA 3O4WA 3G6EN 4I6MA 1GLFO 1BWFO 2CGKA 5KPTA 4BR0A 3ZX2A 3SJHA 4XH1A 2QWLA 3HM8A 1GLEG 2QW9A 2P9UA 2P9LA 1NGFA 2KLAA 2NZTA 4JKCA 5AQIA 5F2RA 1VQ4N 4HTLA 4A62A 5AQVA 3MDQA 4PKHA 3DAWA 4ISEA 2OTLN 3IMXA 4KH5A 4NLCA 4H5WA 3CCEN 4JKDA 1BOTO 2QWNA 3S41A 2E8AA 3MX5A 3P39A 3WXMB 4FWQA 5C2DA 3VEYA 1NGCA 4H0PA 2QWRA 3JS6A 4CZHA 2W41A 4LC9B 1U2VB 5EXWA 4CD1A 2IVNA 1NWKA 3SAFA 5H1SQ 3ENOA 1BO5O 3ZEUB 4MLEA 1EQYA 1G99A 4A61A 3L4QA 2P9PB 3RVCA 3UKUA 3K9KA 3UKRA 5M1OA 3ZETA 1E4GT 3SLCA 3FLCO 1VQLN 4H0TB 4F9OA 5BREA 3VF6A 4U7BA 2F9WA 2WC9A 5AQRA 3MMVA 3A5NC 3OW2M 1DKGD 3MN5A 1RFQA 2A5XA 4FVUA 4BC3A 2E2NA 3D7EO 4I6MB 5MLCQ 4H0XB 5LY3A 1V4TA 3UE5A 5BRDA 1EO1A 4YOTA 3QBXA 3O9QA 3IKMA 3DXKA 1VQPN 2BH1A 4JEPA 3F2KA 3VEWA 3P4IA 3OBWA 3KHYA 2GWJA 4O8UA 2EWSA 3UB5A 4BC4A 1KQSM 1YF5L 1T6DA 3TTFA 3P38A 3W0LA 1ZC6A 2VCPA 3A5OC 3DXMB 1JCEA 3CXCM 3SBTA 1Q82O 2E2QA 2HF4A 2FXUA 3FFKB 3WEEB 4IXCA 4RCHA 5BRHA 3FE1A 2VWBA 1BA1A 1X9JA 4JAXA 5M1KA 2QEXN 1NGBA 5AQZA 2YX6A 3O8MA 5AQJA 2I7NA 2NRTA 4JK8A 4BR2A 3QMLA 1D4XA 1QZ6A 1YIJN 2IVPA 3E9OA 2AA4A 4JKHA 1WUAA 4YOUA 5AQLA 2A6AA 1NM1A 1QHAA 5EOYA 3I55N 1BUPA 2PBDA 3P31A 3HRGA 3DJCA 3HOTA 2HOEA 3KZBA 4WF9L 2P9SB 1HKBA 2HSTA 1K8KB 3QICA 5KPRA 3KWGA 1IG8A 3QBWA 2P9KB 4FPBA 3VPZA 2E1ZA 4AF1A 1X3NA 2ZJPL 4R79A 3MWPA 3TTCA 2WUSA 4MLHA 2YCHA 3SBGA 1NGGA 3C7NB 4M7YA 4WQ5A 3O9UA 4CZIA 3QDKA 4WYBA 4A59A 4A5BA 3G4SN 3NVMA 2A3ZA 3U4LA 3R1XA 3VF4A 4CZLA 3CPWM 4BVPA 2NRVA 4BG8A 4BQZA 3U9ZA 3HOSA 4DB3A 3AGKA 1Q86O 1BU6O 3CJ1A 5AFUA 3OA9A 1ATRA 4GY2B 2J4RA 4PKIA 3H3OB 4K43A 1SAZA 1V4SA 1NGDA 5AQMA 3CF5L 3A0IX 5GIPA 4OPHA 5HL7L 3WEEA 5C15A 2IVOA 3WUHA 4DCHA 5CE3A 1S22A 2F7TA 2RHKA 4BRAA 4FWNA 2GWKA 3AARA 5AQPA 5FPDA 4Z94A 1KAYA 1VQON 5KQ8A 3VEVA 3CPEA 1SZ2A 4CZJA 3D2EB 5ADXH 3MN6A 3U8XA 5AQTA 1KXPA 2CGJA 3PIPL 4CI6A 3SMSA 4KBOA 2FSJA 2Q1NA 2V7YA 5CHIA 1QQOA 3U9DA 1T3VA 3KK7A 2PFUA 5AQSA 3SAGA 2CGLA 2D4WA 1VQNN 4NO7A 2ITMA 2Q0UA 3FZHA 3HTVA 4JHDB 2QWMA 4JKEA 3EZWA 2Q36A 3VGKA 3QFPA 1ATNA 5E26A 3T7ZA 3H46O 1YJ9N 3R3LA 1DEJA 4JNEA 5BPLA 2Q0RA 2ZJRL 4WQ4C 3ATVA 4BR4A 4C1NI 4IOCL 4H5TA 3H45C 3TPQA 1JJ2M 4JD2B 1KAXA 3BUZB 2BTFA 1C0FA 3L6QA 3E9LA 4FPAA 1TYQB 2YHXA 3FZFA 2JWKA 3R9PA 1NGEA 1Y64A 3L4IA 4IEIA 2A41A 3TSPA 1HPMA 4MDAA 3CI5A 4BRCA 4A2BA 1VAZA 2JWLA 3GBTA 1QQNA 3CCVN 5B8HA 2QXLA 2ZJQL 3O80A 4A2AA 5KQDA 1GLBG 3EE8A 3CQXA 5JVHL 3ZEUA 1R59O 4H0OA 5AQKA 5KPZA 5M1FA 1E4FT 3R6MA 1ESVA 2ZWHA 3TSUA 5JLFA 3LM2A 1BA0A 3BP8A 4MDBA 4ILHA 1Z05A 5ADXA 2Q97A 2YJEA 1ILYA 4XEIA 4QS7A 4BC2A 5LJWA 4IWVA 2YHYA 3FGUA 3E66A 3O9TA 1W97L 2P9LB 2P9UB 3I56N 5JVGL 4JKGB 3CMEN 1Q18A 1MDUB 3CC7N 5GAEP 3CC4N 4B1YB 3DLLL 3Q7BA 3EL2A 4GV6A 4IDHA 2NRZA 1YITN 1DT9A 4L3QA 2ASOA 3EN9A 1H1VA 1NGIA 4KH6A 3HI0A 3MCPA 1VQ5N 3PLAA 5BRFA 3NVKA 4BR7A 4FOEA 3MN7A 5BN9A 5AQXA 2GTDA 2P9KA 3CJ7A 3SAHA 3ENHA 3M6GA 4O8KA 2ASPA 3HSCA 2QWQA 5GADP 4JKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW M;  1N8R O;  1KD1 O;  4WFB L;  1Q86 O;  1VQ9 N;  2QA4 N;  1VQ6 N;  3CF5 L;  3CMA N;  1K73 O;  5HL7 L;  3CCU N;  1OVY A;  4WFA L;  3CD6 N;  3G6E N;  1KC8 O;  1S72 N;  1VQO N;  5DM6 L;  4IOA L;  5GAH P;  1VQ4 N;  2OTL N;  3PIP L;  1VQM N;  4WFN L;  3CCE N;  4U67 L;  5GAG P;  3CC2 N;  1VQN N;  1VQK N;  5H1S Q;  1QVG M;  3CCS N;  1YJ9 N;  1VQL N;  1Q81 O;  2ZJR L;  1YJW N;  1K8A O;  4IOC L;  1M90 O;  1JJ2 M;  3OW2 M;  2OTJ N;  3CCR N;  1Q7Y O;  4WCE L;  5MLC Q;  3CCM N;  3CCL N;  1VQP N;  3CCV N;  2ZJQ L;  3CCQ N;  5JVH L;  1KQS M;  3CXC M;  1W2B M;  1Q82 O;  1NJI O;  4IO9 L;  1YHQ N;  1VQ7 N;  1ILY A;  2QEX N;  3PIO L;  1YIJ N;  5JVG L;  3I56 N;  3CME N;  3I55 N;  3CCJ N;  3CC7 N;  5GAE P;  3CC4 N;  4WF9 L;  3DLL L;  1QVF M;  1YIT N;  3G71 N;  1YJN N;  1M1K O;  2ZJP L;  4UY8 O;  1K9M O;  3J7Z O;  1VQ5 N;  1VQ8 N;  1YI2 N;  3G4S N;  5GAD P;  5DM7 L; 
#chains in the Genus database with same CATH topology
 3CJB A;  3VET A;  1XWL A;  3J8A A;  3QFU A;  5FDL A;  3PY8 A;  1N36 K;  1JCG A;  5FRM A;  1VQ6 N;  4JI7 K;  2PY5 A;  3HPO A;  2RE2 A;  3W3D A;  5BR9 A;  1T8E A;  3RWU A;  4KHW A;  3OS0 A;  4L8R B;  4DU4 A;  1OVY A;  2P9I A;  3VTH A;  1J5O A;  3OBY A;  1KFD A;  1JLF A;  3M3Z A;  2P5G A;  2UUB K;  1TL3 A;  4IOA L;  3TSQ A;  4AHC A;  3OYF A;  4ZTF A;  3AAP A;  1HNW K;  1T7P A;  3WXJ A;  2HF3 A;  3M8S A;  4JKF A;  2HB5 A;  4PHT X;  2HNZ A;  2HHS A;  3HST B;  3LWM A;  1YAG A;  1OH6 A;  2P9P A;  4GV9 A;  3V9X A;  1TYQ A;  2NRR A;  1SKR A;  4H0Y B;  4KHP K;  3MEC A;  3VGM A;  3GL1 A;  1JLG A;  4B8A B;  2KZM A;  2F96 A;  2ZF5 O;  1ZBS A;  3VTI A;  3WXL A;  2O8B B;  1TL1 A;  3AGR A;  1R0A A;  3CCL N;  2IGI A;  4OGE A;  4ZHR A;  4JD2 A;  3F73 A;  2YI1 A;  3D2F A;  1KAZ A;  4DQR A;  4B9T A;  3I0S A;  3V1R A;  5JLH A;  3SUN A;  4HCB A;  3JYT A;  3NDK A;  4W5T A;  3FZL A;  4E1M A;  4JV5 K;  1RIL A;  1YTA A;  3KLG A;  3SUP A;  5CYQ A;  1VQ7 N;  4LF8 K;  2BDP A;  3NF7 A;  4AQY K;  4CZK A;  3CQY A;  4ISF A;  2GEM A;  4J2E A;  1IBL K;  3VEN A;  1GOA A;  2ZGY A;  2HMP A;  4KO0 A;  5AFU H;  1M1K O;  3ZSZ A;  3LP0 A;  3S9H A;  3I8B A;  2ITG A;  4AM6 A;  1JLQ A;  3LWL A;  3L3U A;  4DR2 K;  4NXM K;  5F0X A;  2QM1 A;  3AVK A;  5KI6 A;  1QQC A;  1N8R O;  3AO3 A;  3BDP A;  2FBY A;  2PYL A;  4JK9 A;  2KKZ A;  2PAV A;  3L2U A;  3MX2 A;  4N56 A;  4WQ5 C;  3CHW A;  2NLX A;  4FOI A;  4CBW A;  3CMA N;  3AY9 A;  1A5X A;  2I7P A;  4WFA L;  2JGU A;  1WN7 A;  1YXQ A;  3A8Y A;  1SKS A;  1S72 N;  1J9A A;  4CD3 A;  1J5E K;  1P90 A;  3C65 A;  3D6R A;  3BF1 A;  3U3Y A;  3QNN A;  2R7Y A;  4M42 A;  1GLJ O;  1KVB A;  2A1R A;  2KZZ A;  1RBR A;  3D2F B;  4FWK A;  4DR4 K;  3KVG A;  1TUY A;  3LAL A;  4ELV A;  4EAH D;  3FFI A;  3HO1 A;  3SI6 A;  1RT7 A;  1XC3 A;  4E7H A;  1TVR A;  2PZS A;  4LF9 K;  5C42 A;  2D0O A;  1YUW A;  1IKY A;  1J6Z A;  2XHB A;  4BDY A;  4DTM A;  4C8O A;  1XQS C;  1EET A;  2GEL A;  2O8C B;  4H5V A;  2NRH A;  2UXB K;  2G8F A;  5AJ3 K;  1JL1 A;  4IJN A;  2VQE K;  1WBB A;  4B08 A;  3UKU B;  1O13 A;  4CW7 B;  1XHZ A;  2E2O A;  1ZXO A;  3K57 A;  4JHD A;  3KK3 A;  1YHQ N;  2YKN A;  3MEG A;  1C0G A;  1YVU A;  3VQA A;  3TR8 A;  5JS2 A;  3F9M A;  3ID8 A;  4CF8 A;  4DQQ A;  1HNX K;  3WXI A;  3J81 O;  3AAQ A;  4FLT A;  3AO2 A;  2OPR A;  4ILG B;  3CCJ N;  3DXK B;  4CJE A;  3OJU A;  3QB0 A;  3OYI A;  4OGC A;  5K14 A;  4DFP A;  2WFB A;  3SPY A;  5FPM A;  2ZGZ A;  2HHU A;  4OKJ A;  4DHY A;  3AVB A;  3SQ2 A;  5E41 A;  1JLA A;  2FBX A;  3NF9 A;  4XH4 A;  4DSI A;  3FZM A;  3WXK A;  1KD1 O;  1NMD A;  1Z6R A;  3KWI A;  1WSG A;  1RTJ A;  1K8K A;  5LMN K;  2DPN A;  3E9P A;  5KGX A;  1U6Z A;  2VGN A;  3OYD A;  5I3U A;  2P1J A;  4B1W B;  3D2E A;  4CEO A;  4LFB K;  3O4W A;  1FW6 A;  4BR0 A;  3SJH A;  1TK0 A;  4FJM A;  4I7F A;  5F2R A;  2P9L A;  4JKC A;  1VQ4 N;  5HRN A;  5AQV A;  4DFK A;  1J53 A;  3DAW A;  4ISE A;  4NLC A;  1NNE A;  3CCE N;  2DFE A;  3WXM B;  3MX5 A;  1S1X A;  1TGO A;  3QEW A;  1U2V B;  2IVN A;  4FM0 A;  1RT1 A;  2HMI A;  1SV5 A;  4MLE A;  4KKO A;  4FLU A;  4N47 A;  2P9P B;  4CIG A;  5BRE A;  4U7B A;  3QLH A;  4X62 K;  4DTR A;  1FJG K;  5AQR A;  1E3M A;  1KVC A;  1RTD A;  1RFQ A;  4C8K A;  4FM1 A;  3OYJ A;  5MLC Q;  1JLE A;  2E6M A;  1OVQ A;  3DXK A;  4I9L A;  3PSI A;  1WSH A;  3P4I A;  4BC4 A;  3OBW A;  1TK5 A;  4B9S A;  3RR8 A;  1T6D A;  3V4I A;  1ZC6 A;  3A5O C;  3DXM B;  3LP3 A;  1UWB A;  2OCE A;  3FFK B;  1U4B A;  1TKD A;  1VSK A;  3NGY A;  5BRH A;  4CHP A;  2WOM A;  2VG5 A;  5KGW A;  1NK6 A;  5HBM A;  3VQ9 A;  2YNG A;  2AA4 A;  4LSL A;  3ZSX A;  3NHG A;  2A6A A;  4PQU A;  3I55 N;  3P31 A;  3HRG A;  4FVM A;  4DV3 K;  3KZB A;  1J54 A;  4IFY A;  2X78 A;  1K8K B;  3QIC A;  1WSF A;  5FLX O;  5KPR A;  2ZQB A;  4AHT A;  4FPB A;  1REV A;  1LV5 A;  3TAP A;  2IS3 A;  4A5B A;  3G4S N;  2A3Z A;  4Z4E A;  4FLV A;  2YHA A;  4O5B A;  3UIQ A;  3U9Z A;  3THY A;  4F3O A;  4DR5 K;  1OH7 A;  1YTU A;  1KFS A;  3TAG A;  3H3O B;  4QOZ B;  4OPK A;  4B3M K;  1V4S A;  1NGD A;  5J2M A;  4CF1 A;  1NK0 A;  4QCL A;  2IVO A;  3ZCM A;  2XY8 A;  4DCH A;  3MXI A;  3P5J A;  5CE3 A;  3DI6 A;  4FJ5 A;  3O4N A;  2IOC A;  2GWK A;  3H08 A;  5AQP A;  4OPJ A;  1IKW A;  1T03 A;  2CGJ A;  3VQ8 A;  5HLF A;  3OYB A;  1QQO A;  3KK7 A;  4MFB A;  4FZX C;  3FZH A;  3HTV A;  4JI6 K;  4JHD B;  4JKE A;  1JLC A;  4CJT A;  3H46 O;  5BPL A;  4CJS A;  4M3U A;  4WQ4 C;  3ATV A;  1NMN A;  4C1N I;  3DLE A;  3U3G A;  3H45 C;  3TAN A;  4JD2 B;  1KAX A;  3BUZ B;  4CK3 A;  1ZBH A;  1TYQ B;  1Y64 A;  4WE1 A;  4DR3 K;  3GBT A;  3VQE A;  2QXL A;  3O80 A;  4A2A A;  4YNQ A;  5DK5 A;  3EE8 A;  5JVH L;  4KHN A;  5AQK A;  5KPZ A;  5M1F A;  3R6M A;  1W9H A;  4M3W A;  3LM2 A;  1Z05 A;  5ADX A;  3RMA A;  2Q97 A;  4XEI A;  4QS7 A;  4IWV A;  2YHY A;  3VQ4 A;  3DLR A;  4RW4 A;  4CHZ A;  4AHR A;  3E66 A;  1SKW A;  3ZLJ A;  1MDU B;  4FK4 A;  4B3T K;  3ITH A;  3SJJ A;  1B9D A;  3EN9 A;  3TI0 A;  4UQG A;  4KI6 A;  5BRF A;  4K8Z A;  2P9K A;  3ENH A;  1KTQ A;  3M6G A;  4H4O A;  3K0S A;  2VQF K;  5GAD P;  3AVL A;  3RSE A;  4CIE A;  1RNH A;  3RSE B;  2AJQ A;  3MWT A;  3GE1 A;  3GG4 A;  4X64 K;  5AZJ B;  2BAN A;  1K73 O;  3LDP A;  2D5R A;  4O5F A;  2OPP A;  3O1B A;  4A5A A;  4KTQ A;  3V1O A;  3CD6 N;  2FLO A;  1U49 A;  3ZX0 A;  4CER A;  4JKB A;  3ALY A;  4Q5V A;  5CZ1 A;  3LDQ A;  4IEE A;  1QHT A;  1VQM N;  4NB4 A;  2YNI A;  1UOC A;  3KD1 E;  4JN4 A;  1L3V A;  3L8B A;  2EHG A;  1LAW A;  4DF4 A;  3E01 A;  1T44 A;  2P9S A;  1HNV A;  1NGA A;  4KAZ A;  3CCS N;  1N34 K;  4BRP A;  3UKR B;  1Q81 O;  1BCO A;  1HKG A;  4BC5 A;  5EVZ A;  1L3T A;  4ELT A;  3EO3 A;  3MCA B;  5AQO A;  4X65 K;  3SYZ A;  4M3X A;  4FW2 A;  5KRS A;  1GLA G;  3BZC A;  3V81 A;  3CCR N;  5FPE A;  3VA3 A;  2O8F A;  4BRF A;  2HHT A;  3CER A;  4H0V B;  1FK9 A;  3CG7 A;  1D9D A;  1RGI A;  4B8C A;  1BI4 A;  4E7K A;  3DLG A;  3MEE A;  4YOX A;  3L2W A;  4AHV A;  4DMN A;  4C1N K;  2VWJ A;  4KB0 A;  1OKJ A;  5AQW A;  5CY4 A;  2UU9 K;  3K9J A;  3DYA A;  4CBX A;  3TAB A;  5C10 A;  4JRQ A;  3RMC A;  3VQC A;  4IJA A;  4MQ3 A;  2OAN A;  2HBK A;  3SMP A;  1XUP O;  2HBJ A;  4CIF A;  3K5O A;  3VQ5 A;  2CH5 A;  5C12 A;  1YVN A;  2F8S A;  3GOI A;  3J7Y P;  4B9M A;  2YHB A;  3VF2 A;  1NGH A;  4B9U A;  2YV0 X;  4G9Z A;  1A5W A;  3K5L A;  4CEQ A;  2YKM A;  1HYZ A;  1TAU A;  4W5N A;  1C1B A;  4IFE A;  2UYT A;  2E2P A;  4WFB L;  4DTO A;  1LCU A;  1VQ9 N;  5HOO A;  3K58 A;  4KI4 A;  4DG1 A;  3VQP A;  3OYE A;  3SZ2 A;  3TU5 A;  4DLE A;  4BY9 C;  4AHS A;  4W5O A;  2O8D A;  1A5V A;  4CHQ A;  3DMJ A;  4IDK A;  3Q7C A;  3HYF A;  5GIN A;  1T6C A;  2P9N B;  5GAH P;  4BDP A;  3OS1 A;  2NRX A;  3V9S A;  1S1W A;  4U67 L;  3RMD A;  4CGD A;  2E1Y A;  3LPT A;  5AQQ A;  3I33 A;  4BRQ A;  5EY4 A;  1X1P A;  3FZK A;  3OHR A;  4BGA A;  4J2A A;  5DMR A;  4EHU A;  1VSL A;  3VOV A;  3IDH A;  5C0Y A;  3HZ6 A;  2KHO A;  5SZT A;  4E7L A;  2GUI A;  4YOR A;  1HJO A;  1RDC A;  5CR4 A;  4M63 C;  5C25 A;  2XY7 A;  3AVA A;  1W0H A;  5I9E B;  1Q7Y O;  1N33 K;  3QIO A;  1Z26 A;  4OVL A;  3LM9 A;  4BRN A;  2KW4 A;  4KTW A;  3PX4 A;  4EIA A;  1WLJ A;  1RT2 A;  4IZ9 A;  5TKY A;  3EY1 A;  5D3G A;  3G10 A;  3E1Y A;  3ZSO A;  3O08 A;  3KIO A;  5T7B A;  3VEZ A;  5HRP A;  1I3A A;  3PIO L;  3R8E A;  4CZE A;  2YNF A;  4GV3 A;  3HVR A;  5J2N A;  4DKW A;  4MO5 A;  3O5B A;  4WQ4 A;  3LL3 A;  2A42 A;  2DFH A;  1K9M O;  3SPZ A;  4XIU A;  1WAJ A;  3CET A;  4E19 A;  2E88 A;  1HKC A;  1ASU A;  4PA1 A;  3QER A;  2RKI A;  3GDQ A;  1XMO K;  4B1V A;  4OLB A;  4TSX A;  4XH5 A;  2XRI A;  2QA4 N;  4O44 A;  1LAV A;  1TUU A;  1XC9 A;  3CCU N;  2P5O A;  5J1E A;  4YFU A;  3G6E N;  2CGK A;  1TKZ A;  1L5U A;  3ZX2 A;  4DQP A;  2QWL A;  2NZT A;  2KLA A;  1HYS A;  4KH5 A;  2HHW A;  4JKD A;  3P39 A;  1NGC A;  1EXQ A;  3QIP A;  3AVM A;  4CZH A;  1OH5 A;  4DSL A;  1NWK A;  4Z0U A;  3LAK A;  1G99 A;  3L2V A;  3UKU A;  3RVC A;  1VQL N;  1E4G T;  3SLC A;  3FLC O;  4DV2 K;  3THX A;  4DV1 K;  4CF9 A;  1TK8 A;  3A5N C;  3OW2 M;  1NK7 A;  2A1S A;  3J7A P;  4LF7 K;  3O9Q A;  3KD5 E;  2UUC K;  1VQP N;  1QTM A;  2BH1 A;  4JEP A;  3AO5 A;  2GWJ A;  3KHY A;  1KQS M;  4CED A;  2VCP A;  3NCI A;  1Q82 O;  2FXU A;  3BGR A;  1GOB A;  3WEE B;  3KLE A;  3PV8 A;  3LZI A;  1S9G A;  1X9M A;  2VWB A;  1BA1 A;  1NGB A;  5AQZ A;  5AQJ A;  2I7N A;  1QZ6 A;  1WUA A;  4YOU A;  2RPI A;  1QHA A;  4JI4 K;  3DJC A;  5HRR A;  2P9S B;  2HST A;  3KK2 A;  3KWG A;  1IG8 A;  3QBW A;  3VPZ A;  1QSY A;  4AF1 A;  2ZJP L;  3MWP A;  3TTC A;  4WQ5 A;  3O9U A;  1CXQ A;  2PYJ A;  1X9W A;  2QXF A;  3NVM A;  4IG3 A;  3DLH A;  3U4L A;  1KCF A;  4CJ5 A;  4DV6 K;  3VF4 A;  4CES A;  4EZ9 A;  1X9S A;  4BVP A;  1S1V A;  2HHQ A;  1ZBU A;  4BQZ A;  3ZT1 A;  3THW B;  1B92 A;  4BWM A;  3DRP A;  1RDB A;  1Q9X A;  4DB3 A;  4G1Q A;  1NKC A;  2J4R A;  1S1T A;  2VG6 A;  3CF5 L;  1SAZ A;  4LFC K;  3NH2 A;  1BIU A;  3P83 D;  1ZBF A;  4CGJ A;  3HPG A;  3ZSW A;  1NK9 A;  4CEC A;  2RHK A;  5FPD A;  4Z94 A;  1KAY A;  4DWI A;  1VQO N;  1FXX A;  5KQ8 A;  4GKJ K;  4CZJ A;  4CJU A;  3QIN A;  5KRT A;  1C1C A;  3PIP L;  4ID5 A;  4KBO A;  1HQU A;  5HP1 A;  3CFO A;  3U9D A;  2PFU A;  2BE2 A;  1F21 A;  4NO7 A;  4H4M A;  4OLA A;  4HUG A;  2O8E B;  2QWM A;  4NCA A;  3VGK A;  1CLQ A;  4BDZ A;  2X74 A;  3ZSY A;  4HUE A;  2DTU A;  4OX9 K;  2BTF A;  1C0F A;  4CJL A;  3KJV A;  3FZF A;  4DUZ K;  1HRH A;  1IBK K;  2E4L A;  1WSE A;  3IS9 A;  5IT9 O;  4A2B A;  4ZTJ A;  1Y97 A;  2ZJQ L;  4FXD A;  1R59 O;  4H0O A;  1E4F T;  1ESV A;  4DTJ A;  4F2R A;  1DTT A;  4ILH A;  4DFM A;  3DOL A;  2YJE A;  3AO4 A;  3C6U A;  4F4K A;  4NCG A;  5LJW A;  3O9T A;  1W97 L;  2P9U B;  5JVG L;  3CME N;  1Q18 A;  1RBU A;  1TKX A;  3CC7 N;  5GAE P;  3CC4 N;  4B1Y B;  3EL2 A;  3T19 A;  4CFB A;  4FYD A;  2B6A A;  3NVK A;  4CJK A;  3MN7 A;  4CHY A;  4DTN A;  3CJ7 A;  2RN2 A;  2ASP A;  3HSC A;  4DTU A;  3VQQ A;  4JKA A;  4E3S A;  3NMU A;  2F4V K;  2D0C A;  4GNI A;  4BRD A;  3ID6 A;  2Q2R A;  4M3Z A;  2W6K A;  1GLD G;  3PUF A;  1BGX T;  3AVN A;  4DLG A;  4M41 A;  1IKX A;  1MWK A;  3ENB A;  1D9F A;  4JI2 K;  1G15 A;  2GUP A;  4B1U B;  4I2Q A;  3OYG A;  1HNI A;  4CJP A;  3L0Q A;  3DXM A;  1NOZ A;  4DR6 K;  3IFR A;  4BVO A;  3LDS A;  2QTD A;  5DM6 L;  2VYP A;  1RCH A;  4B1X B;  1IJJ A;  3VMF B;  4BG9 A;  4CZM A;  3OJS A;  1RT4 A;  1RTI A;  1YT3 A;  3AVG A;  4BRO A;  4BWJ A;  3A5L C;  4PWD A;  3RR7 A;  5BPM A;  1DGK N;  1LOT B;  2IC3 A;  4HTU A;  5AZI B;  1VQK N;  2QI2 A;  1RBV A;  5AQU A;  2HNY A;  2YHW A;  2V7Z A;  4JYA K;  1BIZ A;  2D0P A;  2A40 A;  4C8M A;  4PL7 A;  4BE2 A;  3EE9 A;  4Y0W A;  1Q9Y A;  4QAG A;  1QS4 A;  3BF3 A;  4WCE L;  3CCM N;  2IAJ A;  4PL8 A;  4N41 A;  1ASW A;  3C7N A;  3ZYY X;  1NOY A;  4O0J A;  2OZM A;  3CCQ N;  4FCY A;  4FO0 A;  4NYF A;  4QS8 A;  3C6T A;  5M1P A;  1W2B M;  1NJI O;  4K25 A;  5FPN A;  4E1J A;  4DSF A;  2KQ2 A;  3VER A;  1KLN A;  3IRX A;  5F1X A;  2CH6 A;  4BRM A;  4F2S A;  2X6S A;  1SS6 A;  3NBP A;  4AHU A;  1MA9 B;  2F9T A;  2EX3 A;  4FWL A;  4CEF A;  2Z1H A;  4Z4F A;  1GOC A;  3I0R A;  3JXU A;  4DV7 K;  3DLB A;  2D0B A;  1JCF A;  4BRE A;  4KH4 A;  4CF0 A;  1K6Y A;  3SQ4 A;  1C6V A;  1YI2 N;  4CVN E;  3AA5 X;  4YDU A;  4BRG A;  2D0A A;  3S3O A;  1VSM A;  5DM7 L;  4CJ4 A;  2E20 A;  1NG9 A;  1NJW A;  1NGJ A;  3EKU A;  1HNZ K;  3C6H A;  1IV0 A;  1VK0 A;  3H6E A;  1N32 K;  1NKE A;  3MK6 A;  2OA8 A;  4DQ8 A;  1KRP A;  5C2F A;  3CJA A;  3J80 O;  4OKK A;  4HVJ A;  4OKE A;  2H3G X;  4CGH A;  5AQN A;  4FZZ A;  1GLC G;  2WTU A;  1HX1 A;  3A2F A;  3ASM A;  3EKS A;  4YDU C;  4BRK A;  4IOX A;  4DFJ A;  1LWE A;  2ZM6 K;  4Z4G A;  5JMV A;  4BAC A;  1RBT A;  5GAG P;  3CC2 N;  2IDO A;  4LF4 K;  1Z25 A;  3S3N A;  4JLH A;  4K41 A;  3QET A;  2E5L K;  4B1Z A;  3WQU A;  4RW6 A;  3T69 A;  3B6O A;  2XY5 A;  1I39 A;  1LWF A;  4FK2 A;  1M90 O;  4J2B A;  4DQI A;  3NH1 A;  4ILJ A;  3MED A;  3O1W A;  1CZ9 A;  4NLB A;  1X3M A;  4CBU A;  3QO9 A;  4DSJ A;  1NU0 A;  1NJY A;  5AZI A;  3LPU A;  2O8C A;  2VWK A;  3SQ1 A;  3AVJ A;  3ZSQ A;  3ZX3 A;  3QEI A;  3MN9 A;  3THV A;  5JIC A;  1CZB A;  4FJH A;  1LW0 A;  4FWO A;  4AH9 A;  1O1W A;  2O8E A;  1S3X A;  4LH5 A;  4H5R A;  5GIO A;  3ATU A;  3KKR A;  5AQH A;  3ULE B;  1LW2 A;  4DTP A;  1S5J A;  2HW3 A;  3AA2 A;  5J2Q A;  3TTD A;  1VSI A;  3O3H A;  4B9L A;  4EFH A;  3T1H K;  1IG9 A;  1QVF M;  4B9Q A;  3H3N O;  3T3F A;  2KFN A;  3F5T A;  1HYV A;  2WBN A;  3O3G A;  1KLM A;  2HBM A;  1I94 K;  3J7Z O;  3TAE A;  4Z4I A;  4IBN A;  4PY5 A;  4OO1 J;  1DLO A;  2GX9 A;  4HWI A;  3LZJ A;  4LD0 A;  2BUP A;  3CIP A;  4CF2 A;  4CGI A;  2Q31 A;  4RTF D;  3NAE A;  2FF3 B;  4Q0B A;  4YOW A;  4FSV A;  4X66 K;  4GKK K;  1NJX A;  1SL0 A;  4E7J A;  5TKW A;  2QK9 A;  3KLI A;  3WQT A;  4I9Q A;  5BPN A;  1RDU A;  4DUY K;  3M5R A;  3T1A A;  1T05 A;  4CGF A;  4JKG A;  5CZ2 A;  3SK3 A;  4ICL A;  3SQ0 A;  1NBW A;  2O4G A;  3AVC A;  4I6M A;  1C0M A;  2OYQ A;  3K5M A;  5C24 A;  3HM8 A;  2QW9 A;  2P9U A;  3OYH A;  4HTL A;  4CK2 A;  4FJ8 A;  2OTL N;  4PKH A;  3THY B;  4H5W A;  3TAM A;  1BOT O;  2QWN A;  3S41 A;  2E8A A;  5C2D A;  3VEY A;  3NH0 A;  4H0P A;  2QWR A;  2E6L A;  3AVH A;  4LC9 B;  4CD1 A;  1U04 A;  4CHN A;  3SAF A;  1IBM K;  3C95 A;  3ENO A;  3ZEU B;  1EQY A;  1UAX A;  3K9K A;  2OPQ A;  4LH4 A;  4H0T B;  4F9O A;  2WC9 A;  1WB9 A;  2A5X A;  4EP5 A;  4CE9 A;  2E2N A;  3AV9 A;  3D7E O;  4H0X B;  1EO1 A;  4RW8 A;  3UE5 A;  1XNQ K;  3IKM A;  4YY3 K;  1QE1 A;  3CQ8 A;  4O8U A;  3UB5 A;  1YF5 L;  4I2P A;  3P38 A;  3SNN A;  4DS4 A;  4B9V A;  4DQS A;  1JKH A;  3O4Q A;  4RCH A;  4JAX A;  2QEX N;  1IKV A;  3O8M A;  4BR2 A;  3PSF A;  5J2P A;  4CJF A;  1YIJ N;  2IVP A;  5AQL A;  4F3T A;  1S6Q A;  5KTQ A;  3AA4 A;  5EOY A;  3HOT A;  4WF9 L;  4DV4 K;  3T1Y K;  2FBV A;  2KTQ A;  2XO7 A;  2E1Z A;  3ISN C;  4LF5 K;  4NCB A;  4LF6 K;  1NGG A;  3C7N B;  3M8R A;  4CK1 A;  1WAF A;  4CZI A;  3QDK A;  4WYB A;  4A59 A;  2UXD K;  3KLF A;  3MAQ A;  3R1X A;  4CZL A;  2Z1J A;  3DM2 A;  4BG8 A;  3SV4 A;  3CM6 A;  1Q86 O;  4KHY A;  1BU6 O;  3OA9 A;  4RG8 A;  2ATQ A;  1KSP A;  3A0I X;  4OPH A;  5HL7 L;  3WEE A;  5I42 A;  5C15 A;  4Y1C A;  3WUH A;  2O8D B;  4H8K A;  2F7T A;  3AAR A;  2HND A;  4GVM A;  1MU2 A;  1NK4 A;  1N5Y A;  5ADX H;  3EYZ A;  3U8X A;  1NKB A;  3OVN A;  4CI6 A;  3SMS A;  4EZ6 A;  4FJN A;  2NUB A;  2V7Y A;  1T3V A;  3F9K A;  5AQS A;  4AIL C;  2CGL A;  2D4W A;  1JLB A;  4EP4 A;  2ZD1 A;  1QSS A;  3LAM A;  3HT3 A;  4FJX A;  3EZW A;  2Q36 A;  3QFP A;  1U47 A;  1YJ9 N;  3R3L A;  1DEJ A;  3P1G A;  4O55 A;  2Q0R A;  5FRO A;  2ZJR L;  4BR4 A;  1VRT A;  3V6D A;  4H5T A;  1SL2 A;  4NXN K;  3THW A;  3OYC A;  3OYK A;  1JXB A;  1HJR A;  3L6Q A;  1WBD A;  4J2D A;  2YHX A;  2XY6 A;  1OH8 A;  2JWK A;  3R9P A;  3JSM A;  3TSP A;  4IEI A;  1HPM A;  3KTQ A;  3DRS A;  1VAZ A;  2JWL A;  1VSE A;  5SWM A;  3V9Z A;  5KQD A;  3CQX A;  3ZEU A;  3LP1 A;  3TSU A;  3MXM A;  3HJF A;  1BA0 A;  2W6L A;  5CYM A;  4HHT A;  5HRS A;  1ILY A;  3SUO A;  1VSD A;  4BC2 A;  3FGU A;  2FC0 A;  4JKG B;  1UA1 A;  3VN5 A;  3DLL L;  1W7A A;  3Q7B A;  4FJG A;  4IDH A;  4KV8 A;  3ZT4 A;  1BHL A;  1JXE A;  1H1V A;  1NGI A;  2FBT A;  3MCP A;  3PLA A;  2Z1G A;  1BQN A;  5BN9 A;  4IKF A;  3AVF A;  3TAF A;  4CEB A;  5M1N A;  4CFD A;  4QS9 A;  5M1Q A;  2YJF A;  4CZF A;  3V9W A;  3LDO A;  3EEQ A;  3VEO A;  2QWP A;  3QEX A;  3LDN A;  4BQL A;  2D1K A;  5AQF A;  4JI8 K;  3DRR A;  2UUA K;  1RDW X;  4DR1 K;  4FWP A;  4K42 A;  3VQB A;  4CJ3 A;  4JI0 K;  4GVE A;  3PX6 A;  1IH7 A;  3V1Q A;  3HK2 A;  1WOQ A;  4O0I A;  3VA0 A;  3IUC A;  3DWL A;  3M8Q A;  1L3S A;  3O9S A;  3PX0 A;  4JI3 K;  4Z4C A;  4FW1 A;  4CGG A;  4CCH A;  2V51 B;  4R5P A;  4JS4 A;  1GLL O;  1CZA N;  2P9I B;  2OTJ N;  2X6N A;  2WON A;  3N4Q A;  2OZS A;  3C6A A;  1DTQ A;  4FJL A;  2AP1 A;  4OPA A;  4M7X A;  4O4G A;  1BDG A;  1C0T A;  3OYN A;  2NNW A;  5AQG A;  1N6Q A;  3RRG A;  1HQE A;  3O6W A;  5JS1 A;  3G0Z A;  2YNH A;  2HBL A;  4BE0 A;  1MWM A;  3QNO A;  2HHH K;  1BG3 A;  4YOY A;  4JI5 K;  1BQM A;  3WT0 A;  3I8D A;  3G25 A;  3ZET B;  2G8W A;  3L3V A;  4BR5 A;  3OY9 A;  2HVI A;  3ULD A;  3H1V X;  5AQY A;  3KK1 A;  3AVI A;  4C8L A;  4AM7 A;  3QES A;  4KHU A;  3ULE A;  4IFV A;  2O8B A;  1TKT A;  1ZYQ A;  2P51 A;  4IG0 A;  4RW7 A;  4DSK A;  1YJN N;  5EX5 A;  4JRP A;  3TAQ A;  4Z4H A;  4EHT A;  3VQ6 A;  1RT6 A;  3HBT A;  4JI1 K;  1VQ8 N;  4FLX A;  4CZG A;  3OTO K;  3OS2 A;  2KFZ A;  4FWR A;  1VSJ A;  1ATS A;  1HLU A;  1QQM A;  5LMU K;  3HL8 A;  1BIS A;  4CEA A;  3BEX A;  1RDA A;  4M3Y A;  4J8F A;  2G8V A;  3O9R A;  5E84 A;  3VES A;  4JK7 A;  1TAQ A;  1D5A A;  1S1U A;  3CJ9 A;  1KC8 O;  4CJ7 A;  1ZBI A;  2P9N A;  3H1Q A;  3JAM O;  3A5M C;  4ISG A;  2F8T A;  3OYL A;  4GMJ B;  1P8Z A;  2FSK A;  4WFN L;  5BR8 K;  3HP9 A;  2O8F B;  3LAN A;  1UA0 A;  4YHH K;  4A57 A;  3OYA A;  1CXU A;  4E89 A;  4NYN A;  3K2P A;  1RBS A;  1JL2 A;  1HUX A;  1QVG M;  2QWO A;  1YJW N;  3LDL A;  4BE1 A;  1K8A O;  3SUQ A;  3NF8 A;  3ZSV A;  4FWS A;  1Q8I A;  4DV0 K;  4CJQ A;  3B8A X;  5LJV A;  5LL6 Z;  2FSN A;  4FLW A;  3N4P A;  3C0B A;  4DSE A;  2DY4 A;  4PKG A;  3M1F A;  4KHS A;  2GV9 A;  1XHX A;  2ASM A;  2V52 B;  5IWA K;  1QZ5 A;  5AR0 A;  4HCC A;  4LY7 A;  3CJC A;  3NE6 A;  4H03 B;  4IO9 L;  4Y1D A;  1WSI A;  4FL9 A;  3TWH A;  4DTS A;  5FRN A;  2NRW A;  4K0K K;  3NGI A;  1HR0 K;  4DU1 A;  3ZSR A;  4E1N A;  4C23 A;  1NLV A;  3DLK A;  3K5N A;  3VGL A;  4BRL A;  3VEX A;  5AZJ A;  3RRH A;  4KPY A;  4KHQ A;  3O3F A;  3V9U A;  3G71 N;  5ELZ A;  2HHX A;  4BR9 A;  4UY8 O;  1VSH A;  2W40 A;  4CJW A;  3BY5 A;  4FWM A;  3PO4 A;  3RMB A;  2IIR A;  3FR0 A;  4IO8 A;  4OJR A;  4B9N A;  4RW9 A;  1VRU A;  1U2V A;  2OPS A;  2FF6 A;  4CEZ A;  2VGM A;  3ZT2 A;  1U48 A;  2B4J A;  4BRH A;  1EWQ A;  4H5N A;  4MO4 A;  4BRI A;  1NJZ A;  4DTX A;  4RWT A;  1SQK A;  4C8N A;  3IAY A;  3L2R A;  4BGB A;  2O4I A;  5BN8 A;  3CYM A;  3WNE A;  1ITG A;  4YOV A;  4HUF A;  4DF8 A;  1WSJ A;  1L3U A;  1GLF O;  1BWF O;  2I5J A;  4CJV A;  5KPT A;  4XH1 A;  1EX4 A;  5AQI A;  1GLE G;  1NGF A;  4A62 A;  4ELU A;  2ZE2 A;  3MDQ A;  3IMX A;  3HXM A;  3M8P A;  4FWQ A;  3AO1 A;  1LWC A;  4GW6 A;  3JS6 A;  2W41 A;  5EXW A;  5H1S Q;  1BO5 O;  1B9F A;  3CM5 A;  3L4Q A;  3UKR A;  4A61 A;  3ZET A;  5M1O A;  3VF6 A;  2Z1I A;  4FJ7 A;  2F9W A;  3MMV A;  4K8X A;  1DKG D;  3MN5 A;  3K59 A;  3RTV A;  4FVU A;  2VG7 A;  1KVA A;  4BC3 A;  2B5J A;  3IG1 A;  4N76 A;  4I6M B;  5LY3 A;  1V4T A;  5BRD A;  3CFR A;  2DFF A;  4YOT A;  3QBX A;  4N5S A;  3VEW A;  3F2K A;  3WNG A;  2RF2 A;  2EWS A;  4W5Q A;  2G8U A;  3TTF A;  3W0L A;  3NGZ A;  1JCE A;  3CXC M;  4B3O A;  3SBT A;  2E2Q A;  2HF4 A;  4KFB A;  3CFP A;  4IXC A;  3C94 A;  2BGG A;  1D8Y A;  3FE1 A;  5M1K A;  1X9J A;  1XI1 A;  1SL1 A;  3HP6 A;  2W42 A;  2YX6 A;  4JK8 A;  2NRT A;  3QML A;  2G8K A;  1D4X A;  3ZT3 A;  3E9O A;  3VQD A;  1HPZ A;  1RT5 A;  4JKH A;  4CJR A;  3WNH A;  3HVT A;  1BCM A;  1NM1 A;  4E0D A;  4JS5 A;  4FLZ A;  1BUP A;  2PBD A;  2ETJ A;  2HOE A;  1HKB A;  3VQ7 A;  4FLY A;  4FJJ A;  3U6F A;  2P9K B;  1TV6 A;  4CHO A;  4LFA K;  1X3N A;  4ID1 A;  4R79 A;  2WUS A;  4MLH A;  2YCH A;  3SBG A;  3NFA A;  4M7Y A;  1RT3 A;  1FKO A;  1NK5 A;  2LSN A;  3WNF A;  1VHX A;  3PO5 A;  3CPW M;  2NRV A;  4LSN A;  2GBZ A;  3HOS A;  4F8R A;  4DS5 A;  3AGK A;  1IO2 A;  2QKK A;  3CJ1 A;  5AFU A;  2Y1J A;  1ATR A;  4GY2 B;  4PKI A;  2Y1I A;  4K43 A;  5AQM A;  1XNR K;  5GIP A;  3EZ5 A;  4DR7 K;  4FJ9 A;  1S22 A;  4BRA A;  4FWN A;  3AA3 A;  3THX B;  2HHV A;  3HPH A;  1C1A A;  3VEV A;  3CPE A;  1BL3 A;  1ASV A;  1SZ2 A;  3KKS A;  3D2E B;  3MN6 A;  5AQT A;  1KXP A;  5HRO A;  3KLH A;  1RTH A;  2FSJ A;  2Q1N A;  4M3R A;  5CHI A;  1NK8 A;  1EWR A;  4E7I A;  3SAG A;  1VQN N;  2ITM A;  2Q0U A;  4KTZ A;  4FZY A;  4B3R K;  1SUQ A;  1HMV A;  1ATN A;  4DV5 K;  3DOK A;  5E26 A;  3T7Z A;  1QSL A;  4JNE A;  4KRF A;  4M3T A;  3B6P A;  1FKP A;  4IOC L;  3TPQ A;  1JJ2 M;  3QEP A;  4FJI A;  1EP4 A;  4FPA A;  3E9L A;  4DU3 A;  2Q3S A;  1NGE A;  3L4I A;  2A41 A;  4MDA A;  3CI5 A;  3MXJ A;  4BRC A;  4FK0 A;  2QKB A;  1QQN A;  3CCV N;  5EU7 A;  5B8H A;  1GLB G;  2JLE A;  4KRE A;  1RDD A;  3D45 A;  1WNS A;  2ZWH A;  5JLF A;  1S6P A;  3NF6 A;  4M45 A;  4PUO A;  4MDB A;  1BI4 B;  3BP8 A;  5A2Q O;  3LP2 A;  2HVH A;  1S9E A;  4CEE A;  3TAR A;  3OYM A;  1ZBL A;  1XMQ K;  4V19 S;  2G8I A;  4W5R A;  2P9L B;  3I56 N;  4CFA A;  3ZT0 A;  4FJK A;  1C0U A;  1U45 A;  4GV6 A;  3HM9 A;  4B3S K;  3S3M A;  2NRZ A;  3BZK A;  1YIT N;  1DT9 A;  4L3Q A;  2ASO A;  4FM2 A;  4KH6 A;  3D0P A;  4KB1 A;  3HI0 A;  3SV3 A;  1EKE A;  1VQ5 N;  4BR7 A;  4FOE A;  1VSF A;  2G8H A;  5AQX A;  2GTD A;  3SAH A;  3L2Q A;  4O8K A;  3QEV A;  4CFC A;  2QWQ A;  2UXC K;  3SCX A; 
#chains in the Genus database with same CATH homology
 3CJB A;  3VET A;  3RSE A;  3NMU A;  3RSE B;  3J8A A;  4GNI A;  4BRD A;  3ID6 A;  3MWT A;  2Q2R A;  5M1N A;  3QFU A;  1GLD G;  3GE1 A;  4QS9 A;  5M1Q A;  2YJF A;  4CZF A;  3GG4 A;  1JCG A;  3LDO A;  1VQ6 N;  5AZJ B;  3VEO A;  1MWK A;  2QWP A;  2RE2 A;  3ENB A;  3W3D A;  5BR9 A;  1K73 O;  3LDP A;  2GUP A;  4B1U B;  1OVY A;  2P9I A;  3O1B A;  4O5F A;  4A5A A;  3VTH A;  3CD6 N;  3OBY A;  3L0Q A;  2FLO A;  3DXM A;  3ZX0 A;  3M3Z A;  4JKB A;  3LDN A;  4BQL A;  3IFR A;  2D1K A;  5AQF A;  4BVO A;  2QTD A;  5DM6 L;  4IOA L;  2VYP A;  3LDQ A;  1RDW X;  4IEE A;  3TSQ A;  4FWP A;  4K42 A;  4B1X B;  4GVE A;  1IJJ A;  1VQM N;  4NB4 A;  3VMF B;  4BG9 A;  4CZM A;  3AAP A;  4JN4 A;  4BRO A;  3A5L C;  1WOQ A;  5BPM A;  3WXJ A;  1DGK N;  1LOT B;  2HF3 A;  3IUC A;  4JKF A;  3DWL A;  5AZI B;  1VQK N;  1T44 A;  2QI2 A;  4PHT X;  2P9S A;  3O9S A;  5AQU A;  2YHW A;  1NGA A;  2V7Z A;  3CCS N;  1YAG A;  4BRP A;  2P9P A;  3UKR B;  1Q81 O;  4GV9 A;  2D0P A;  2A40 A;  1HKG A;  1TYQ A;  2NRR A;  5EVZ A;  4BC5 A;  4PL7 A;  2V51 B;  4H0Y B;  3EO3 A;  3EE9 A;  3MCA B;  5AQO A;  1GLL O;  1CZA N;  2P9I B;  4Y0W A;  2OTJ N;  3VGM A;  3GL1 A;  3N4Q A;  1GLA G;  3C6A A;  2ZF5 O;  3WXL A;  1ZBS A;  3VTI A;  3CCR N;  3AGR A;  5FPE A;  3BF3 A;  4WCE L;  3CCM N;  3CCL N;  4BRF A;  2AP1 A;  4JD2 A;  4OPA A;  4M7X A;  2YI1 A;  4PL8 A;  3D2F A;  3CER A;  1KAZ A;  4H0V B;  1BDG A;  3C7N A;  5JLH A;  3ZYY X;  1RGI A;  2NNW A;  5AQG A;  3CCQ N;  3O6W A;  4FO0 A;  4YOX A;  1S72 N;  3FZL A;  2HBL A;  4QS8 A;  5M1P A;  4C1N K;  1MWM A;  1W2B M;  1OKJ A;  5AQW A;  1NJI O;  1BG3 A;  4YOY A;  3K9J A;  4K25 A;  5FPN A;  4CBX A;  4E1J A;  1VQ7 N;  3VER A;  3WT0 A;  5C10 A;  3G25 A;  3ZET B;  5F1X A;  4BR5 A;  2CH6 A;  4CZK A;  3CQY A;  4BRM A;  4ISF A;  3H1V X;  5AQY A;  2GEM A;  4IJA A;  4AM7 A;  1SS6 A;  3ULE A;  3VEN A;  2OAN A;  2HBK A;  1MA9 B;  3SMP A;  1XUP O;  2F9T A;  2HBJ A;  2ZGY A;  2HMP A;  2CH5 A;  5AFU H;  4FWL A;  1YJN N;  5C12 A;  1M1K O;  1YVN A;  3GOI A;  5EX5 A;  3I8B A;  3JXU A;  4EHT A;  4AM6 A;  1JCF A;  3HBT A;  4KH4 A;  4BRE A;  3VF2 A;  1NGH A;  1VQ8 N;  1YI2 N;  4CZG A;  4G9Z A;  4YDU A;  4BRG A;  5F0X A;  4FWR A;  2QM1 A;  5DM7 L;  2E20 A;  1N8R O;  4IFE A;  2UYT A;  1ATS A;  2E2P A;  1NGJ A;  3EKU A;  3C6H A;  1HLU A;  4WFB L;  1QQM A;  3H6E A;  1LCU A;  1VQ9 N;  5HOO A;  3MK6 A;  4DQ8 A;  3BEX A;  2KKZ A;  4JK9 A;  2PAV A;  3MX2 A;  4WQ5 C;  3CHW A;  5C2F A;  3CJA A;  4J8F A;  2NLX A;  4FOI A;  4CBW A;  3CMA N;  3O9R A;  5E84 A;  3TU5 A;  3VES A;  4BY9 C;  3AY9 A;  4JK7 A;  2I7P A;  2H3G X;  4WFA L;  5AQN A;  3CJ9 A;  1YXQ A;  3A8Y A;  1KC8 O;  4CJ7 A;  3Q7C A;  5GIN A;  1T6C A;  1GLC G;  2P9N A;  3A5M C;  3H1Q A;  4CD3 A;  2P9N B;  1HX1 A;  4ISG A;  5GAH P;  1P90 A;  3EKS A;  3C65 A;  3D6R A;  4YDU C;  4BRK A;  4IOX A;  1P8Z A;  3BF1 A;  2NRX A;  2FSK A;  5JMV A;  4WFN L;  1GLJ O;  5GAG P;  4U67 L;  2E1Y A;  3CC2 N;  5AQQ A;  3I33 A;  4BRQ A;  3D2F B;  4FWK A;  5EY4 A;  4A57 A;  3FZK A;  3OHR A;  3KVG A;  1TUY A;  4BGA A;  4EAH D;  4EHU A;  3VOV A;  4K41 A;  3IDH A;  5C0Y A;  4B1Z A;  1HUX A;  3HZ6 A;  3WQU A;  2KHO A;  1QVG M;  4YOR A;  3T69 A;  1HJO A;  2QWO A;  1YJW N;  1XC3 A;  3LDL A;  1K8A O;  5CR4 A;  1M90 O;  2D0O A;  1YUW A;  4ILJ A;  4M63 C;  4FWS A;  3O1W A;  1J6Z A;  4NLB A;  1X3M A;  4CBU A;  5I9E B;  3B8A X;  1Q7Y O;  1XQS C;  5LJV A;  5AZI A;  3LM9 A;  4BRN A;  2GEL A;  2FSN A;  4H5V A;  2NRH A;  3N4P A;  3C0B A;  3ZX3 A;  4PKG A;  3MN9 A;  3M1F A;  4IJN A;  3UKU B;  5JIC A;  2ASM A;  1O13 A;  2V52 B;  1QZ5 A;  4FWO A;  5AR0 A;  4EIA A;  2E2O A;  1ZXO A;  4IZ9 A;  5TKY A;  3CJC A;  4JHD A;  4H03 B;  4IO9 L;  1YHQ N;  1S3X A;  3E1Y A;  4FL9 A;  1C0G A;  4H5R A;  5GIO A;  3ATU A;  3O08 A;  2NRW A;  5AQH A;  3ULE B;  3VEZ A;  4C23 A;  3PIO L;  3F9M A;  3ID8 A;  1NLV A;  3TTD A;  3WXI A;  3R8E A;  4CZE A;  3VGL A;  4BRL A;  3VEX A;  3AAQ A;  5AZJ A;  4GV3 A;  4EFH A;  4ILG B;  3CCJ N;  3DXK B;  4DKW A;  3QB0 A;  4MO5 A;  1QVF M;  4B9Q A;  3H3N O;  3O5B A;  3F5T A;  3G71 N;  2WBN A;  5ELZ A;  2WFB A;  4WQ4 A;  3LL3 A;  2A42 A;  5FPM A;  4BR9 A;  4UY8 O;  2W40 A;  2HBM A;  1K9M O;  2ZGZ A;  3J7Z O;  4DHY A;  4FWM A;  3CET A;  4HWI A;  2GX9 A;  4OO1 J;  2E88 A;  2BUP A;  1HKC A;  3CIP A;  2Q31 A;  4RTF D;  2IIR A;  3FR0 A;  4XH4 A;  2FF3 B;  4IO8 A;  3FZM A;  4FSV A;  3WXK A;  4YOW A;  1KD1 O;  1NMD A;  1Z6R A;  1U2V A;  2FF6 A;  3GDQ A;  2VGM A;  5TKW A;  4B1V A;  3KWI A;  3WQT A;  5BPN A;  4BRH A;  1RDU A;  4XH5 A;  3M5R A;  4H5N A;  1K8K A;  4MO4 A;  4BRI A;  2QA4 N;  4RWT A;  4JKG A;  1SQK A;  2DPN A;  3E9P A;  3SK3 A;  1TUU A;  4BGB A;  1U6Z A;  2VGN A;  5BN8 A;  3CCU N;  1NBW A;  4YOV A;  4B1W B;  3D2E A;  3O4W A;  3G6E N;  4I6M A;  1GLF O;  1BWF O;  2CGK A;  5KPT A;  4BR0 A;  3ZX2 A;  3SJH A;  4XH1 A;  2QWL A;  3HM8 A;  1GLE G;  2QW9 A;  2P9U A;  2P9L A;  1NGF A;  2KLA A;  2NZT A;  4JKC A;  5AQI A;  5F2R A;  1VQ4 N;  4HTL A;  4A62 A;  5AQV A;  3MDQ A;  4PKH A;  3DAW A;  4ISE A;  2OTL N;  3IMX A;  4KH5 A;  4NLC A;  4H5W A;  3CCE N;  4JKD A;  1BOT O;  2QWN A;  3S41 A;  2E8A A;  3MX5 A;  3P39 A;  3WXM B;  4FWQ A;  5C2D A;  3VEY A;  1NGC A;  4H0P A;  2QWR A;  3JS6 A;  4CZH A;  2W41 A;  4LC9 B;  1U2V B;  5EXW A;  4CD1 A;  2IVN A;  1NWK A;  3SAF A;  5H1S Q;  3ENO A;  1BO5 O;  3ZEU B;  4MLE A;  1EQY A;  1G99 A;  4A61 A;  3L4Q A;  2P9P B;  3RVC A;  3UKU A;  3K9K A;  3UKR A;  5M1O A;  3ZET A;  1E4G T;  3SLC A;  3FLC O;  1VQL N;  4H0T B;  4F9O A;  5BRE A;  3VF6 A;  4U7B A;  2F9W A;  2WC9 A;  5AQR A;  3MMV A;  3A5N C;  3OW2 M;  1DKG D;  3MN5 A;  1RFQ A;  2A5X A;  4FVU A;  4BC3 A;  2E2N A;  3D7E O;  4I6M B;  5MLC Q;  4H0X B;  5LY3 A;  1V4T A;  3UE5 A;  5BRD A;  1EO1 A;  4YOT A;  3QBX A;  3O9Q A;  3IKM A;  3DXK A;  1VQP N;  2BH1 A;  4JEP A;  3F2K A;  3VEW A;  3P4I A;  3OBW A;  3KHY A;  2GWJ A;  4O8U A;  2EWS A;  3UB5 A;  4BC4 A;  1KQS M;  1YF5 L;  1T6D A;  3TTF A;  3P38 A;  3W0L A;  1ZC6 A;  2VCP A;  3A5O C;  3DXM B;  1JCE A;  3CXC M;  3SBT A;  1Q82 O;  2E2Q A;  2HF4 A;  2FXU A;  3FFK B;  3WEE B;  4IXC A;  4RCH A;  5BRH A;  3FE1 A;  2VWB A;  1BA1 A;  1X9J A;  4JAX A;  5M1K A;  2QEX N;  1NGB A;  5AQZ A;  2YX6 A;  3O8M A;  5AQJ A;  2I7N A;  2NRT A;  4JK8 A;  4BR2 A;  3QML A;  1D4X A;  1QZ6 A;  1YIJ N;  2IVP A;  3E9O A;  2AA4 A;  4JKH A;  1WUA A;  4YOU A;  5AQL A;  2A6A A;  1NM1 A;  1QHA A;  5EOY A;  3I55 N;  1BUP A;  2PBD A;  3P31 A;  3HRG A;  3DJC A;  3HOT A;  2HOE A;  3KZB A;  4WF9 L;  2P9S B;  1HKB A;  2HST A;  1K8K B;  3QIC A;  5KPR A;  3KWG A;  1IG8 A;  3QBW A;  2P9K B;  4FPB A;  3VPZ A;  2E1Z A;  4AF1 A;  1X3N A;  2ZJP L;  4R79 A;  3MWP A;  3TTC A;  2WUS A;  4MLH A;  2YCH A;  3SBG A;  1NGG A;  3C7N B;  4M7Y A;  4WQ5 A;  3O9U A;  4CZI A;  3QDK A;  4WYB A;  4A59 A;  4A5B A;  3G4S N;  3NVM A;  2A3Z A;  3U4L A;  3R1X A;  3VF4 A;  4CZL A;  3CPW M;  4BVP A;  2NRV A;  4BG8 A;  4BQZ A;  3U9Z A;  3HOS A;  4DB3 A;  3AGK A;  1Q86 O;  1BU6 O;  3CJ1 A;  5AFU A;  3OA9 A;  1ATR A;  4GY2 B;  2J4R A;  4PKI A;  3H3O B;  4K43 A;  1SAZ A;  1V4S A;  1NGD A;  5AQM A;  3CF5 L;  3A0I X;  5GIP A;  4OPH A;  5HL7 L;  3WEE A;  5C15 A;  2IVO A;  3WUH A;  4DCH A;  5CE3 A;  1S22 A;  2F7T A;  2RHK A;  4BRA A;  4FWN A;  2GWK A;  3AAR A;  5AQP A;  5FPD A;  4Z94 A;  1KAY A;  1VQO N;  5KQ8 A;  3VEV A;  3CPE A;  1SZ2 A;  4CZJ A;  3D2E B;  5ADX H;  3MN6 A;  3U8X A;  5AQT A;  1KXP A;  2CGJ A;  3PIP L;  4CI6 A;  3SMS A;  4KBO A;  2FSJ A;  2Q1N A;  2V7Y A;  5CHI A;  1QQO A;  3U9D A;  1T3V A;  3KK7 A;  2PFU A;  5AQS A;  3SAG A;  2CGL A;  2D4W A;  1VQN N;  4NO7 A;  2ITM A;  2Q0U A;  3FZH A;  3HTV A;  4JHD B;  2QWM A;  4JKE A;  3EZW A;  2Q36 A;  3VGK A;  3QFP A;  1ATN A;  5E26 A;  3T7Z A;  3H46 O;  1YJ9 N;  3R3L A;  1DEJ A;  4JNE A;  5BPL A;  2Q0R A;  2ZJR L;  4WQ4 C;  3ATV A;  4BR4 A;  4C1N I;  4IOC L;  4H5T A;  3H45 C;  3TPQ A;  1JJ2 M;  4JD2 B;  1KAX A;  3BUZ B;  2BTF A;  1C0F A;  3L6Q A;  3E9L A;  4FPA A;  1TYQ B;  2YHX A;  3FZF A;  2JWK A;  3R9P A;  1NGE A;  1Y64 A;  3L4I A;  4IEI A;  2A41 A;  3TSP A;  1HPM A;  4MDA A;  3CI5 A;  4BRC A;  4A2B A;  1VAZ A;  2JWL A;  3GBT A;  1QQN A;  3CCV N;  5B8H A;  2QXL A;  2ZJQ L;  3O80 A;  4A2A A;  5KQD A;  1GLB G;  3EE8 A;  3CQX A;  5JVH L;  3ZEU A;  1R59 O;  4H0O A;  5AQK A;  5KPZ A;  5M1F A;  1E4F T;  3R6M A;  1ESV A;  2ZWH A;  3TSU A;  5JLF A;  3LM2 A;  1BA0 A;  3BP8 A;  4MDB A;  4ILH A;  1Z05 A;  5ADX A;  2Q97 A;  2YJE A;  1ILY A;  4XEI A;  4QS7 A;  4BC2 A;  5LJW A;  4IWV A;  2YHY A;  3FGU A;  3E66 A;  3O9T A;  1W97 L;  2P9L B;  2P9U B;  3I56 N;  5JVG L;  4JKG B;  3CME N;  1Q18 A;  1MDU B;  3CC7 N;  5GAE P;  3CC4 N;  4B1Y B;  3DLL L;  3Q7B A;  3EL2 A;  4GV6 A;  4IDH A;  2NRZ A;  1YIT N;  1DT9 A;  4L3Q A;  2ASO A;  3EN9 A;  1H1V A;  1NGI A;  4KH6 A;  3HI0 A;  3MCP A;  1VQ5 N;  3PLA A;  5BRF A;  3NVK A;  4BR7 A;  4FOE A;  3MN7 A;  5BN9 A;  5AQX A;  2GTD A;  2P9K A;  3CJ7 A;  3SAH A;  3ENH A;  3M6G A;  4O8K A;  2ASP A;  3HSC A;  2QWQ A;  5GAD P;  4JKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...