4WFNL

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22 in complex with erythromycin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
b'RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wfnL01
1M1KO 1N8RO 3CCRN 3CC2N 3CCLN 5DM6L 3CC7N 3OW2M 3CCJN 3CC4N 1K9MO 3DLLL 1YITN 1VQMN 1YI2N 3PIOL 3G6EN 4U67L 5GAGP 3CCSN 1S72N 1JJ2M 4UY8O 5GAHP 1VQNN 5H1SQ 1QVGM 5GADP 2OTLN 3CPWM 3PIPL 1VQLN 1YJ9N 4IOAL 1YJWN 3CMAN 1QVFM 1VQ6N 1VQ9N 1Q81O 1YHQN 1VQ5N 3CCUN 3CF5L 3CD6N 1K73O 3CMEN 1KC8O 4IOCL 3CCQN 1VQ8N 5GAEP 3CXCM 2ZJPL 2QA4N 1VQ7N 4WFAL 1VQPN 4IO9L 1W2BM 1M90O 4WCEL 1K8AO 2QEXN 4WF9L 1Q7YO 1Q86O 3G4SN 1NJIO 5DM7L 3I56N 3I55N 1VQ4N 3CCEN 1Q82O 1KQSM 1YJNN 5MLCQ 5HL7L 3CCMN 1YIJN 3G71N 3J7ZO 5JVGL 4WFNL 2ZJQL 3CCVN 2ZJRL 1ILYA 2OTJN 1OVYA 5JVHL 1VQKN 4WFBL 1KD1O 1VQON
chains in the Genus database with same CATH superfamily
4JI6K 4N47A 1RDDA 4Y1DA 2HHHK 1VSEA 1RNHA 3F9MA 2WFBA 3T3FA 3NVMA 4FLXA 5LL6Z 3KWIA 2YI1A 3ZLJA 3LPUA 1KSPA 1T44A 3TARA 4CEDA 1MWKA 3NBPA 5EY4A 3SUPA 2HW3A 3ALYA 3LM2A 3AVCA 4XIUA 2VWKA 3CIPA 3ZT1A 1Z26A 2QWPA 1QVGM 3VOVA 2F8SA 4KH6A 4CZKA 4DS5A 3L2UA 4IEEA 4X66K 3HPGA 4WQ5A 5DK5A 1HNIA 1K8KA 3AVFA 2O8CB 3ULDA 2G8KA 1N36K 1BISA 2ZGZA 4PL7A 4EAHD 3MCAB 2NRRA 1RTDA 4FJ7A 2W41A 3NE6A 1WAFA 3CF5L 3CD6N 3K59A 1RBVA 3SJJA 1QSSA 1HKGA 1VQ8N 4I6MB 1BDGA 2ASPA 3AARA 3D45A 4JK9A 3VQCA 5F0XA 3CXCM 1SKRA 1TAQA 3HYFA 1XNRK 4BE2A 1K8AO 1T7PA 1HMVA 3VEYA 4FL9A 3QEXA 4CFCA 4DSKA 4CEEA 3A5NC 5ADXA 4HUEA 3I56N 1HKCA 3PLAA 4N56A 3DLHA 3J7AP 4YORA 4DU3A 3VGLA 5HL7L 1YIJN 4CK3A 1HPMA 4IFEA 4J2BA 1XHXA 3J7ZO 5JVGL 3UKUA 2E2OA 1IV0A 2ITGA 1OKJA 3MK6A 3JXUA 3MN6A 3RTVA 4J2AA 4FK4A 2W40A 3I0RA 3F5TA 3NH0A 3KLEA 1N33K 1RTIA 3OTOK 4LFAK 1NGFA 3CCLN 2JWKA 1EO1A 4JI7K 1DTQA 1NGGA 1SAZA 4B1XB 4JI2K 1SKWA 5JICA 3DOKA 3SPZA 4B9SA 2VQEK 3R6MA 2WUSA 1JCGA 3O4WA 2WONA 3DOLA 2NRHA 4U67L 4M3ZA 3RR8A 4JI1K 2OCEA 3O5BA 4YHHK 3RR7A 4AQYK 3O1WA 4RW9A 4CHPA 3O4QA 4A62A 5KPTA 5AQKA 2HNZA 4CI6A 4CFBA 3VQ5A 4CJ7A 3UB5A 3V1RA 2NUBA 3HRGA 1ASUA 3ISNC 3S3OA 3QEVA 3SUQA 4FPAA 3EN9A 5C24A 4JV5K 4FWRA 3O1BA 2Y1IA 3R1XA 1JCFA 3ITHA 1Y97A 1KC8O 3ENBA 1JXEA 2Y1JA 2BH1A 3I33A 1BA1A 1BWFO 3FZLA 4F2RA 1TYQA 3TAPA 1VQPN 2Q1NA 4BDPA 4BRHA 2Q31A 4Y0WA 4B3OA 4DQQA 3GG4A 4ZHRA 4CHYA 4KO0A 4GW6A 1MWMA 3NGYA 5CHIA 4DS4A 4YDUA 2PZSA 2O8EA 4DSEA 2DTUA 3VEOA 1O13A 2RN2A 4CJQA 2O8DA 3TSPA 3PY8A 4BC2A 5MLCQ 3SQ0A 5BPMA 2X74A 5F1XA 3THYA 1XC9A 3KD1E 3AVLA 4PHTX 4FLWA 4J2DA 2YNHA 1NKEA 1YTAA 3O9UA 3VENA 1NOZA 1UA1A 3KK1A 4M3XA 1NM1A 4KHSA 3AY9A 4I9QA 4FW1A 1ATSA 1TL3A 3C6TA 2UXDK 4JEPA 4CCHA 4QOZB 1O1WA 1WBBA 4BY9C 2CH6A 2AA4A 3FZHA 4FVUA 4AM7A 4LFBK 1TKXA 4XH4A 2FBTA 3K58A 1C1CA 4M7XA 1A5WA 4UY8O 4N41A 4LF8K 3S41A 4LD0A 2NRTA 3VMFB 3Q7BA 3CFPA 1JLAA 2XY7A 2KQ2A 2P1JA 3VQEA 1Q18A 4DKWA 4JD2A 5FRNA 3MN7A 3CMAN 4CEOA 1W9HA 2V7ZA 1YTUA 1W0HA 1IBLK 3WEEA 1NGCA 4F9OA 4FWPA 2X78A 4JKAA 2VG5A 1U04A 1YVNA 1R59O 1S5JA 3H08A 4BG8A 4DU1A 2O8BA 3MXMA 2HHSA 1WAJA 3OS0A 1LW0A 3B6OA 4JI0K 1JLCA 1X9JA 3OYEA 3LP1A 4GVMA 2WBNA 3TAQA 3A5OC 1CLQA 4AH9A 2RPIA 4K8XA 2D0OA 4FSVA 4KKOA 4A5AA 4UQGA 2E5LK 2G8FA 1QTMA 4CGDA 5AQPA 2HHWA 2Q0RA 4GV6A 4J2EA 3MDQA 1KVCA 2KHOA 4CJUA 4W5OA 3VESA 4DTXA 4H5WA 1NBWA 4DV0K 3VF4A 2D0AA 2XRIA 1FKPA 5FRMA 1TV6A 3ULEB 1A5XA 4BRCA 4B9UA 4CJ3A 3JS6A 4B8AB 2P9IA 4KFBA 4FWQA 1WN7A 4IO8A 1KLMA 3JSMA 4NXNK 1QE1A 4RW6A 3SI6A 2UUBK 3THVA 2P9UA 5AZIA 3OS2A 1RT5A 3KHYA 3NF9A 1VSKA 4FJNA 4M41A 3OY9A 3WNHA 4BDYA 3THWA 1S1UA 3C0BA 4DTPA 1KAZA 3CPWM 1B9DA 4M7YA 1S6PA 5HROA 4ELUA 2QWQA 3EEQA 4DQRA 4KAZA 2ZF5O 5HRRA 3HL8A 4Z4HA 5HRPA 4KREA 3ZT2A 4X62K 3MWTA 4QCLA 2D0PA 2NRXA 1E4GT 3VQ7A 3LP3A 4QAGA 4BWMA 3H6EA 4A5BA 3D6RA 3P31A 4CJLA 2ZJPL 1E3MA 5J2MA 4CD3A 1BL3A 4MO4A 3LANA 4IOXA 3JAMO 1Q86O 3G4SN 3TAMA 3HO1A 1X9SA 3F73A 3KKRA 2J4RA 3RRGA 2V51B 1L3VA 1QZ6A 1Q82O 3OYHA 3L4QA 4FJLA 1RTJA 3ZSXA 2OANA 4AHTA 4PQUA 4X65K 4H0PA 4JK8A 4FLZA 2D0CA 3SBTA 3J80O 3ZT4A 4BRNA 4BQLA 3HXMA 3DLGA 1TUUA 3FFKB 1ASVA 1NGIA 5CR4A 4OGCA 4BREA 1S9GA 2ITMA 4CVNE 1KD1O 4O8UA 3WXLA 4KV8A 3DXMB 1U48A 3P39A 5AZJB 1WSHA 4BACA 5HOOA 5JLFA 4DFPA 2VCPA 1NGHA 1X3MA 4WQ4A 4I6MA 3B6PA 1S9EA 4X64K 3I8BA 1EXQA 1VRTA 3VQBA 4DUZK 4H8KA 3E9OA 2IVNA 3CJAA 1MU2A 4NB4A 1IKXA 1S72N 1L3SA 4FJ8A 4H5TA 5AQLA 4E1MA 2VG6A 4MO5A 4DQPA 3ZETB 3OS1A 3WXKA 1WUAA 2X6NA 3WXJA 5D3GA 5AQTA 2OZSA 5T7BA 5KGXA 2OA8A 4JKEA 2FBVA 4CEBA 2OZMA 1QQCA 1VQ9N 4HUGA 4RTFD 1NKBA 2D4WA 4FJMA 1HNVA 3ZCMA 4OVLA 3ASMA 1U2VB 5AFUH 3ZSRA 1V4TA 4KHYA 2KZMA 4GMJB 1OVQA 4ILJA 2IAJA 4FJXA 3AVIA 1TK5A 3VEXA 4H0TB 1JXBA 3MN5A 4W5RA 1RBUA 5HRNA 3QEIA 1JL1A 1NU0A 1VSFA 3KLHA 4ICLA 4B1YB 4JHDA 1GLDG 1NK0A 3QB0A 4B1UB 1X9WA 4M3YA 3HTVA 4DTMA 3DRSA 5M1PA 1J5OA 3KD5E 1QQNA 4CZGA 4AHUA 2ASMA 4LH5A 1RGIA 5EOYA 1YJNN 2Z1HA 3V1QA 3C6AA 3O9SA 1C0GA 4FJGA 1GLEG 1HKBA 2HF3A 3DRRA 4JRPA 3HPHA 3CJ7A 3SQ2A 3HZ6A 4CGFA 3RRHA 3VEWA 5LMNK 4QS7A 2A1SA 3UKRB 2W42A 4BE0A 4CIGA 2GBZA 2FF3B 5DM6L 3R9PA 4CZEA 1CXQA 5GIOA 1D4XA 4G1QA 3CC4N 3CCJN 5IT9O 3QBXA 3BZCA 1C0UA 2IDOA 4EHUA 1LCUA 5LMUK 1YITN 4DSIA 1N6QA 2NNWA 2YNIA 1WSEA 3GOIA 2G8IA 4BQZA 4RW4A 3PIOL 1ATRA 5HRSA 1ITGA 1BGXT 1SUQA 1D5AA 2QWLA 4TSXA 3DJCA 4CHZA 4DHYA 2PBDA 4W5QA 2OPSA 5GAHP 1SQKA 2FSNA 2WTUA 4RW7A 4LF6K 3K5MA 2A3ZA 2E2PA 1VQLN 4CBWA 3F9KA 3AVNA 3OVNA 3SBGA 3I8DA 1IG8A 1GOCA 3LL3A 5BN9A 3MECA 2A6AA 1VQ6N 2YHXA 1EWRA 1BUPA 3LPTA 2HOEA 3C7NA 3HOSA 1U47A 1LAVA 4KTWA 4NYNA 3RMAA 4ZTJA 1T8EA 5I9EB 3I0SA 3WT0A 5JMVA 4CJPA 4K43A 3V81A 4LSLA 1HYVA 3OYJA 1RDBA 3LM9A 3NCIA 4WFAL 3FLCO 5AQMA 4JS5A 1U4BA 4NXMK 4DV3K 1RT3A 3G10A 3QO9A 3SUOA 4E7JA 4CF9A 3OJSA 3VA0A 1JKHA 3O80A 3DYAA 3SCXA 1JCEA 3CI5A 3DXKB 2HVIA 1OH8A 4CZLA 3D2EA 4NYFA 1EKEA 4N76A 4WFNL 2RKIA 4H0YB 2YKMA 4DR7K 4IKFA 3IFRA 3CQ8A 2KLAA 3AO3A 1KFSA 2XY6A 4MDAA 3OYNA 1TK0A 1J6ZA 2V7YA 3HI0A 3L3VA 4JAXA 1M1KO 4W5NA 1HR0K 1YVUA 5HBMA 2HB5A 4BVPA 1E4FT 3OW2M 2BDPA 3HVRA 4JI8K 1VSIA 4DTNA 4F2SA 3S3NA 4NLBA 1L3UA 3AO2A 1VQMN 5AFUA 3QDKA 4CZIA 2JLEA 3KK2A 4C8LA 4CBUA 2E88A 1G15A 1QHTA 3MN9A 1XHZA 4K0KK 5KPRA 3P83D 4U7BA 1C0MA 1U49A 4DUYK 4PY5A 3GDQA 1HYSA 4CF0A 4B9VA 2YHWA 3GBTA 3U9ZA 3T19A 1HLUA 1TKTA 4JLHA 4B9LA 2A40A 5AQIA 1D9FA 4CJ5A 3VEVA 4EP4A 3THXB 3AO1A 4F8RA 4CGJA 1QVFM 4H5RA 4KH5A 3CERA 2HVHA 4DR5K 4KRFA 2IS3A 1YHQN 1XUPO 1I94K 3W0LA 4EHTA 4Z4FA 4Z4EA 4IDHA 3TANA 3Q7CA 1JL2A 3ULEA 2HBMA 4BRQA 5CZ2A 3VF2A 5LJVA 1SL1A 1NGEA 3D2FB 3KLGA 5KPZA 4WQ5C 4IWVA 4H03B 3KZBA 4B9NA 3PSFA 1W2BM 2HBKA 3CQXA 4YFUA 3CG7A 4DR6K 5HLFA 2UYTA 3C6UA 4EP5A 4DR1K 1NG9A 1N5YA 5A2QO 5DM7L 4IBNA 3SMPA 4CZHA 1SL0A 4HCCA 2P9PB 2GELA 1JLEA 2XHBA 3WQUA 3CCMN 3U8XA 4CZFA 2WOMA 1EX4A 1NGDA 4FJJA 5EU7A 3AVKA 1KAXA 2QM1A 2E20A 2JWLA 4E7LA 3JYTA 2ZJRL 1VRUA 4CGIA 2QXFA 3NAEA 5C0YA 4WFBL 2HHUA 1TVRA 4B9MA 5BR8K 4DB3A 1JLQA 1NGAA 1KAYA 3TTFA 3L2VA 1Q9YA 4BE1A 4KI4A 2O4IA 3HSCA 4OKJA 4MQ3A 3BF1A 3BP8A 4JI3K 2F7TA 3VERA 4AM6A 1FXXA 4BROA 1SL2A 3WXIA 1CZBA 4GKKK 2KFZA 4BRAA 4IFVA 4AHCA 5GAGP 2O4GA 3HP9A 4FWOA 2PYLA 2F9WA 3VEZA 1IKVA 3G0ZA 2Q2RA 3PSIA 2E1ZA 1UA0A 2Q0UA 3QLHA 3PIPL 3MMVA 5C10A 1FJGK 4H0VB 4JKDA 3NH2A 3W3DA 1YJWN 3QINA 4H4OA 1QZ5A 5HP1A 4ELTA 4CBXA 2Z1JA 2VGNA 1UAXA 3O6WA 1D9DA 4IOCL 3SV3A 3NFAA 3VQ4A 3WNGA 4GVEA 1J9AA 1RT2A 3DXMA 1WOQA 5AZJA 3ATVA 4DSLA 5B8HA 3VTIA 4IO9L 1RT4A 3ZSVA 3V9UA 1NK6A 4WCEL 3L2WA 3T1HK 2P9SB 1QSYA 3VTHA 2YHBA 3K5OA 4LF9K 4M3TA 1NGJA 5C25A 4GV3A 1RT1A 4FW2A 1VAZA 2RHKA 5ELZA 1V4SA 5AQFA 4CF1A 2XO7A 5JS2A 4BC5A 5I42A 4PKIA 1VQ4N 4PA1A 5CY4A 3LAMA 1VSHA 1YF5L 3IDHA 1EETA 2NLXA 3K2PA 4KTZA 3EY1A 3AVGA 4FLVA 3L2QA 3G71N 4WYBA 3SYZA 3ZETA 3NF6A 3T7ZA 2E8AA 3OBWA 4A61A 4BRLA 5EVZA 1IBKK 2GWJA 4CERA 3M8SA 4CZJA 4MDBA 1HNWK 4HTUA 4DSFA 1HYZA 3NF7A 4DTSA 5AR0A 3CFOA 4R79A 4FZXC 1J5EK 5FPEA 1BQNA 1N8RO 4YDUC 3C6HA 3UKUB 1U2VA 4DV7K 1K9MO 4FLYA 2FSKA 4FLUA 5AQHA 4DFJA 2FXUA 2X6SA 3ZEUA 3KJVA 4H4MA 1CZAN 1T3VA 4DV4K 1DKGD 2HNYA 4N5SA 3S9HA 3V4IA 3BZKA 4FWKA 1R0AA 3N4PA 4FJKA 3MXIA 3P1GA 1C6VA 4CK1A 4KHQA 4K42A 1NOYA 1ZBLA 3NMUA 4DTUA 1VSMA 2IGIA 4ID5A 3U6FA 2F96A 2EWSA 2Q97A 3EZ5A 2P9NB 3LWMA 3QICA 1HJOA 3CQYA 3TPQA 1K73O 2ZGYA 4KHUA 3OBYA 3PV8A 2O8FB 3UKRA 3CJ9A 2VWBA 5JLHA 3CPEA 5GAEP 5AQUA 3DLBA 3OYLA 4KHNA 1M90O 1A5VA 2BE2A 3M8QA 1NMDA 4M45A 4DG1A 4ID1A 2YJEA 4WF9L 4OLBA 2Z1GA 5IWAK 3VA3A 5SZTA 2NRVA 1NJXA 3E66A 1DGKN 4C1NK 2QWMA 2I7NA 3DLKA 4LSNA 3AAQA 4YNQA 1FK9A 2P5GA 1S3XA 5GINA 3L2RA 3SZ2A 4M42A 5AQSA 4CJRA 2KTQA 4FVMA 3VQQA 1I39A 1RBSA 3VGMA 3SAFA 4CF8A 2O8EB 1FKOA 2YCHA 4B3TK 3TABA 3AV9A 4CJWA 1NK9A 1HQUA 2NRWA 2QXLA 3FZMA 1VQON 4JYAK 4DV6K 3H1QA 1VK0A 2RE2A 2HBJA 3AVBA 4OPJA 4LF5K 1HRHA 1Q8IA 4CGHA 3SLCA 1G99A 2O8CA 2KW4A 4DQ8A 3CCSN 4FO0A 4O4GA 1IO2A 4IXCA 1NLVA 4CEAA 3K0SA 3H46O 4Z4GA 1VHXA 4QS8A 2BTFA 3KWGA 4K41A 3AGRA 3P5JA 1TL1A 3E1YA 3AA3A 4DLEA 1NJYA 2KFNA 1IKWA 3LDSA 1KVBA 4M63C 3BY5A 3KLIA 1EP4A 1OH7A 3AVAA 4ISFA 3ZX3A 2OPRA 2P9KB 3O4NA 4NO7A 1XMOK 1OH6A 4CHNA 3QMLA 1S1XA 3M5RA 3LDOA 3OYBA 2HBLA 3L3UA 4BRPA 4GKJK 3F2KA 2HSTA 4ILHA 5KGWA 4DF4A 1WSJA 1XNQK 2ZD1A 3VPZA 4O55A 4OLAA 1RFQA 3VQ9A 3I55N 3C65A 3J8AA 3CCEN 1WSGA 4E7KA 1NK7A 1VSJA 4CW7B 1KQSM 2QKKA 3RVCA 3QBWA 3MWPA 2W6KA 3SQ4A 4KB0A 2R7YA 1N32K 2QTDA 2FBXA 2QW9A 4FM0A 3ATUA 1JLBA 2GUIA 1T03A 4JI4K 2OPQA 3P4IA 3NGZA 1KFDA 1RT7A 3THXA 3SNNA 3QIOA 2I7PA 3TU5A 3OYIA 1L5UA 2IOCA 4FWLA 1TUYA 5F2RA 1YAGA 3V9WA 1KTQA 5BPLA 4EZ6A 3KK3A 3QETA 3BF3A 3LDPA 5C15A 2HF4A 4B08A 1GLBG 1NMNA 4CECA 1X3NA 2OPPA 3M1FA 4YOTA 3VQAA 4C8NA 3EO3A 3HBTA 5AQJA 5BREA 3NVKA 4R5PA 2E1YA 4BC4A 1BU6O 4HVJA 5GADP 5AQVA 3R8EA 2HHXA 1NGBA 4L8RB 1BO5O 4NCGA 5M1QA 1QQOA 4LH4A 2P9PA 4Z0UA 4CFDA 3O9RA 3FGUA 4E1JA 5AQXA 4FZYA 2LSNA 3IG1A 2D0BA 5BN8A 4IDKA 2B4JA 5FLXO 5BRHA 1XQSC 5C2DA 3J81O 5BRFA 1S1WA 5J1EA 3TSQA 3SAGA 1NK5A 3OYAA 3O9TA 3C94A 4YOUA 2IC3A 3EYZA 3UE5A 4E89A 4JKBA 4FWNA 3NGIA 4HUFA 4B1WB 3T1AA 3M8PA 2PFUA 4OX9K 3ZSWA 5BRDA 5AQNA 2ZQBA 3IAYA 2DY4A 4DTOA 2B6AA 5C42A 1HPZA 2ETJA 4A57A 1FW6A 3BUZB 4B8CA 3ZYYX 4C1NI 4DR4K 3RSEB 3TR8A 2F8TA 4YOXA 3U3GA 3U9DA 3ID8A 1GLAG 4K25A 3QEWA 1C0FA 4CK2A 1Q9XA 4AHSA 2CH5A 1ATNA 2P51A 3SQ1A 2HHTA 1OH5A 3TWHA 1XC3A 4FCYA 4DMNA 3DM2A 3WNEA 3A2FA 4CESA 3QIPA 4BR4A 3M8RA 3ZSZA 3CETA 1HUXA 2GTDA 1ASWA 3SV4A 3QEPA 4C8OA 4FOEA 3B8AX 2ATQA 3CC7N 2UXCK 2CGJA 5FDLA 2EX3A 5FPMA 1TK8A 1TGOA 2YX6A 3FZFA 3UIQA 5EXWA 4JN4A 2FLOA 4H5NA 1BIUA 3WQTA 3GL1A 2G8VA 4O8KA 1IG9A 3EZWA 3HOTA 3LDQA 4I2QA 4JS4A 1RTHA 3MX5A 4BRKA 3EL2A 4V19S 4RG8A 4RW8A 4E3SA 2P9SA 1VQNN 4JNEA 5H1SQ 3OYFA 3SUNA 4CEQA 2OTLN 2ZWHA 5KQ8A 2WC9A 4JKCA 1N34K 2E4LA 1ZBFA 3AA2A 4Z4CA 2Q36A 1YJ9N 4OKEA 4CE9A 2P9LB 3TTCA 2YNFA 1RILA 1BG3A 4DFKA 3V1OA 1BIZA 1J53A 2XY5A 4KBOA 1Q81O 4MFBA 4CJSA 1EQYA 3CCUN 4Q0BA 2PAVA 2A5XA 4KB1A 3CMEN 1Z6RA 5M1OA 1BHLA 3C95A 3L0QA 3RMDA 3KVGA 3OA9A 3QNNA 4NCAA 5J2NA 1HNXK 1JLFA 4I9LA 1HJRA 1GLFO 4LFCK 1H1VA 1GLJO 1QS4A 3O3FA 1KRPA 1P90A 4BR9A 3MCPA 3ENOA 3NHGA 1UWBA 1SZ2A 4CIEA 3WNFA 4FJ9A 2KKZA 4EFHA 2D5RA 5E41A 3IMXA 1Z25A 4O5BA 5J2PA 2HNDA 2Q3SA 3O8MA 3VQPA 3DAWA 4IG3A 3VQ6A 1GOAA 1KCFA 3CJCA 3DI6A 4M3WA 3LP2A 5JS1A 2DFFA 1DTTA 4JHDB 3BGRA 3TAFA 1NKCA 5C12A 3CCVN 1LWFA 1U6ZA 1XWLA 2GWKA 1ILYA 2GX9A 3MX2A 2OTJN 1OVYA 3AAPA 2ZE2A 3ZT0A 3SK3A 3AA5X 3CYMA 2P9NA 4JRQA 2G8HA 1ZBHA 4M3UA 2O8FA 1MDUB 3PX4A 3H45C 4K8ZA 3K9KA 4BR5A 1ZYQA 1XI1A 5BR9A 3N4QA 5FROA 3ZSYA 1BI4B 1B9FA 4Y1CA 4ELVA 4A2BA 1U45A 3VQ8A 1TKZA 3G25A 4OPHA 2YKNA 4BRFA 1VSLA 4E7IA 4HCBA 4C8KA 3KK7A 3QESA 5SWMA 5I3UA 3O08A 4FWSA 3DMJA 3L4IA 2EHGA 3ZT3A 2HHVA 4JKGB 3WXMB 3V9XA 2XY8A 4IEIA 3ZX0A 1BCOA 2E2QA 2IIRA 3EKSA 4O5FA 5AJ3K 2F4VK 1X9MA 4Z94A 4OJRA 2G8UA 3V9SA 4BR0A 3E9PA 5FPNA 3IUCA 4BR7A 3KKSA 1WB9A 4QS9A 3AA4A 2QA4N 4DCHA 4KI6A 2VGMA 4IZ9A 4DTRA 4M3RA 4DQSA 3C7NB 5FPDA 2DPNA 3T1YK 4B3RK 3ENHA 1BQMA 2QEXN 1NJIO 4OKKA 2ZM6K 1RDAA 2V52B 3OYKA 5KRSA 2IVOA 4F4KA 1KXPA 2A1RA 3AO4A 1K8KB 3ZSOA 1NK4A 1WSIA 4DV5K 2GUPA 1C0TA 1DT9A 2I5JA 1B92A 1QHAA 1EWQA 1SV5A 2QK9A 5CZ1A 4E1NA 1IBMK 3SMSA 4E7HA 1XMQK 1NK8A 1ZBSA 3KIOA 1ESVA 3H3OB 4JKFA 5JVHL 3H1VX 3OYDA 5M1NA 5LJWA 4C8MA 4L3QA 3D2EB 4KTQA 3CHWA 1WBDA 3AGKA 4YY3K 2VYPA 4IFYA 3LWLA 2PY5A 3HJFA 1WSFA 3NF8A 3DLLL 2P9KA 3VN5A 1RDWX 1YI2N 1DEJA 1QSLA 4O44A 4AILC 3PX6A 4LY7A 1KVAA 3D7EO 3A5LC 3OHRA 1BOTO 3MEEA 3AVHA 4B1ZA 4DWIA 4I7FA 4BGBA 4NCBA 1L3TA 3WUHA 4LF7K 3AVMA 3TSUA 2DFHA 3RWUA 3V9ZA 4FLTA 3FZKA 4GV9A 1RDCA 4MLEA 4IOAL 4CHOA 3MXJA 2VQFK 4KHWA 4CGGA 4DLGA 4DFMA 2QI2A 4WE1A 4H0XB 4IG0A 1GOBA 3BEXA 1TAUA 3HVTA 2FC0A 3K9JA 3QFPA 1LWEA 4CD1A 3QERA 4G9ZA 5DMRA 1MA9B 4C23A 4FXDA 4AHVA 4FPBA 1WLJA 4O0IA 3NDKA 4FM1A 2H3GX 1S22A 4PL8A 1WNSA 2AP1A 1CXUA 4B1VA 2GEMA 4OO1J 1IKYA 1ZBIA 2IVPA 2A42A 4BDZA 3TTDA 2W6LA 1NNEA 1J54A 5E84A 4O0JA 2E6LA 3K57A 4JI5K 1HQEA 3RMCA 3DLRA 1YUWA 3LDNA 2B5JA 3QFUA 4ISGA 3J7YP 4B3SK 1C1AA 3DLEA 5TKWA 2Z1IA 2ASOA 4DTJA 4YOYA 3EKUA 4CJEA 3O9QA 4PWDA 3PO5A 3MEGA 4BVOA 4FJHA 2OYQA 4FZZA 5KQDA 4FJ5A 1VQKN 1NJWA 4BRGA 1D8YA 2QKBA 1LOTB 2VG7A 5CYQA 3CCRN 3P38A 3ZX2A 4A2AA 1TYQB 3EE9A 4PUOA 4JK7A 4CF2A 3DRPA 3HM8A 1F21A 3E9LA 5AQGA 1C1BA 1BA0A 1ZXOA 4BRDA 3LP0A 4DQIA 5M1KA 1ZBUA 5AQZA 3HPOA 4ZTFA 3D0PA 5AQRA 2BGGA 3G6EN 2RF2A 2YHYA 2UU9K 4DV1K 4LC9B 2O8DB 1JJ2M 3TAEA 3K5LA 1W7AA 4E19A 4A59A 3AVJA 1IJJA 4H0OA 3HT3A 4BWJA 3THYB 2JGUA 2BUPA 3SJHA 3LZIA 1VSDA 3CJ1A 4CJFA 4BG9A 4CEFA 3RSEA 4OPKA 3L6QA 3PO4A 4DSJA 5LY3A 4CJTA 4CJVA 2YV0X 1Y64A 4B9QA 4IJNA 5C2FA 3OJUA 3FR0A 3M6GA 5KTQA 3QNOA 2UUCK 2KZZA 3HP6A 4EIAA 2UUAK 1TKDA 3MAQA 4Q5VA 4RCHA 3CCQN 4DF8A 4IJAA 4FOIA 3KTQA 2FSJA 1P8ZA 2CGLA 3MEDA 4E0DA 4FM2A 1RCHA 3K5NA 4DV2K 5E26A 2F9TA 3DXKA 3RMBA 1VQ7N 3PX0A 1LAWA 1QQMA 1T6CA 4DR2K 4B3MK 1SKSA 4KHPK 3V6DA 3U4LA 4EZ9A 5CYMA 3OYCA 4OGEA 3CFRA 4FK2A 4CFAA 1K6YA 4F3OA 5K14A 3VQDA 1NJZA 4HWIA 3FE1A 3VETA 4JD2B 1LW2A 3OYMA 2HMIA 3ZSQA 2E2NA 4BR2A 5KRTA 2YHAA 4ILGB 1RDUA 5CE3A 4F3TA 3WEEB 3ID6A 4FYDA 3VF6A 2ZJQL 2P9LA 4KH4A 3LDLA 2DFEA 1YT3A 1LV5A 2O8BB 1ZC6A 3T69A 3CC2N 4CJ4A 5BPNA 2CGKA 1HNZK 4BC3A 1JLGA 4J8FA 3VGKA 4CHQA 3HK2A 1Z05A 3O3GA 4YOWA 2QWNA 3OYGA 3O3HA 3AO5A 3LZJA 2GV9A 5ADXH 2E6MA 2G8WA 4FWMA 1UOCA 2FF6A 3IKMA 3CM6A 3EE8A 5J2QA 3S3MA 4HHTA 3A8YA 3IS9A 2BANA 1GLLO 4BRMA 4XEIA 1W97L 1RBRA 3H3NO 2D1KA 4Z4IA 2AJQA 2HHQA 2VWJA 2PYJA 3SAHA 3ZEUB 4FJIA 4MLHA 2QWRA 3U3YA 1NWKA 1I3AA 1CZ9A 4H5VA 3D2FA 1BCMA 4YOVA 3FFIA 5TKYA 4W5TA 5M1FA 3L8BA 5AQQA 1REVA 3PUFA 3GE1A 3TI0A 1VQ5N 1IH7A 3BDPA 3LALA 5AQOA 2P9IB 4JKHA 3R3LA 1KLNA 4BGAA 2QWOA 4KPYA 3TAGA 4XH1A 1RT6A 1X1PA 4HTLA 4PKGA 4DU4A 2P5OA 1DLOA 4GNIA 1YXQA 2P9UB 1T6DA 5AZIB 3CM5A 4BRIA 4CJKA 1LWCA 4AF1A 4ISEA 2A41A 4WQ4C 4CEZA 3A0IX 3THWB 2NRZA 4B9TA 3IRXA 3HSTB 1S6QA 1BI4A 3CJBA 1Q7YO 2YNGA 4FK0A 4GY2B 3HM9A 4LF4K 1S1VA 5AQWA 3E01A 4CIFA 2UXBK 4OPAA 3NH1A 4RWTA 2NZTA 2HMPA 4DR3K 3KLFA 4CZMA 2YJFA 1T05A 3DWLA 4NLCA 4PKHA 1GLCG 4JKGA 3SPYA 5KI6A 5GIPA 3LAKA 1S1TA 5EX5A 5AQYA 1SS6A 4XH5A 1HX1A 3M3ZA 2FBYA 3A5MC 4AHRA 1RBTA 4I2PA
chains in the Genus database with same CATH topology
3WXLA 2P9NA 1N8RO 3DXMB 3P39A 4YDUC 5AZJB 3C6HA 3UKUB 3F9MA 1U2VA 5HOOA 5JLFA 1K9MO 1MDUB 3H45C 2WFBA 2FSKA 2VCPA 3K9KA 1NGHA 1X3MA 3NVMA 4BR5A 3KWIA 2YI1A 5AQHA 4WQ4A 5BR9A 3N4QA 2FXUA 4I6MA 3ZEUA 1T44A 3I8BA 4A2BA 3E9OA 2IVNA 3CJAA 1MWKA 5EY4A 4NB4A 1CZAN 3G25A 1T3VA 4OPHA 1S72N 1DKGD 4BRFA 3LM2A 4H5TA 5AQLA 4FWKA 3CIPA 3KK7A 2QWPA 3N4PA 1QVGM 3VOVA 4MO5A 4KH6A 4CZKA 3O08A 4FWSA 4IEEA 3ZETB 3L4IA 4JKGB 4WQ5A 3WXMB 3WXKA 4K42A 4IEIA 1WUAA 3ZX0A 3WXJA 1K8KA 2E2QA 3NMUA 5AQTA 2IIRA 2ZGZA 4PL7A 3EKSA 4JKEA 4EAHD 3MCAB 4O5FA 2NRRA 2EWSA 2Q97A 2P9NB 1VQ9N 2W41A 4RTFD 3QICA 2D4WA 4Z94A 1HJOA 3CF5L 3CD6N 3CQYA 3TPQA 1K73O 2ZGYA 1U2VB 3OBYA 4BR0A 3E9PA 5AFUH 3UKRA 1V4TA 5FPNA 3CJ9A 2VWBA 3IUCA 5JLHA 1HKGA 4BR7A 1VQ8N 3CPEA 4I6MB 5GAEP 4ILJA 5AQUA 1BDGA 2ASPA 3AARA 4QS9A 4JK9A 5F0XA 3CXCM 2QA4N 4DCHA 2VGMA 4H0TB 3VEXA 4IZ9A 3MN5A 1M90O 3C7NB 5FPDA 1NMDA 1K8AO 2DPNA 3VEYA 4FL9A 2YJEA 3ENHA 4B1YB 4JHDA 1GLDG 4WF9L 2QEXN 3QB0A 4B1UB 1NJIO 3HTVA 3A5NC 5M1PA 5ADXA 1QQNA 2V52B 2NRVA 4CZGA 3I56N 1HKCA 2ASMA 3E66A 1RGIA 3PLAA 2IVOA 1DGKN 1KXPA 4C1NK 2QWMA 2I7NA 4YORA 5EOYA 1K8KB 3AAQA 3VGLA 1YJNN 5HL7L 1S3XA 1YIJN 2GUPA 1DT9A 1HPMA 3C6AA 3O9SA 4IFEA 5GINA 1C0GA 3J7ZO 5JVGL 3UKUA 2E2OA 1GLEG 1QHAA 1OKJA 1HKBA 5AQSA 3MK6A 2HF3A 3JXUA 3VGMA 3CJ7A 3MN6A 3SMSA 3SAFA 3HZ6A 2W40A 2YCHA 3F5TA 1ZBSA 3VEWA 1ESVA 4QS7A 3UKRB 3H3OB 4JKFA 2NRWA 5JVHL 2QXLA 3FZMA 3H1VX 1VQON 1NGFA 5M1NA 5LJWA 2FF3B 4L3QA 3D2EB 2JWKA 5DM6L 3CCLN 3R9PA 4CZEA 1EO1A 3CHWA 5GIOA 3H1QA 3AGKA 1NGGA 2RE2A 2HBJA 1SAZA 1D4XA 2VYPA 3CC4N 4B1XB 3CCJN 1KD1O 3QBXA 4EHUA 1LCUA 5JICA 3DLLL 1YITN 2P9KA 3R6MA 2NNWA 2WUSA 1JCGA 1RDWX 3GOIA 4BQZA 1YI2N 1DEJA 3O4WA 3PIOL 1ATRA 2NRHA 3SLCA 4U67L 2QWLA 1G99A 3O5BA 3D7EO 3DJCA 3A5LC 3OHRA 4DQ8A 1BOTO 4FO0A 3CCSN 4B1ZA 2PBDA 3O1WA 4DHYA 4IXCA 5GAHP 1SQKA 4A62A 4BGBA 2FSNA 3WUHA 5KPTA 1NLVA 5AQKA 3TSUA 4CI6A 3H46O 4CJ7A 4QS8A 2BTFA 3KWGA 4K41A 2A3ZA 3FZKA 3AGRA 3UB5A 4GV9A 2E2PA 1VQLN 4CBWA 3HRGA 4MLEA 4IOAL 3E1YA 3SBGA 1IG8A 3LL3A 5BN9A 2A6AA 2QI2A 3EN9A 2YHXA 4FPAA 1VQ6N 4FWRA 3O1BA 4H0XB 3R1XA 4M63C 3BEXA 1BUPA 2HOEA 1JCFA 3C7NA 3HOSA 1KC8O 3K9JA 3QFPA 4CD1A 4G9ZA 3ENBA 1MA9B 4ISFA 3ZX3A 2BH1A 4C23A 5I9EB 3I33A 2P9KB 4FPBA 1BA1A 3WT0A 1BWFO 4NO7A 5JMVA 3FZLA 1TYQA 3QMLA 4K43A 3LM9A 3M5RA 2H3GX 3LDOA 4WFAL 1VQPN 2HBLA 2Q1NA 1S22A 3FLCO 4PL8A 4BRHA 5AQMA 2AP1A 2Q31A 4Y0WA 4BRPA 3F2KA 2HSTA 3GG4A 4B1VA 2GEMA 4OO1J 4ILHA 1MWMA 2IVPA 2A42A 3TTDA 3VPZA 5FPEA 5CHIA 1RFQA 4YDUA 3I55N 3O80A 3VEOA 1O13A 5E84A 1JCEA 3TSPA 3C65A 3J8AA 3CI5A 3CCEN 3DXKB 4BC2A 1KQSM 4CZLA 5MLCQ 3RVCA 3QBWA 3D2EA 3MWPA 5BPMA 5F1XA 1YUWA 3LDNA 4WFNL 3QFUA 4ISGA 2QTDA 4H0YB 4PHTX 5TKWA 2ASOA 2QW9A 3IFRA 3O9UA 2KLAA 3ATUA 3VENA 4YOYA 3EKUA 3O9QA 3P4IA 4MDAA 4BVOA 5KQDA 1NM1A 1VQKN 4BRGA 3AY9A 2I7PA 1J6ZA 3TU5A 2V7YA 3HI0A 1LOTB 4JAXA 1M1KO 4FWLA 3CCRN 3P38A 1TUYA 5F2RA 3ZX2A 1YAGA 4A2AA 1TYQB 3EE9A 4BVPA 1E4FT 1ATSA 4JK7A 3OW2M 5BPLA 3HM8A 4JEPA 3E9LA 4NLBA 5AQGA 1BA0A 1VQMN 4BY9C 1ZXOA 4BRDA 5M1KA 3BF3A 3LDPA 5C15A 2CH6A 2HF4A 5AFUA 3QDKA 1GLBG 2AA4A 5AQZA 4CZIA 4CBUA 3FZHA 1X3NA 2E88A 4AM7A 4FVUA 5AQRA 3G6EN 3MN9A 2YHYA 4XH4A 3M1FA 4YOTA 4LC9B 5KPRA 3EO3A 3HBTA 4M7XA 5AQJA 1JJ2M 5BREA 3NVKA 4U7BA 4UY8O 3S41A 3GDQA 4A59A 2E1YA 1IJJA 1BU6O 2YHWA 4BC4A 4H0OA 5GADP 5AQVA 3R8EA 1NGBA 2NRTA 3VMFB 3Q7BA 3GBTA 2BUPA 3SJHA 3U9ZA 1HLUA 1BO5O 3CJ1A 5M1QA 4BG9A 1Q18A 1QQOA 2A40A 4DKWA 2P9PA 3RSEA 3L6QA 3O9RA 5AQIA 4JD2A 5LY3A 3FGUA 3VEVA 4E1JA 5AQXA 1Y64A 4B9QA 3MN7A 3CMAN 1QVFM 2V7ZA 4H5RA 4IJNA 5BN8A 4KH5A 3CERA 5C2FA 3WEEA 1NGCA 4F9OA 5BRHA 1XQSC 1YHQN 1XUPO 3FR0A 3M6GA 4FWPA 5C2DA 3W0LA 4EHTA 4JKAA 5BRFA 4EIAA 1YVNA 3TSQA 3SAGA 1R59O 4RCHA 3CCQN 4IDHA 4IJAA 4FOIA 4BG8A 2FSJA 3Q7CA 1P8ZA 2CGLA 2HBMA 3O9TA 3ULEA 4YOUA 3VF2A 4BRQA 5LJVA 1NGEA 3D2FB 3UE5A 4JKBA 2F9TA 4WQ5C 1X9JA 4IWVA 3DXKA 3KZBA 4FWNA 4H03B 5E26A 1VQ7N 4B1WB 1W2BM 2HBKA 1QQMA 1T6CA 2WBNA 3CQXA 3A5OC 2PFUA 3U4LA 2UYTA 5BRDA 5AQNA 5DM7L 2D0OA 4FSVA 4A57A 4A5AA 3SMPA 4CZHA 3BUZB 3ZYYX 5AQPA 4C1NI 2P9PB 2GELA 2Q0RA 4HWIA 3RSEB 3FE1A 3VETA 4JD2B 4GV6A 3WQUA 4YOXA 3CCMN 3U8XA 4CZFA 3U9DA 3ID8A 1GLAG 4K25A 2E2NA 3MDQA 4BR2A 1C0FA 1NGDA 4ILGB 1RDUA 5CE3A 2KHOA 3WEEB 1KAXA 2CH5A 1ATNA 3VESA 4H5WA 3ID6A 2QM1A 3VF6A 1NBWA 2P9LA 2ZJQL 4KH4A 1XC3A 3VF4A 2E20A 2JWLA 3LDLA 2ZJRL 5C0YA 4WFBL 4BR4A 1ZC6A 1HUXA 2GTDA 3CETA 3T69A 3ULEB 5BPNA 4FOEA 2CGKA 3B8AX 4BRCA 4DB3A 3CC2N 3CC7N 1NGAA 4BC3A 4J8FA 1KAYA 3TTFA 3VGKA 3JS6A 1Z05A 2CGJA 4YOWA 2P9IA 2QWNA 5FPMA 3HSCA 3BF1A 3BP8A 4FWQA 2YX6A 3FZFA 4IO8A 2F7TA 5EXWA 4JN4A 2FLOA 4H5NA 3VERA 3WQTA 3GL1A 5ADXH 4AM6A 4O8KA 4BROA 4FWMA 3EZWA 3WXIA 3HOTA 2P9UA 3LDQA 5AZIA 3MX5A 2FF6A 3IKMA 3KHYA 3EE8A 4BRAA 3EL2A 4BRKA 5GAGP 3A8YA 1GLLO 4FWOA 4BRMA 2P9SA 2F9WA 1W97L 4XEIA 3VEZA 3C0BA 1VQNN 3H3NO 2D1KA 4JNEA 2Q2RA 5H1SQ 2E1ZA 2OTLN 2ZWHA 5KQ8A 2WC9A 4JKCA 3SAHA 1KAZA 2Q0UA 3ZEUB 3CPWM 3PIPL 4M7YA 3MMVA 4MLHA 2Q36A 5C10A 1YJ9N 2QWQA 4H0VB 4JKDA 2P9LB 3W3DA 2QWRA 3TTCA 1YJWN 1NWKA 1BG3A 1QZ5A 4H5VA 3D2FA 2ZF5O 4YOVA 5TKYA 5M1FA 5AQQA 4CBXA 4KBOA 1Q81O 3GE1A 1EQYA 1VQ5N 3CCUN 2PAVA 2VGNA 2A5XA 5AQOA 2P9IB 4JKHA 3CMEN 3R3LA 3O6WA 1Z6RA 2QWOA 5M1OA 4BGAA 4IOCL 3L0QA 3MWTA 2D0PA 2NRXA 1E4GT 3KVGA 3OA9A 4GVEA 4XH1A 3DXMA 4HTLA 4PKGA 1WOQA 3H6EA 4GNIA 1YXQA 2P9UB 1T6DA 3ATVA 5AZIB 3D6RA 3P31A 4A5BA 5AZJA 4BRIA 2ZJPL 1GLFO 5B8HA 1H1VA 3VTIA 4AF1A 1GLJO 4ISEA 4CD3A 4IO9L 4MO4A 2A41A 4WCEL 1P90A 2P9SB 4IOXA 3MCPA 3ENOA 4WQ4C 3A0IX 4BR9A 2NRZA 1SZ2A 3VTHA 1Q7YO 3CJBA 1Q86O 2KKZA 3G4SN 1NGJA 4EFHA 4GV3A 1VAZA 2RHKA 4GY2B 1V4SA 3IMXA 5ELZA 5AQWA 2J4RA 5KPZA 5AQFA 2V51B 4BC5A 4OPAA 4PKIA 1VQ4N 4RWTA 1YF5L 1QZ6A 3O8MA 3IDHA 2NLXA 2NZTA 1Q82O 2HMPA 3L4QA 2OANA 3DAWA 4CZMA 4H0PA 3G71N 2YJFA 4WYBA 3CJCA 4JK8A 3DWLA 3ZETA 4JHDB 4NLCA 4PKHA 3SBTA 1GLCG 4JKGA 2E8AA 3T7ZA 4BRNA 3OBWA 4A61A 4BQLA 4BRLA 5GIPA 5EVZA 5C12A 1TUUA 2GWJA 3FFKB 3CCVN 5EX5A 1NGIA 5CR4A 5AQYA 1SS6A 4XH5A 1HX1A 4CZJA 4BREA 1U6ZA 2GWKA 3M3ZA 3A5MC 4MDBA 2GX9A 3MX2A 2ITMA 2OTJN 1OVYA 3AAPA 1ILYA 5AR0A 3SK3A 4R79A 4O8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K O;  1N8R O;  3CCR N;  3CC2 N;  3CCL N;  5DM6 L;  3CC7 N;  3OW2 M;  3CCJ N;  3CC4 N;  1K9M O;  3DLL L;  1YIT N;  1VQM N;  1YI2 N;  3PIO L;  3G6E N;  4U67 L;  5GAG P;  3CCS N;  1S72 N;  1JJ2 M;  4UY8 O;  5GAH P;  1VQN N;  5H1S Q;  1QVG M;  5GAD P;  2OTL N;  3CPW M;  3PIP L;  1VQL N;  1YJ9 N;  4IOA L;  1YJW N;  3CMA N;  1QVF M;  1VQ6 N;  1VQ9 N;  1Q81 O;  1YHQ N;  1VQ5 N;  3CCU N;  3CF5 L;  3CD6 N;  1K73 O;  3CME N;  1KC8 O;  4IOC L;  3CCQ N;  1VQ8 N;  5GAE P;  3CXC M;  2ZJP L;  2QA4 N;  1VQ7 N;  4WFA L;  1VQP N;  4IO9 L;  1W2B M;  1M90 O;  4WCE L;  1K8A O;  2QEX N;  4WF9 L;  1Q7Y O;  1Q86 O;  3G4S N;  1NJI O;  5DM7 L;  3I56 N;  3I55 N;  1VQ4 N;  3CCE N;  1Q82 O;  1KQS M;  1YJN N;  5MLC Q;  5HL7 L;  3CCM N;  1YIJ N;  3G71 N;  3J7Z O;  5JVG L;  4WFN L;  2ZJQ L;  3CCV N;  2ZJR L;  1ILY A;  2OTJ N;  1OVY A;  5JVH L;  1VQK N;  4WFB L;  1KD1 O;  1VQO N; 
#chains in the Genus database with same CATH topology
 4JI6 K;  4N47 A;  1RDD A;  4Y1D A;  2HHH K;  1VSE A;  1RNH A;  3F9M A;  2WFB A;  3T3F A;  3NVM A;  4FLX A;  5LL6 Z;  3KWI A;  2YI1 A;  3ZLJ A;  3LPU A;  1KSP A;  1T44 A;  3TAR A;  4CED A;  1MWK A;  3NBP A;  5EY4 A;  3SUP A;  2HW3 A;  3ALY A;  3LM2 A;  3AVC A;  4XIU A;  2VWK A;  3CIP A;  3ZT1 A;  1Z26 A;  2QWP A;  1QVG M;  3VOV A;  2F8S A;  4KH6 A;  4CZK A;  4DS5 A;  3L2U A;  4IEE A;  4X66 K;  3HPG A;  4WQ5 A;  5DK5 A;  1HNI A;  1K8K A;  3AVF A;  2O8C B;  3ULD A;  2G8K A;  1N36 K;  1BIS A;  2ZGZ A;  4PL7 A;  4EAH D;  3MCA B;  2NRR A;  1RTD A;  4FJ7 A;  2W41 A;  3NE6 A;  1WAF A;  3CF5 L;  3CD6 N;  3K59 A;  1RBV A;  3SJJ A;  1QSS A;  1HKG A;  1VQ8 N;  4I6M B;  1BDG A;  2ASP A;  3AAR A;  3D45 A;  4JK9 A;  3VQC A;  5F0X A;  3CXC M;  1SKR A;  1TAQ A;  3HYF A;  1XNR K;  4BE2 A;  1K8A O;  1T7P A;  1HMV A;  3VEY A;  4FL9 A;  3QEX A;  4CFC A;  4DSK A;  4CEE A;  3A5N C;  5ADX A;  4HUE A;  3I56 N;  1HKC A;  3PLA A;  4N56 A;  3DLH A;  3J7A P;  4YOR A;  4DU3 A;  3VGL A;  5HL7 L;  1YIJ N;  4CK3 A;  1HPM A;  4IFE A;  4J2B A;  1XHX A;  3J7Z O;  5JVG L;  3UKU A;  2E2O A;  1IV0 A;  2ITG A;  1OKJ A;  3MK6 A;  3JXU A;  3MN6 A;  3RTV A;  4J2A A;  4FK4 A;  2W40 A;  3I0R A;  3F5T A;  3NH0 A;  3KLE A;  1N33 K;  1RTI A;  3OTO K;  4LFA K;  1NGF A;  3CCL N;  2JWK A;  1EO1 A;  4JI7 K;  1DTQ A;  1NGG A;  1SAZ A;  4B1X B;  4JI2 K;  1SKW A;  5JIC A;  3DOK A;  3SPZ A;  4B9S A;  2VQE K;  3R6M A;  2WUS A;  1JCG A;  3O4W A;  2WON A;  3DOL A;  2NRH A;  4U67 L;  4M3Z A;  3RR8 A;  4JI1 K;  2OCE A;  3O5B A;  4YHH K;  3RR7 A;  4AQY K;  3O1W A;  4RW9 A;  4CHP A;  3O4Q A;  4A62 A;  5KPT A;  5AQK A;  2HNZ A;  4CI6 A;  4CFB A;  3VQ5 A;  4CJ7 A;  3UB5 A;  3V1R A;  2NUB A;  3HRG A;  1ASU A;  3ISN C;  3S3O A;  3QEV A;  3SUQ A;  4FPA A;  3EN9 A;  5C24 A;  4JV5 K;  4FWR A;  3O1B A;  2Y1I A;  3R1X A;  1JCF A;  3ITH A;  1Y97 A;  1KC8 O;  3ENB A;  1JXE A;  2Y1J A;  2BH1 A;  3I33 A;  1BA1 A;  1BWF O;  3FZL A;  4F2R A;  1TYQ A;  3TAP A;  1VQP N;  2Q1N A;  4BDP A;  4BRH A;  2Q31 A;  4Y0W A;  4B3O A;  4DQQ A;  3GG4 A;  4ZHR A;  4CHY A;  4KO0 A;  4GW6 A;  1MWM A;  3NGY A;  5CHI A;  4DS4 A;  4YDU A;  2PZS A;  2O8E A;  4DSE A;  2DTU A;  3VEO A;  1O13 A;  2RN2 A;  4CJQ A;  2O8D A;  3TSP A;  3PY8 A;  4BC2 A;  5MLC Q;  3SQ0 A;  5BPM A;  2X74 A;  5F1X A;  3THY A;  1XC9 A;  3KD1 E;  3AVL A;  4PHT X;  4FLW A;  4J2D A;  2YNH A;  1NKE A;  1YTA A;  3O9U A;  3VEN A;  1NOZ A;  1UA1 A;  3KK1 A;  4M3X A;  1NM1 A;  4KHS A;  3AY9 A;  4I9Q A;  4FW1 A;  1ATS A;  1TL3 A;  3C6T A;  2UXD K;  4JEP A;  4CCH A;  4QOZ B;  1O1W A;  1WBB A;  4BY9 C;  2CH6 A;  2AA4 A;  3FZH A;  4FVU A;  4AM7 A;  4LFB K;  1TKX A;  4XH4 A;  2FBT A;  3K58 A;  1C1C A;  4M7X A;  1A5W A;  4UY8 O;  4N41 A;  4LF8 K;  3S41 A;  4LD0 A;  2NRT A;  3VMF B;  3Q7B A;  3CFP A;  1JLA A;  2XY7 A;  2KQ2 A;  2P1J A;  3VQE A;  1Q18 A;  4DKW A;  4JD2 A;  5FRN A;  3MN7 A;  3CMA N;  4CEO A;  1W9H A;  2V7Z A;  1YTU A;  1W0H A;  1IBL K;  3WEE A;  1NGC A;  4F9O A;  4FWP A;  2X78 A;  4JKA A;  2VG5 A;  1U04 A;  1YVN A;  1R59 O;  1S5J A;  3H08 A;  4BG8 A;  4DU1 A;  2O8B A;  3MXM A;  2HHS A;  1WAJ A;  3OS0 A;  1LW0 A;  3B6O A;  4JI0 K;  1JLC A;  1X9J A;  3OYE A;  3LP1 A;  4GVM A;  2WBN A;  3TAQ A;  3A5O C;  1CLQ A;  4AH9 A;  2RPI A;  4K8X A;  2D0O A;  4FSV A;  4KKO A;  4A5A A;  4UQG A;  2E5L K;  2G8F A;  1QTM A;  4CGD A;  5AQP A;  2HHW A;  2Q0R A;  4GV6 A;  4J2E A;  3MDQ A;  1KVC A;  2KHO A;  4CJU A;  4W5O A;  3VES A;  4DTX A;  4H5W A;  1NBW A;  4DV0 K;  3VF4 A;  2D0A A;  2XRI A;  1FKP A;  5FRM A;  1TV6 A;  3ULE B;  1A5X A;  4BRC A;  4B9U A;  4CJ3 A;  3JS6 A;  4B8A B;  2P9I A;  4KFB A;  4FWQ A;  1WN7 A;  4IO8 A;  1KLM A;  3JSM A;  4NXN K;  1QE1 A;  4RW6 A;  3SI6 A;  2UUB K;  3THV A;  2P9U A;  5AZI A;  3OS2 A;  1RT5 A;  3KHY A;  3NF9 A;  1VSK A;  4FJN A;  4M41 A;  3OY9 A;  3WNH A;  4BDY A;  3THW A;  1S1U A;  3C0B A;  4DTP A;  1KAZ A;  3CPW M;  1B9D A;  4M7Y A;  1S6P A;  5HRO A;  4ELU A;  2QWQ A;  3EEQ A;  4DQR A;  4KAZ A;  2ZF5 O;  5HRR A;  3HL8 A;  4Z4H A;  5HRP A;  4KRE A;  3ZT2 A;  4X62 K;  3MWT A;  4QCL A;  2D0P A;  2NRX A;  1E4G T;  3VQ7 A;  3LP3 A;  4QAG A;  4BWM A;  3H6E A;  4A5B A;  3D6R A;  3P31 A;  4CJL A;  2ZJP L;  1E3M A;  5J2M A;  4CD3 A;  1BL3 A;  4MO4 A;  3LAN A;  4IOX A;  3JAM O;  1Q86 O;  3G4S N;  3TAM A;  3HO1 A;  1X9S A;  3F73 A;  3KKR A;  2J4R A;  3RRG A;  2V51 B;  1L3V A;  1QZ6 A;  1Q82 O;  3OYH A;  3L4Q A;  4FJL A;  1RTJ A;  3ZSX A;  2OAN A;  4AHT A;  4PQU A;  4X65 K;  4H0P A;  4JK8 A;  4FLZ A;  2D0C A;  3SBT A;  3J80 O;  3ZT4 A;  4BRN A;  4BQL A;  3HXM A;  3DLG A;  1TUU A;  3FFK B;  1ASV A;  1NGI A;  5CR4 A;  4OGC A;  4BRE A;  1S9G A;  2ITM A;  4CVN E;  1KD1 O;  4O8U A;  3WXL A;  4KV8 A;  3DXM B;  1U48 A;  3P39 A;  5AZJ B;  1WSH A;  4BAC A;  5HOO A;  5JLF A;  4DFP A;  2VCP A;  1NGH A;  1X3M A;  4WQ4 A;  4I6M A;  3B6P A;  1S9E A;  4X64 K;  3I8B A;  1EXQ A;  1VRT A;  3VQB A;  4DUZ K;  4H8K A;  3E9O A;  2IVN A;  3CJA A;  1MU2 A;  4NB4 A;  1IKX A;  1S72 N;  1L3S A;  4FJ8 A;  4H5T A;  5AQL A;  4E1M A;  2VG6 A;  4MO5 A;  4DQP A;  3ZET B;  3OS1 A;  3WXK A;  1WUA A;  2X6N A;  3WXJ A;  5D3G A;  5AQT A;  2OZS A;  5T7B A;  5KGX A;  2OA8 A;  4JKE A;  2FBV A;  4CEB A;  2OZM A;  1QQC A;  1VQ9 N;  4HUG A;  4RTF D;  1NKB A;  2D4W A;  4FJM A;  1HNV A;  3ZCM A;  4OVL A;  3ASM A;  1U2V B;  5AFU H;  3ZSR A;  1V4T A;  4KHY A;  2KZM A;  4GMJ B;  1OVQ A;  4ILJ A;  2IAJ A;  4FJX A;  3AVI A;  1TK5 A;  3VEX A;  4H0T B;  1JXB A;  3MN5 A;  4W5R A;  1RBU A;  5HRN A;  3QEI A;  1JL1 A;  1NU0 A;  1VSF A;  3KLH A;  4ICL A;  4B1Y B;  4JHD A;  1GLD G;  1NK0 A;  3QB0 A;  4B1U B;  1X9W A;  4M3Y A;  3HTV A;  4DTM A;  3DRS A;  5M1P A;  1J5O A;  3KD5 E;  1QQN A;  4CZG A;  4AHU A;  2ASM A;  4LH5 A;  1RGI A;  5EOY A;  1YJN N;  2Z1H A;  3V1Q A;  3C6A A;  3O9S A;  1C0G A;  4FJG A;  1GLE G;  1HKB A;  2HF3 A;  3DRR A;  4JRP A;  3HPH A;  3CJ7 A;  3SQ2 A;  3HZ6 A;  4CGF A;  3RRH A;  3VEW A;  5LMN K;  4QS7 A;  2A1S A;  3UKR B;  2W42 A;  4BE0 A;  4CIG A;  2GBZ A;  2FF3 B;  5DM6 L;  3R9P A;  4CZE A;  1CXQ A;  5GIO A;  1D4X A;  4G1Q A;  3CC4 N;  3CCJ N;  5IT9 O;  3QBX A;  3BZC A;  1C0U A;  2IDO A;  4EHU A;  1LCU A;  5LMU K;  1YIT N;  4DSI A;  1N6Q A;  2NNW A;  2YNI A;  1WSE A;  3GOI A;  2G8I A;  4BQZ A;  4RW4 A;  3PIO L;  1ATR A;  5HRS A;  1ITG A;  1BGX T;  1SUQ A;  1D5A A;  2QWL A;  4TSX A;  3DJC A;  4CHZ A;  4DHY A;  2PBD A;  4W5Q A;  2OPS A;  5GAH P;  1SQK A;  2FSN A;  2WTU A;  4RW7 A;  4LF6 K;  3K5M A;  2A3Z A;  2E2P A;  1VQL N;  4CBW A;  3F9K A;  3AVN A;  3OVN A;  3SBG A;  3I8D A;  1IG8 A;  1GOC A;  3LL3 A;  5BN9 A;  3MEC A;  2A6A A;  1VQ6 N;  2YHX A;  1EWR A;  1BUP A;  3LPT A;  2HOE A;  3C7N A;  3HOS A;  1U47 A;  1LAV A;  4KTW A;  4NYN A;  3RMA A;  4ZTJ A;  1T8E A;  5I9E B;  3I0S A;  3WT0 A;  5JMV A;  4CJP A;  4K43 A;  3V81 A;  4LSL A;  1HYV A;  3OYJ A;  1RDB A;  3LM9 A;  3NCI A;  4WFA L;  3FLC O;  5AQM A;  4JS5 A;  1U4B A;  4NXM K;  4DV3 K;  1RT3 A;  3G10 A;  3QO9 A;  3SUO A;  4E7J A;  4CF9 A;  3OJS A;  3VA0 A;  1JKH A;  3O80 A;  3DYA A;  3SCX A;  1JCE A;  3CI5 A;  3DXK B;  2HVI A;  1OH8 A;  4CZL A;  3D2E A;  4NYF A;  1EKE A;  4N76 A;  4WFN L;  2RKI A;  4H0Y B;  2YKM A;  4DR7 K;  4IKF A;  3IFR A;  3CQ8 A;  2KLA A;  3AO3 A;  1KFS A;  2XY6 A;  4MDA A;  3OYN A;  1TK0 A;  1J6Z A;  2V7Y A;  3HI0 A;  3L3V A;  4JAX A;  1M1K O;  4W5N A;  1HR0 K;  1YVU A;  5HBM A;  2HB5 A;  4BVP A;  1E4F T;  3OW2 M;  2BDP A;  3HVR A;  4JI8 K;  1VSI A;  4DTN A;  4F2S A;  3S3N A;  4NLB A;  1L3U A;  3AO2 A;  1VQM N;  5AFU A;  3QDK A;  4CZI A;  2JLE A;  3KK2 A;  4C8L A;  4CBU A;  2E88 A;  1G15 A;  1QHT A;  3MN9 A;  1XHZ A;  4K0K K;  5KPR A;  3P83 D;  4U7B A;  1C0M A;  1U49 A;  4DUY K;  4PY5 A;  3GDQ A;  1HYS A;  4CF0 A;  4B9V A;  2YHW A;  3GBT A;  3U9Z A;  3T19 A;  1HLU A;  1TKT A;  4JLH A;  4B9L A;  2A40 A;  5AQI A;  1D9F A;  4CJ5 A;  3VEV A;  4EP4 A;  3THX B;  3AO1 A;  4F8R A;  4CGJ A;  1QVF M;  4H5R A;  4KH5 A;  3CER A;  2HVH A;  4DR5 K;  4KRF A;  2IS3 A;  1YHQ N;  1XUP O;  1I94 K;  3W0L A;  4EHT A;  4Z4F A;  4Z4E A;  4IDH A;  3TAN A;  3Q7C A;  1JL2 A;  3ULE A;  2HBM A;  4BRQ A;  5CZ2 A;  3VF2 A;  5LJV A;  1SL1 A;  1NGE A;  3D2F B;  3KLG A;  5KPZ A;  4WQ5 C;  4IWV A;  4H03 B;  3KZB A;  4B9N A;  3PSF A;  1W2B M;  2HBK A;  3CQX A;  4YFU A;  3CG7 A;  4DR6 K;  5HLF A;  2UYT A;  3C6U A;  4EP5 A;  4DR1 K;  1NG9 A;  1N5Y A;  5A2Q O;  5DM7 L;  4IBN A;  3SMP A;  4CZH A;  1SL0 A;  4HCC A;  2P9P B;  2GEL A;  1JLE A;  2XHB A;  3WQU A;  3CCM N;  3U8X A;  4CZF A;  2WOM A;  1EX4 A;  1NGD A;  4FJJ A;  5EU7 A;  3AVK A;  1KAX A;  2QM1 A;  2E20 A;  2JWL A;  4E7L A;  3JYT A;  2ZJR L;  1VRU A;  4CGI A;  2QXF A;  3NAE A;  5C0Y A;  4WFB L;  2HHU A;  1TVR A;  4B9M A;  5BR8 K;  4DB3 A;  1JLQ A;  1NGA A;  1KAY A;  3TTF A;  3L2V A;  1Q9Y A;  4BE1 A;  4KI4 A;  2O4I A;  3HSC A;  4OKJ A;  4MQ3 A;  3BF1 A;  3BP8 A;  4JI3 K;  2F7T A;  3VER A;  4AM6 A;  1FXX A;  4BRO A;  1SL2 A;  3WXI A;  1CZB A;  4GKK K;  2KFZ A;  4BRA A;  4IFV A;  4AHC A;  5GAG P;  2O4G A;  3HP9 A;  4FWO A;  2PYL A;  2F9W A;  3VEZ A;  1IKV A;  3G0Z A;  2Q2R A;  3PSI A;  2E1Z A;  1UA0 A;  2Q0U A;  3QLH A;  3PIP L;  3MMV A;  5C10 A;  1FJG K;  4H0V B;  4JKD A;  3NH2 A;  3W3D A;  1YJW N;  3QIN A;  4H4O A;  1QZ5 A;  5HP1 A;  4ELT A;  4CBX A;  2Z1J A;  2VGN A;  1UAX A;  3O6W A;  1D9D A;  4IOC L;  3SV3 A;  3NFA A;  3VQ4 A;  3WNG A;  4GVE A;  1J9A A;  1RT2 A;  3DXM A;  1WOQ A;  5AZJ A;  3ATV A;  4DSL A;  5B8H A;  3VTI A;  4IO9 L;  1RT4 A;  3ZSV A;  3V9U A;  1NK6 A;  4WCE L;  3L2W A;  3T1H K;  2P9S B;  1QSY A;  3VTH A;  2YHB A;  3K5O A;  4LF9 K;  4M3T A;  1NGJ A;  5C25 A;  4GV3 A;  1RT1 A;  4FW2 A;  1VAZ A;  2RHK A;  5ELZ A;  1V4S A;  5AQF A;  4CF1 A;  2XO7 A;  5JS2 A;  4BC5 A;  5I42 A;  4PKI A;  1VQ4 N;  4PA1 A;  5CY4 A;  3LAM A;  1VSH A;  1YF5 L;  3IDH A;  1EET A;  2NLX A;  3K2P A;  4KTZ A;  3EY1 A;  3AVG A;  4FLV A;  3L2Q A;  3G71 N;  4WYB A;  3SYZ A;  3ZET A;  3NF6 A;  3T7Z A;  2E8A A;  3OBW A;  4A61 A;  4BRL A;  5EVZ A;  1IBK K;  2GWJ A;  4CER A;  3M8S A;  4CZJ A;  4MDB A;  1HNW K;  4HTU A;  4DSF A;  1HYZ A;  3NF7 A;  4DTS A;  5AR0 A;  3CFO A;  4R79 A;  4FZX C;  1J5E K;  5FPE A;  1BQN A;  1N8R O;  4YDU C;  3C6H A;  3UKU B;  1U2V A;  4DV7 K;  1K9M O;  4FLY A;  2FSK A;  4FLU A;  5AQH A;  4DFJ A;  2FXU A;  2X6S A;  3ZEU A;  3KJV A;  4H4M A;  1CZA N;  1T3V A;  4DV4 K;  1DKG D;  2HNY A;  4N5S A;  3S9H A;  3V4I A;  3BZK A;  4FWK A;  1R0A A;  3N4P A;  4FJK A;  3MXI A;  3P1G A;  1C6V A;  4CK1 A;  4KHQ A;  4K42 A;  1NOY A;  1ZBL A;  3NMU A;  4DTU A;  1VSM A;  2IGI A;  4ID5 A;  3U6F A;  2F96 A;  2EWS A;  2Q97 A;  3EZ5 A;  2P9N B;  3LWM A;  3QIC A;  1HJO A;  3CQY A;  3TPQ A;  1K73 O;  2ZGY A;  4KHU A;  3OBY A;  3PV8 A;  2O8F B;  3UKR A;  3CJ9 A;  2VWB A;  5JLH A;  3CPE A;  5GAE P;  5AQU A;  3DLB A;  3OYL A;  4KHN A;  1M90 O;  1A5V A;  2BE2 A;  3M8Q A;  1NMD A;  4M45 A;  4DG1 A;  4ID1 A;  2YJE A;  4WF9 L;  4OLB A;  2Z1G A;  5IWA K;  3VA3 A;  5SZT A;  2NRV A;  1NJX A;  3E66 A;  1DGK N;  4C1N K;  2QWM A;  2I7N A;  3DLK A;  4LSN A;  3AAQ A;  4YNQ A;  1FK9 A;  2P5G A;  1S3X A;  5GIN A;  3L2R A;  3SZ2 A;  4M42 A;  5AQS A;  4CJR A;  2KTQ A;  4FVM A;  3VQQ A;  1I39 A;  1RBS A;  3VGM A;  3SAF A;  4CF8 A;  2O8E B;  1FKO A;  2YCH A;  4B3T K;  3TAB A;  3AV9 A;  4CJW A;  1NK9 A;  1HQU A;  2NRW A;  2QXL A;  3FZM A;  1VQO N;  4JYA K;  4DV6 K;  3H1Q A;  1VK0 A;  2RE2 A;  2HBJ A;  3AVB A;  4OPJ A;  4LF5 K;  1HRH A;  1Q8I A;  4CGH A;  3SLC A;  1G99 A;  2O8C A;  2KW4 A;  4DQ8 A;  3CCS N;  4FO0 A;  4O4G A;  1IO2 A;  4IXC A;  1NLV A;  4CEA A;  3K0S A;  3H46 O;  4Z4G A;  1VHX A;  4QS8 A;  2BTF A;  3KWG A;  4K41 A;  3AGR A;  3P5J A;  1TL1 A;  3E1Y A;  3AA3 A;  4DLE A;  1NJY A;  2KFN A;  1IKW A;  3LDS A;  1KVB A;  4M63 C;  3BY5 A;  3KLI A;  1EP4 A;  1OH7 A;  3AVA A;  4ISF A;  3ZX3 A;  2OPR A;  2P9K B;  3O4N A;  4NO7 A;  1XMO K;  1OH6 A;  4CHN A;  3QML A;  1S1X A;  3M5R A;  3LDO A;  3OYB A;  2HBL A;  3L3U A;  4BRP A;  4GKJ K;  3F2K A;  2HST A;  4ILH A;  5KGW A;  4DF4 A;  1WSJ A;  1XNQ K;  2ZD1 A;  3VPZ A;  4O55 A;  4OLA A;  1RFQ A;  3VQ9 A;  3I55 N;  3C65 A;  3J8A A;  3CCE N;  1WSG A;  4E7K A;  1NK7 A;  1VSJ A;  4CW7 B;  1KQS M;  2QKK A;  3RVC A;  3QBW A;  3MWP A;  2W6K A;  3SQ4 A;  4KB0 A;  2R7Y A;  1N32 K;  2QTD A;  2FBX A;  2QW9 A;  4FM0 A;  3ATU A;  1JLB A;  2GUI A;  1T03 A;  4JI4 K;  2OPQ A;  3P4I A;  3NGZ A;  1KFD A;  1RT7 A;  3THX A;  3SNN A;  3QIO A;  2I7P A;  3TU5 A;  3OYI A;  1L5U A;  2IOC A;  4FWL A;  1TUY A;  5F2R A;  1YAG A;  3V9W A;  1KTQ A;  5BPL A;  4EZ6 A;  3KK3 A;  3QET A;  3BF3 A;  3LDP A;  5C15 A;  2HF4 A;  4B08 A;  1GLB G;  1NMN A;  4CEC A;  1X3N A;  2OPP A;  3M1F A;  4YOT A;  3VQA A;  4C8N A;  3EO3 A;  3HBT A;  5AQJ A;  5BRE A;  3NVK A;  4R5P A;  2E1Y A;  4BC4 A;  1BU6 O;  4HVJ A;  5GAD P;  5AQV A;  3R8E A;  2HHX A;  1NGB A;  4L8R B;  1BO5 O;  4NCG A;  5M1Q A;  1QQO A;  4LH4 A;  2P9P A;  4Z0U A;  4CFD A;  3O9R A;  3FGU A;  4E1J A;  5AQX A;  4FZY A;  2LSN A;  3IG1 A;  2D0B A;  5BN8 A;  4IDK A;  2B4J A;  5FLX O;  5BRH A;  1XQS C;  5C2D A;  3J81 O;  5BRF A;  1S1W A;  5J1E A;  3TSQ A;  3SAG A;  1NK5 A;  3OYA A;  3O9T A;  3C94 A;  4YOU A;  2IC3 A;  3EYZ A;  3UE5 A;  4E89 A;  4JKB A;  4FWN A;  3NGI A;  4HUF A;  4B1W B;  3T1A A;  3M8P A;  2PFU A;  4OX9 K;  3ZSW A;  5BRD A;  5AQN A;  2ZQB A;  3IAY A;  2DY4 A;  4DTO A;  2B6A A;  5C42 A;  1HPZ A;  2ETJ A;  4A57 A;  1FW6 A;  3BUZ B;  4B8C A;  3ZYY X;  4C1N I;  4DR4 K;  3RSE B;  3TR8 A;  2F8T A;  4YOX A;  3U3G A;  3U9D A;  3ID8 A;  1GLA G;  4K25 A;  3QEW A;  1C0F A;  4CK2 A;  1Q9X A;  4AHS A;  2CH5 A;  1ATN A;  2P51 A;  3SQ1 A;  2HHT A;  1OH5 A;  3TWH A;  1XC3 A;  4FCY A;  4DMN A;  3DM2 A;  3WNE A;  3A2F A;  4CES A;  3QIP A;  4BR4 A;  3M8R A;  3ZSZ A;  3CET A;  1HUX A;  2GTD A;  1ASW A;  3SV4 A;  3QEP A;  4C8O A;  4FOE A;  3B8A X;  2ATQ A;  3CC7 N;  2UXC K;  2CGJ A;  5FDL A;  2EX3 A;  5FPM A;  1TK8 A;  1TGO A;  2YX6 A;  3FZF A;  3UIQ A;  5EXW A;  4JN4 A;  2FLO A;  4H5N A;  1BIU A;  3WQT A;  3GL1 A;  2G8V A;  4O8K A;  1IG9 A;  3EZW A;  3HOT A;  3LDQ A;  4I2Q A;  4JS4 A;  1RTH A;  3MX5 A;  4BRK A;  3EL2 A;  4V19 S;  4RG8 A;  4RW8 A;  4E3S A;  2P9S A;  1VQN N;  4JNE A;  5H1S Q;  3OYF A;  3SUN A;  4CEQ A;  2OTL N;  2ZWH A;  5KQ8 A;  2WC9 A;  4JKC A;  1N34 K;  2E4L A;  1ZBF A;  3AA2 A;  4Z4C A;  2Q36 A;  1YJ9 N;  4OKE A;  4CE9 A;  2P9L B;  3TTC A;  2YNF A;  1RIL A;  1BG3 A;  4DFK A;  3V1O A;  1BIZ A;  1J53 A;  2XY5 A;  4KBO A;  1Q81 O;  4MFB A;  4CJS A;  1EQY A;  3CCU N;  4Q0B A;  2PAV A;  2A5X A;  4KB1 A;  3CME N;  1Z6R A;  5M1O A;  1BHL A;  3C95 A;  3L0Q A;  3RMD A;  3KVG A;  3OA9 A;  3QNN A;  4NCA A;  5J2N A;  1HNX K;  1JLF A;  4I9L A;  1HJR A;  1GLF O;  4LFC K;  1H1V A;  1GLJ O;  1QS4 A;  3O3F A;  1KRP A;  1P90 A;  4BR9 A;  3MCP A;  3ENO A;  3NHG A;  1UWB A;  1SZ2 A;  4CIE A;  3WNF A;  4FJ9 A;  2KKZ A;  4EFH A;  2D5R A;  5E41 A;  3IMX A;  1Z25 A;  4O5B A;  5J2P A;  2HND A;  2Q3S A;  3O8M A;  3VQP A;  3DAW A;  4IG3 A;  3VQ6 A;  1GOA A;  1KCF A;  3CJC A;  3DI6 A;  4M3W A;  3LP2 A;  5JS1 A;  2DFF A;  1DTT A;  4JHD B;  3BGR A;  3TAF A;  1NKC A;  5C12 A;  3CCV N;  1LWF A;  1U6Z A;  1XWL A;  2GWK A;  1ILY A;  2GX9 A;  3MX2 A;  2OTJ N;  1OVY A;  3AAP A;  2ZE2 A;  3ZT0 A;  3SK3 A;  3AA5 X;  3CYM A;  2P9N A;  4JRQ A;  2G8H A;  1ZBH A;  4M3U A;  2O8F A;  1MDU B;  3PX4 A;  3H45 C;  4K8Z A;  3K9K A;  4BR5 A;  1ZYQ A;  1XI1 A;  5BR9 A;  3N4Q A;  5FRO A;  3ZSY A;  1BI4 B;  1B9F A;  4Y1C A;  4ELV A;  4A2B A;  1U45 A;  3VQ8 A;  1TKZ A;  3G25 A;  4OPH A;  2YKN A;  4BRF A;  1VSL A;  4E7I A;  4HCB A;  4C8K A;  3KK7 A;  3QES A;  5SWM A;  5I3U A;  3O08 A;  4FWS A;  3DMJ A;  3L4I A;  2EHG A;  3ZT3 A;  2HHV A;  4JKG B;  3WXM B;  3V9X A;  2XY8 A;  4IEI A;  3ZX0 A;  1BCO A;  2E2Q A;  2IIR A;  3EKS A;  4O5F A;  5AJ3 K;  2F4V K;  1X9M A;  4Z94 A;  4OJR A;  2G8U A;  3V9S A;  4BR0 A;  3E9P A;  5FPN A;  3IUC A;  4BR7 A;  3KKS A;  1WB9 A;  4QS9 A;  3AA4 A;  2QA4 N;  4DCH A;  4KI6 A;  2VGM A;  4IZ9 A;  4DTR A;  4M3R A;  4DQS A;  3C7N B;  5FPD A;  2DPN A;  3T1Y K;  4B3R K;  3ENH A;  1BQM A;  2QEX N;  1NJI O;  4OKK A;  2ZM6 K;  1RDA A;  2V52 B;  3OYK A;  5KRS A;  2IVO A;  4F4K A;  1KXP A;  2A1R A;  3AO4 A;  1K8K B;  3ZSO A;  1NK4 A;  1WSI A;  4DV5 K;  2GUP A;  1C0T A;  1DT9 A;  2I5J A;  1B92 A;  1QHA A;  1EWQ A;  1SV5 A;  2QK9 A;  5CZ1 A;  4E1N A;  1IBM K;  3SMS A;  4E7H A;  1XMQ K;  1NK8 A;  1ZBS A;  3KIO A;  1ESV A;  3H3O B;  4JKF A;  5JVH L;  3H1V X;  3OYD A;  5M1N A;  5LJW A;  4C8M A;  4L3Q A;  3D2E B;  4KTQ A;  3CHW A;  1WBD A;  3AGK A;  4YY3 K;  2VYP A;  4IFY A;  3LWL A;  2PY5 A;  3HJF A;  1WSF A;  3NF8 A;  3DLL L;  2P9K A;  3VN5 A;  1RDW X;  1YI2 N;  1DEJ A;  1QSL A;  4O44 A;  4AIL C;  3PX6 A;  4LY7 A;  1KVA A;  3D7E O;  3A5L C;  3OHR A;  1BOT O;  3MEE A;  3AVH A;  4B1Z A;  4DWI A;  4I7F A;  4BGB A;  4NCB A;  1L3T A;  3WUH A;  4LF7 K;  3AVM A;  3TSU A;  2DFH A;  3RWU A;  3V9Z A;  4FLT A;  3FZK A;  4GV9 A;  1RDC A;  4MLE A;  4IOA L;  4CHO A;  3MXJ A;  2VQF K;  4KHW A;  4CGG A;  4DLG A;  4DFM A;  2QI2 A;  4WE1 A;  4H0X B;  4IG0 A;  1GOB A;  3BEX A;  1TAU A;  3HVT A;  2FC0 A;  3K9J A;  3QFP A;  1LWE A;  4CD1 A;  3QER A;  4G9Z A;  5DMR A;  1MA9 B;  4C23 A;  4FXD A;  4AHV A;  4FPB A;  1WLJ A;  4O0I A;  3NDK A;  4FM1 A;  2H3G X;  1S22 A;  4PL8 A;  1WNS A;  2AP1 A;  1CXU A;  4B1V A;  2GEM A;  4OO1 J;  1IKY A;  1ZBI A;  2IVP A;  2A42 A;  4BDZ A;  3TTD A;  2W6L A;  1NNE A;  1J54 A;  5E84 A;  4O0J A;  2E6L A;  3K57 A;  4JI5 K;  1HQE A;  3RMC A;  3DLR A;  1YUW A;  3LDN A;  2B5J A;  3QFU A;  4ISG A;  3J7Y P;  4B3S K;  1C1A A;  3DLE A;  5TKW A;  2Z1I A;  2ASO A;  4DTJ A;  4YOY A;  3EKU A;  4CJE A;  3O9Q A;  4PWD A;  3PO5 A;  3MEG A;  4BVO A;  4FJH A;  2OYQ A;  4FZZ A;  5KQD A;  4FJ5 A;  1VQK N;  1NJW A;  4BRG A;  1D8Y A;  2QKB A;  1LOT B;  2VG7 A;  5CYQ A;  3CCR N;  3P38 A;  3ZX2 A;  4A2A A;  1TYQ B;  3EE9 A;  4PUO A;  4JK7 A;  4CF2 A;  3DRP A;  3HM8 A;  1F21 A;  3E9L A;  5AQG A;  1C1B A;  1BA0 A;  1ZXO A;  4BRD A;  3LP0 A;  4DQI A;  5M1K A;  1ZBU A;  5AQZ A;  3HPO A;  4ZTF A;  3D0P A;  5AQR A;  2BGG A;  3G6E N;  2RF2 A;  2YHY A;  2UU9 K;  4DV1 K;  4LC9 B;  2O8D B;  1JJ2 M;  3TAE A;  3K5L A;  1W7A A;  4E19 A;  4A59 A;  3AVJ A;  1IJJ A;  4H0O A;  3HT3 A;  4BWJ A;  3THY B;  2JGU A;  2BUP A;  3SJH A;  3LZI A;  1VSD A;  3CJ1 A;  4CJF A;  4BG9 A;  4CEF A;  3RSE A;  4OPK A;  3L6Q A;  3PO4 A;  4DSJ A;  5LY3 A;  4CJT A;  4CJV A;  2YV0 X;  1Y64 A;  4B9Q A;  4IJN A;  5C2F A;  3OJU A;  3FR0 A;  3M6G A;  5KTQ A;  3QNO A;  2UUC K;  2KZZ A;  3HP6 A;  4EIA A;  2UUA K;  1TKD A;  3MAQ A;  4Q5V A;  4RCH A;  3CCQ N;  4DF8 A;  4IJA A;  4FOI A;  3KTQ A;  2FSJ A;  1P8Z A;  2CGL A;  3MED A;  4E0D A;  4FM2 A;  1RCH A;  3K5N A;  4DV2 K;  5E26 A;  2F9T A;  3DXK A;  3RMB A;  1VQ7 N;  3PX0 A;  1LAW A;  1QQM A;  1T6C A;  4DR2 K;  4B3M K;  1SKS A;  4KHP K;  3V6D A;  3U4L A;  4EZ9 A;  5CYM A;  3OYC A;  4OGE A;  3CFR A;  4FK2 A;  4CFA A;  1K6Y A;  4F3O A;  5K14 A;  3VQD A;  1NJZ A;  4HWI A;  3FE1 A;  3VET A;  4JD2 B;  1LW2 A;  3OYM A;  2HMI A;  3ZSQ A;  2E2N A;  4BR2 A;  5KRT A;  2YHA A;  4ILG B;  1RDU A;  5CE3 A;  4F3T A;  3WEE B;  3ID6 A;  4FYD A;  3VF6 A;  2ZJQ L;  2P9L A;  4KH4 A;  3LDL A;  2DFE A;  1YT3 A;  1LV5 A;  2O8B B;  1ZC6 A;  3T69 A;  3CC2 N;  4CJ4 A;  5BPN A;  2CGK A;  1HNZ K;  4BC3 A;  1JLG A;  4J8F A;  3VGK A;  4CHQ A;  3HK2 A;  1Z05 A;  3O3G A;  4YOW A;  2QWN A;  3OYG A;  3O3H A;  3AO5 A;  3LZJ A;  2GV9 A;  5ADX H;  2E6M A;  2G8W A;  4FWM A;  1UOC A;  2FF6 A;  3IKM A;  3CM6 A;  3EE8 A;  5J2Q A;  3S3M A;  4HHT A;  3A8Y A;  3IS9 A;  2BAN A;  1GLL O;  4BRM A;  4XEI A;  1W97 L;  1RBR A;  3H3N O;  2D1K A;  4Z4I A;  2AJQ A;  2HHQ A;  2VWJ A;  2PYJ A;  3SAH A;  3ZEU B;  4FJI A;  4MLH A;  2QWR A;  3U3Y A;  1NWK A;  1I3A A;  1CZ9 A;  4H5V A;  3D2F A;  1BCM A;  4YOV A;  3FFI A;  5TKY A;  4W5T A;  5M1F A;  3L8B A;  5AQQ A;  1REV A;  3PUF A;  3GE1 A;  3TI0 A;  1VQ5 N;  1IH7 A;  3BDP A;  3LAL A;  5AQO A;  2P9I B;  4JKH A;  3R3L A;  1KLN A;  4BGA A;  2QWO A;  4KPY A;  3TAG A;  4XH1 A;  1RT6 A;  1X1P A;  4HTL A;  4PKG A;  4DU4 A;  2P5O A;  1DLO A;  4GNI A;  1YXQ A;  2P9U B;  1T6D A;  5AZI B;  3CM5 A;  4BRI A;  4CJK A;  1LWC A;  4AF1 A;  4ISE A;  2A41 A;  4WQ4 C;  4CEZ A;  3A0I X;  3THW B;  2NRZ A;  4B9T A;  3IRX A;  3HST B;  1S6Q A;  1BI4 A;  3CJB A;  1Q7Y O;  2YNG A;  4FK0 A;  4GY2 B;  3HM9 A;  4LF4 K;  1S1V A;  5AQW A;  3E01 A;  4CIF A;  2UXB K;  4OPA A;  3NH1 A;  4RWT A;  2NZT A;  2HMP A;  4DR3 K;  3KLF A;  4CZM A;  2YJF A;  1T05 A;  3DWL A;  4NLC A;  4PKH A;  1GLC G;  4JKG A;  3SPY A;  5KI6 A;  5GIP A;  3LAK A;  1S1T A;  5EX5 A;  5AQY A;  1SS6 A;  4XH5 A;  1HX1 A;  3M3Z A;  2FBY A;  3A5M C;  4AHR A;  1RBT A;  4I2P A; 
#chains in the Genus database with same CATH homology
 3WXL A;  2P9N A;  1N8R O;  3DXM B;  3P39 A;  4YDU C;  5AZJ B;  3C6H A;  3UKU B;  3F9M A;  1U2V A;  5HOO A;  5JLF A;  1K9M O;  1MDU B;  3H45 C;  2WFB A;  2FSK A;  2VCP A;  3K9K A;  1NGH A;  1X3M A;  3NVM A;  4BR5 A;  3KWI A;  2YI1 A;  5AQH A;  4WQ4 A;  5BR9 A;  3N4Q A;  2FXU A;  4I6M A;  3ZEU A;  1T44 A;  3I8B A;  4A2B A;  3E9O A;  2IVN A;  3CJA A;  1MWK A;  5EY4 A;  4NB4 A;  1CZA N;  3G25 A;  1T3V A;  4OPH A;  1S72 N;  1DKG D;  4BRF A;  3LM2 A;  4H5T A;  5AQL A;  4FWK A;  3CIP A;  3KK7 A;  2QWP A;  3N4P A;  1QVG M;  3VOV A;  4MO5 A;  4KH6 A;  4CZK A;  3O08 A;  4FWS A;  4IEE A;  3ZET B;  3L4I A;  4JKG B;  4WQ5 A;  3WXM B;  3WXK A;  4K42 A;  4IEI A;  1WUA A;  3ZX0 A;  3WXJ A;  1K8K A;  2E2Q A;  3NMU A;  5AQT A;  2IIR A;  2ZGZ A;  4PL7 A;  3EKS A;  4JKE A;  4EAH D;  3MCA B;  4O5F A;  2NRR A;  2EWS A;  2Q97 A;  2P9N B;  1VQ9 N;  2W41 A;  4RTF D;  3QIC A;  2D4W A;  4Z94 A;  1HJO A;  3CF5 L;  3CD6 N;  3CQY A;  3TPQ A;  1K73 O;  2ZGY A;  1U2V B;  3OBY A;  4BR0 A;  3E9P A;  5AFU H;  3UKR A;  1V4T A;  5FPN A;  3CJ9 A;  2VWB A;  3IUC A;  5JLH A;  1HKG A;  4BR7 A;  1VQ8 N;  3CPE A;  4I6M B;  5GAE P;  4ILJ A;  5AQU A;  1BDG A;  2ASP A;  3AAR A;  4QS9 A;  4JK9 A;  5F0X A;  3CXC M;  2QA4 N;  4DCH A;  2VGM A;  4H0T B;  3VEX A;  4IZ9 A;  3MN5 A;  1M90 O;  3C7N B;  5FPD A;  1NMD A;  1K8A O;  2DPN A;  3VEY A;  4FL9 A;  2YJE A;  3ENH A;  4B1Y B;  4JHD A;  1GLD G;  4WF9 L;  2QEX N;  3QB0 A;  4B1U B;  1NJI O;  3HTV A;  3A5N C;  5M1P A;  5ADX A;  1QQN A;  2V52 B;  2NRV A;  4CZG A;  3I56 N;  1HKC A;  2ASM A;  3E66 A;  1RGI A;  3PLA A;  2IVO A;  1DGK N;  1KXP A;  4C1N K;  2QWM A;  2I7N A;  4YOR A;  5EOY A;  1K8K B;  3AAQ A;  3VGL A;  1YJN N;  5HL7 L;  1S3X A;  1YIJ N;  2GUP A;  1DT9 A;  1HPM A;  3C6A A;  3O9S A;  4IFE A;  5GIN A;  1C0G A;  3J7Z O;  5JVG L;  3UKU A;  2E2O A;  1GLE G;  1QHA A;  1OKJ A;  1HKB A;  5AQS A;  3MK6 A;  2HF3 A;  3JXU A;  3VGM A;  3CJ7 A;  3MN6 A;  3SMS A;  3SAF A;  3HZ6 A;  2W40 A;  2YCH A;  3F5T A;  1ZBS A;  3VEW A;  1ESV A;  4QS7 A;  3UKR B;  3H3O B;  4JKF A;  2NRW A;  5JVH L;  2QXL A;  3FZM A;  3H1V X;  1VQO N;  1NGF A;  5M1N A;  5LJW A;  2FF3 B;  4L3Q A;  3D2E B;  2JWK A;  5DM6 L;  3CCL N;  3R9P A;  4CZE A;  1EO1 A;  3CHW A;  5GIO A;  3H1Q A;  3AGK A;  1NGG A;  2RE2 A;  2HBJ A;  1SAZ A;  1D4X A;  2VYP A;  3CC4 N;  4B1X B;  3CCJ N;  1KD1 O;  3QBX A;  4EHU A;  1LCU A;  5JIC A;  3DLL L;  1YIT N;  2P9K A;  3R6M A;  2NNW A;  2WUS A;  1JCG A;  1RDW X;  3GOI A;  4BQZ A;  1YI2 N;  1DEJ A;  3O4W A;  3PIO L;  1ATR A;  2NRH A;  3SLC A;  4U67 L;  2QWL A;  1G99 A;  3O5B A;  3D7E O;  3DJC A;  3A5L C;  3OHR A;  4DQ8 A;  1BOT O;  4FO0 A;  3CCS N;  4B1Z A;  2PBD A;  3O1W A;  4DHY A;  4IXC A;  5GAH P;  1SQK A;  4A62 A;  4BGB A;  2FSN A;  3WUH A;  5KPT A;  1NLV A;  5AQK A;  3TSU A;  4CI6 A;  3H46 O;  4CJ7 A;  4QS8 A;  2BTF A;  3KWG A;  4K41 A;  2A3Z A;  3FZK A;  3AGR A;  3UB5 A;  4GV9 A;  2E2P A;  1VQL N;  4CBW A;  3HRG A;  4MLE A;  4IOA L;  3E1Y A;  3SBG A;  1IG8 A;  3LL3 A;  5BN9 A;  2A6A A;  2QI2 A;  3EN9 A;  2YHX A;  4FPA A;  1VQ6 N;  4FWR A;  3O1B A;  4H0X B;  3R1X A;  4M63 C;  3BEX A;  1BUP A;  2HOE A;  1JCF A;  3C7N A;  3HOS A;  1KC8 O;  3K9J A;  3QFP A;  4CD1 A;  4G9Z A;  3ENB A;  1MA9 B;  4ISF A;  3ZX3 A;  2BH1 A;  4C23 A;  5I9E B;  3I33 A;  2P9K B;  4FPB A;  1BA1 A;  3WT0 A;  1BWF O;  4NO7 A;  5JMV A;  3FZL A;  1TYQ A;  3QML A;  4K43 A;  3LM9 A;  3M5R A;  2H3G X;  3LDO A;  4WFA L;  1VQP N;  2HBL A;  2Q1N A;  1S22 A;  3FLC O;  4PL8 A;  4BRH A;  5AQM A;  2AP1 A;  2Q31 A;  4Y0W A;  4BRP A;  3F2K A;  2HST A;  3GG4 A;  4B1V A;  2GEM A;  4OO1 J;  4ILH A;  1MWM A;  2IVP A;  2A42 A;  3TTD A;  3VPZ A;  5FPE A;  5CHI A;  1RFQ A;  4YDU A;  3I55 N;  3O80 A;  3VEO A;  1O13 A;  5E84 A;  1JCE A;  3TSP A;  3C65 A;  3J8A A;  3CI5 A;  3CCE N;  3DXK B;  4BC2 A;  1KQS M;  4CZL A;  5MLC Q;  3RVC A;  3QBW A;  3D2E A;  3MWP A;  5BPM A;  5F1X A;  1YUW A;  3LDN A;  4WFN L;  3QFU A;  4ISG A;  2QTD A;  4H0Y B;  4PHT X;  5TKW A;  2ASO A;  2QW9 A;  3IFR A;  3O9U A;  2KLA A;  3ATU A;  3VEN A;  4YOY A;  3EKU A;  3O9Q A;  3P4I A;  4MDA A;  4BVO A;  5KQD A;  1NM1 A;  1VQK N;  4BRG A;  3AY9 A;  2I7P A;  1J6Z A;  3TU5 A;  2V7Y A;  3HI0 A;  1LOT B;  4JAX A;  1M1K O;  4FWL A;  3CCR N;  3P38 A;  1TUY A;  5F2R A;  3ZX2 A;  1YAG A;  4A2A A;  1TYQ B;  3EE9 A;  4BVP A;  1E4F T;  1ATS A;  4JK7 A;  3OW2 M;  5BPL A;  3HM8 A;  4JEP A;  3E9L A;  4NLB A;  5AQG A;  1BA0 A;  1VQM N;  4BY9 C;  1ZXO A;  4BRD A;  5M1K A;  3BF3 A;  3LDP A;  5C15 A;  2CH6 A;  2HF4 A;  5AFU A;  3QDK A;  1GLB G;  2AA4 A;  5AQZ A;  4CZI A;  4CBU A;  3FZH A;  1X3N A;  2E88 A;  4AM7 A;  4FVU A;  5AQR A;  3G6E N;  3MN9 A;  2YHY A;  4XH4 A;  3M1F A;  4YOT A;  4LC9 B;  5KPR A;  3EO3 A;  3HBT A;  4M7X A;  5AQJ A;  1JJ2 M;  5BRE A;  3NVK A;  4U7B A;  4UY8 O;  3S41 A;  3GDQ A;  4A59 A;  2E1Y A;  1IJJ A;  1BU6 O;  2YHW A;  4BC4 A;  4H0O A;  5GAD P;  5AQV A;  3R8E A;  1NGB A;  2NRT A;  3VMF B;  3Q7B A;  3GBT A;  2BUP A;  3SJH A;  3U9Z A;  1HLU A;  1BO5 O;  3CJ1 A;  5M1Q A;  4BG9 A;  1Q18 A;  1QQO A;  2A40 A;  4DKW A;  2P9P A;  3RSE A;  3L6Q A;  3O9R A;  5AQI A;  4JD2 A;  5LY3 A;  3FGU A;  3VEV A;  4E1J A;  5AQX A;  1Y64 A;  4B9Q A;  3MN7 A;  3CMA N;  1QVF M;  2V7Z A;  4H5R A;  4IJN A;  5BN8 A;  4KH5 A;  3CER A;  5C2F A;  3WEE A;  1NGC A;  4F9O A;  5BRH A;  1XQS C;  1YHQ N;  1XUP O;  3FR0 A;  3M6G A;  4FWP A;  5C2D A;  3W0L A;  4EHT A;  4JKA A;  5BRF A;  4EIA A;  1YVN A;  3TSQ A;  3SAG A;  1R59 O;  4RCH A;  3CCQ N;  4IDH A;  4IJA A;  4FOI A;  4BG8 A;  2FSJ A;  3Q7C A;  1P8Z A;  2CGL A;  2HBM A;  3O9T A;  3ULE A;  4YOU A;  3VF2 A;  4BRQ A;  5LJV A;  1NGE A;  3D2F B;  3UE5 A;  4JKB A;  2F9T A;  4WQ5 C;  1X9J A;  4IWV A;  3DXK A;  3KZB A;  4FWN A;  4H03 B;  5E26 A;  1VQ7 N;  4B1W B;  1W2B M;  2HBK A;  1QQM A;  1T6C A;  2WBN A;  3CQX A;  3A5O C;  2PFU A;  3U4L A;  2UYT A;  5BRD A;  5AQN A;  5DM7 L;  2D0O A;  4FSV A;  4A57 A;  4A5A A;  3SMP A;  4CZH A;  3BUZ B;  3ZYY X;  5AQP A;  4C1N I;  2P9P B;  2GEL A;  2Q0R A;  4HWI A;  3RSE B;  3FE1 A;  3VET A;  4JD2 B;  4GV6 A;  3WQU A;  4YOX A;  3CCM N;  3U8X A;  4CZF A;  3U9D A;  3ID8 A;  1GLA G;  4K25 A;  2E2N A;  3MDQ A;  4BR2 A;  1C0F A;  1NGD A;  4ILG B;  1RDU A;  5CE3 A;  2KHO A;  3WEE B;  1KAX A;  2CH5 A;  1ATN A;  3VES A;  4H5W A;  3ID6 A;  2QM1 A;  3VF6 A;  1NBW A;  2P9L A;  2ZJQ L;  4KH4 A;  1XC3 A;  3VF4 A;  2E20 A;  2JWL A;  3LDL A;  2ZJR L;  5C0Y A;  4WFB L;  4BR4 A;  1ZC6 A;  1HUX A;  2GTD A;  3CET A;  3T69 A;  3ULE B;  5BPN A;  4FOE A;  2CGK A;  3B8A X;  4BRC A;  4DB3 A;  3CC2 N;  3CC7 N;  1NGA A;  4BC3 A;  4J8F A;  1KAY A;  3TTF A;  3VGK A;  3JS6 A;  1Z05 A;  2CGJ A;  4YOW A;  2P9I A;  2QWN A;  5FPM A;  3HSC A;  3BF1 A;  3BP8 A;  4FWQ A;  2YX6 A;  3FZF A;  4IO8 A;  2F7T A;  5EXW A;  4JN4 A;  2FLO A;  4H5N A;  3VER A;  3WQT A;  3GL1 A;  5ADX H;  4AM6 A;  4O8K A;  4BRO A;  4FWM A;  3EZW A;  3WXI A;  3HOT A;  2P9U A;  3LDQ A;  5AZI A;  3MX5 A;  2FF6 A;  3IKM A;  3KHY A;  3EE8 A;  4BRA A;  3EL2 A;  4BRK A;  5GAG P;  3A8Y A;  1GLL O;  4FWO A;  4BRM A;  2P9S A;  2F9W A;  1W97 L;  4XEI A;  3VEZ A;  3C0B A;  1VQN N;  3H3N O;  2D1K A;  4JNE A;  2Q2R A;  5H1S Q;  2E1Z A;  2OTL N;  2ZWH A;  5KQ8 A;  2WC9 A;  4JKC A;  3SAH A;  1KAZ A;  2Q0U A;  3ZEU B;  3CPW M;  3PIP L;  4M7Y A;  3MMV A;  4MLH A;  2Q36 A;  5C10 A;  1YJ9 N;  2QWQ A;  4H0V B;  4JKD A;  2P9L B;  3W3D A;  2QWR A;  3TTC A;  1YJW N;  1NWK A;  1BG3 A;  1QZ5 A;  4H5V A;  3D2F A;  2ZF5 O;  4YOV A;  5TKY A;  5M1F A;  5AQQ A;  4CBX A;  4KBO A;  1Q81 O;  3GE1 A;  1EQY A;  1VQ5 N;  3CCU N;  2PAV A;  2VGN A;  2A5X A;  5AQO A;  2P9I B;  4JKH A;  3CME N;  3R3L A;  3O6W A;  1Z6R A;  2QWO A;  5M1O A;  4BGA A;  4IOC L;  3L0Q A;  3MWT A;  2D0P A;  2NRX A;  1E4G T;  3KVG A;  3OA9 A;  4GVE A;  4XH1 A;  3DXM A;  4HTL A;  4PKG A;  1WOQ A;  3H6E A;  4GNI A;  1YXQ A;  2P9U B;  1T6D A;  3ATV A;  5AZI B;  3D6R A;  3P31 A;  4A5B A;  5AZJ A;  4BRI A;  2ZJP L;  1GLF O;  5B8H A;  1H1V A;  3VTI A;  4AF1 A;  1GLJ O;  4ISE A;  4CD3 A;  4IO9 L;  4MO4 A;  2A41 A;  4WCE L;  1P90 A;  2P9S B;  4IOX A;  3MCP A;  3ENO A;  4WQ4 C;  3A0I X;  4BR9 A;  2NRZ A;  1SZ2 A;  3VTH A;  1Q7Y O;  3CJB A;  1Q86 O;  2KKZ A;  3G4S N;  1NGJ A;  4EFH A;  4GV3 A;  1VAZ A;  2RHK A;  4GY2 B;  1V4S A;  3IMX A;  5ELZ A;  5AQW A;  2J4R A;  5KPZ A;  5AQF A;  2V51 B;  4BC5 A;  4OPA A;  4PKI A;  1VQ4 N;  4RWT A;  1YF5 L;  1QZ6 A;  3O8M A;  3IDH A;  2NLX A;  2NZT A;  1Q82 O;  2HMP A;  3L4Q A;  2OAN A;  3DAW A;  4CZM A;  4H0P A;  3G71 N;  2YJF A;  4WYB A;  3CJC A;  4JK8 A;  3DWL A;  3ZET A;  4JHD B;  4NLC A;  4PKH A;  3SBT A;  1GLC G;  4JKG A;  2E8A A;  3T7Z A;  4BRN A;  3OBW A;  4A61 A;  4BQL A;  4BRL A;  5GIP A;  5EVZ A;  5C12 A;  1TUU A;  2GWJ A;  3FFK B;  3CCV N;  5EX5 A;  1NGI A;  5CR4 A;  5AQY A;  1SS6 A;  4XH5 A;  1HX1 A;  4CZJ A;  4BRE A;  1U6Z A;  2GWK A;  3M3Z A;  3A5M C;  4MDB A;  2GX9 A;  3MX2 A;  2ITM A;  2OTJ N;  1OVY A;  3AAP A;  1ILY A;  5AR0 A;  3SK3 A;  4R79 A;  4O8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...