4WFNL

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22 in complex with erythromycin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wfnL01
1Q86O 3G71N 4WFNL 4WFBL 4IO9L 1YJWN 1VQ6N 1K73O 1S72N 3J7ZO 1YIJN 2ZJRL 3CXCM 5DM6L 3OW2M 1Q81O 4U67L 2ZJPL 3CCUN 1YITN 1K8AO 5JVGL 1VQKN 3CCVN 2ZJQL 3CCJN 5DM7L 1N8RO 3CF5L 3G6EN 4UY8O 1Q7YO 1OVYA 3DLLL 1VQ7N 1JJ2M 2OTLN 1KQSM 5HL7L 1VQ8N 3CPWM 1M1KO 3G4SN 1QVFM 5GADP 4WCEL 1VQ4N 3CCQN 1QVGM 3PIOL 1VQPN 5GAEP 5GAGP 3CC4N 3I56N 2QEXN 2OTJN 3CCEN 3CMAN 1Q82O 1YI2N 3CC2N 1NJIO 1YJ9N 1W2BM 3CD6N 4IOCL 4WF9L 1KC8O 2QA4N 4IOAL 3CCSN 1VQMN 1YJNN 3CCRN 1K9MO 1VQ9N 3PIPL 1YHQN 1KD1O 1VQ5N 5H1SQ 5MLCQ 5GAHP 5JVHL 1M90O 1VQLN 1VQNN 3CCMN 1VQON 1ILYA 4WFAL 3I55N 3CC7N 3CMEN 3CCLN
chains in the Genus database with same CATH superfamily
1TK8A 1Q86O 2OCEA 2A6AA 3O5BA 4CZHA 2HBMA 2O8CA 1HJOA 3I0RA 4K42A 1KFDA 3ENHA 4LFAK 4HUGA 1VQ6N 2KZZA 3H1VX 3J7ZO 1BA0A 3R1XA 1ASUA 4CEDA 1IV0A 1U6ZA 5C25A 3BDPA 4B3SK 3V9XA 4DQRA 4OLBA 3OW2M 1K8AO 1YITN 3OYHA 4IG0A 4B3RK 2WFBA 2Q97A 3LANA 2EWSA 4LY7A 4IO8A 4JKBA 1QQOA 2ZF5O 4KHUA 1RFQA 3BZKA 3ZSXA 4BWMA 1BQNA 3WQTA 4DR6K 2HF3A 1FKPA 3O9TA 1VQ7N 1D9FA 4MO5A 4FJ9A 3VA3A 3L2RA 1KRPA 1RILA 1GLCG 2QWLA 1J5EK 1S3XA 4JYAK 2HHTA 2F8SA 1QE1A 2YJFA 1TYQB 3TABA 2HHSA 1HQUA 2A1RA 4KH4A 2IDOA 1C6VA 3TAEA 5GAGP 3ENOA 4BRMA 4BREA 4PY5A 2NRHA 3DXKB 3ZEUA 4DUYK 2IS3A 4DR1K 1QTMA 3VOVA 1K8KB 4BRFA 2G8FA 4WQ4C 1XMOK 1VRUA 1C1CA 4DS5A 4CJ7A 1NJIO 2PY5A 3R6MA 3J80O 1OH8A 1BA1A 4JI4K 4W5NA 1KC8O 1VSEA 2UU9K 4BG8A 3AA3A 4BRDA 4FLWA 1XC9A 1K9MO 4B1ZA 3KLGA 2UYTA 1N32K 4HCBA 5MLCQ 4O5BA 2PAVA 3OYJA 2W40A 3QFUA 3D45A 2P9LB 2VWKA 4OGEA 3M8SA 1XQSC 2IVNA 3NE6A 5LMNK 1VSLA 3GOIA 4IJAA 2FSNA 4DTNA 3I55N 3CMEN 3CFPA 3CQ8A 1G99A 4FLZA 3MCPA 1VRTA 3EKSA 3VQ4A 4WFBL 4DV7K 4BWJA 3SYZA 2NRTA 4NCGA 4AHRA 1N6QA 4X62K 4ISGA 4HVJA 1NKBA 3MDQA 2VG5A 1TGOA 3MWTA 4Z4CA 4KTWA 3OYGA 2B6AA 4KKOA 4MLHA 3O3FA 3M8QA 3KHYA 1T03A 4DTRA 1O1WA 2Z1HA 4FJ5A 4MQ3A 3G6EN 1U2VB 4Q5VA 1VSHA 5J2MA 3L3UA 3RMBA 3FR0A 4DR7K 1MU2A 1SKRA 4TSXA 1HRHA 1UA1A 1JCGA 3CG7A 3CPWM 1UOCA 1REVA 1CXQA 2KKZA 1QQNA 5F2RA 3NGZA 1NG9A 1BCMA 2E6LA 1NGEA 4BRCA 2E6MA 5AQPA 3D2FB 3SMSA 1E4FT 3V6DA 3K58A 1WSGA 1IG8A 4DSKA 3HTVA 1HNIA 5AQNA 4E1MA 4CHNA 2NUBA 3IFRA 2HHHK 4E1JA 3CC2N 3V9UA 3P31A 4KREA 2D5RA 3QMLA 4C8MA 3AY9A 2RE2A 1X3NA 3RVCA 2VCPA 4FM1A 4FK0A 3CD6N 1C0FA 3SPZA 3K5NA 4K25A 3UB5A 3AVGA 2DFEA 4GMJB 1Q9XA 3MN7A 4FJGA 1VQMN 4I7FA 4YOVA 3UIQA 5ADXH 4H5RA 3Q7BA 3I8DA 3ZSRA 2HHUA 2OZMA 1NKEA 5AFUH 2JLEA 1ITGA 4DQ8A 3TAMA 3JXUA 3OYKA 2GUIA 4FM2A 3HM9A 2NRXA 1UA0A 1NK9A 1ILYA 1A5VA 4LFBK 1LW0A 3OY9A 5TKYA 4B3MK 1NBWA 1S1VA 1RT5A 1VHXA 1SL0A 4IEEA 4E19A 4HTUA 3LPTA 5KGXA 2ASMA 3TI0A 1YVNA 2HBKA 1NMNA 1XHZA 2Z1GA 4PKIA 4CK3A 3C6HA 4CD1A 2E8AA 4OPHA 5BN9A 4OKKA 2ZJPL 4JKEA 4K41A 1GLFO 1BQMA 1OVQA 3L2QA 3LZIA 4JS5A 1ZC6A 1OH6A 1H1VA 3KLEA 4UY8O 3T19A 3LP2A 2RF2A 1ZBHA 3NDKA 4KFBA 4PL7A 1QSLA 3VQDA 5GADP 4AHVA 5LJWA 2DPNA 1WSFA 3ZX2A 3CJBA 4O8KA 2HNZA 4O55A 3L0QA 3TSUA 2H3GX 3DRPA 4JS4A 4BRGA 2GV9A 3A5LC 1TKZA 3KD1E 3LP0A 2QEXN 2KZMA 1LAVA 4CZJA 4CCHA 4Y0WA 5FDLA 4AILC 2Q0RA 5AQKA 5EU7A 3EE9A 1KFSA 3NGYA 4B1YB 1X1PA 3I8BA 2P9IA 3CI5A 4DV6K 2P1JA 2QW9A 4BRHA 4M3RA 4CHYA 3GBTA 4DF4A 5FPEA 4IFEA 4LSLA 2NZTA 3OS1A 3IKMA 1BCOA 1JLFA 1VQ9N 1VQ5N 4CZIA 3I0SA 1DTTA 4YY3K 4MDBA 3VEZA 4DQPA 3NF9A 3T1YK 5CHIA 1JXBA 5LJVA 3SUOA 1LV5A 3SJHA 3HJFA 3HBTA 3A5NC 5IT9O 2D0AA 2P9PB 3OYFA 5C10A 5KPRA 3LAMA 1ATSA 2D1KA 3HK2A 1KCFA 1IJJA 4RW4A 4BROA 2O8FA 3VQ5A 1S1WA 4H0PA 3LL3A 3ZETA 4AQYK 4B8CA 3AA4A 4RW6A 1JXEA 1S72N 1JL2A 3NF7A 1BOTO 4BRKA 1LAWA 3SAGA 1WN7A 3K5OA 5AFUA 1F21A 4BR2A 2EHGA 2G8WA 4KAZA 1XWLA 4FM0A 4XIUA 3FLCO 3DXMB 2ZJQL 3WNHA 3MN9A 4J2BA 4FZZA 1N8RO 3PV8A 5HRNA 3OJSA 3AO1A 4B9MA 5EOYA 4H5NA 4FLTA 1WB9A 3V4IA 1WBDA 3TSQA 1VSJA 4KHQA 4JI8K 3F9MA 3HRGA 2ATQA 4CECA 3SUQA 5AR0A 4CF2A 3AV9A 4AHUA 2FF6A 4BVPA 3AVIA 1EKEA 1T3VA 2ITGA 2Q1NA 1BHLA 4IBNA 5AQXA 1TL1A 1BG3A 3SQ4A 3DMJA 1IO2A 3CCEN 4FO0A 1NJXA 2OA8A 3TAGA 3S3OA 4CEZA 3TWHA 1SUQA 3EE8A 2UUCK 5HLFA 5HOOA 4IKFA 2FBXA 2PYJA 1GLBG 1GLDG 5C42A 5I3UA 2HSTA 2P9SB 4CK1A 4BE0A 1JLGA 1YTUA 5E84A 3T3FA 1HKCA 3VQ9A 1FKOA 1TKTA 2ZGYA 2RHKA 1ZBFA 3LWLA 4L8RB 3VQ6A 1QQMA 4DTSA 1WSJA 1QHAA 4NYNA 4CBWA 3P39A 1ASVA 2OPRA 1VQON 4CFDA 3QIOA 4L3QA 5LL6Z 4CZLA 3AO2A 2F4VK 1NK7A 3FE1A 3HPOA 4Z0UA 3LDLA 3J7AP 5AZJB 2A40A 1SKWA 1MA9B 4DMNA 2VWJA 3NHGA 5AZIB 3DLEA 4IJNA 1JKHA 4W5OA 3L4IA 1X9SA 4DV0K 2PZSA 3KK2A 2HMIA 1NGBA 3CXCM 4EHTA 4BQLA 5DMRA 4CJQA 1RT2A 4U67L 3HSTB 4GV6A 4H0VB 1I3AA 4IXCA 5SWMA 3RMCA 2E2PA 3VF2A 2HBJA 4NYFA 4QS7A 1RBSA 1KXPA 4OLAA 1QHTA 5CY4A 3VTIA 5AQRA 3O4QA 4CESA 3QBWA 1CZ9A 2D4WA 1LCUA 1NK8A 1RT3A 3MXJA 4BR7A 1P8ZA 4GV9A 2FC0A 1EQYA 5GINA 3DRSA 3CCQN 3D2EA 2YHWA 1RBUA 5AQFA 1BO5O 4CEBA 4ILGB 4FWPA 4DR5K 4FJJA 2KQ2A 3I56N 4JI2K 3F2KA 3M1FA 3V9WA 4LF5K 4OGCA 4CJPA 4XH5A 2IIRA 3THXB 3IG1A 4FJIA 1YVUA 4NXMK 2P9LA 4MLEA 4DV3K 3OYCA 1D9DA 5M1PA 1HJRA 1L3TA 2HVIA 3SUNA 4JKAA 3HOSA 1HNXK 1BWFO 1NJWA 4A59A 1D8YA 3RSEA 1SV5A 4J2EA 4F8RA 3PIPL 1OKJA 4CF1A 2BH1A 1NK4A 4Z4HA 2O8CB 2HHQA 3CFRA 5JVHL 4YOUA 3O6WA 3ZX0A 2A5XA 1R59O 3RRGA 4RTFD 3HSCA 3FZMA 1J5OA 4FZYA 1S1UA 1L5UA 2OZSA 3KLFA 3CQYA 3N4PA 4H03B 1E4GT 3DLKA 4HWIA 4OJRA 2CH5A 4CJTA 3H46O 3EZ5A 4KBOA 5I42A 5SZTA 3AARA 3WXLA 2UUAK 3WXMB 1WBBA 1NGCA 5AZJA 4ZHRA 1Q81O 3EY1A 4FWOA 5J1EA 1OH5A 2HF4A 2HMPA 4DTPA 3M8RA 4DTJA 2W41A 3MEDA 2QI2A 4A2BA 1KAYA 3WXJA 2RKIA 3VN5A 4FSVA 4MFBA 1BIZA 3NH0A 2OTLN 1XC3A 1KQSM 3THVA 1SL1A 3MEGA 2I7PA 3ZLJA 2P9NA 3AVNA 1DEJA 2YHAA 3DLBA 3C65A 4JK8A 1ZXOA 3VETA 2I5JA 4CI6A 2ZD1A 3JAMO 3KTQA 4E7IA 1KTQA 4CGGA 1N36K 1RBTA 2GX9A 4PUOA 1RDCA 3CMAN 2ASOA 1QQCA 4DF8A 3ZEUB 4RWTA 3BY5A 4Q0BA 3G0ZA 3NVKA 2ZM6K 2F96A 5HP1A 4F2SA 4CIGA 3OYDA 5AQQA 1YJ9N 1JLBA 4CGHA 4M3XA 3IUCA 4O44A 3VQAA 3RMAA 3O3HA 2G8KA 5D3GA 4JEPA 3QBXA 4KHWA 4M42A 4QS9A 4DSFA 5AQSA 1EETA 3ZT3A 3OS0A 1WOQA 4DKWA 2VGMA 4CHPA 1GLEG 4CJ4A 1TAQA 2GTDA 3MMVA 1VQNN 2O8DA 1GOAA 4ILHA 4JD2B 4KO0A 5KQ8A 4BVOA 1NGFA 1TUYA 2CGLA 4MDAA 3BEXA 3ID8A 1WSIA 2PYLA 4BE1A 4DV1K 1IBMK 3AVFA 3PO5A 1S6QA 4IO9L 4F3OA 5AZIA 3HVTA 4PL8A 4FYDA 2BE2A 3QDKA 3LP3A 3K59A 4IG3A 1HLUA 4W5QA 3DXKA 3ZX3A 3D7EO 3ITHA 2P51A 3KK1A 3SBTA 1NLVA 3VEVA 5EVZA 4AHTA 2V7YA 4I2QA 3TPQA 3CCJN 4KTQA 3BF1A 3ATVA 4DLEA 1A5XA 5BPMA 3NAEA 3UKRA 1EX4A 4PQUA 4OKJA 5BRDA 1EO1A 4FVUA 3KK3A 5E26A 2YKNA 3TTDA 1FJGK 1Z25A 4M3TA 3T1HK 1HX1A 2ASPA 2HNDA 1QVFM 2RPIA 2W6KA 4DQSA 4A2AA 3B8AX 2AJQA 4B1UB 2E1YA 4JI3K 4QS8A 4JV5K 2YV0X 4B3TK 3AO3A 4Y1DA 3B6PA 3W3DA 4Z4FA 4C23A 2P9KB 4O0JA 3OVNA 3HO1A 4JN4A 4PHTX 2Z1IA 4BDPA 3DYAA 3DOKA 3ZSOA 3QEWA 1GLJO 2UXDK 4AF1A 4FLYA 3AGRA 2GBZA 3VMFB 2QKKA 1JCEA 3A5OC 4CF9A 1TL3A 1YUWA 4CGJA 4BR4A 2HB5A 1C0UA 2ZWHA 3H08A 1LWFA 1M90O 2WONA 2I7NA 5J2PA 4CGFA 1RDDA 3EKUA 2WTUA 3W0LA 2VG7A 1RT1A 4ZTJA 4NCAA 4FJXA 1R0AA 2HHWA 4C1NI 4DU3A 3VQ7A 5CR4A 4JI5K 2LSNA 3ENBA 2ZGZA 4FWLA 4BR9A 4LH4A 1VSMA 1P90A 3A5MC 4OVLA 4BE2A 3EN9A 4RG8A 2FXUA 4FCYA 1NNEA 1IBLK 4CFBA 1L3UA 5AQMA 3DLGA 1EWRA 3O1BA 3DJCA 5BR8K 1TK5A 5JVGL 3KJVA 2NRZA 2VG6A 4F4KA 3MX5A 4G1QA 3CJ1A 1YAGA 5AQZA 4CBUA 5AQTA 3PX6A 4F2RA 3ZT4A 4V19S 1TVRA 2KFNA 2QWPA 3DWLA 4M7YA 3LAKA 1TKXA 3ZSWA 4IZ9A 1HPZA 3HYFA 4CEAA 1NMDA 3B6OA 3O9RA 2CH6A 3PSIA 3L6QA 2VGNA 4KV8A 4PKGA 1VQ4N 3BUZB 4FWMA 1Y97A 4ICLA 3EYZA 1SAZA 1JLCA 1B92A 3HT3A 3DLHA 1J9AA 4C8LA 1N34K 1S5JA 4FL9A 3RTVA 1VQPN 2X78A 3NF6A 4DTOA 4QOZB 1CXUA 1NGIA 4BR5A 3D0PA 1HNVA 4KI6A 2D0BA 3LM2A 4FWRA 1OH7A 4BGAA 1MDUB 4CW7B 3QEXA 3H1QA 4DQIA 3VERA 1RDWX 2F9TA 5BR9A 4F3TA 4CHZA 1W2BM 1JLEA 2JWKA 4DLGA 1Q9YA 2A3ZA 3IMXA 3TTCA 4CJWA 4UQGA 1I39A 2KW4A 2QA4N 3G25A 4LF9K 3WXIA 3AVCA 3KVGA 4DQQA 3MCAB 2QTDA 5FRNA 3U6FA 4DSIA 4JI0K 4CHQA 3UKUB 2AA4A 1LWCA 2HHVA 3GE1A 5C0YA 3O1WA 1G15A 1SKSA 4A5AA 3IS9A 4KHPK 4FWNA 1VQLN 3GL1A 2DFHA 3J7YP 2GUPA 5J2NA 1DT9A 5FLXO 1JLAA 5C2FA 3SV4A 2IVPA 1W7AA 4M3WA 1E3MA 1K6YA 1RTIA 3CHWA 5AQWA 3C6TA 4LC9B 4CJLA 3PUFA 4B9SA 1L3VA 2IC3A 5LMUK 4LFCK 4E1NA 3V1RA 4OKEA 5FPDA 3VESA 4IEIA 5J2QA 1KLMA 3R3LA 1RDUA 1XMQK 2OPQA 1VSIA 1RDAA 3SI6A 2Q0UA 4EHUA 2QWOA 3CF5L 5HBMA 1O13A 4DSLA 1VSDA 4ID1A 1YF5L 1HYZA 3HVRA 1ZBIA 1Y64A 3H45C 3G4SN 4FK2A 4CGDA 3SCXA 2DTUA 4AM7A 1HQEA 3O08A 4DSEA 3PX0A 3M3ZA 1NOYA 4YHHK 4KHNA 1JCFA 3WXKA 4C8KA 3SPYA 4KB1A 3CIPA 4JK9A 2IGIA 3J8AA 5M1FA 5E41A 2Y1IA 4JNEA 4ELVA 3H3NO 4BRQA 2YHYA 3AAQA 5AQLA 4FWKA 1HKBA 3WNGA 5I9EB 4YORA 4GKKK 2D0PA 4FJ7A 1C1BA 3QINA 4JRPA 1YXQA 1JLQA 3CCRN 4EP4A 3ZT1A 2O8DB 4OPJA 3VQEA 3OYAA 1D4XA 1RT4A 1QS4A 2F7TA 1S9GA 1XHXA 2EX3A 1Q8IA 5ADXA 4E0DA 4CF8A 3CETA 4BRNA 3THWB 3RR7A 4WQ4A 1RDBA 4R79A 3CCLN 2QM1A 2E5LK 3ZSYA 2G8IA 4Z4IA 4YOYA 2KFZA 4JD2A 3WNEA 2O8EA 1WSHA 3NBPA 4H0YB 5IWAK 2WBNA 5GIPA 1WNSA 1YJWN 1MWMA 1NGGA 4B3OA 3HP6A 4CJSA 4B9VA 4LF8K 1X9WA 4FPAA 2ZJRL 4CZGA 3E9OA 3P38A 4CHOA 5HROA 4H0TB 2FSKA 4N5SA 1S9EA 4NO7A 2G8HA 1QSYA 4N56A 3O4NA 4J8FA 1NK6A 3ULDA 3U9DA 1OVYA 2QXFA 3FZLA 3QEIA 2YI1A 3QNOA 2YCHA 5A2QO 3CM5A 3AVAA 2OANA 5BN8A 3TAPA 3OYLA 3ZYYX 2E1ZA 1N33K 3MK6A 2GEMA 5GAEP 4KHSA 3LDOA 2IAJA 3E66A 3PSFA 4DV5K 1HMVA 4BRLA 3M6GA 3ZSZA 2BUPA 2UXBK 3AO5A 1QZ5A 2HVHA 3VQQA 1ZBSA 4FJNA 5JICA 3HZ6A 1NK5A 4E89A 5C24A 1B9DA 4GW6A 3O9QA 2ETJA 2F9WA 4CE9A 2FBYA 1L3SA 3VEOA 3RRHA 3CJCA 2BDPA 4E7JA 2O4GA 4BDYA 4Z4GA 4CBXA 1U45A 3KWIA 3LDSA 4JRQA 5H1SQ 3FGUA 3UE5A 4JLHA 2XY8A 1K8KA 3TTFA 3K5LA 2BANA 4CJ5A 1S22A 4E7KA 3SQ2A 1T8EA 3S3MA 4FJMA 4M63C 3K0SA 3THYB 1NWKA 1T6CA 3JS6A 1BU6O 5FROA 2BTFA 3NFAA 4A61A 1IKVA 4H4OA 4I9LA 1LW2A 2XY5A 3G71N 1NGDA 1SS6A 4WFNL 3SV3A 3S3NA 3QESA 4BC5A 3NVMA 5KGWA 5AQJA 3MWPA 4CJVA 3SQ0A 5T7BA 4B9QA 1RBRA 2XRIA 2KHOA 4JKFA 1GLAG 2DY4A 3AVKA 3I33A 3C95A 1KVCA 3L2WA 3K9JA 4LF4K 4GKJK 3RR8A 1BL3A 1T05A 3P83D 1W9HA 1D5AA 4BRAA 4CEOA 4CIEA 1Q7YO 1TYQA 3QO9A 5CZ2A 5FPNA 1TUUA 5M1OA 4NLBA 4DV4K 4QCLA 4CK2A 4AM6A 5AJ3K 5F1XA 3BZCA 3SUPA 1VQ8N 1V4TA 1NJYA 1NGJA 4KH5A 3ZETB 4DS4A 4XH4A 1C1AA 4X64K 1UWBA 1J53A 2Q3SA 3KKRA 5AQOA 4JKCA 3CC4N 3SMPA 2YNFA 1U48A 2V7ZA 1U47A 3VGMA 5AQHA 2FSJA 2YNIA 4FW2A 5AQYA 4O5FA 2E4LA 3K5MA 4DTMA 4A57A 3GG4A 3QB0A 4CIFA 4O4GA 4IOAL 3EZWA 3AVLA 3OHRA 3P4IA 3CCSN 3V9ZA 1YJNN 4NXNK 1NM1A 1EXQA 3Q7CA 2DFFA 3CJ7A 3DRRA 3ZCMA 4U7BA 3R9PA 3LM9A 4KRFA 3CYMA 3WEEA 3K9KA 3AVBA 5HRPA 4B1XB 1VSFA 4FVMA 2WC9A 3AA5X 3MN5A 5DK5A 3PLAA 4ZTFA 1KSPA 4CZKA 2YJEA 1U4BA 4DR3K 4FZXC 1KVAA 4EIAA 1EWQA 3M8PA 4JI1K 3VF6A 2O8BB 4M3ZA 3L2UA 1KLNA 3VQPA 3SAFA 2YHXA 3C6AA 3DI6A 1XI1A 3F5TA 4H0OA 4RCHA 1YIJN 1WAJA 3LDQA 3TAQA 4BY9C 3WUHA 5M1NA 4CVNE 3VA0A 4HHTA 2HOEA 2ITMA 5GIOA 1HKGA 3ISNC 3WEEB 4BGBA 3E01A 4W5RA 1HYVA 5CYQA 1XNQK 5JS2A 3E1YA 2GELA 4LSNA 1T6DA 2E20A 3E9PA 2AP1A 5EY4A 3FZFA 3HP9A 3CERA 4FJHA 4LF6K 1SL2A 4K43A 2D0OA 3CJ9A 3QNNA 4IDKA 3G10A 3ULEA 3AVMA 3WT0A 3VQCA 4WCEL 5KPZA 2F8TA 4CD3A 3DXMA 3BF3A 5KI6A 5KPTA 1GOBA 4X65K 3VF4A 5AQVA 3HPHA 2FLOA 5F0XA 5KRSA 4BG9A 4BRPA 4YOWA 4M7XA 4BC4A 3DOLA 1HYSA 1Q82O 3A0IX 1BISA 3T1AA 3C7NB 3MAQA 1RTJA 3N4QA 2V52B 4ILJA 1T44A 3SBGA 3OS2A 3S9HA 3VGLA 1X9MA 3ZT0A 4C8NA 4JHDA 5EXWA 4EZ6A 2GWKA 2YKMA 3O80A 3KD5E 5BRFA 3SLCA 2FBVA 4PWDA 2D0CA 3OBWA 4EFHA 3O8MA 4CZEA 4AH9A 1IG9A 4OX9K 3OBYA 4M3UA 1KD1O 4B9LA 4BDZA 4FOEA 1HUXA 3A8YA 3L8BA 1KVBA 4FWSA 2NRVA 1U04A 1XUPO 3IDHA 4IFVA 2OPPA 3U4LA 3ULEB 1IBKK 4WFAL 3MECA 4BRIA 5BRHA 3GDQA 2XHBA 4H8KA 1ZYQA 4B8AB 2P5GA 4X66K 1QSSA 3KK7A 4HUFA 4FLVA 1Z6RA 1ZBUA 2HNYA 3DM2A 3ASMA 3ID6A 4M45A 5DM6L 5C15A 3V1OA 4EP5A 3CCUN 4K8XA 2IVOA 1TK0A 4CJFA 3CCVN 3ZSQA 5KRTA 2KTQA 2G8VA 2FF3B 4C1NK 4FPBA 2HBLA 1X3MA 3T69A 1JJ2M 4BACA 4B9UA 3KLHA 3EEQA 3K57A 3QERA 4DTXA 1HNWK 2KLAA 2BGGA 3VQ8A 5HRSA 4DWIA 4I6MA 4J2DA 4GV3A 3EL2A 3QFPA 1QVGM 4IFYA 4CEQA 3CFOA 3FFKB 2VQEK 4BC2A 3T7ZA 1U2VA 4DTUA 3RMDA 1GLLO 1YT3A 4ID5A 3VPZA 3NCIA 5M1QA 3SK3A 2V51B 4RW8A 4N41A 1LOTB 3V81A 3IAYA 3OJUA 4OPKA 4IOXA 5TKWA 4XEIA 2P9UA 2A42A 2OPSA 1VAZA 1ESVA 3AVHA 4KPYA 3QICA 5AQIA 2P9KA 3S41A 1QZ6A 2P9NB 3V9SA 4FJLA 4WYBA 1DGKN 2W6LA 2Y1JA 4RW9A 4WQ5A 3OYEA 3CPEA 5GAHP 4C8OA 4OO1J 1FXXA 4H0XB 3FZHA 2E2NA 3AO4A 2NRRA 2Q31A 3KZBA 4JKDA 2VWBA 2G8UA 3PO4A 2QKBA 1UAXA 1C0TA 5CE3A 5EX5A 4JI6K 4CZFA 1Z05A 2Q36A 4O8UA 1DTQA 3OYMA 4ISFA 3H6EA 1U49A 3KWGA 5BREA 4ISEA 4FWQA 1DKGD 3SZ2A 3O9SA 4KHYA 2R7YA 2OYQA 3IRXA 1VQKN 4DR2K 3THXA 3SAHA 4BC3A 3AA2A 2YNHA 2A41A 2XO7A 2UXCK 2E2QA 4B1WB 3HM8A 4YDUA 4FOIA 3KKSA 2W42A 2JGUA 5BPLA 1CLQA 2E2OA 3QEPA 1DLOA 1M1KO 3RSEB 3HL8A 3H3OB 5CZ1A 1ASWA 2VQFK 3QETA 4LD0A 2P9SA 3LDPA 3EO3A 3QLHA 5JLFA 3C6UA 1RT6A 1VSKA 4FLXA 3VQBA 1NK0A 2CGKA 4CFAA 4DU4A 2E88A 1SQKA 2OTJN 1V4SA 3VENA 2P5OA 1YI2N 4LH5A 5AQGA 2ZE2A 2ZQBA 4RW7A 1CZAN 5ELZA 2QK9A 3U9ZA 3UKRB 3ZSVA 4DHYA 3L2VA 2Z1JA 3O3GA 3AVJA 4H5VA 4E7LA 4YOTA 1SZ2A 2IOCA 1B9FA 5B8HA 3BP8A 5FRMA 3P1GA 3WNFA 3LZJA 3PX4A 3AAPA 4DFPA 5LY3A 1J6ZA 1NJZA 3VEXA 5C12A 4G9ZA 2O8FB 4I2PA 1WLJA 3HPGA 3F9KA 1IH7A 2P9PA 3ALYA 5KQDA 2B5JA 3QEVA 1BIUA 4EAHD 3R8EA 3VGKA 4GNIA 1RCHA 4QAGA 4H5TA 4HUEA 2NRWA 3MX2A 4EZ9A 1HNZK 1BUPA 1J54A 4XH1A 3NGIA 3TANA 3OTOK 3HOTA 3K2PA 4DCHA 1RTDA 3L3VA 5KTQA 4JAXA 2P9UB 4KB0A 4JKHA 3DLRA 4M41A 3KIOA 5BPNA 1EP4A 1K73O 1NGAA 3TU5A 5JLHA 1NKCA 4CJEA 4FXDA 2B4JA 4PA1A 4CF0A 3D2FA 4GVEA 3AGKA 2VYPA 2CGJA 1T7PA 4CJKA 4Z94A 2Q2RA 3V1QA 4WE1A 4CEEA 2O8EB 1S1XA 3TAFA 2A1SA 3JYTA 4H5WA 4YFUA 4FK4A 4R5PA 3HXMA 2HW3A 4A62A 3OYNA 2WOMA 3NF8A 3NMUA 5JS1A 3OA9A 3RWUA 3OYBA 4HCCA 3SQ1A 3C94A 4DG1A 1HR0K 4YNQA 3QIPA 3MEEA 5JMVA 3DAWA 3TSPA 2WUSA 4B9TA 1FW6A 4M3YA 4MO4A 5M1KA 3LDNA 1ZBLA 3SJJA 1X9JA 2FBTA 1NU0A 1I94K 4IDHA 2X74A 3JSMA 4J2AA 3D2EB 4N47A 3TR8A 2XY6A 4ELUA 4K8ZA 5C2DA 3MXIA 1RTHA 3J81O 4YOXA 4B08A 4NCBA 4O0IA 4CJRA 1XNRK 1S6PA 3L4QA 3U8XA 4WF9L 4CGIA 3VTHA 3NH2A 1HPMA 1RBVA 1RGIA 3FZKA 4JHDB 3KLIA 3LWMA 4KTZA 1Q18A 3VEWA 5CYMA 1WAFA 1IKYA 1KAZA 4AHSA 5AQUA 1JL1A 2PFUA 2QXLA 4JKGB 3NH1A 4DFKA 2YNGA 2HHXA 4NLCA 3CJAA 1WSEA 1A5WA 2J4RA 3CCMN 4LF7K 1YTAA 3LALA 4CJUA 4JKGA 1ATRA 3O4WA 3P5JA 3FFIA 4DSJA 3ZT2A 3CC7N 3BGRA 1C0MA 1BI4B 4FW1A 4E3SA 4DFMA 2O8BA 4W5TA 4B9NA 3F73A 1BI4A 4N76A 2NLXA 1BGXT 4IWVA 4DUZK 1TV6A 4HTLA 3ATUA 4A5BA 4Z4EA 3CQXA 1TKDA 1RNHA 3UKUA 2UUBK 3TARA 2NNWA 3VEYA 2YX6A 4CFCA 2GWJA 4CZMA 3D6RA 5DM7L 2QWMA 4YDUC 3THWA 4JK7A 1W97L 1LWEA 4FJ8A 1GOCA 4E7HA 3DLLL 1CZBA 1W0HA 4CJ3A 3WQUA 4K0KK 1C0GA 4AHCA 5HL7L 1ATNA 4B1VA 4DFJA 4BR0A 4FLUA 2PBDA 4DR4K 4KI4A 4OPAA 3PIOL 2QWRA 1MWKA 3MN6A 4JI7K 4CERA 1NGHA 2X6NA 4DB3A 3PY8A 3LPUA 4FJKA 4I6MB 4BQZA 1RT7A 1TAUA 3U3GA 4GVMA 1FK9A 1S1TA 1IKWA 3HI0A 4KH6A 3E9LA 2QWNA 2O4IA 1IKXA 1N5YA 4PKHA 4GY2B 3MXMA 4IOCL 3A2FA 1NOZA 4NB4A 4CEFA 1Z26A 1VK0A 4DU1A 3C7NA 2P9IB 4F9OA 4WQ5C 1WUAA 1YHQN 5K14A 2YHBA 5FPMA 3THYA 4I9QA 2XY7A 4DV2K 3LP1A 3SNNA 2JWLA 2QWQA 2RN2A 3O9UA 1KAXA 4H4MA 3CM6A 3M5RA 3C0BA 3OYIA 2X6SA 5HRRA 3U3YA 1BDGA 4Y1CA 4ELTA
chains in the Genus database with same CATH topology
1Q86O 1MA9B 3KK7A 3CHWA 2A6AA 1Z6RA 3O5BA 2HBMA 5AQWA 5AZIB 4IJNA 1HJOA 4LC9B 4CZHA 4K42A 3ENHA 3L4IA 1VQ6N 3H1VX 3J7ZO 1BA0A 3ID6A 3R1XA 1NGBA 5FPDA 1U6ZA 3CXCM 3VESA 4IEIA 4BQLA 4EHTA 5DM6L 5C15A 3OW2M 3R3LA 4U67L 3CCUN 1YITN 1K8AO 4GV6A 1RDUA 2WFBA 2IVOA 2Q97A 4H0VB 4IXCA 2ZJQL 2EWSA 4IO8A 4JKBA 1QQOA 3CCVN 2Q0UA 4EHUA 2E2PA 2ZF5O 2HBJA 3VF2A 2QWOA 1RFQA 2FF3B 4QS7A 4C1NK 3CF5L 1KXPA 4FPBA 2HBLA 5AQRA 3VTIA 1X3MA 1O13A 3QBWA 3WQTA 3T69A 2HF3A 1YF5L 3O9TA 1JJ2M 2D4WA 1VQ7N 1LCUA 1Y64A 3H45C 4MO5A 4BR7A 1P8ZA 4GV9A 2QWLA 1GLCG 1S3XA 3G4SN 2KLAA 2YJFA 1TYQB 1EQYA 4AM7A 5GINA 3CCQN 3O08A 4I6MA 3D2EA 2YHWA 3M3ZA 4GV3A 3EL2A 1JCFA 3QFPA 1BO5O 5AQFA 1QVGM 4ILGB 4KH4A 4FWPA 3WXKA 3FFKB 3CIPA 4BC2A 5GAGP 4JK9A 3T7ZA 3I56N 1U2VA 3ENOA 3F2KA 3J8AA 3M1FA 5M1FA 4BRMA 4BREA 1GLLO 2NRHA 3DXKB 3VPZA 4JNEA 3ZEUA 3H3NO 5M1QA 3SK3A 4XH5A 2YHYA 3VOVA 2IIRA 1K8KB 2V51B 4BRQA 4WQ4C 3AAQA 5AQLA 4BRFA 4FWKA 1LOTB 2P9LA 4MLEA 5AZJB 4IOXA 4CJ7A 1HKBA 5TKWA 4XEIA 5I9EB 1NJIO 3R6MA 5M1PA 4YORA 2P9UA 2A42A 1VAZA 4JKAA 3HOSA 1ESVA 2D0PA 1BA1A 3QICA 1BWFO 4A59A 5AQIA 2P9KA 1KC8O 3S41A 1QZ6A 2P9NB 3RSEA 1YXQA 4BG8A 4BRDA 4WYBA 1DGKN 3CCRN 1K9MO 4B1ZA 3PIPL 1OKJA 2UYTA 4WQ5A 2BH1A 5MLCQ 2PAVA 3CPEA 5GAHP 4OO1J 4H0XB 5JVHL 4YOUA 3FZHA 2E2NA 2NRRA 3O6WA 3ZX0A 2Q31A 2W40A 3QFUA 1D4XA 3KZBA 2P9LB 1XQSC 2A5XA 1R59O 2F7TA 4RTFD 2IVNA 4JKDA 3HSCA 2VWBA 3FZMA 5ADXA 3GOIA 4IJAA 2FSNA 3CETA 4BRNA 3CQYA 3N4PA 3I55N 4H03B 3CMEN 1E4GT 4WQ4A 4R79A 5CE3A 5EX5A 3CCLN 2QM1A 1G99A 4HWIA 3MCPA 4CZFA 3EKSA 4YOYA 1Z05A 2CH5A 2Q36A 4O8UA 4WFBL 4JD2A 3H46O 4H0YB 2NRTA 2WBNA 5GIPA 4KBOA 1YJWN 4ISFA 3H6EA 1MWMA 1NGGA 3KWGA 5BREA 3AARA 4ISEA 4FWQA 1DKGD 3WXLA 4ISGA 3WXMB 1NGCA 3MDQA 4FPAA 2ZJRL 4CZGA 3E9OA 3O9SA 3P38A 5AZJA 3MWTA 1Q81O 4FWOA 4H0TB 2FSKA 2HF4A 2HMPA 4MLHA 1VQKN 3KHYA 3SAHA 4NO7A 2W41A 4BC3A 2QI2A 4A2BA 1KAYA 2A41A 4J8FA 3WXJA 3G6EN 3U9DA 1U2VB 1OVYA 2E2QA 3HM8A 4FSVA 4YDUA 4FOIA 4B1WB 3FR0A 3FZLA 5BPLA 2OTLN 1XC3A 2YI1A 1KQSM 2E2OA 2YCHA 1JCGA 3CPWM 2I7PA 1M1KO 2P9NA 3RSEB 1DEJA 2OANA 2KKZA 5BN8A 1QQNA 5F2RA 3H3OB 2E1ZA 3ZYYX 1NGEA 3C65A 4JK8A 3MK6A 4BRCA 2P9SA 5AQPA 2GEMA 1ZXOA 3D2FB 3EO3A 3LDPA 3VETA 4CI6A 3SMSA 1E4FT 5JLFA 5GAEP 3LDOA 1IG8A 3E66A 2CGKA 3HTVA 4BRLA 5AQNA 3M6GA 2E88A 2BUPA 2GX9A 1SQKA 2OTJN 1QZ5A 3CMAN 2ASOA 1V4SA 3IFRA 3VENA 3ZEUB 1YI2N 4E1JA 3CC2N 3P31A 4RWTA 1ZBSA 5AQGA 5JICA 3HZ6A 3QMLA 3NVKA 3AY9A 2RE2A 1CZAN 5ELZA 5AQQA 1X3NA 3U9ZA 3UKRB 1YJ9N 3O9QA 2VCPA 3RVCA 3CD6N 1C0FA 2F9WA 3IUCA 4DHYA 3VEOA 3CJCA 4H5VA 3QBXA 4JEPA 4K25A 3UB5A 4YOTA 1SZ2A 3MN7A 5B8HA 3BP8A 4CBXA 1VQMN 3KWIA 4QS9A 4YOVA 5ADXH 4H5RA 5AQSA 3Q7BA 3AAPA 1WOQA 5H1SQ 5LY3A 4DKWA 1J6ZA 2VGMA 3FGUA 5AFUH 3VEXA 3UE5A 5C12A 4G9ZA 1GLEG 1K8KA 4DQ8A 3JXUA 3TTFA 2GTDA 3MMVA 1S22A 2NRXA 1VQNN 2P9PA 4ILHA 5KQDA 4EAHD 1ILYA 3R8EA 3VGKA 4GNIA 4H5TA 4M63C 2NRWA 3MX2A 4JD2B 5KQ8A 5TKYA 1BUPA 4XH1A 1NWKA 1NBWA 1T6CA 3JS6A 1BU6O 4BVOA 1NGFA 1TUYA 2BTFA 2CGLA 3BEXA 3ID8A 4MDAA 4DCHA 3HOTA 4A61A 3G71N 1NGDA 1SS6A 4IEEA 4JAXA 4WFNL 2P9UB 4IO9L 4JKHA 5AZIA 4BC5A 3NVMA 2ASMA 4PL8A 5BPNA 1YVNA 1K73O 5AQJA 2HBKA 1NGAA 3TU5A 3MWPA 5JLHA 3QDKA 4PKIA 4B9QA 3C6HA 4CD1A 2KHOA 2E8AA 4OPHA 5BN9A 3D2FA 4JKFA 4GVEA 1HLUA 3AGKA 4JKEA 3DXKA 2VYPA 3ZX3A 1GLAG 2ZJPL 4K41A 3D7EO 1GLFO 2CGJA 3I33A 1NLVA 3SBTA 5EVZA 3VEVA 4Z94A 2Q2RA 2V7YA 3K9JA 3TPQA 3CCJN 1ZC6A 1H1VA 3BF1A 3ATVA 4BRAA 5BPMA 4UY8O 4H5WA 3UKRA 1Q7YO 1TYQA 5FPNA 1TUUA 5BRDA 5M1OA 4NLBA 4FVUA 1EO1A 4PL7A 5E26A 4A62A 4AM6A 3TTDA 5F1XA 1VQ8N 1HX1A 2ASPA 1V4TA 1QVFM 3NMUA 1NGJA 4KH5A 3OA9A 5GADP 3ZETB 4XH4A 5LJWA 2DPNA 3ZX2A 3CJBA 4O8KA 5AQOA 3L0QA 3TSUA 2H3GX 4JKCA 4BRGA 4A2AA 5JMVA 3B8AX 3CC4N 3DAWA 3TSPA 4B1UB 2WUSA 3A5LC 4MO4A 3SMPA 2E1YA 5M1KA 2QEXN 3LDNA 4CZJA 2V7ZA 4Y0WA 1X9JA 4QS8A 2Q0RA 4IDHA 5AQKA 3D2EB 3EE9A 3VGMA 3W3DA 5AQHA 2FSJA 5AQYA 4B1YB 4C23A 2P9KB 4O5FA 5C2DA 4YOXA 3I8BA 4JN4A 2P9IA 4PHTX 4A57A 3CI5A 3GG4A 3QB0A 3L4QA 3U8XA 2QW9A 4WF9L 4BRHA 3VTHA 1HPMA 3GBTA 4IOAL 1GLJO 5FPEA 4IFEA 3EZWA 1RGIA 3OHRA 3P4IA 3AGRA 4AF1A 2NZTA 3FZKA 4JHDB 3CCSN 1YJNN 3VMFB 1JCEA 1NM1A 3A5OC 1Q18A 3IKMA 3Q7CA 3VEWA 1VQ9N 3CJ7A 1VQ5N 4CZIA 1YUWA 4BR4A 4MDBA 3VEZA 2ZWHA 1KAZA 4U7BA 5AQUA 3R9PA 4JKGB 2PFUA 2QXLA 3LM9A 1M90O 2I7NA 5CHIA 3WEEA 5LJVA 4NLCA 3SJHA 3EKUA 3CJAA 3HBTA 3K9KA 3A5NC 3W0LA 4B1XB 2J4RA 3CCMN 2WC9A 4JKGA 2P9PB 3MN5A 1ATRA 3O4WA 5C10A 5KPRA 3PLAA 4C1NI 3CC7N 5CR4A 1ATSA 4CZKA 2YJEA 3ENBA 4EIAA 2D1KA 2ZGZA 1IJJA 4FWLA 4BROA 4H0PA 3LL3A 3VF6A 4BR9A 3ZETA 3SAFA 2YHXA 1P90A 3C6AA 3A5MC 1S72N 2NLXA 4IWVA 3F5TA 4HTLA 3ATUA 3EN9A 4A5BA 1BOTO 2FXUA 4H0OA 4RCHA 4BRKA 3LDQA 1YIJN 3CQXA 3SAGA 4BY9C 5AQMA 3WUHA 5AFUA 5M1NA 3O1BA 3UKUA 3DJCA 4BR2A 2NNWA 3VEYA 2HOEA 2ITMA 5GIOA 5JVGL 1HKGA 3WEEB 2NRZA 2YX6A 4BGBA 3MX5A 3FLCO 3DXMB 2GWJA 3D6RA 3CJ1A 1YAGA 3MN9A 4CZMA 5AQZA 2QWMA 4YDUC 5AQTA 4CBUA 3E1YA 5DM7L 2GELA 4JK7A 1T6DA 1W97L 1N8RO 3E9PA 2E20A 2AP1A 2QWPA 3DWLA 5EY4A 4M7YA 3FZFA 5EOYA 3CERA 4H5NA 4IZ9A 3DLLL 1NMDA 3O9RA 3TSQA 4K43A 2CH6A 2D0OA 3L6QA 3CJ9A 3WQUA 3F9MA 3HRGA 2VGNA 1C0GA 5HL7L 1ATNA 3ULEA 5AR0A 4B1VA 4PKGA 3WT0A 2FF6A 4BVPA 4BR0A 4WCEL 1VQ4N 3BUZB 5KPZA 4FWMA 1T3VA 1SAZA 2PBDA 4OPAA 4CD3A 3PIOL 2QWRA 3DXMA 3BF3A 1MWKA 4FL9A 2Q1NA 3MN6A 5AQXA 1VQPN 5KPTA 1NGHA 5AQVA 3VF4A 2FLOA 1BG3A 4DB3A 5F0XA 1NGIA 4I6MB 4BQZA 4BG9A 4BR5A 4BRPA 4YOWA 4M7XA 3CCEN 4BC4A 4FO0A 1Q82O 3A0IX 3LM2A 3C7NB 4FWRA 3N4QA 3HI0A 4KH6A 2V52B 4ILJA 1T44A 3E9LA 3SBGA 4BGAA 1MDUB 3EE8A 2QWNA 3H1QA 3VGLA 3VERA 1RDWX 2F9TA 5BR9A 5HOOA 4PKHA 4GY2B 4JHDA 5EXWA 1W2BM 2JWKA 2GWKA 3O80A 4IOCL 5BRFA 3SLCA 2A3ZA 3IMXA 4NB4A 1GLBG 3TTCA 1GLDG 3OBWA 2QA4N 2HSTA 2P9SB 3C7NA 4EFHA 3O8MA 3G25A 2P9IB 3WXIA 4CZEA 4F9OA 4WQ5C 1WUAA 1YHQN 3KVGA 3OBYA 1KD1O 3MCAB 2QTDA 5E84A 4FOEA 1HUXA 1HKCA 5FPMA 2ZGYA 3A8YA 4FWSA 2NRVA 3UKUB 2AA4A 2RHKA 3GE1A 5C0YA 1QQMA 1XUPO 3O1WA 2JWLA 1QHAA 4A5AA 3IDHA 2QWQA 4FWNA 1VQLN 3O9UA 1KAXA 3P39A 3U4LA 4CBWA 3GL1A 3M5RA 3ULEB 2GUPA 3C0BA 1VQON 4WFAL 4L3QA 4CZLA 4BRIA 5BRHA 3GDQA 1DT9A 3FE1A 5C2FA 1BDGA 3LDLA 2IVPA 2A40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 O;  3G71 N;  4WFN L;  4WFB L;  4IO9 L;  1YJW N;  1VQ6 N;  1K73 O;  1S72 N;  3J7Z O;  1YIJ N;  2ZJR L;  3CXC M;  5DM6 L;  3OW2 M;  1Q81 O;  4U67 L;  2ZJP L;  3CCU N;  1YIT N;  1K8A O;  5JVG L;  1VQK N;  3CCV N;  2ZJQ L;  3CCJ N;  5DM7 L;  1N8R O;  3CF5 L;  3G6E N;  4UY8 O;  1Q7Y O;  1OVY A;  3DLL L;  1VQ7 N;  1JJ2 M;  2OTL N;  1KQS M;  5HL7 L;  1VQ8 N;  3CPW M;  1M1K O;  3G4S N;  1QVF M;  5GAD P;  4WCE L;  1VQ4 N;  3CCQ N;  1QVG M;  3PIO L;  1VQP N;  5GAE P;  5GAG P;  3CC4 N;  3I56 N;  2QEX N;  2OTJ N;  3CCE N;  3CMA N;  1Q82 O;  1YI2 N;  3CC2 N;  1NJI O;  1YJ9 N;  1W2B M;  3CD6 N;  4IOC L;  4WF9 L;  1KC8 O;  2QA4 N;  4IOA L;  3CCS N;  1VQM N;  1YJN N;  3CCR N;  1K9M O;  1VQ9 N;  3PIP L;  1YHQ N;  1KD1 O;  1VQ5 N;  5H1S Q;  5MLC Q;  5GAH P;  5JVH L;  1M90 O;  1VQL N;  1VQN N;  3CCM N;  1VQO N;  1ILY A;  4WFA L;  3I55 N;  3CC7 N;  3CME N;  3CCL N; 
#chains in the Genus database with same CATH topology
 1TK8 A;  1Q86 O;  2OCE A;  2A6A A;  3O5B A;  4CZH A;  2HBM A;  2O8C A;  1HJO A;  3I0R A;  4K42 A;  1KFD A;  3ENH A;  4LFA K;  4HUG A;  1VQ6 N;  2KZZ A;  3H1V X;  3J7Z O;  1BA0 A;  3R1X A;  1ASU A;  4CED A;  1IV0 A;  1U6Z A;  5C25 A;  3BDP A;  4B3S K;  3V9X A;  4DQR A;  4OLB A;  3OW2 M;  1K8A O;  1YIT N;  3OYH A;  4IG0 A;  4B3R K;  2WFB A;  2Q97 A;  3LAN A;  2EWS A;  4LY7 A;  4IO8 A;  4JKB A;  1QQO A;  2ZF5 O;  4KHU A;  1RFQ A;  3BZK A;  3ZSX A;  4BWM A;  1BQN A;  3WQT A;  4DR6 K;  2HF3 A;  1FKP A;  3O9T A;  1VQ7 N;  1D9F A;  4MO5 A;  4FJ9 A;  3VA3 A;  3L2R A;  1KRP A;  1RIL A;  1GLC G;  2QWL A;  1J5E K;  1S3X A;  4JYA K;  2HHT A;  2F8S A;  1QE1 A;  2YJF A;  1TYQ B;  3TAB A;  2HHS A;  1HQU A;  2A1R A;  4KH4 A;  2IDO A;  1C6V A;  3TAE A;  5GAG P;  3ENO A;  4BRM A;  4BRE A;  4PY5 A;  2NRH A;  3DXK B;  3ZEU A;  4DUY K;  2IS3 A;  4DR1 K;  1QTM A;  3VOV A;  1K8K B;  4BRF A;  2G8F A;  4WQ4 C;  1XMO K;  1VRU A;  1C1C A;  4DS5 A;  4CJ7 A;  1NJI O;  2PY5 A;  3R6M A;  3J80 O;  1OH8 A;  1BA1 A;  4JI4 K;  4W5N A;  1KC8 O;  1VSE A;  2UU9 K;  4BG8 A;  3AA3 A;  4BRD A;  4FLW A;  1XC9 A;  1K9M O;  4B1Z A;  3KLG A;  2UYT A;  1N32 K;  4HCB A;  5MLC Q;  4O5B A;  2PAV A;  3OYJ A;  2W40 A;  3QFU A;  3D45 A;  2P9L B;  2VWK A;  4OGE A;  3M8S A;  1XQS C;  2IVN A;  3NE6 A;  5LMN K;  1VSL A;  3GOI A;  4IJA A;  2FSN A;  4DTN A;  3I55 N;  3CME N;  3CFP A;  3CQ8 A;  1G99 A;  4FLZ A;  3MCP A;  1VRT A;  3EKS A;  3VQ4 A;  4WFB L;  4DV7 K;  4BWJ A;  3SYZ A;  2NRT A;  4NCG A;  4AHR A;  1N6Q A;  4X62 K;  4ISG A;  4HVJ A;  1NKB A;  3MDQ A;  2VG5 A;  1TGO A;  3MWT A;  4Z4C A;  4KTW A;  3OYG A;  2B6A A;  4KKO A;  4MLH A;  3O3F A;  3M8Q A;  3KHY A;  1T03 A;  4DTR A;  1O1W A;  2Z1H A;  4FJ5 A;  4MQ3 A;  3G6E N;  1U2V B;  4Q5V A;  1VSH A;  5J2M A;  3L3U A;  3RMB A;  3FR0 A;  4DR7 K;  1MU2 A;  1SKR A;  4TSX A;  1HRH A;  1UA1 A;  1JCG A;  3CG7 A;  3CPW M;  1UOC A;  1REV A;  1CXQ A;  2KKZ A;  1QQN A;  5F2R A;  3NGZ A;  1NG9 A;  1BCM A;  2E6L A;  1NGE A;  4BRC A;  2E6M A;  5AQP A;  3D2F B;  3SMS A;  1E4F T;  3V6D A;  3K58 A;  1WSG A;  1IG8 A;  4DSK A;  3HTV A;  1HNI A;  5AQN A;  4E1M A;  4CHN A;  2NUB A;  3IFR A;  2HHH K;  4E1J A;  3CC2 N;  3V9U A;  3P31 A;  4KRE A;  2D5R A;  3QML A;  4C8M A;  3AY9 A;  2RE2 A;  1X3N A;  3RVC A;  2VCP A;  4FM1 A;  4FK0 A;  3CD6 N;  1C0F A;  3SPZ A;  3K5N A;  4K25 A;  3UB5 A;  3AVG A;  2DFE A;  4GMJ B;  1Q9X A;  3MN7 A;  4FJG A;  1VQM N;  4I7F A;  4YOV A;  3UIQ A;  5ADX H;  4H5R A;  3Q7B A;  3I8D A;  3ZSR A;  2HHU A;  2OZM A;  1NKE A;  5AFU H;  2JLE A;  1ITG A;  4DQ8 A;  3TAM A;  3JXU A;  3OYK A;  2GUI A;  4FM2 A;  3HM9 A;  2NRX A;  1UA0 A;  1NK9 A;  1ILY A;  1A5V A;  4LFB K;  1LW0 A;  3OY9 A;  5TKY A;  4B3M K;  1NBW A;  1S1V A;  1RT5 A;  1VHX A;  1SL0 A;  4IEE A;  4E19 A;  4HTU A;  3LPT A;  5KGX A;  2ASM A;  3TI0 A;  1YVN A;  2HBK A;  1NMN A;  1XHZ A;  2Z1G A;  4PKI A;  4CK3 A;  3C6H A;  4CD1 A;  2E8A A;  4OPH A;  5BN9 A;  4OKK A;  2ZJP L;  4JKE A;  4K41 A;  1GLF O;  1BQM A;  1OVQ A;  3L2Q A;  3LZI A;  4JS5 A;  1ZC6 A;  1OH6 A;  1H1V A;  3KLE A;  4UY8 O;  3T19 A;  3LP2 A;  2RF2 A;  1ZBH A;  3NDK A;  4KFB A;  4PL7 A;  1QSL A;  3VQD A;  5GAD P;  4AHV A;  5LJW A;  2DPN A;  1WSF A;  3ZX2 A;  3CJB A;  4O8K A;  2HNZ A;  4O55 A;  3L0Q A;  3TSU A;  2H3G X;  3DRP A;  4JS4 A;  4BRG A;  2GV9 A;  3A5L C;  1TKZ A;  3KD1 E;  3LP0 A;  2QEX N;  2KZM A;  1LAV A;  4CZJ A;  4CCH A;  4Y0W A;  5FDL A;  4AIL C;  2Q0R A;  5AQK A;  5EU7 A;  3EE9 A;  1KFS A;  3NGY A;  4B1Y B;  1X1P A;  3I8B A;  2P9I A;  3CI5 A;  4DV6 K;  2P1J A;  2QW9 A;  4BRH A;  4M3R A;  4CHY A;  3GBT A;  4DF4 A;  5FPE A;  4IFE A;  4LSL A;  2NZT A;  3OS1 A;  3IKM A;  1BCO A;  1JLF A;  1VQ9 N;  1VQ5 N;  4CZI A;  3I0S A;  1DTT A;  4YY3 K;  4MDB A;  3VEZ A;  4DQP A;  3NF9 A;  3T1Y K;  5CHI A;  1JXB A;  5LJV A;  3SUO A;  1LV5 A;  3SJH A;  3HJF A;  3HBT A;  3A5N C;  5IT9 O;  2D0A A;  2P9P B;  3OYF A;  5C10 A;  5KPR A;  3LAM A;  1ATS A;  2D1K A;  3HK2 A;  1KCF A;  1IJJ A;  4RW4 A;  4BRO A;  2O8F A;  3VQ5 A;  1S1W A;  4H0P A;  3LL3 A;  3ZET A;  4AQY K;  4B8C A;  3AA4 A;  4RW6 A;  1JXE A;  1S72 N;  1JL2 A;  3NF7 A;  1BOT O;  4BRK A;  1LAW A;  3SAG A;  1WN7 A;  3K5O A;  5AFU A;  1F21 A;  4BR2 A;  2EHG A;  2G8W A;  4KAZ A;  1XWL A;  4FM0 A;  4XIU A;  3FLC O;  3DXM B;  2ZJQ L;  3WNH A;  3MN9 A;  4J2B A;  4FZZ A;  1N8R O;  3PV8 A;  5HRN A;  3OJS A;  3AO1 A;  4B9M A;  5EOY A;  4H5N A;  4FLT A;  1WB9 A;  3V4I A;  1WBD A;  3TSQ A;  1VSJ A;  4KHQ A;  4JI8 K;  3F9M A;  3HRG A;  2ATQ A;  4CEC A;  3SUQ A;  5AR0 A;  4CF2 A;  3AV9 A;  4AHU A;  2FF6 A;  4BVP A;  3AVI A;  1EKE A;  1T3V A;  2ITG A;  2Q1N A;  1BHL A;  4IBN A;  5AQX A;  1TL1 A;  1BG3 A;  3SQ4 A;  3DMJ A;  1IO2 A;  3CCE N;  4FO0 A;  1NJX A;  2OA8 A;  3TAG A;  3S3O A;  4CEZ A;  3TWH A;  1SUQ A;  3EE8 A;  2UUC K;  5HLF A;  5HOO A;  4IKF A;  2FBX A;  2PYJ A;  1GLB G;  1GLD G;  5C42 A;  5I3U A;  2HST A;  2P9S B;  4CK1 A;  4BE0 A;  1JLG A;  1YTU A;  5E84 A;  3T3F A;  1HKC A;  3VQ9 A;  1FKO A;  1TKT A;  2ZGY A;  2RHK A;  1ZBF A;  3LWL A;  4L8R B;  3VQ6 A;  1QQM A;  4DTS A;  1WSJ A;  1QHA A;  4NYN A;  4CBW A;  3P39 A;  1ASV A;  2OPR A;  1VQO N;  4CFD A;  3QIO A;  4L3Q A;  5LL6 Z;  4CZL A;  3AO2 A;  2F4V K;  1NK7 A;  3FE1 A;  3HPO A;  4Z0U A;  3LDL A;  3J7A P;  5AZJ B;  2A40 A;  1SKW A;  1MA9 B;  4DMN A;  2VWJ A;  3NHG A;  5AZI B;  3DLE A;  4IJN A;  1JKH A;  4W5O A;  3L4I A;  1X9S A;  4DV0 K;  2PZS A;  3KK2 A;  2HMI A;  1NGB A;  3CXC M;  4EHT A;  4BQL A;  5DMR A;  4CJQ A;  1RT2 A;  4U67 L;  3HST B;  4GV6 A;  4H0V B;  1I3A A;  4IXC A;  5SWM A;  3RMC A;  2E2P A;  3VF2 A;  2HBJ A;  4NYF A;  4QS7 A;  1RBS A;  1KXP A;  4OLA A;  1QHT A;  5CY4 A;  3VTI A;  5AQR A;  3O4Q A;  4CES A;  3QBW A;  1CZ9 A;  2D4W A;  1LCU A;  1NK8 A;  1RT3 A;  3MXJ A;  4BR7 A;  1P8Z A;  4GV9 A;  2FC0 A;  1EQY A;  5GIN A;  3DRS A;  3CCQ N;  3D2E A;  2YHW A;  1RBU A;  5AQF A;  1BO5 O;  4CEB A;  4ILG B;  4FWP A;  4DR5 K;  4FJJ A;  2KQ2 A;  3I56 N;  4JI2 K;  3F2K A;  3M1F A;  3V9W A;  4LF5 K;  4OGC A;  4CJP A;  4XH5 A;  2IIR A;  3THX B;  3IG1 A;  4FJI A;  1YVU A;  4NXM K;  2P9L A;  4MLE A;  4DV3 K;  3OYC A;  1D9D A;  5M1P A;  1HJR A;  1L3T A;  2HVI A;  3SUN A;  4JKA A;  3HOS A;  1HNX K;  1BWF O;  1NJW A;  4A59 A;  1D8Y A;  3RSE A;  1SV5 A;  4J2E A;  4F8R A;  3PIP L;  1OKJ A;  4CF1 A;  2BH1 A;  1NK4 A;  4Z4H A;  2O8C B;  2HHQ A;  3CFR A;  5JVH L;  4YOU A;  3O6W A;  3ZX0 A;  2A5X A;  1R59 O;  3RRG A;  4RTF D;  3HSC A;  3FZM A;  1J5O A;  4FZY A;  1S1U A;  1L5U A;  2OZS A;  3KLF A;  3CQY A;  3N4P A;  4H03 B;  1E4G T;  3DLK A;  4HWI A;  4OJR A;  2CH5 A;  4CJT A;  3H46 O;  3EZ5 A;  4KBO A;  5I42 A;  5SZT A;  3AAR A;  3WXL A;  2UUA K;  3WXM B;  1WBB A;  1NGC A;  5AZJ A;  4ZHR A;  1Q81 O;  3EY1 A;  4FWO A;  5J1E A;  1OH5 A;  2HF4 A;  2HMP A;  4DTP A;  3M8R A;  4DTJ A;  2W41 A;  3MED A;  2QI2 A;  4A2B A;  1KAY A;  3WXJ A;  2RKI A;  3VN5 A;  4FSV A;  4MFB A;  1BIZ A;  3NH0 A;  2OTL N;  1XC3 A;  1KQS M;  3THV A;  1SL1 A;  3MEG A;  2I7P A;  3ZLJ A;  2P9N A;  3AVN A;  1DEJ A;  2YHA A;  3DLB A;  3C65 A;  4JK8 A;  1ZXO A;  3VET A;  2I5J A;  4CI6 A;  2ZD1 A;  3JAM O;  3KTQ A;  4E7I A;  1KTQ A;  4CGG A;  1N36 K;  1RBT A;  2GX9 A;  4PUO A;  1RDC A;  3CMA N;  2ASO A;  1QQC A;  4DF8 A;  3ZEU B;  4RWT A;  3BY5 A;  4Q0B A;  3G0Z A;  3NVK A;  2ZM6 K;  2F96 A;  5HP1 A;  4F2S A;  4CIG A;  3OYD A;  5AQQ A;  1YJ9 N;  1JLB A;  4CGH A;  4M3X A;  3IUC A;  4O44 A;  3VQA A;  3RMA A;  3O3H A;  2G8K A;  5D3G A;  4JEP A;  3QBX A;  4KHW A;  4M42 A;  4QS9 A;  4DSF A;  5AQS A;  1EET A;  3ZT3 A;  3OS0 A;  1WOQ A;  4DKW A;  2VGM A;  4CHP A;  1GLE G;  4CJ4 A;  1TAQ A;  2GTD A;  3MMV A;  1VQN N;  2O8D A;  1GOA A;  4ILH A;  4JD2 B;  4KO0 A;  5KQ8 A;  4BVO A;  1NGF A;  1TUY A;  2CGL A;  4MDA A;  3BEX A;  3ID8 A;  1WSI A;  2PYL A;  4BE1 A;  4DV1 K;  1IBM K;  3AVF A;  3PO5 A;  1S6Q A;  4IO9 L;  4F3O A;  5AZI A;  3HVT A;  4PL8 A;  4FYD A;  2BE2 A;  3QDK A;  3LP3 A;  3K59 A;  4IG3 A;  1HLU A;  4W5Q A;  3DXK A;  3ZX3 A;  3D7E O;  3ITH A;  2P51 A;  3KK1 A;  3SBT A;  1NLV A;  3VEV A;  5EVZ A;  4AHT A;  2V7Y A;  4I2Q A;  3TPQ A;  3CCJ N;  4KTQ A;  3BF1 A;  3ATV A;  4DLE A;  1A5X A;  5BPM A;  3NAE A;  3UKR A;  1EX4 A;  4PQU A;  4OKJ A;  5BRD A;  1EO1 A;  4FVU A;  3KK3 A;  5E26 A;  2YKN A;  3TTD A;  1FJG K;  1Z25 A;  4M3T A;  3T1H K;  1HX1 A;  2ASP A;  2HND A;  1QVF M;  2RPI A;  2W6K A;  4DQS A;  4A2A A;  3B8A X;  2AJQ A;  4B1U B;  2E1Y A;  4JI3 K;  4QS8 A;  4JV5 K;  2YV0 X;  4B3T K;  3AO3 A;  4Y1D A;  3B6P A;  3W3D A;  4Z4F A;  4C23 A;  2P9K B;  4O0J A;  3OVN A;  3HO1 A;  4JN4 A;  4PHT X;  2Z1I A;  4BDP A;  3DYA A;  3DOK A;  3ZSO A;  3QEW A;  1GLJ O;  2UXD K;  4AF1 A;  4FLY A;  3AGR A;  2GBZ A;  3VMF B;  2QKK A;  1JCE A;  3A5O C;  4CF9 A;  1TL3 A;  1YUW A;  4CGJ A;  4BR4 A;  2HB5 A;  1C0U A;  2ZWH A;  3H08 A;  1LWF A;  1M90 O;  2WON A;  2I7N A;  5J2P A;  4CGF A;  1RDD A;  3EKU A;  2WTU A;  3W0L A;  2VG7 A;  1RT1 A;  4ZTJ A;  4NCA A;  4FJX A;  1R0A A;  2HHW A;  4C1N I;  4DU3 A;  3VQ7 A;  5CR4 A;  4JI5 K;  2LSN A;  3ENB A;  2ZGZ A;  4FWL A;  4BR9 A;  4LH4 A;  1VSM A;  1P90 A;  3A5M C;  4OVL A;  4BE2 A;  3EN9 A;  4RG8 A;  2FXU A;  4FCY A;  1NNE A;  1IBL K;  4CFB A;  1L3U A;  5AQM A;  3DLG A;  1EWR A;  3O1B A;  3DJC A;  5BR8 K;  1TK5 A;  5JVG L;  3KJV A;  2NRZ A;  2VG6 A;  4F4K A;  3MX5 A;  4G1Q A;  3CJ1 A;  1YAG A;  5AQZ A;  4CBU A;  5AQT A;  3PX6 A;  4F2R A;  3ZT4 A;  4V19 S;  1TVR A;  2KFN A;  2QWP A;  3DWL A;  4M7Y A;  3LAK A;  1TKX A;  3ZSW A;  4IZ9 A;  1HPZ A;  3HYF A;  4CEA A;  1NMD A;  3B6O A;  3O9R A;  2CH6 A;  3PSI A;  3L6Q A;  2VGN A;  4KV8 A;  4PKG A;  1VQ4 N;  3BUZ B;  4FWM A;  1Y97 A;  4ICL A;  3EYZ A;  1SAZ A;  1JLC A;  1B92 A;  3HT3 A;  3DLH A;  1J9A A;  4C8L A;  1N34 K;  1S5J A;  4FL9 A;  3RTV A;  1VQP N;  2X78 A;  3NF6 A;  4DTO A;  4QOZ B;  1CXU A;  1NGI A;  4BR5 A;  3D0P A;  1HNV A;  4KI6 A;  2D0B A;  3LM2 A;  4FWR A;  1OH7 A;  4BGA A;  1MDU B;  4CW7 B;  3QEX A;  3H1Q A;  4DQI A;  3VER A;  1RDW X;  2F9T A;  5BR9 A;  4F3T A;  4CHZ A;  1W2B M;  1JLE A;  2JWK A;  4DLG A;  1Q9Y A;  2A3Z A;  3IMX A;  3TTC A;  4CJW A;  4UQG A;  1I39 A;  2KW4 A;  2QA4 N;  3G25 A;  4LF9 K;  3WXI A;  3AVC A;  3KVG A;  4DQQ A;  3MCA B;  2QTD A;  5FRN A;  3U6F A;  4DSI A;  4JI0 K;  4CHQ A;  3UKU B;  2AA4 A;  1LWC A;  2HHV A;  3GE1 A;  5C0Y A;  3O1W A;  1G15 A;  1SKS A;  4A5A A;  3IS9 A;  4KHP K;  4FWN A;  1VQL N;  3GL1 A;  2DFH A;  3J7Y P;  2GUP A;  5J2N A;  1DT9 A;  5FLX O;  1JLA A;  5C2F A;  3SV4 A;  2IVP A;  1W7A A;  4M3W A;  1E3M A;  1K6Y A;  1RTI A;  3CHW A;  5AQW A;  3C6T A;  4LC9 B;  4CJL A;  3PUF A;  4B9S A;  1L3V A;  2IC3 A;  5LMU K;  4LFC K;  4E1N A;  3V1R A;  4OKE A;  5FPD A;  3VES A;  4IEI A;  5J2Q A;  1KLM A;  3R3L A;  1RDU A;  1XMQ K;  2OPQ A;  1VSI A;  1RDA A;  3SI6 A;  2Q0U A;  4EHU A;  2QWO A;  3CF5 L;  5HBM A;  1O13 A;  4DSL A;  1VSD A;  4ID1 A;  1YF5 L;  1HYZ A;  3HVR A;  1ZBI A;  1Y64 A;  3H45 C;  3G4S N;  4FK2 A;  4CGD A;  3SCX A;  2DTU A;  4AM7 A;  1HQE A;  3O08 A;  4DSE A;  3PX0 A;  3M3Z A;  1NOY A;  4YHH K;  4KHN A;  1JCF A;  3WXK A;  4C8K A;  3SPY A;  4KB1 A;  3CIP A;  4JK9 A;  2IGI A;  3J8A A;  5M1F A;  5E41 A;  2Y1I A;  4JNE A;  4ELV A;  3H3N O;  4BRQ A;  2YHY A;  3AAQ A;  5AQL A;  4FWK A;  1HKB A;  3WNG A;  5I9E B;  4YOR A;  4GKK K;  2D0P A;  4FJ7 A;  1C1B A;  3QIN A;  4JRP A;  1YXQ A;  1JLQ A;  3CCR N;  4EP4 A;  3ZT1 A;  2O8D B;  4OPJ A;  3VQE A;  3OYA A;  1D4X A;  1RT4 A;  1QS4 A;  2F7T A;  1S9G A;  1XHX A;  2EX3 A;  1Q8I A;  5ADX A;  4E0D A;  4CF8 A;  3CET A;  4BRN A;  3THW B;  3RR7 A;  4WQ4 A;  1RDB A;  4R79 A;  3CCL N;  2QM1 A;  2E5L K;  3ZSY A;  2G8I A;  4Z4I A;  4YOY A;  2KFZ A;  4JD2 A;  3WNE A;  2O8E A;  1WSH A;  3NBP A;  4H0Y B;  5IWA K;  2WBN A;  5GIP A;  1WNS A;  1YJW N;  1MWM A;  1NGG A;  4B3O A;  3HP6 A;  4CJS A;  4B9V A;  4LF8 K;  1X9W A;  4FPA A;  2ZJR L;  4CZG A;  3E9O A;  3P38 A;  4CHO A;  5HRO A;  4H0T B;  2FSK A;  4N5S A;  1S9E A;  4NO7 A;  2G8H A;  1QSY A;  4N56 A;  3O4N A;  4J8F A;  1NK6 A;  3ULD A;  3U9D A;  1OVY A;  2QXF A;  3FZL A;  3QEI A;  2YI1 A;  3QNO A;  2YCH A;  5A2Q O;  3CM5 A;  3AVA A;  2OAN A;  5BN8 A;  3TAP A;  3OYL A;  3ZYY X;  2E1Z A;  1N33 K;  3MK6 A;  2GEM A;  5GAE P;  4KHS A;  3LDO A;  2IAJ A;  3E66 A;  3PSF A;  4DV5 K;  1HMV A;  4BRL A;  3M6G A;  3ZSZ A;  2BUP A;  2UXB K;  3AO5 A;  1QZ5 A;  2HVH A;  3VQQ A;  1ZBS A;  4FJN A;  5JIC A;  3HZ6 A;  1NK5 A;  4E89 A;  5C24 A;  1B9D A;  4GW6 A;  3O9Q A;  2ETJ A;  2F9W A;  4CE9 A;  2FBY A;  1L3S A;  3VEO A;  3RRH A;  3CJC A;  2BDP A;  4E7J A;  2O4G A;  4BDY A;  4Z4G A;  4CBX A;  1U45 A;  3KWI A;  3LDS A;  4JRQ A;  5H1S Q;  3FGU A;  3UE5 A;  4JLH A;  2XY8 A;  1K8K A;  3TTF A;  3K5L A;  2BAN A;  4CJ5 A;  1S22 A;  4E7K A;  3SQ2 A;  1T8E A;  3S3M A;  4FJM A;  4M63 C;  3K0S A;  3THY B;  1NWK A;  1T6C A;  3JS6 A;  1BU6 O;  5FRO A;  2BTF A;  3NFA A;  4A61 A;  1IKV A;  4H4O A;  4I9L A;  1LW2 A;  2XY5 A;  3G71 N;  1NGD A;  1SS6 A;  4WFN L;  3SV3 A;  3S3N A;  3QES A;  4BC5 A;  3NVM A;  5KGW A;  5AQJ A;  3MWP A;  4CJV A;  3SQ0 A;  5T7B A;  4B9Q A;  1RBR A;  2XRI A;  2KHO A;  4JKF A;  1GLA G;  2DY4 A;  3AVK A;  3I33 A;  3C95 A;  1KVC A;  3L2W A;  3K9J A;  4LF4 K;  4GKJ K;  3RR8 A;  1BL3 A;  1T05 A;  3P83 D;  1W9H A;  1D5A A;  4BRA A;  4CEO A;  4CIE A;  1Q7Y O;  1TYQ A;  3QO9 A;  5CZ2 A;  5FPN A;  1TUU A;  5M1O A;  4NLB A;  4DV4 K;  4QCL A;  4CK2 A;  4AM6 A;  5AJ3 K;  5F1X A;  3BZC A;  3SUP A;  1VQ8 N;  1V4T A;  1NJY A;  1NGJ A;  4KH5 A;  3ZET B;  4DS4 A;  4XH4 A;  1C1A A;  4X64 K;  1UWB A;  1J53 A;  2Q3S A;  3KKR A;  5AQO A;  4JKC A;  3CC4 N;  3SMP A;  2YNF A;  1U48 A;  2V7Z A;  1U47 A;  3VGM A;  5AQH A;  2FSJ A;  2YNI A;  4FW2 A;  5AQY A;  4O5F A;  2E4L A;  3K5M A;  4DTM A;  4A57 A;  3GG4 A;  3QB0 A;  4CIF A;  4O4G A;  4IOA L;  3EZW A;  3AVL A;  3OHR A;  3P4I A;  3CCS N;  3V9Z A;  1YJN N;  4NXN K;  1NM1 A;  1EXQ A;  3Q7C A;  2DFF A;  3CJ7 A;  3DRR A;  3ZCM A;  4U7B A;  3R9P A;  3LM9 A;  4KRF A;  3CYM A;  3WEE A;  3K9K A;  3AVB A;  5HRP A;  4B1X B;  1VSF A;  4FVM A;  2WC9 A;  3AA5 X;  3MN5 A;  5DK5 A;  3PLA A;  4ZTF A;  1KSP A;  4CZK A;  2YJE A;  1U4B A;  4DR3 K;  4FZX C;  1KVA A;  4EIA A;  1EWQ A;  3M8P A;  4JI1 K;  3VF6 A;  2O8B B;  4M3Z A;  3L2U A;  1KLN A;  3VQP A;  3SAF A;  2YHX A;  3C6A A;  3DI6 A;  1XI1 A;  3F5T A;  4H0O A;  4RCH A;  1YIJ N;  1WAJ A;  3LDQ A;  3TAQ A;  4BY9 C;  3WUH A;  5M1N A;  4CVN E;  3VA0 A;  4HHT A;  2HOE A;  2ITM A;  5GIO A;  1HKG A;  3ISN C;  3WEE B;  4BGB A;  3E01 A;  4W5R A;  1HYV A;  5CYQ A;  1XNQ K;  5JS2 A;  3E1Y A;  2GEL A;  4LSN A;  1T6D A;  2E20 A;  3E9P A;  2AP1 A;  5EY4 A;  3FZF A;  3HP9 A;  3CER A;  4FJH A;  4LF6 K;  1SL2 A;  4K43 A;  2D0O A;  3CJ9 A;  3QNN A;  4IDK A;  3G10 A;  3ULE A;  3AVM A;  3WT0 A;  3VQC A;  4WCE L;  5KPZ A;  2F8T A;  4CD3 A;  3DXM A;  3BF3 A;  5KI6 A;  5KPT A;  1GOB A;  4X65 K;  3VF4 A;  5AQV A;  3HPH A;  2FLO A;  5F0X A;  5KRS A;  4BG9 A;  4BRP A;  4YOW A;  4M7X A;  4BC4 A;  3DOL A;  1HYS A;  1Q82 O;  3A0I X;  1BIS A;  3T1A A;  3C7N B;  3MAQ A;  1RTJ A;  3N4Q A;  2V52 B;  4ILJ A;  1T44 A;  3SBG A;  3OS2 A;  3S9H A;  3VGL A;  1X9M A;  3ZT0 A;  4C8N A;  4JHD A;  5EXW A;  4EZ6 A;  2GWK A;  2YKM A;  3O80 A;  3KD5 E;  5BRF A;  3SLC A;  2FBV A;  4PWD A;  2D0C A;  3OBW A;  4EFH A;  3O8M A;  4CZE A;  4AH9 A;  1IG9 A;  4OX9 K;  3OBY A;  4M3U A;  1KD1 O;  4B9L A;  4BDZ A;  4FOE A;  1HUX A;  3A8Y A;  3L8B A;  1KVB A;  4FWS A;  2NRV A;  1U04 A;  1XUP O;  3IDH A;  4IFV A;  2OPP A;  3U4L A;  3ULE B;  1IBK K;  4WFA L;  3MEC A;  4BRI A;  5BRH A;  3GDQ A;  2XHB A;  4H8K A;  1ZYQ A;  4B8A B;  2P5G A;  4X66 K;  1QSS A;  3KK7 A;  4HUF A;  4FLV A;  1Z6R A;  1ZBU A;  2HNY A;  3DM2 A;  3ASM A;  3ID6 A;  4M45 A;  5DM6 L;  5C15 A;  3V1O A;  4EP5 A;  3CCU N;  4K8X A;  2IVO A;  1TK0 A;  4CJF A;  3CCV N;  3ZSQ A;  5KRT A;  2KTQ A;  2G8V A;  2FF3 B;  4C1N K;  4FPB A;  2HBL A;  1X3M A;  3T69 A;  1JJ2 M;  4BAC A;  4B9U A;  3KLH A;  3EEQ A;  3K57 A;  3QER A;  4DTX A;  1HNW K;  2KLA A;  2BGG A;  3VQ8 A;  5HRS A;  4DWI A;  4I6M A;  4J2D A;  4GV3 A;  3EL2 A;  3QFP A;  1QVG M;  4IFY A;  4CEQ A;  3CFO A;  3FFK B;  2VQE K;  4BC2 A;  3T7Z A;  1U2V A;  4DTU A;  3RMD A;  1GLL O;  1YT3 A;  4ID5 A;  3VPZ A;  3NCI A;  5M1Q A;  3SK3 A;  2V51 B;  4RW8 A;  4N41 A;  1LOT B;  3V81 A;  3IAY A;  3OJU A;  4OPK A;  4IOX A;  5TKW A;  4XEI A;  2P9U A;  2A42 A;  2OPS A;  1VAZ A;  1ESV A;  3AVH A;  4KPY A;  3QIC A;  5AQI A;  2P9K A;  3S41 A;  1QZ6 A;  2P9N B;  3V9S A;  4FJL A;  4WYB A;  1DGK N;  2W6L A;  2Y1J A;  4RW9 A;  4WQ5 A;  3OYE A;  3CPE A;  5GAH P;  4C8O A;  4OO1 J;  1FXX A;  4H0X B;  3FZH A;  2E2N A;  3AO4 A;  2NRR A;  2Q31 A;  3KZB A;  4JKD A;  2VWB A;  2G8U A;  3PO4 A;  2QKB A;  1UAX A;  1C0T A;  5CE3 A;  5EX5 A;  4JI6 K;  4CZF A;  1Z05 A;  2Q36 A;  4O8U A;  1DTQ A;  3OYM A;  4ISF A;  3H6E A;  1U49 A;  3KWG A;  5BRE A;  4ISE A;  4FWQ A;  1DKG D;  3SZ2 A;  3O9S A;  4KHY A;  2R7Y A;  2OYQ A;  3IRX A;  1VQK N;  4DR2 K;  3THX A;  3SAH A;  4BC3 A;  3AA2 A;  2YNH A;  2A41 A;  2XO7 A;  2UXC K;  2E2Q A;  4B1W B;  3HM8 A;  4YDU A;  4FOI A;  3KKS A;  2W42 A;  2JGU A;  5BPL A;  1CLQ A;  2E2O A;  3QEP A;  1DLO A;  1M1K O;  3RSE B;  3HL8 A;  3H3O B;  5CZ1 A;  1ASW A;  2VQF K;  3QET A;  4LD0 A;  2P9S A;  3LDP A;  3EO3 A;  3QLH A;  5JLF A;  3C6U A;  1RT6 A;  1VSK A;  4FLX A;  3VQB A;  1NK0 A;  2CGK A;  4CFA A;  4DU4 A;  2E88 A;  1SQK A;  2OTJ N;  1V4S A;  3VEN A;  2P5O A;  1YI2 N;  4LH5 A;  5AQG A;  2ZE2 A;  2ZQB A;  4RW7 A;  1CZA N;  5ELZ A;  2QK9 A;  3U9Z A;  3UKR B;  3ZSV A;  4DHY A;  3L2V A;  2Z1J A;  3O3G A;  3AVJ A;  4H5V A;  4E7L A;  4YOT A;  1SZ2 A;  2IOC A;  1B9F A;  5B8H A;  3BP8 A;  5FRM A;  3P1G A;  3WNF A;  3LZJ A;  3PX4 A;  3AAP A;  4DFP A;  5LY3 A;  1J6Z A;  1NJZ A;  3VEX A;  5C12 A;  4G9Z A;  2O8F B;  4I2P A;  1WLJ A;  3HPG A;  3F9K A;  1IH7 A;  2P9P A;  3ALY A;  5KQD A;  2B5J A;  3QEV A;  1BIU A;  4EAH D;  3R8E A;  3VGK A;  4GNI A;  1RCH A;  4QAG A;  4H5T A;  4HUE A;  2NRW A;  3MX2 A;  4EZ9 A;  1HNZ K;  1BUP A;  1J54 A;  4XH1 A;  3NGI A;  3TAN A;  3OTO K;  3HOT A;  3K2P A;  4DCH A;  1RTD A;  3L3V A;  5KTQ A;  4JAX A;  2P9U B;  4KB0 A;  4JKH A;  3DLR A;  4M41 A;  3KIO A;  5BPN A;  1EP4 A;  1K73 O;  1NGA A;  3TU5 A;  5JLH A;  1NKC A;  4CJE A;  4FXD A;  2B4J A;  4PA1 A;  4CF0 A;  3D2F A;  4GVE A;  3AGK A;  2VYP A;  2CGJ A;  1T7P A;  4CJK A;  4Z94 A;  2Q2R A;  3V1Q A;  4WE1 A;  4CEE A;  2O8E B;  1S1X A;  3TAF A;  2A1S A;  3JYT A;  4H5W A;  4YFU A;  4FK4 A;  4R5P A;  3HXM A;  2HW3 A;  4A62 A;  3OYN A;  2WOM A;  3NF8 A;  3NMU A;  5JS1 A;  3OA9 A;  3RWU A;  3OYB A;  4HCC A;  3SQ1 A;  3C94 A;  4DG1 A;  1HR0 K;  4YNQ A;  3QIP A;  3MEE A;  5JMV A;  3DAW A;  3TSP A;  2WUS A;  4B9T A;  1FW6 A;  4M3Y A;  4MO4 A;  5M1K A;  3LDN A;  1ZBL A;  3SJJ A;  1X9J A;  2FBT A;  1NU0 A;  1I94 K;  4IDH A;  2X74 A;  3JSM A;  4J2A A;  3D2E B;  4N47 A;  3TR8 A;  2XY6 A;  4ELU A;  4K8Z A;  5C2D A;  3MXI A;  1RTH A;  3J81 O;  4YOX A;  4B08 A;  4NCB A;  4O0I A;  4CJR A;  1XNR K;  1S6P A;  3L4Q A;  3U8X A;  4WF9 L;  4CGI A;  3VTH A;  3NH2 A;  1HPM A;  1RBV A;  1RGI A;  3FZK A;  4JHD B;  3KLI A;  3LWM A;  4KTZ A;  1Q18 A;  3VEW A;  5CYM A;  1WAF A;  1IKY A;  1KAZ A;  4AHS A;  5AQU A;  1JL1 A;  2PFU A;  2QXL A;  4JKG B;  3NH1 A;  4DFK A;  2YNG A;  2HHX A;  4NLC A;  3CJA A;  1WSE A;  1A5W A;  2J4R A;  3CCM N;  4LF7 K;  1YTA A;  3LAL A;  4CJU A;  4JKG A;  1ATR A;  3O4W A;  3P5J A;  3FFI A;  4DSJ A;  3ZT2 A;  3CC7 N;  3BGR A;  1C0M A;  1BI4 B;  4FW1 A;  4E3S A;  4DFM A;  2O8B A;  4W5T A;  4B9N A;  3F73 A;  1BI4 A;  4N76 A;  2NLX A;  1BGX T;  4IWV A;  4DUZ K;  1TV6 A;  4HTL A;  3ATU A;  4A5B A;  4Z4E A;  3CQX A;  1TKD A;  1RNH A;  3UKU A;  2UUB K;  3TAR A;  2NNW A;  3VEY A;  2YX6 A;  4CFC A;  2GWJ A;  4CZM A;  3D6R A;  5DM7 L;  2QWM A;  4YDU C;  3THW A;  4JK7 A;  1W97 L;  1LWE A;  4FJ8 A;  1GOC A;  4E7H A;  3DLL L;  1CZB A;  1W0H A;  4CJ3 A;  3WQU A;  4K0K K;  1C0G A;  4AHC A;  5HL7 L;  1ATN A;  4B1V A;  4DFJ A;  4BR0 A;  4FLU A;  2PBD A;  4DR4 K;  4KI4 A;  4OPA A;  3PIO L;  2QWR A;  1MWK A;  3MN6 A;  4JI7 K;  4CER A;  1NGH A;  2X6N A;  4DB3 A;  3PY8 A;  3LPU A;  4FJK A;  4I6M B;  4BQZ A;  1RT7 A;  1TAU A;  3U3G A;  4GVM A;  1FK9 A;  1S1T A;  1IKW A;  3HI0 A;  4KH6 A;  3E9L A;  2QWN A;  2O4I A;  1IKX A;  1N5Y A;  4PKH A;  4GY2 B;  3MXM A;  4IOC L;  3A2F A;  1NOZ A;  4NB4 A;  4CEF A;  1Z26 A;  1VK0 A;  4DU1 A;  3C7N A;  2P9I B;  4F9O A;  4WQ5 C;  1WUA A;  1YHQ N;  5K14 A;  2YHB A;  5FPM A;  3THY A;  4I9Q A;  2XY7 A;  4DV2 K;  3LP1 A;  3SNN A;  2JWL A;  2QWQ A;  2RN2 A;  3O9U A;  1KAX A;  4H4M A;  3CM6 A;  3M5R A;  3C0B A;  3OYI A;  2X6S A;  5HRR A;  3U3Y A;  1BDG A;  4Y1C A;  4ELT A; 
#chains in the Genus database with same CATH homology
 1Q86 O;  1MA9 B;  3KK7 A;  3CHW A;  2A6A A;  1Z6R A;  3O5B A;  2HBM A;  5AQW A;  5AZI B;  4IJN A;  1HJO A;  4LC9 B;  4CZH A;  4K42 A;  3ENH A;  3L4I A;  1VQ6 N;  3H1V X;  3J7Z O;  1BA0 A;  3ID6 A;  3R1X A;  1NGB A;  5FPD A;  1U6Z A;  3CXC M;  3VES A;  4IEI A;  4BQL A;  4EHT A;  5DM6 L;  5C15 A;  3OW2 M;  3R3L A;  4U67 L;  3CCU N;  1YIT N;  1K8A O;  4GV6 A;  1RDU A;  2WFB A;  2IVO A;  2Q97 A;  4H0V B;  4IXC A;  2ZJQ L;  2EWS A;  4IO8 A;  4JKB A;  1QQO A;  3CCV N;  2Q0U A;  4EHU A;  2E2P A;  2ZF5 O;  2HBJ A;  3VF2 A;  2QWO A;  1RFQ A;  2FF3 B;  4QS7 A;  4C1N K;  3CF5 L;  1KXP A;  4FPB A;  2HBL A;  5AQR A;  3VTI A;  1X3M A;  1O13 A;  3QBW A;  3WQT A;  3T69 A;  2HF3 A;  1YF5 L;  3O9T A;  1JJ2 M;  2D4W A;  1VQ7 N;  1LCU A;  1Y64 A;  3H45 C;  4MO5 A;  4BR7 A;  1P8Z A;  4GV9 A;  2QWL A;  1GLC G;  1S3X A;  3G4S N;  2KLA A;  2YJF A;  1TYQ B;  1EQY A;  4AM7 A;  5GIN A;  3CCQ N;  3O08 A;  4I6M A;  3D2E A;  2YHW A;  3M3Z A;  4GV3 A;  3EL2 A;  1JCF A;  3QFP A;  1BO5 O;  5AQF A;  1QVG M;  4ILG B;  4KH4 A;  4FWP A;  3WXK A;  3FFK B;  3CIP A;  4BC2 A;  5GAG P;  4JK9 A;  3T7Z A;  3I56 N;  1U2V A;  3ENO A;  3F2K A;  3J8A A;  3M1F A;  5M1F A;  4BRM A;  4BRE A;  1GLL O;  2NRH A;  3DXK B;  3VPZ A;  4JNE A;  3ZEU A;  3H3N O;  5M1Q A;  3SK3 A;  4XH5 A;  2YHY A;  3VOV A;  2IIR A;  1K8K B;  2V51 B;  4BRQ A;  4WQ4 C;  3AAQ A;  5AQL A;  4BRF A;  4FWK A;  1LOT B;  2P9L A;  4MLE A;  5AZJ B;  4IOX A;  4CJ7 A;  1HKB A;  5TKW A;  4XEI A;  5I9E B;  1NJI O;  3R6M A;  5M1P A;  4YOR A;  2P9U A;  2A42 A;  1VAZ A;  4JKA A;  3HOS A;  1ESV A;  2D0P A;  1BA1 A;  3QIC A;  1BWF O;  4A59 A;  5AQI A;  2P9K A;  1KC8 O;  3S41 A;  1QZ6 A;  2P9N B;  3RSE A;  1YXQ A;  4BG8 A;  4BRD A;  4WYB A;  1DGK N;  3CCR N;  1K9M O;  4B1Z A;  3PIP L;  1OKJ A;  2UYT A;  4WQ5 A;  2BH1 A;  5MLC Q;  2PAV A;  3CPE A;  5GAH P;  4OO1 J;  4H0X B;  5JVH L;  4YOU A;  3FZH A;  2E2N A;  2NRR A;  3O6W A;  3ZX0 A;  2Q31 A;  2W40 A;  3QFU A;  1D4X A;  3KZB A;  2P9L B;  1XQS C;  2A5X A;  1R59 O;  2F7T A;  4RTF D;  2IVN A;  4JKD A;  3HSC A;  2VWB A;  3FZM A;  5ADX A;  3GOI A;  4IJA A;  2FSN A;  3CET A;  4BRN A;  3CQY A;  3N4P A;  3I55 N;  4H03 B;  3CME N;  1E4G T;  4WQ4 A;  4R79 A;  5CE3 A;  5EX5 A;  3CCL N;  2QM1 A;  1G99 A;  4HWI A;  3MCP A;  4CZF A;  3EKS A;  4YOY A;  1Z05 A;  2CH5 A;  2Q36 A;  4O8U A;  4WFB L;  4JD2 A;  3H46 O;  4H0Y B;  2NRT A;  2WBN A;  5GIP A;  4KBO A;  1YJW N;  4ISF A;  3H6E A;  1MWM A;  1NGG A;  3KWG A;  5BRE A;  3AAR A;  4ISE A;  4FWQ A;  1DKG D;  3WXL A;  4ISG A;  3WXM B;  1NGC A;  3MDQ A;  4FPA A;  2ZJR L;  4CZG A;  3E9O A;  3O9S A;  3P38 A;  5AZJ A;  3MWT A;  1Q81 O;  4FWO A;  4H0T B;  2FSK A;  2HF4 A;  2HMP A;  4MLH A;  1VQK N;  3KHY A;  3SAH A;  4NO7 A;  2W41 A;  4BC3 A;  2QI2 A;  4A2B A;  1KAY A;  2A41 A;  4J8F A;  3WXJ A;  3G6E N;  3U9D A;  1U2V B;  1OVY A;  2E2Q A;  3HM8 A;  4FSV A;  4YDU A;  4FOI A;  4B1W B;  3FR0 A;  3FZL A;  5BPL A;  2OTL N;  1XC3 A;  2YI1 A;  1KQS M;  2E2O A;  2YCH A;  1JCG A;  3CPW M;  2I7P A;  1M1K O;  2P9N A;  3RSE B;  1DEJ A;  2OAN A;  2KKZ A;  5BN8 A;  1QQN A;  5F2R A;  3H3O B;  2E1Z A;  3ZYY X;  1NGE A;  3C65 A;  4JK8 A;  3MK6 A;  4BRC A;  2P9S A;  5AQP A;  2GEM A;  1ZXO A;  3D2F B;  3EO3 A;  3LDP A;  3VET A;  4CI6 A;  3SMS A;  1E4F T;  5JLF A;  5GAE P;  3LDO A;  1IG8 A;  3E66 A;  2CGK A;  3HTV A;  4BRL A;  5AQN A;  3M6G A;  2E88 A;  2BUP A;  2GX9 A;  1SQK A;  2OTJ N;  1QZ5 A;  3CMA N;  2ASO A;  1V4S A;  3IFR A;  3VEN A;  3ZEU B;  1YI2 N;  4E1J A;  3CC2 N;  3P31 A;  4RWT A;  1ZBS A;  5AQG A;  5JIC A;  3HZ6 A;  3QML A;  3NVK A;  3AY9 A;  2RE2 A;  1CZA N;  5ELZ A;  5AQQ A;  1X3N A;  3U9Z A;  3UKR B;  1YJ9 N;  3O9Q A;  2VCP A;  3RVC A;  3CD6 N;  1C0F A;  2F9W A;  3IUC A;  4DHY A;  3VEO A;  3CJC A;  4H5V A;  3QBX A;  4JEP A;  4K25 A;  3UB5 A;  4YOT A;  1SZ2 A;  3MN7 A;  5B8H A;  3BP8 A;  4CBX A;  1VQM N;  3KWI A;  4QS9 A;  4YOV A;  5ADX H;  4H5R A;  5AQS A;  3Q7B A;  3AAP A;  1WOQ A;  5H1S Q;  5LY3 A;  4DKW A;  1J6Z A;  2VGM A;  3FGU A;  5AFU H;  3VEX A;  3UE5 A;  5C12 A;  4G9Z A;  1GLE G;  1K8K A;  4DQ8 A;  3JXU A;  3TTF A;  2GTD A;  3MMV A;  1S22 A;  2NRX A;  1VQN N;  2P9P A;  4ILH A;  5KQD A;  4EAH D;  1ILY A;  3R8E A;  3VGK A;  4GNI A;  4H5T A;  4M63 C;  2NRW A;  3MX2 A;  4JD2 B;  5KQ8 A;  5TKY A;  1BUP A;  4XH1 A;  1NWK A;  1NBW A;  1T6C A;  3JS6 A;  1BU6 O;  4BVO A;  1NGF A;  1TUY A;  2BTF A;  2CGL A;  3BEX A;  3ID8 A;  4MDA A;  4DCH A;  3HOT A;  4A61 A;  3G71 N;  1NGD A;  1SS6 A;  4IEE A;  4JAX A;  4WFN L;  2P9U B;  4IO9 L;  4JKH A;  5AZI A;  4BC5 A;  3NVM A;  2ASM A;  4PL8 A;  5BPN A;  1YVN A;  1K73 O;  5AQJ A;  2HBK A;  1NGA A;  3TU5 A;  3MWP A;  5JLH A;  3QDK A;  4PKI A;  4B9Q A;  3C6H A;  4CD1 A;  2KHO A;  2E8A A;  4OPH A;  5BN9 A;  3D2F A;  4JKF A;  4GVE A;  1HLU A;  3AGK A;  4JKE A;  3DXK A;  2VYP A;  3ZX3 A;  1GLA G;  2ZJP L;  4K41 A;  3D7E O;  1GLF O;  2CGJ A;  3I33 A;  1NLV A;  3SBT A;  5EVZ A;  3VEV A;  4Z94 A;  2Q2R A;  2V7Y A;  3K9J A;  3TPQ A;  3CCJ N;  1ZC6 A;  1H1V A;  3BF1 A;  3ATV A;  4BRA A;  5BPM A;  4UY8 O;  4H5W A;  3UKR A;  1Q7Y O;  1TYQ A;  5FPN A;  1TUU A;  5BRD A;  5M1O A;  4NLB A;  4FVU A;  1EO1 A;  4PL7 A;  5E26 A;  4A62 A;  4AM6 A;  3TTD A;  5F1X A;  1VQ8 N;  1HX1 A;  2ASP A;  1V4T A;  1QVF M;  3NMU A;  1NGJ A;  4KH5 A;  3OA9 A;  5GAD P;  3ZET B;  4XH4 A;  5LJW A;  2DPN A;  3ZX2 A;  3CJB A;  4O8K A;  5AQO A;  3L0Q A;  3TSU A;  2H3G X;  4JKC A;  4BRG A;  4A2A A;  5JMV A;  3B8A X;  3CC4 N;  3DAW A;  3TSP A;  4B1U B;  2WUS A;  3A5L C;  4MO4 A;  3SMP A;  2E1Y A;  5M1K A;  2QEX N;  3LDN A;  4CZJ A;  2V7Z A;  4Y0W A;  1X9J A;  4QS8 A;  2Q0R A;  4IDH A;  5AQK A;  3D2E B;  3EE9 A;  3VGM A;  3W3D A;  5AQH A;  2FSJ A;  5AQY A;  4B1Y B;  4C23 A;  2P9K B;  4O5F A;  5C2D A;  4YOX A;  3I8B A;  4JN4 A;  2P9I A;  4PHT X;  4A57 A;  3CI5 A;  3GG4 A;  3QB0 A;  3L4Q A;  3U8X A;  2QW9 A;  4WF9 L;  4BRH A;  3VTH A;  1HPM A;  3GBT A;  4IOA L;  1GLJ O;  5FPE A;  4IFE A;  3EZW A;  1RGI A;  3OHR A;  3P4I A;  3AGR A;  4AF1 A;  2NZT A;  3FZK A;  4JHD B;  3CCS N;  1YJN N;  3VMF B;  1JCE A;  1NM1 A;  3A5O C;  1Q18 A;  3IKM A;  3Q7C A;  3VEW A;  1VQ9 N;  3CJ7 A;  1VQ5 N;  4CZI A;  1YUW A;  4BR4 A;  4MDB A;  3VEZ A;  2ZWH A;  1KAZ A;  4U7B A;  5AQU A;  3R9P A;  4JKG B;  2PFU A;  2QXL A;  3LM9 A;  1M90 O;  2I7N A;  5CHI A;  3WEE A;  5LJV A;  4NLC A;  3SJH A;  3EKU A;  3CJA A;  3HBT A;  3K9K A;  3A5N C;  3W0L A;  4B1X B;  2J4R A;  3CCM N;  2WC9 A;  4JKG A;  2P9P B;  3MN5 A;  1ATR A;  3O4W A;  5C10 A;  5KPR A;  3PLA A;  4C1N I;  3CC7 N;  5CR4 A;  1ATS A;  4CZK A;  2YJE A;  3ENB A;  4EIA A;  2D1K A;  2ZGZ A;  1IJJ A;  4FWL A;  4BRO A;  4H0P A;  3LL3 A;  3VF6 A;  4BR9 A;  3ZET A;  3SAF A;  2YHX A;  1P90 A;  3C6A A;  3A5M C;  1S72 N;  2NLX A;  4IWV A;  3F5T A;  4HTL A;  3ATU A;  3EN9 A;  4A5B A;  1BOT O;  2FXU A;  4H0O A;  4RCH A;  4BRK A;  3LDQ A;  1YIJ N;  3CQX A;  3SAG A;  4BY9 C;  5AQM A;  3WUH A;  5AFU A;  5M1N A;  3O1B A;  3UKU A;  3DJC A;  4BR2 A;  2NNW A;  3VEY A;  2HOE A;  2ITM A;  5GIO A;  5JVG L;  1HKG A;  3WEE B;  2NRZ A;  2YX6 A;  4BGB A;  3MX5 A;  3FLC O;  3DXM B;  2GWJ A;  3D6R A;  3CJ1 A;  1YAG A;  3MN9 A;  4CZM A;  5AQZ A;  2QWM A;  4YDU C;  5AQT A;  4CBU A;  3E1Y A;  5DM7 L;  2GEL A;  4JK7 A;  1T6D A;  1W97 L;  1N8R O;  3E9P A;  2E20 A;  2AP1 A;  2QWP A;  3DWL A;  5EY4 A;  4M7Y A;  3FZF A;  5EOY A;  3CER A;  4H5N A;  4IZ9 A;  3DLL L;  1NMD A;  3O9R A;  3TSQ A;  4K43 A;  2CH6 A;  2D0O A;  3L6Q A;  3CJ9 A;  3WQU A;  3F9M A;  3HRG A;  2VGN A;  1C0G A;  5HL7 L;  1ATN A;  3ULE A;  5AR0 A;  4B1V A;  4PKG A;  3WT0 A;  2FF6 A;  4BVP A;  4BR0 A;  4WCE L;  1VQ4 N;  3BUZ B;  5KPZ A;  4FWM A;  1T3V A;  1SAZ A;  2PBD A;  4OPA A;  4CD3 A;  3PIO L;  2QWR A;  3DXM A;  3BF3 A;  1MWK A;  4FL9 A;  2Q1N A;  3MN6 A;  5AQX A;  1VQP N;  5KPT A;  1NGH A;  5AQV A;  3VF4 A;  2FLO A;  1BG3 A;  4DB3 A;  5F0X A;  1NGI A;  4I6M B;  4BQZ A;  4BG9 A;  4BR5 A;  4BRP A;  4YOW A;  4M7X A;  3CCE N;  4BC4 A;  4FO0 A;  1Q82 O;  3A0I X;  3LM2 A;  3C7N B;  4FWR A;  3N4Q A;  3HI0 A;  4KH6 A;  2V52 B;  4ILJ A;  1T44 A;  3E9L A;  3SBG A;  4BGA A;  1MDU B;  3EE8 A;  2QWN A;  3H1Q A;  3VGL A;  3VER A;  1RDW X;  2F9T A;  5BR9 A;  5HOO A;  4PKH A;  4GY2 B;  4JHD A;  5EXW A;  1W2B M;  2JWK A;  2GWK A;  3O80 A;  4IOC L;  5BRF A;  3SLC A;  2A3Z A;  3IMX A;  4NB4 A;  1GLB G;  3TTC A;  1GLD G;  3OBW A;  2QA4 N;  2HST A;  2P9S B;  3C7N A;  4EFH A;  3O8M A;  3G25 A;  2P9I B;  3WXI A;  4CZE A;  4F9O A;  4WQ5 C;  1WUA A;  1YHQ N;  3KVG A;  3OBY A;  1KD1 O;  3MCA B;  2QTD A;  5E84 A;  4FOE A;  1HUX A;  1HKC A;  5FPM A;  2ZGY A;  3A8Y A;  4FWS A;  2NRV A;  3UKU B;  2AA4 A;  2RHK A;  3GE1 A;  5C0Y A;  1QQM A;  1XUP O;  3O1W A;  2JWL A;  1QHA A;  4A5A A;  3IDH A;  2QWQ A;  4FWN A;  1VQL N;  3O9U A;  1KAX A;  3P39 A;  3U4L A;  4CBW A;  3GL1 A;  3M5R A;  3ULE B;  2GUP A;  3C0B A;  1VQO N;  4WFA L;  4L3Q A;  4CZL A;  4BRI A;  5BRH A;  3GDQ A;  1DT9 A;  3FE1 A;  5C2F A;  1BDG A;  3LDL A;  2IVP A;  2A40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...