4WFNS

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22 in complex with erythromycin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4wfnS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4wfnS02
2ZJPS 5JVHS 1EXDA 4P2BA 5BNZA 1FEUA 5GADW 1QRSA 1DFUP 4JXZA 1B75A 4IO9S 5GAHW 1ZJWA 2ZJRS 3PIPS 1O0CA 1QRUA 4JXXA 1EUYA 4H3SA 1D6KA 1EUQA 2RE8A 5HL7S 5DM6S 4WFNS 4WFAS 2ZJQS 3AIIA 1GTRA 3CF5S 3PIOS 4IOCS 5GAGW 3J7ZV 4JYZA 1QTQA 1NYLA 2HZ7A 4WCES 4WF9S 4U67S 4WFBS 5DM7S 1GTSA 5IZNA 1QRTA 5JVGS 2RD2A 4UY88 3DLLS 1O0BA 4IOAS 5GAEW
chains in the Genus database with same CATH superfamily
2ZJPS 3I4NC 3PO2C 1Y1VC 4Y7NC 1TWAC 1EXDA 5BNZA 1FEUA 4XSZA 2A68A 3S17C 4A3GC 1DFUP 1B75A 2BE5A 3HOXC 5GAHW 3PO3C 1ZJWA 1UDXA 1SMYA 3FKIC 4LK1A 4KMUA 3HOYC 3K7AC 1EUYA 3GTMC 2KXYA 3HOUC 2NVYC 4GZYA 5IYDC 2CW0A 3W2VB 2PA8D 5IYCC 3S16C 2ZJQS 3AIIA 1GTRA 3CF5S 2R92C 5C4XC 4IOCS 2R93C 5GAGW 3J7ZV 1QTQA 4OIRA 1K83C 2A6HA 3S2HC 4C3JC 5FLMC 1VHKA 1TWCC 1QRTA 5TMFA 4YFKA 3RZOC 4OIQA 4BY7C 3H3VD 1I6HC 3CQZC 4LLGA 4BY1C 3HOVC 2KQ1A 5JVHS 4BBSC 2G5DA 2L5NA 4XSXA 3X1LB 1I6VA 3GTJC 1I3QC 1TWGC 4MEYA 1VHYA 2EGWA 2WB1D 3WODA 4Q4ZA 4C3IC 3GTOC 4L69A 4J3CA 2RE8A 5HL7S 5TMCA 4G7OA 2JA7C 5IYBC 4A3LC 5C3EC 3S2DC 3EQLA 2R7ZC 3M4OC 4MEXA 3GTGC 3GTQC 2O5JA 4JYZA 2PJJA 4C2MC 2VUMC 2NVTC 4WCES 3GTPC 3I4MC 3S1NC 4X6AC 2PICA 3S1MC 2EGVA 4Y52C 5DM7S 2WAQD 3LYWA 4QIWD 2PI8A 5IZNA 4UY88 2A69A 2JA8C 1O0BA 4KN4A 1Z85A 1ZYRA 4G7HA 5IP7C 4JK1A 2KPUA 4P2BA 4G7ZA 5GADW 1V6ZA 3S1RC 1QRSA 1YNNA 2E2IC 3S14C 4NOIA 5C44C 2ZJRS 3PIPS 2G6GA 5C4JC 2AE0X 1QRUA 1SFOC 2B63C 4OIOA 3HOZC 4JXXA 4A3CC 1D6KA 1EUQA 4MQ9A 4A3KC 2NVXC 1TWFC 5DM6S 4AYBD 1YNJA 1R9TC 4WFAS 1HQMA 4ZH4A 3PIOS 4LJZA 2NWAA 3KW2A 2E2JC 3H0GC 2A6EA 1NYLA 4A3JC 2HZ7A 2YU9C 4WF9S 2Y0SD 4U67S 1WCMC 4KN7A 3M3YC 4BXXC 4YG2A 4LK0A 4YFXA 3CZBA 4H4KA 3DLLS 4IOAS 5GAEW 1I50C 4E8BA 2CX8A 2PNWA 4A3FC 5HQHA 2JA5C 2O5IA 4OIPA 3DXJA 3S15C 4JXZA 4IO9S 2GAEA 4A3DC 4A93C 2E2HC 1O0CA 4A3EC 4Q5SA 4A3BC 4H3SA 1NXZA 2Z0YA 1Y1WC 3W2WB 3HOWC 4WFNS 3S1QC 5D4DA 2JA6C 4OINA 4XLNA 4V194 2PPBA 4QJVA 4WFBS 2NVQC 1IW7A 4C3HC 3GTLC 3HKZD 1TWHC 4XLPA 4A3IC 1GTSA 1BDFA 5IP9C 2L3UA 4BBRC 5JVGS 2RD2A 3RZDC 2PMZD 3GTKC 4A3MC 4YFNA
chains in the Genus database with same CATH topology
2ZJPS 5JVHS 1EXDA 4P2BA 5BNZA 1FEUA 5GADW 3X1LB 1QRSA 1DFUP 4JXZA 1B75A 4IO9S 5GAHW 1ZJWA 1UDXA 3PIPS 2ZJRS 1O0CA 1QRUA 4JXXA 1EUYA 4H3SA 1D6KA 1EUQA 2RE8A 5HL7S 3W2WB 5DM6S 4WFNS 3W2VB 4WFAS 2ZJQS 3AIIA 1GTRA 3CF5S 3PIOS 4IOCS 5GAGW 3J7ZV 4JYZA 4V194 1QTQA 1NYLA 2HZ7A 4WCES 4WF9S 4WFBS 4U67S 5DM7S 1GTSA 5IZNA 1QRTA 5JVGS 2RD2A 4H4KA 4UY88 3DLLS 1O0BA 4IOAS 5GAEW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJP S;  5JVH S;  1EXD A;  4P2B A;  5BNZ A;  1FEU A;  5GAD W;  1QRS A;  1DFU P;  4JXZ A;  1B75 A;  4IO9 S;  5GAH W;  1ZJW A;  2ZJR S;  3PIP S;  1O0C A;  1QRU A;  4JXX A;  1EUY A;  4H3S A;  1D6K A;  1EUQ A;  2RE8 A;  5HL7 S;  5DM6 S;  4WFN S;  4WFA S;  2ZJQ S;  3AII A;  1GTR A;  3CF5 S;  3PIO S;  4IOC S;  5GAG W;  3J7Z V;  4JYZ A;  1QTQ A;  1NYL A;  2HZ7 A;  4WCE S;  4WF9 S;  4U67 S;  4WFB S;  5DM7 S;  1GTS A;  5IZN A;  1QRT A;  5JVG S;  2RD2 A;  4UY8 8;  3DLL S;  1O0B A;  4IOA S;  5GAE W; 
#chains in the Genus database with same CATH topology
 2ZJP S;  3I4N C;  3PO2 C;  1Y1V C;  4Y7N C;  1TWA C;  1EXD A;  5BNZ A;  1FEU A;  4XSZ A;  2A68 A;  3S17 C;  4A3G C;  1DFU P;  1B75 A;  2BE5 A;  3HOX C;  5GAH W;  3PO3 C;  1ZJW A;  1UDX A;  1SMY A;  3FKI C;  4LK1 A;  4KMU A;  3HOY C;  3K7A C;  1EUY A;  3GTM C;  2KXY A;  3HOU C;  2NVY C;  4GZY A;  5IYD C;  2CW0 A;  3W2V B;  2PA8 D;  5IYC C;  3S16 C;  2ZJQ S;  3AII A;  1GTR A;  3CF5 S;  2R92 C;  5C4X C;  4IOC S;  2R93 C;  5GAG W;  3J7Z V;  1QTQ A;  4OIR A;  1K83 C;  2A6H A;  3S2H C;  4C3J C;  5FLM C;  1VHK A;  1TWC C;  1QRT A;  5TMF A;  4YFK A;  3RZO C;  4OIQ A;  4BY7 C;  3H3V D;  1I6H C;  3CQZ C;  4LLG A;  4BY1 C;  3HOV C;  2KQ1 A;  5JVH S;  4BBS C;  2G5D A;  2L5N A;  4XSX A;  3X1L B;  1I6V A;  3GTJ C;  1I3Q C;  1TWG C;  4MEY A;  1VHY A;  2EGW A;  2WB1 D;  3WOD A;  4Q4Z A;  4C3I C;  3GTO C;  4L69 A;  4J3C A;  2RE8 A;  5HL7 S;  5TMC A;  4G7O A;  2JA7 C;  5IYB C;  4A3L C;  5C3E C;  3S2D C;  3EQL A;  2R7Z C;  3M4O C;  4MEX A;  3GTG C;  3GTQ C;  2O5J A;  4JYZ A;  2PJJ A;  4C2M C;  2VUM C;  2NVT C;  4WCE S;  3GTP C;  3I4M C;  3S1N C;  4X6A C;  2PIC A;  3S1M C;  2EGV A;  4Y52 C;  5DM7 S;  2WAQ D;  3LYW A;  4QIW D;  2PI8 A;  5IZN A;  4UY8 8;  2A69 A;  2JA8 C;  1O0B A;  4KN4 A;  1Z85 A;  1ZYR A;  4G7H A;  5IP7 C;  4JK1 A;  2KPU A;  4P2B A;  4G7Z A;  5GAD W;  1V6Z A;  3S1R C;  1QRS A;  1YNN A;  2E2I C;  3S14 C;  4NOI A;  5C44 C;  2ZJR S;  3PIP S;  2G6G A;  5C4J C;  2AE0 X;  1QRU A;  1SFO C;  2B63 C;  4OIO A;  3HOZ C;  4JXX A;  4A3C C;  1D6K A;  1EUQ A;  4MQ9 A;  4A3K C;  2NVX C;  1TWF C;  5DM6 S;  4AYB D;  1YNJ A;  1R9T C;  4WFA S;  1HQM A;  4ZH4 A;  3PIO S;  4LJZ A;  2NWA A;  3KW2 A;  2E2J C;  3H0G C;  2A6E A;  1NYL A;  4A3J C;  2HZ7 A;  2YU9 C;  4WF9 S;  2Y0S D;  4U67 S;  1WCM C;  4KN7 A;  3M3Y C;  4BXX C;  4YG2 A;  4LK0 A;  4YFX A;  3CZB A;  4H4K A;  3DLL S;  4IOA S;  5GAE W;  1I50 C;  4E8B A;  2CX8 A;  2PNW A;  4A3F C;  5HQH A;  2JA5 C;  2O5I A;  4OIP A;  3DXJ A;  3S15 C;  4JXZ A;  4IO9 S;  2GAE A;  4A3D C;  4A93 C;  2E2H C;  1O0C A;  4A3E C;  4Q5S A;  4A3B C;  4H3S A;  1NXZ A;  2Z0Y A;  1Y1W C;  3W2W B;  3HOW C;  4WFN S;  3S1Q C;  5D4D A;  2JA6 C;  4OIN A;  4XLN A;  4V19 4;  2PPB A;  4QJV A;  4WFB S;  2NVQ C;  1IW7 A;  4C3H C;  3GTL C;  3HKZ D;  1TWH C;  4XLP A;  4A3I C;  1GTS A;  1BDF A;  5IP9 C;  2L3U A;  4BBR C;  5JVG S;  2RD2 A;  3RZD C;  2PMZ D;  3GTK C;  4A3M C;  4YFN A; 
#chains in the Genus database with same CATH homology
 2ZJP S;  5JVH S;  1EXD A;  4P2B A;  5BNZ A;  1FEU A;  5GAD W;  3X1L B;  1QRS A;  1DFU P;  4JXZ A;  1B75 A;  4IO9 S;  5GAH W;  1ZJW A;  1UDX A;  3PIP S;  2ZJR S;  1O0C A;  1QRU A;  4JXX A;  1EUY A;  4H3S A;  1D6K A;  1EUQ A;  2RE8 A;  5HL7 S;  3W2W B;  5DM6 S;  4WFN S;  3W2V B;  4WFA S;  2ZJQ S;  3AII A;  1GTR A;  3CF5 S;  3PIO S;  4IOC S;  5GAG W;  3J7Z V;  4JYZ A;  4V19 4;  1QTQ A;  1NYL A;  2HZ7 A;  4WCE S;  4WF9 S;  4WFB S;  4U67 S;  5DM7 S;  1GTS A;  5IZN A;  1QRT A;  5JVG S;  2RD2 A;  4H4K A;  4UY8 8;  3DLL S;  1O0B A;  4IOA S;  5GAE W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...