4WFNS

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22 in complex with erythromycin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2
total genus 19
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4wfnS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4wfnS02
5JVHS 4WCES 2ZJPS 3DLLS 5IZNA 4JYZA 1GTSA 5JVGS 1FEUA 1EUQA 4IOAS 3AIIA 5DM7S 4WFNS 4WFBS 1EUYA 1O0CA 1QRSA 5GAEW 3CF5S 5BNZA 5HL7S 4IO9S 1EXDA 4JXXA 4H3SA 1NYLA 2HZ7A 3J7ZV 4WFAS 2ZJRS 5GADW 4JXZA 1GTRA 4U67S 2RE8A 1QRUA 1ZJWA 1QTQA 1DFUP 4WF9S 1O0BA 2ZJQS 4IOCS 1B75A 3PIOS 4UY88 2RD2A 1D6KA 5GAHW 5DM6S 3PIPS 4P2BA 5GAGW 1QRTA
chains in the Genus database with same CATH superfamily
3HOVC 4WCES 2WAQD 1TWAC 3DLLS 2E2JC 4NOIA 5JVGS 2BE5A 4BBRC 3S14C 1EUQA 4IOAS 1EUYA 4LK1A 1R9TC 4YFKA 4ZH4A 3GTMC 4L69A 4A3CC 4Y7NC 2Z0YA 1QRSA 3S1RC 5GAEW 2O5IA 3CF5S 5HQHA 2JA5C 2NVTC 4LJZA 2O5JA 2PJJA 3HOXC 1NYLA 4H3SA 4MQ9A 4JXZA 1V6ZA 4A3EC 2RE8A 2VUMC 5IYCC 2L3UA 4OIQA 2YU9C 4MEXA 4Q4ZA 4A3DC 2EGWA 3HKZD 1NXZA 1YNJA 3GTLC 3HOYC 2JA7C 1TWFC 2PI8A 4UY88 2RD2A 1D6KA 2PNWA 3GTGC 1WCMC 4QIWD 3GTPC 4OINA 3AIIA 1I6HC 4V194 2JA8C 2NWAA 5D4DA 2ZJPS 1GTSA 2R92C 3S15C 4GZYA 1FEUA 5IP9C 4BBSC 5C44C 3M4OC 3S1QC 3S2HC 5TMCA 2WB1D 3HOUC 2PICA 2PPBA 3GTJC 5FLMC 4OIOA 2R7ZC 5C3EC 4C3IC 4A3KC 4XSXA 4IO9S 5TMFA 4JXXA 3M3YC 2HZ7A 2KQ1A 1GTRA 4A3JC 4KMUA 4KN7A 1QRUA 1ZJWA 2CX8A 1QTQA 3X1LB 2PA8D 4KN4A 3DXJA 4E8BA 4XSZA 2EGVA 5IYDC 4IOCS 1B75A 1YNNA 3GTKC 4C3HC 3RZOC 4OIPA 4X6AC 5GAHW 5DM6S 4P2BA 5C4JC 3EQLA 1VHKA 4AYBD 4A3BC 1QRTA 2Y0SD 1IW7A 1I6VA 3K7AC 4LK0A 4JYZA 4C3JC 4G7ZA 4BXXC 1TWCC 1O0CA 2A68A 4JK1A 4OIRA 3S16C 2G5DA 5BNZA 4QJVA 4A93C 3I4MC 1EXDA 5C4XC 1I3QC 4YG2A 4A3MC 4BY1C 2PMZD 4U67S 3GTOC 2GAEA 1I50C 1TWGC 4A3IC 4MEYA 1SFOC 4C2MC 4A3FC 3W2VB 2ZJQS 4G7OA 1HQMA 2AE0X 3PO3C 3I4NC 3S17C 4LLGA 2A69A 3CQZC 3PIOS 3H0GC 4XLNA 2A6HA 2B63C 2E2IC 3GTQC 3HOZC 3PIPS 3W2WB 5GAGW 2KPUA 4YFXA 2NVXC 5JVHS 2R93C 2JA6C 5IZNA 1TWHC 4Y52C 2NVQC 3HOWC 3CZBA 5DM7S 4WFNS 4WFBS 1K83C 3S1MC 1ZYRA 5IYBC 2G6GA 2L5NA 5HL7S 1BDFA 3KW2A 1Y1VC 1Y1WC 5IP7C 3FKIC 4XLPA 3S2DC 4WFAS 3J7ZV 2ZJRS 5GADW 1VHYA 1DFUP 4WF9S 4A3LC 1O0BA 3PO2C 1SMYA 4BY7C 2A6EA 3WODA 3LYWA 2KXYA 2E2HC 4YFNA 3RZDC 4G7HA 3S1NC 4H4KA 4J3CA 3H3VD 2CW0A 4A3GC 1Z85A 2NVYC 1UDXA 4Q5SA
chains in the Genus database with same CATH topology
5JVHS 4WCES 4V194 2ZJPS 3DLLS 5IZNA 4JYZA 1GTSA 5JVGS 1FEUA 1EUQA 4IOAS 3AIIA 5DM7S 4WFNS 4WFBS 1EUYA 1O0CA 1QRSA 5GAEW 3CF5S 5BNZA 5HL7S 4IO9S 1EXDA 4JXXA 4H3SA 1NYLA 2HZ7A 4WFAS 3J7ZV 2ZJRS 5GADW 4JXZA 1GTRA 4U67S 2RE8A 1QRUA 1ZJWA 1QTQA 3X1LB 1DFUP 1O0BA 4WF9S 3W2VB 2ZJQS 4IOCS 1B75A 4H4KA 3PIOS 4UY88 2RD2A 1D6KA 5GAHW 5DM6S 3PIPS 4P2BA 3W2WB 1UDXA 5GAGW 1QRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JVH S;  4WCE S;  2ZJP S;  3DLL S;  5IZN A;  4JYZ A;  1GTS A;  5JVG S;  1FEU A;  1EUQ A;  4IOA S;  3AII A;  5DM7 S;  4WFN S;  4WFB S;  1EUY A;  1O0C A;  1QRS A;  5GAE W;  3CF5 S;  5BNZ A;  5HL7 S;  4IO9 S;  1EXD A;  4JXX A;  4H3S A;  1NYL A;  2HZ7 A;  3J7Z V;  4WFA S;  2ZJR S;  5GAD W;  4JXZ A;  1GTR A;  4U67 S;  2RE8 A;  1QRU A;  1ZJW A;  1QTQ A;  1DFU P;  4WF9 S;  1O0B A;  2ZJQ S;  4IOC S;  1B75 A;  3PIO S;  4UY8 8;  2RD2 A;  1D6K A;  5GAH W;  5DM6 S;  3PIP S;  4P2B A;  5GAG W;  1QRT A; 
#chains in the Genus database with same CATH topology
 3HOV C;  4WCE S;  2WAQ D;  1TWA C;  3DLL S;  2E2J C;  4NOI A;  5JVG S;  2BE5 A;  4BBR C;  3S14 C;  1EUQ A;  4IOA S;  1EUY A;  4LK1 A;  1R9T C;  4YFK A;  4ZH4 A;  3GTM C;  4L69 A;  4A3C C;  4Y7N C;  2Z0Y A;  1QRS A;  3S1R C;  5GAE W;  2O5I A;  3CF5 S;  5HQH A;  2JA5 C;  2NVT C;  4LJZ A;  2O5J A;  2PJJ A;  3HOX C;  1NYL A;  4H3S A;  4MQ9 A;  4JXZ A;  1V6Z A;  4A3E C;  2RE8 A;  2VUM C;  5IYC C;  2L3U A;  4OIQ A;  2YU9 C;  4MEX A;  4Q4Z A;  4A3D C;  2EGW A;  3HKZ D;  1NXZ A;  1YNJ A;  3GTL C;  3HOY C;  2JA7 C;  1TWF C;  2PI8 A;  4UY8 8;  2RD2 A;  1D6K A;  2PNW A;  3GTG C;  1WCM C;  4QIW D;  3GTP C;  4OIN A;  3AII A;  1I6H C;  4V19 4;  2JA8 C;  2NWA A;  5D4D A;  2ZJP S;  1GTS A;  2R92 C;  3S15 C;  4GZY A;  1FEU A;  5IP9 C;  4BBS C;  5C44 C;  3M4O C;  3S1Q C;  3S2H C;  5TMC A;  2WB1 D;  3HOU C;  2PIC A;  2PPB A;  3GTJ C;  5FLM C;  4OIO A;  2R7Z C;  5C3E C;  4C3I C;  4A3K C;  4XSX A;  4IO9 S;  5TMF A;  4JXX A;  3M3Y C;  2HZ7 A;  2KQ1 A;  1GTR A;  4A3J C;  4KMU A;  4KN7 A;  1QRU A;  1ZJW A;  2CX8 A;  1QTQ A;  3X1L B;  2PA8 D;  4KN4 A;  3DXJ A;  4E8B A;  4XSZ A;  2EGV A;  5IYD C;  4IOC S;  1B75 A;  1YNN A;  3GTK C;  4C3H C;  3RZO C;  4OIP A;  4X6A C;  5GAH W;  5DM6 S;  4P2B A;  5C4J C;  3EQL A;  1VHK A;  4AYB D;  4A3B C;  1QRT A;  2Y0S D;  1IW7 A;  1I6V A;  3K7A C;  4LK0 A;  4JYZ A;  4C3J C;  4G7Z A;  4BXX C;  1TWC C;  1O0C A;  2A68 A;  4JK1 A;  4OIR A;  3S16 C;  2G5D A;  5BNZ A;  4QJV A;  4A93 C;  3I4M C;  1EXD A;  5C4X C;  1I3Q C;  4YG2 A;  4A3M C;  4BY1 C;  2PMZ D;  4U67 S;  3GTO C;  2GAE A;  1I50 C;  1TWG C;  4A3I C;  4MEY A;  1SFO C;  4C2M C;  4A3F C;  3W2V B;  2ZJQ S;  4G7O A;  1HQM A;  2AE0 X;  3PO3 C;  3I4N C;  3S17 C;  4LLG A;  2A69 A;  3CQZ C;  3PIO S;  3H0G C;  4XLN A;  2A6H A;  2B63 C;  2E2I C;  3GTQ C;  3HOZ C;  3PIP S;  3W2W B;  5GAG W;  2KPU A;  4YFX A;  2NVX C;  5JVH S;  2R93 C;  2JA6 C;  5IZN A;  1TWH C;  4Y52 C;  2NVQ C;  3HOW C;  3CZB A;  5DM7 S;  4WFN S;  4WFB S;  1K83 C;  3S1M C;  1ZYR A;  5IYB C;  2G6G A;  2L5N A;  5HL7 S;  1BDF A;  3KW2 A;  1Y1V C;  1Y1W C;  5IP7 C;  3FKI C;  4XLP A;  3S2D C;  4WFA S;  3J7Z V;  2ZJR S;  5GAD W;  1VHY A;  1DFU P;  4WF9 S;  4A3L C;  1O0B A;  3PO2 C;  1SMY A;  4BY7 C;  2A6E A;  3WOD A;  3LYW A;  2KXY A;  2E2H C;  4YFN A;  3RZD C;  4G7H A;  3S1N C;  4H4K A;  4J3C A;  3H3V D;  2CW0 A;  4A3G C;  1Z85 A;  2NVY C;  1UDX A;  4Q5S A; 
#chains in the Genus database with same CATH homology
 5JVH S;  4WCE S;  4V19 4;  2ZJP S;  3DLL S;  5IZN A;  4JYZ A;  1GTS A;  5JVG S;  1FEU A;  1EUQ A;  4IOA S;  3AII A;  5DM7 S;  4WFN S;  4WFB S;  1EUY A;  1O0C A;  1QRS A;  5GAE W;  3CF5 S;  5BNZ A;  5HL7 S;  4IO9 S;  1EXD A;  4JXX A;  4H3S A;  1NYL A;  2HZ7 A;  4WFA S;  3J7Z V;  2ZJR S;  5GAD W;  4JXZ A;  1GTR A;  4U67 S;  2RE8 A;  1QRU A;  1ZJW A;  1QTQ A;  3X1L B;  1DFU P;  1O0B A;  4WF9 S;  3W2V B;  2ZJQ S;  4IOC S;  1B75 A;  4H4K A;  3PIO S;  4UY8 8;  2RD2 A;  1D6K A;  5GAH W;  5DM6 S;  3PIP S;  4P2B A;  3W2W B;  1UDX A;  5GAG W;  1QRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...