4WFNS

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22 in complex with erythromycin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
175
structure length
175
Chain Sequence
b'MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4wfnS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4wfnS02
5DM7S 1EXDA 5BNZA 4IOAS 2RD2A 4UY88 1QRTA 1O0CA 1GTRA 1EUYA 1ZJWA 2HZ7A 4WFBS 1D6KA 3AIIA 5IZNA 3CF5S 1QTQA 3J7ZV 2ZJPS 3DLLS 1EUQA 1FEUA 1QRSA 3PIPS 5GAGW 5DM6S 5GAEW 4P2BA 5HL7S 1GTSA 1DFUP 2ZJQS 5GADW 1B75A 4IO9S 2RE8A 1QRUA 5JVGS 2ZJRS 4H3SA 4JXZA 5GAHW 3PIOS 4WCES 1NYLA 4JXXA 5JVHS 4JYZA 4WFAS 4WF9S 4U67S 4IOCS 4WFNS 1O0BA
chains in the Genus database with same CATH superfamily
3EQLA 4JK1A 4ZH4A 2E2JC 2R92C 2Z0YA 3HKZD 2WAQD 3FKIC 4A3FC 1EUYA 3CZBA 2L3UA 3HOXC 1ZJWA 2HZ7A 1ZYRA 1QTQA 4A3BC 5IZNA 4A3CC 2ZJPS 1Y1VC 1FEUA 4BXXC 4X6AC 1HQMA 1DFUP 4KN4A 3LYWA 2PICA 2ZJQS 5D4DA 1B75A 4A93C 4Q5SA 1V6ZA 1I50C 4XLPA 4V194 4Y7NC 4LK1A 4H3SA 4JXZA 3X1LB 5GAHW 2L5NA 2JA5C 3HOVC 1I6HC 1YNNA 2VUMC 4L69A 3PIOS 3GTQC 3KW2A 4BBRC 5JVHS 4C3HC 5FLMC 4WFAS 3H3VD 4A3EC 4WF9S 4U67S 4WFNS 4C2MC 1EXDA 3WODA 3GTJC 5C3EC 4LJZA 1SFOC 2R7ZC 3CQZC 3GTPC 3S2DC 2R93C 2KPUA 4Y52C 1O0CA 4BBSC 3I4MC 3GTGC 4WFBS 3HOYC 1YNJA 2Y0SD 4AYBD 1EUQA 4OINA 2PNWA 4YFKA 5GAGW 5HL7S 1IW7A 4QJVA 2CW0A 3HOWC 2CX8A 4LK0A 2KQ1A 2B63C 2GAEA 1TWGC 4OIQA 4IO9S 2O5IA 2A68A 5HQHA 2NVTC 1K83C 2ZJRS 2E2IC 4WCES 2A69A 2WB1D 3DXJA 2NVXC 1NYLA 3RZDC 3S1QC 1TWFC 4JYZA 4Q4ZA 1Z85A 3W2VB 3GTOC 4IOCS 5DM7S 4YFNA 4YG2A 5IP9C 4XLNA 1I6VA 5BNZA 4G7HA 2PMZD 4IOAS 3S2HC 3PO3C 3PO2C 1GTRA 2PJJA 3S1NC 1D6KA 4MEYA 2EGVA 3CF5S 2PI8A 3J7ZV 2G5DA 1QRSA 5IYCC 5IYDC 1WCMC 4NOIA 5GAEW 4P2BA 1GTSA 3GTMC 2O5JA 5C4XC 1VHKA 3I4NC 5GADW 4KN7A 4A3DC 1TWCC 2PPBA 4BY1C 2RE8A 1QRUA 2E2HC 5JVGS 1TWHC 5C44C 3M3YC 4G7OA 2AE0X 4KMUA 4A3MC 4BY7C 5TMFA 3S14C 5TMCA 4LLGA 3W2WB 1I3QC 3H0GC 3GTLC 1NXZA 4C3JC 3K7AC 4YFXA 5IP7C 1R9TC 4OIPA 3GTKC 4XSXA 5IYBC 2RD2A 4OIRA 4UY88 1QRTA 3S17C 4GZYA 3S15C 1TWAC 3S1MC 4A3IC 2NWAA 4QIWD 2JA8C 3AIIA 4MQ9A 4A3GC 4A3JC 4MEXA 5C4JC 4G7ZA 3PIPS 2YU9C 2PA8D 3HOUC 4C3IC 1UDXA 2G6GA 1BDFA 2KXYA 3RZOC 4J3CA 4H4KA 4E8BA 4XSZA 2JA6C 4A3LC 2BE5A 4OIOA 1VHYA 2EGWA 2NVYC 4A3KC 1Y1WC 3S1RC 2JA7C 3HOZC 4JXXA 3S16C 2A6HA 2A6EA 2NVQC 3DLLS 5DM6S 3M4OC 1O0BA 1SMYA
chains in the Genus database with same CATH topology
5DM7S 1EXDA 5BNZA 4IOAS 2RD2A 4UY88 1QRTA 1O0CA 1GTRA 1EUYA 1ZJWA 2HZ7A 4WFBS 1D6KA 3AIIA 5IZNA 3CF5S 1QTQA 3J7ZV 2ZJPS 3DLLS 1EUQA 1FEUA 1QRSA 3PIPS 5GAGW 5DM6S 5GAEW 4P2BA 5HL7S 1GTSA 1DFUP 2ZJQS 5GADW 1UDXA 1B75A 4IO9S 2RE8A 1QRUA 4V194 5JVGS 4H4KA 2ZJRS 4H3SA 4JXZA 3X1LB 5GAHW 3PIOS 4WCES 1NYLA 4JXXA 5JVHS 4JYZA 3W2WB 3W2VB 4WFAS 4WF9S 4U67S 4IOCS 4WFNS 1O0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM7 S;  1EXD A;  5BNZ A;  4IOA S;  2RD2 A;  4UY8 8;  1QRT A;  1O0C A;  1GTR A;  1EUY A;  1ZJW A;  2HZ7 A;  4WFB S;  1D6K A;  3AII A;  5IZN A;  3CF5 S;  1QTQ A;  3J7Z V;  2ZJP S;  3DLL S;  1EUQ A;  1FEU A;  1QRS A;  3PIP S;  5GAG W;  5DM6 S;  5GAE W;  4P2B A;  5HL7 S;  1GTS A;  1DFU P;  2ZJQ S;  5GAD W;  1B75 A;  4IO9 S;  2RE8 A;  1QRU A;  5JVG S;  2ZJR S;  4H3S A;  4JXZ A;  5GAH W;  3PIO S;  4WCE S;  1NYL A;  4JXX A;  5JVH S;  4JYZ A;  4WFA S;  4WF9 S;  4U67 S;  4IOC S;  4WFN S;  1O0B A; 
#chains in the Genus database with same CATH topology
 3EQL A;  4JK1 A;  4ZH4 A;  2E2J C;  2R92 C;  2Z0Y A;  3HKZ D;  2WAQ D;  3FKI C;  4A3F C;  1EUY A;  3CZB A;  2L3U A;  3HOX C;  1ZJW A;  2HZ7 A;  1ZYR A;  1QTQ A;  4A3B C;  5IZN A;  4A3C C;  2ZJP S;  1Y1V C;  1FEU A;  4BXX C;  4X6A C;  1HQM A;  1DFU P;  4KN4 A;  3LYW A;  2PIC A;  2ZJQ S;  5D4D A;  1B75 A;  4A93 C;  4Q5S A;  1V6Z A;  1I50 C;  4XLP A;  4V19 4;  4Y7N C;  4LK1 A;  4H3S A;  4JXZ A;  3X1L B;  5GAH W;  2L5N A;  2JA5 C;  3HOV C;  1I6H C;  1YNN A;  2VUM C;  4L69 A;  3PIO S;  3GTQ C;  3KW2 A;  4BBR C;  5JVH S;  4C3H C;  5FLM C;  4WFA S;  3H3V D;  4A3E C;  4WF9 S;  4U67 S;  4WFN S;  4C2M C;  1EXD A;  3WOD A;  3GTJ C;  5C3E C;  4LJZ A;  1SFO C;  2R7Z C;  3CQZ C;  3GTP C;  3S2D C;  2R93 C;  2KPU A;  4Y52 C;  1O0C A;  4BBS C;  3I4M C;  3GTG C;  4WFB S;  3HOY C;  1YNJ A;  2Y0S D;  4AYB D;  1EUQ A;  4OIN A;  2PNW A;  4YFK A;  5GAG W;  5HL7 S;  1IW7 A;  4QJV A;  2CW0 A;  3HOW C;  2CX8 A;  4LK0 A;  2KQ1 A;  2B63 C;  2GAE A;  1TWG C;  4OIQ A;  4IO9 S;  2O5I A;  2A68 A;  5HQH A;  2NVT C;  1K83 C;  2ZJR S;  2E2I C;  4WCE S;  2A69 A;  2WB1 D;  3DXJ A;  2NVX C;  1NYL A;  3RZD C;  3S1Q C;  1TWF C;  4JYZ A;  4Q4Z A;  1Z85 A;  3W2V B;  3GTO C;  4IOC S;  5DM7 S;  4YFN A;  4YG2 A;  5IP9 C;  4XLN A;  1I6V A;  5BNZ A;  4G7H A;  2PMZ D;  4IOA S;  3S2H C;  3PO3 C;  3PO2 C;  1GTR A;  2PJJ A;  3S1N C;  1D6K A;  4MEY A;  2EGV A;  3CF5 S;  2PI8 A;  3J7Z V;  2G5D A;  1QRS A;  5IYC C;  5IYD C;  1WCM C;  4NOI A;  5GAE W;  4P2B A;  1GTS A;  3GTM C;  2O5J A;  5C4X C;  1VHK A;  3I4N C;  5GAD W;  4KN7 A;  4A3D C;  1TWC C;  2PPB A;  4BY1 C;  2RE8 A;  1QRU A;  2E2H C;  5JVG S;  1TWH C;  5C44 C;  3M3Y C;  4G7O A;  2AE0 X;  4KMU A;  4A3M C;  4BY7 C;  5TMF A;  3S14 C;  5TMC A;  4LLG A;  3W2W B;  1I3Q C;  3H0G C;  3GTL C;  1NXZ A;  4C3J C;  3K7A C;  4YFX A;  5IP7 C;  1R9T C;  4OIP A;  3GTK C;  4XSX A;  5IYB C;  2RD2 A;  4OIR A;  4UY8 8;  1QRT A;  3S17 C;  4GZY A;  3S15 C;  1TWA C;  3S1M C;  4A3I C;  2NWA A;  4QIW D;  2JA8 C;  3AII A;  4MQ9 A;  4A3G C;  4A3J C;  4MEX A;  5C4J C;  4G7Z A;  3PIP S;  2YU9 C;  2PA8 D;  3HOU C;  4C3I C;  1UDX A;  2G6G A;  1BDF A;  2KXY A;  3RZO C;  4J3C A;  4H4K A;  4E8B A;  4XSZ A;  2JA6 C;  4A3L C;  2BE5 A;  4OIO A;  1VHY A;  2EGW A;  2NVY C;  4A3K C;  1Y1W C;  3S1R C;  2JA7 C;  3HOZ C;  4JXX A;  3S16 C;  2A6H A;  2A6E A;  2NVQ C;  3DLL S;  5DM6 S;  3M4O C;  1O0B A;  1SMY A; 
#chains in the Genus database with same CATH homology
 5DM7 S;  1EXD A;  5BNZ A;  4IOA S;  2RD2 A;  4UY8 8;  1QRT A;  1O0C A;  1GTR A;  1EUY A;  1ZJW A;  2HZ7 A;  4WFB S;  1D6K A;  3AII A;  5IZN A;  3CF5 S;  1QTQ A;  3J7Z V;  2ZJP S;  3DLL S;  1EUQ A;  1FEU A;  1QRS A;  3PIP S;  5GAG W;  5DM6 S;  5GAE W;  4P2B A;  5HL7 S;  1GTS A;  1DFU P;  2ZJQ S;  5GAD W;  1UDX A;  1B75 A;  4IO9 S;  2RE8 A;  1QRU A;  4V19 4;  5JVG S;  4H4K A;  2ZJR S;  4H3S A;  4JXZ A;  3X1L B;  5GAH W;  3PIO S;  4WCE S;  1NYL A;  4JXX A;  5JVH S;  4JYZ A;  3W2W B;  3W2V B;  4WFA S;  4WF9 S;  4U67 S;  4IOC S;  4WFN S;  1O0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...