4WFNS

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22 in complex with erythromycin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2
total genus 19
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4wfnS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4wfnS02
4JXXA 2ZJPS 2ZJQS 5GAEW 1QTQA 4IOAS 4JYZA 5GAHW 5JVGS 4WF9S 2HZ7A 4JXZA 3PIOS 1O0BA 4U67S 4WCES 2RD2A 1ZJWA 1QRTA 1EUYA 4WFAS 1D6KA 5GAGW 5JVHS 4P2BA 5DM7S 5IZNA 5HL7S 1NYLA 1EXDA 5DM6S 4WFNS 2RE8A 3PIPS 1QRSA 1EUQA 3AIIA 2ZJRS 3CF5S 5GADW 5BNZA 1FEUA 1DFUP 3DLLS 1QRUA 4IO9S 4UY88 1GTSA 1B75A 4IOCS 1GTRA 1O0CA 3J7ZV 4H3SA 4WFBS
chains in the Genus database with same CATH superfamily
4A93C 4MEYA 1TWGC 2L3UA 3S2HC 4C3HC 4A3IC 4KN4A 4L69A 4WF9S 4LLGA 2E2JC 4YG2A 2G5DA 1HQMA 4LJZA 2Z0YA 1O0BA 4U67S 2JA6C 3H3VD 1VHYA 4A3JC 3HOZC 3GTJC 4A3FC 3GTGC 4AYBD 3S16C 1UDXA 5JVHS 3H0GC 1YNJA 4XSXA 5IYBC 1Z85A 2WAQD 2PMZD 1TWFC 3HOYC 2R93C 3GTLC 1ZYRA 3CZBA 5HQHA 4XSZA 2R7ZC 4XLNA 2VUMC 3CQZC 3DLLS 1V6ZA 1QRUA 4C2MC 4IO9S 5C44C 4A3DC 3S1MC 4BXXC 3M3YC 3S14C 2PPBA 3HOXC 1SFOC 3S1RC 2PICA 4GZYA 2A6HA 2BE5A 1I6HC 5GAEW 4OIOA 1Y1VC 1QTQA 4IOAS 4A3BC 5JVGS 4OIQA 3GTPC 1NXZA 4OIPA 4YFKA 3RZOC 2B63C 2KQ1A 5GAGW 2JA8C 3HOVC 3S15C 5DM7S 5IZNA 2KXYA 5C3EC 1EXDA 3S1QC 4BBSC 2CX8A 1TWCC 3EQLA 1IW7A 2NVYC 4Y7NC 3S2DC 1EUQA 2ZJRS 4OINA 3I4NC 2R92C 3S1NC 1R9TC 1FEUA 5IYCC 4UY88 1SMYA 2CW0A 1B75A 3HOWC 3GTQC 1O0CA 4IOCS 4YFXA 1GTRA 2PJJA 4WFBS 4JXXA 3LYWA 2ZJPS 5FLMC 1YNNA 5C4JC 2Y0SD 4Q4ZA 2AE0X 3PO2C 3GTOC 5GAHW 2E2IC 2KPUA 4JK1A 4Y52C 2NVXC 2WB1D 2A6EA 3HKZD 3GTMC 4JXZA 4ZH4A 5IP9C 4X6AC 2RD2A 1EUYA 4YFNA 4WFAS 2A69A 2PNWA 1TWAC 4H4KA 4MEXA 2E2HC 5TMFA 4G7ZA 3PO3C 2G6GA 4V194 2L5NA 5IYDC 4A3KC 2NVTC 3GTKC 2RE8A 3RZDC 2A68A 4C3IC 4A3GC 3FKIC 5C4XC 5BNZA 4KN7A 3M4OC 2NWAA 2EGWA 1GTSA 5D4DA 4G7HA 4KMUA 4Q5SA 4H3SA 4MQ9A 4BY7C 1Y1WC 4A3EC 4E8BA 2ZJQS 4NOIA 2YU9C 4JYZA 4A3MC 3DXJA 4XLPA 2O5JA 1WCMC 3WODA 4A3CC 2HZ7A 3PIOS 4WCES 1ZJWA 1QRTA 3X1LB 4QJVA 3S17C 3W2WB 4A3LC 3KW2A 1D6KA 4LK1A 4QIWD 4P2BA 5HL7S 4G7OA 1NYLA 3K7AC 2GAEA 2EGVA 5TMCA 5DM6S 1I6VA 4J3CA 2JA7C 4WFNS 3PIPS 1QRSA 3HOUC 1BDFA 1K83C 2O5IA 3AIIA 3I4MC 3CF5S 5GADW 4BBRC 1VHKA 4OIRA 1DFUP 3W2VB 1TWHC 2PA8D 4LK0A 4BY1C 4C3JC 2NVQC 2JA5C 1I50C 5IP7C 2PI8A 3J7ZV 1I3QC
chains in the Genus database with same CATH topology
4JXXA 2ZJPS 2ZJQS 5GAEW 1QTQA 4IOAS 4JYZA 5GAHW 5JVGS 4WF9S 2HZ7A 4JXZA 3PIOS 1O0BA 4U67S 4WCES 2RD2A 1ZJWA 1QRTA 1EUYA 3X1LB 3W2WB 4WFAS 1D6KA 5GAGW 1UDXA 4H4KA 4P2BA 5DM7S 5IZNA 5HL7S 1NYLA 5JVHS 1EXDA 4V194 5DM6S 4WFNS 2RE8A 3PIPS 1QRSA 1EUQA 3AIIA 2ZJRS 3CF5S 5GADW 5BNZA 1FEUA 1DFUP 3W2VB 3DLLS 1QRUA 4IO9S 4UY88 1GTSA 1B75A 4IOCS 1GTRA 1O0CA 3J7ZV 4H3SA 4WFBS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JXX A;  2ZJP S;  2ZJQ S;  5GAE W;  1QTQ A;  4IOA S;  4JYZ A;  5GAH W;  5JVG S;  4WF9 S;  2HZ7 A;  4JXZ A;  3PIO S;  1O0B A;  4U67 S;  4WCE S;  2RD2 A;  1ZJW A;  1QRT A;  1EUY A;  4WFA S;  1D6K A;  5GAG W;  5JVH S;  4P2B A;  5DM7 S;  5IZN A;  5HL7 S;  1NYL A;  1EXD A;  5DM6 S;  4WFN S;  2RE8 A;  3PIP S;  1QRS A;  1EUQ A;  3AII A;  2ZJR S;  3CF5 S;  5GAD W;  5BNZ A;  1FEU A;  1DFU P;  3DLL S;  1QRU A;  4IO9 S;  4UY8 8;  1GTS A;  1B75 A;  4IOC S;  1GTR A;  1O0C A;  3J7Z V;  4H3S A;  4WFB S; 
#chains in the Genus database with same CATH topology
 4A93 C;  4MEY A;  1TWG C;  2L3U A;  3S2H C;  4C3H C;  4A3I C;  4KN4 A;  4L69 A;  4WF9 S;  4LLG A;  2E2J C;  4YG2 A;  2G5D A;  1HQM A;  4LJZ A;  2Z0Y A;  1O0B A;  4U67 S;  2JA6 C;  3H3V D;  1VHY A;  4A3J C;  3HOZ C;  3GTJ C;  4A3F C;  3GTG C;  4AYB D;  3S16 C;  1UDX A;  5JVH S;  3H0G C;  1YNJ A;  4XSX A;  5IYB C;  1Z85 A;  2WAQ D;  2PMZ D;  1TWF C;  3HOY C;  2R93 C;  3GTL C;  1ZYR A;  3CZB A;  5HQH A;  4XSZ A;  2R7Z C;  4XLN A;  2VUM C;  3CQZ C;  3DLL S;  1V6Z A;  1QRU A;  4C2M C;  4IO9 S;  5C44 C;  4A3D C;  3S1M C;  4BXX C;  3M3Y C;  3S14 C;  2PPB A;  3HOX C;  1SFO C;  3S1R C;  2PIC A;  4GZY A;  2A6H A;  2BE5 A;  1I6H C;  5GAE W;  4OIO A;  1Y1V C;  1QTQ A;  4IOA S;  4A3B C;  5JVG S;  4OIQ A;  3GTP C;  1NXZ A;  4OIP A;  4YFK A;  3RZO C;  2B63 C;  2KQ1 A;  5GAG W;  2JA8 C;  3HOV C;  3S15 C;  5DM7 S;  5IZN A;  2KXY A;  5C3E C;  1EXD A;  3S1Q C;  4BBS C;  2CX8 A;  1TWC C;  3EQL A;  1IW7 A;  2NVY C;  4Y7N C;  3S2D C;  1EUQ A;  2ZJR S;  4OIN A;  3I4N C;  2R92 C;  3S1N C;  1R9T C;  1FEU A;  5IYC C;  4UY8 8;  1SMY A;  2CW0 A;  1B75 A;  3HOW C;  3GTQ C;  1O0C A;  4IOC S;  4YFX A;  1GTR A;  2PJJ A;  4WFB S;  4JXX A;  3LYW A;  2ZJP S;  5FLM C;  1YNN A;  5C4J C;  2Y0S D;  4Q4Z A;  2AE0 X;  3PO2 C;  3GTO C;  5GAH W;  2E2I C;  2KPU A;  4JK1 A;  4Y52 C;  2NVX C;  2WB1 D;  2A6E A;  3HKZ D;  3GTM C;  4JXZ A;  4ZH4 A;  5IP9 C;  4X6A C;  2RD2 A;  1EUY A;  4YFN A;  4WFA S;  2A69 A;  2PNW A;  1TWA C;  4H4K A;  4MEX A;  2E2H C;  5TMF A;  4G7Z A;  3PO3 C;  2G6G A;  4V19 4;  2L5N A;  5IYD C;  4A3K C;  2NVT C;  3GTK C;  2RE8 A;  3RZD C;  2A68 A;  4C3I C;  4A3G C;  3FKI C;  5C4X C;  5BNZ A;  4KN7 A;  3M4O C;  2NWA A;  2EGW A;  1GTS A;  5D4D A;  4G7H A;  4KMU A;  4Q5S A;  4H3S A;  4MQ9 A;  4BY7 C;  1Y1W C;  4A3E C;  4E8B A;  2ZJQ S;  4NOI A;  2YU9 C;  4JYZ A;  4A3M C;  3DXJ A;  4XLP A;  2O5J A;  1WCM C;  3WOD A;  4A3C C;  2HZ7 A;  3PIO S;  4WCE S;  1ZJW A;  1QRT A;  3X1L B;  4QJV A;  3S17 C;  3W2W B;  4A3L C;  3KW2 A;  1D6K A;  4LK1 A;  4QIW D;  4P2B A;  5HL7 S;  4G7O A;  1NYL A;  3K7A C;  2GAE A;  2EGV A;  5TMC A;  5DM6 S;  1I6V A;  4J3C A;  2JA7 C;  4WFN S;  3PIP S;  1QRS A;  3HOU C;  1BDF A;  1K83 C;  2O5I A;  3AII A;  3I4M C;  3CF5 S;  5GAD W;  4BBR C;  1VHK A;  4OIR A;  1DFU P;  3W2V B;  1TWH C;  2PA8 D;  4LK0 A;  4BY1 C;  4C3J C;  2NVQ C;  2JA5 C;  1I50 C;  5IP7 C;  2PI8 A;  3J7Z V;  1I3Q C; 
#chains in the Genus database with same CATH homology
 4JXX A;  2ZJP S;  2ZJQ S;  5GAE W;  1QTQ A;  4IOA S;  4JYZ A;  5GAH W;  5JVG S;  4WF9 S;  2HZ7 A;  4JXZ A;  3PIO S;  1O0B A;  4U67 S;  4WCE S;  2RD2 A;  1ZJW A;  1QRT A;  1EUY A;  3X1L B;  3W2W B;  4WFA S;  1D6K A;  5GAG W;  1UDX A;  4H4K A;  4P2B A;  5DM7 S;  5IZN A;  5HL7 S;  1NYL A;  5JVH S;  1EXD A;  4V19 4;  5DM6 S;  4WFN S;  2RE8 A;  3PIP S;  1QRS A;  1EUQ A;  3AII A;  2ZJR S;  3CF5 S;  5GAD W;  5BNZ A;  1FEU A;  1DFU P;  3W2V B;  3DLL S;  1QRU A;  4IO9 S;  4UY8 8;  1GTS A;  1B75 A;  4IOC S;  1GTR A;  1O0C A;  3J7Z V;  4H3S A;  4WFB S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...