4WGHA

Crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with nadp and acetate at 1.8 a resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
283
structure length
283
Chain Sequence
b'VKKTVRFGEQAAVPAIGLGTWYMGEHAAQRQQEVAALRAGIDHGLTVIDTAEMYADGGAEEVVGQAIRGLRDRVVLVSKVYPWHAGKAAMHRACENSLRRLQTDYLDMYLLHWRGDIPLQETVEAMEKLVAEGKIRRWGVSNLDTEDMQALWRTADGEHCATNQVLYHLASRGIEYDLLPWCQQHSLPVMAYCPLAQAGRLRDGLFQHSDIINMANARGITVAQLLLAWVIRHPGVLAIPKAASIEHVVQNAAALDIVLSGEELAQLDRLYPPPQRKNRLDMV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldehyde reductase
publication title Crystal structure of aldo/keto reductase from Klebsiella pneumoniae in complex with NADP and acetate at 1.8 A resolution
rcsb
source organism Klebsiella pneumoniae
molecule tags Oxidoreductase
total genus 83
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2014-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wghA00
3H7UA 2NVDA 4XVDA 1C9WA 2IPGA 4JTQA 2AGTA 2IQ0A 4RPQA 4GQ0A 4QR6A 2QXWA 1HW6A 1YNQA 3LQLA 2C91A 3RX3A 1AZ1A 2DUXA 2PEVA 1UR3M 4LB4A 3QKZA 5AZ1A 4LB3A 4HBKA 2INEA 3EB3A 2PDCA 3R58A 2HE5A 2PDIA 3BUVA 3CMFA 3M4HA 5AZ0A 2PDHA 4YU1A 2PDQA 3CASA 4XZMX 4QBXA 4H7CA 4GABA 3M64A 3RX4A 2FVLA 4WEVX 3R6IA 2ACQA 2INZA 4JIHA 3ONBA 4YVXA 1AH0A 1FRBA 3O3RA 1MRQA 4WDUA 1VP5A 1RALA 3FJNA 5JH2A 3CV7A 3BURA 5HA7A 3B3DA 3D3FA 2IKJA 2PFHA 5LIKX 4WRHA 2FZDA 1RY8A 4WDWA 1ZQ5A 4IJCA 2PD5A 2WZTA 4GA8A 1PZ0A 3V36A 2F38A 3V35A 1Z9AA 4LAZA 3UYIA 4DBWA 1XF0A 2PDJA 1YE6A 2DV0A 2PDGA 3GHRA 4WDTA 4XZLX 5HNTA 3WCZA 3LENA 1AFSA 1EXBA 3MB9A 3UZWA 2IKHA 5HNUA 1PWLA 2A79A 4JQ4A 4JTDA 3V0TA 4Q7BA 4FALA 5KETA 3DN5A 4QXIA 4PMJA 4QX4A 2DUZA 4G5DA 2NVCA 2PF8A 1A80A 4FAMA 2IKIA 4GIEA 3RX2A 5JH1A 1JEZA 4FZIA 4JQ1A 3V0SA 2I17A 3ERPA 2ACSA 4XVEA 2ALRA 4LAUA 3CAQA 1YE4A 3U2CA 3Q67A 1Z3NA 4JTCA 1VBJA 2PDBA 4PR4A 3O0KA 3COTA 3GUGA 3CAVA 2PDLA 4IJRA 1ZGDA 3WBXA 1Q5MA 2PDNA 2BGSA 3R8GA 4WGHA 3EB4A 1HQTA 2PDMA 3LNMA 2J8TA 1US0A 3LEPA 2PDUA 2IQDA 1Z89A 1X96A 3LZ3A 3ONCA 4MHBA 1X98A 3CV6A 1Q13A 4PRTA 2HEJA 1M9HA 1PWMA 3R8HA 2PDXA 2ISFA 4JQ2A 1MI3A 3H7RA 3BCJA 1EKOA 2PDPA 1T41A 2F2KA 3N2TA 4DBUA 2IPJA 4PUUA 5C7HA 3NTYA 2HE8A 2PDYA 4JTAA 2HDJA 1SM9A 1ZUAX 4NKCA 2PDWA 1S1PA 2PDFA 4FA3A 4ZFCA 2PZNA 2BGQA 4XAPA 4GQGA 1QRQA 2VDGA 4DZ5A 2IS7A 4GCAA 1RY0A 1OG6A 3R94A 3GHSA 4L1WA 1R38A 1XGDA 1X97A 2IKGA 1S2AA 3G5EA 1AH4A 4H8NA 3MC5A 4ICCX 2FZ9A 1S1RA 3LD5A 3R43A 2I16A 2R9RA 2FGBA 3LBOA 4WDXA 4HMNA 4ASTA 1Z8AA 3LQGA 3G1RA 3UWEA 4EXAA 5LIXX 2PD9A 2P5NA 4XO7A 3UG8A 1AH3A 4YS1A 1AZ2A 3Q65A 4EXBA 2IPWA 1ZSXA 3LZ5A 2HV5A 3WG6A 1PYFA 1QWKA 3T42A 2IPFA 3S3GA 2WZMA 4GACA 4AUBA 5LIUX 4PRRA 3F7JA 2R24A 4YVVA 4JTRA 4LBRA 2HVNA 3UZZA 4JQAA 4OTKA 3WBWA 3H4GA 4DBSA 1LWIA 3KRBA 4JQ3A 1XJBA 3DOPA 2ACUA 4LBSA 4XZIA 2PDKA 4XZNX 3R7MA 3UFYA 1GVEA 5M2FX 3EAUA 2BP1A 4I5XA 4PUWA 2FZBA 3M0IA 3WBYA 4JIRA 1ADSA 3V0UA 1S2CA 3BV7A 3LN3A 5DANA 1LQAA 4XZHA 3UZYA 1IEIA 2HVOA 1IHIA 5LIWX 4F40A 1YNPA 1K8CA 2ACRA 3C3UA 1EF3A 4Q3MA 4XK2A 3LUTA 1EL3A 1PZ1A 3UP8A 3GHTA 3N6QA 2FZ8A 4R9OA 1MZRA 3UGRA 4XO6A 1J96A 1T40A 4JIIX 4IGSA 3GHUA 3UZXA 3VXGA 5LIYX 3FX4A 4YVPA 3P2VA 2CLPA 4L1XA
chains in the Genus database with same CATH superfamily
5CSRA 3SQSA 1WUEA 3TSBA 1TPH1 4MZ8A 3M0VA 2QJMA 4BA0A 3K1GA 4EK7A 3HM7A 2XJ7A 2GJXB 3KRSA 1BKHA 3TZFA 2DPEA 1CWYA 5A95A 3CYJA 1E6QM 4Z08A 3FA5A 3MI3A 3O9NA 1TWSA 3L4TA 4G6CA 5DLCA 2PDCA 2BNJA 1R0MA 2W92A 4WLCA 3W23A 1PKMA 1J0ZA 4CQDA 1CENA 2BG5A 3VMPA 4GABA 4RK8A 3GQYA 1PX8A 2G3FA 4MPKA 1B0IA 3G77A 3TK7A 5C5YA 2E3ZA 3IK2A 4DYKA 2P0OA 1BG9A 3EXTA 3R6IA 1PX4A 4BQ4A 3VDAA 1W32A 1W3HA 4GNJA 2VWTA 2VJXA 1AH0A 2Z0IA 2NXGA 1KTCA 1PCKA 4IICA 1NF0A 3KBSA 3GTIA 1WPCA 2OO0A 1XIDA 5HQEA 4JCLA 3CAKA 1E9IA 3H26A 4WQ6A 4KEVA 3A13A 3NVTA 3ORWA 2ZRZA 3UR8A 2CHRA 3GXFA 2WHKA 1EUAA 5LIKX 3I6RA 3M5YA 3KHJA 2VX4A 1H7PA 4EANA 3CL8A 5E70A 3OHMB 4GI9A 2YXXA 2F38A 2VC6A 2E1DA 3E74A 3M5XA 1KXVA 4QLLA 3VNDA 1AK5A 1ITUA 3WLIA 4AHPA 1D3CA 1JR1A 2KAUC 4Q4RA 1J0YA 5FA5A 1NFBA 3UXKA 3R11A 1KNWA 4IFKB 3VX1A 3W37A 1UCWA 2A79A 3TV8A 4LSBA 3IIZA 4J3ZA 2QCEA 2Q02A 3UJRA 1PKNA 3P60A 2IW0A 3AIVA 3HMCA 1T6MA 3POCA 4RZBA 3PBVA 1P0EA 1XYLA 1TPVA 3AYVA 3HV8A 3AMLA 1TKKA 4LUIA 4F4RA 1VAHA 2C13A 3WQ8A 3G24A 4RZ4A 1JAKA 1SZRA 2ALRA 1UWSA 7REQB 1PJ9A 5LHEA 4PN2A 1RUSA 4W86A 3ARSA 4ZO7A 1G1YA 4AY1A 4UFIA 2OZ3A 4GYPC 3GD6A 5HXMA 4DNHA 2YCJA 5ENLA 2ZRVA 3S6DA 4NRSA 4GVHA 1NP2A 3AIBA 1UD5A 3MHGA 2BGSA 1R3TA 3HJZA 2V69A 1GW9A 2VMFA 5I3KA 3W71A 4WGHA 1P4CA 1TG7A 4MKVA 1H2JA 1KCXA 1RCXB 1LBMA 1WOAA 5EL1A 4QITA 5A8GA 3KCOA 3LZ3A 4MB4A 2VEMA 3FJ6A 4JTEA 4E6MA 4DJFA 3T08A 1DVJA 3NQ7A 1UJPA 3CV6A 2GJPA 4WK9A 2PWFA 2A7RA 3MBFA 3EWDA 4XZWA 1W3TA 2GUUA 3IIXA 4XD5A 2E68A 4R33A 3AHZA 4I9JA 1FWSA 1JPHA 3W3OA 1W3KA 2D1ZA 1SGJA 1DJHA 2XTKA 1HJWA 1GJWA 4C7DA 2YKKA 4DVOA 1ZU8A 4DPQA 3LMYA 3MSGA 4BHYA 1EX1A 5PTDA 3BAIA 1A4MA 1HKVA 5HJLA 1AJZA 1OM0A 3RYSA 3FAWA 5XINA 1SM9A 3CPUA 4EACA 3CQHA 1OIMA 2AAAA 1KM0A 3RMEA 3IIPA 3A9BA 2D2HA 1ELSA 4UQAA 1LORA 1C92A 1QI3A 2C6QA 5A2BA 3FKKA 1ML1A 5C9ZA 4AW7A 3W24A 2Z2BA 4KFOA 1CECA 4H4IA 2DW6A 4TXEA 1DEDA 1IIHA 3WJYA 4TTGA 3LCWA 3QV7A 3VNZA 2D0HA 3MBDA 2Z28A 3VZZA 1B90A 4EXQA 3R43A 3CPRA 3CIXA 4L4OA 5DF0A 2Y7EA 1UUMA 4HKPA 4WDXA 4F9DA 4CQAA 2EXOA 3LBMA 4M8UA 1Q3NA 3T2QA 4B4HA 1K70A 3FSUA 1U22A 1KFBA 3QQ1A 3W53A 1UKPA 4PUJA 1F2JA 1FCBA 4ZL1A 1ME8A 2VC7A 4Q33A 4P8XA 4OBTA 2W9MA 4OFCA 2PA6A 1GORA 2OT1A 4MIMA 1QW9A 3STFA 1WKYA 2C79A 1YDNA 4WZHA 5G1TA 3ICJA 3SRFA 3NZQA 2ATMA 5T9CE 3M07A 4K8EA 2BASA 4WVXA 1R7AA 1A3HA 1ISVA 3S0CA 3OOQA 3B0YA 3OLEA 3P74A 1BXNA 3DFOA 3L66A 1OCQA 3CL7A 3DIPA 1I45A 3S1VA 3THAA 3W83A 4F40A 4BK9A 2J79A 2H8XA 7TIMA 3TW9A 2QCHA 1EL3A 1PZ1A 3S5OA 3NQMA 4JHOA 4B5NA 1SZEA 2TPSA 5DEZA 4O16A 3UXIA 3WLPA 4HOXA 4F2UA 3VFCA 4ONVA 2EF9A 1K7EA 4D8LA 3BQ5A 3A22A 4Z2HA 1XRVA 3L4ZA 1LBLA 3NA8A 4ZO8A 2VP8A 2DY3A 3WJZA 4S3DA 1E5JA 4EWJA 4FO4A 1HGYA 2FIQA 2C1IA 2RJHA 1DJWA 4RXFA 1V0LA 3DXIA 1W9XA 5E09A 3R89A 4WXZA 1CGYA 5MKGA 3ZOAA 1BEUA 4M80A 1SFTA 4IGHA 2BVWA 3VGBA 1B3YA 2UV8G 1OY0A 1TA3B 3W9ZA 3K5XA 3OHIA 3DAQA 3OZMA 1XLMA 3CASA 3GNOA 3EMQA 4UQBA 2YDAA 3OA3A 4Y8EA 2FPYA 1G5AA 1SFSA 4Q8NA 4FXJA 4C60A 1XDMA 4AIBA 3SAZA 4IFRA 3B8UA 4AHOA 3H22A 2ZUWA 2G41A 1DYSA 4V1YA 2ACQA 1SVDA 4Y9PA 3NAVA 5T91A 3W70A 2UBPC 3REQB 1BXBA 4Z2LA 1QO5A 5HK4A 4C5YA 4D6FA 3O06A 4OV4A 1B2YA 2X40A 5I3GA 2V2DA 3RR1A 4KERA 1XINA 2BDQA 3NQ6A 2E8ZA 2B7OA 3E5BA 5JMUA 1QW7A 3TW7A 4DJFD 1WZKA 4G7EA 2PZ0A 2XH4A 1RY8A 3MSYA 1YKWA 4GA8A 4O1EA 2Z7GA 3GBEA 3VOJA 1L9WA 4DBWA 1RLDA 4XZLX 4NAFB 2QAPA 5HNTA 5ABEA 1TJRA 1CXEA 1KFKA 2XG9A 4HGXA 2IKHA 4W5ZA 3ABOA 5E6ZA 5HAOA 3N13A 1FWAC 3S9YA 2DGAA 2RAGA 1UR9A 4GKTA 2VM8A 8XIAA 2V2CA 4UQDA 3TA9A 2NUWA 4MB1A 1YIXA 2XIMA 1WV2A 2WNZA 3VZXA 3ZO9A 2E6AA 2P1FA 3HGOA 4A3QA 3D47A 1L8NA 1YE4A 4HPJA 4DIAA 1N8WA 2GFTA 1VYRA 4GY0A 4CN6A 4OE7A 3AOFA 4PR4A 3O0KA 1DXIA 1RBOB 4YTTA 4IJRA 3D46A 1I1XA 1IEQA 4HA3A 5HMDA 1T0OA 1Q5MA 4X2PA 2AKZA 3A47A 3IJ7A 4AC1X 1BG4A 2HK1A 4BQ2A 3TTEA 3IPWA 1ZTVA 2E5DA 2QS8A 1B54A 1FWEC 2A3AA 2OZ0A 2BB0A 2VFHA 3M16A 4N0RA 2V38A 1OJXA 2VRKA 1WP6A 3QN3A 5IHRA 1P0KA 2YJQA 1FWBC 1UH2A 5K9XA 3PG9A 4ZODA 2HWGA 4MHBA 4Y9NA 4P2VA 2QEZA 3OVPA 2DZWA 5EMLA 4I9TA 2J9XA 5FAJA 3QH2A 2YXGA 4K39A 4DAIA 1GT8A 4OECA 5JIWA 2DUAA 4EPDC 3R8HA 2WK2A 3SGZA 4L5ZA 3HG2A 1EHNA 3CZLA 5IRPA 1G94A 2J4GA 1KD0A 2DSWA 1M7PA 5EFFA 2J7GA 1T41A 3BSMA 2WCGA 1L0PA 3L5MA 1ODZA 1XM3A 6TIMA 1OYAA 1KKOA 2VFGA 1YADA 5I3FA 3WJSA 4A6GA 3TP4A 2Z24A 2XUCA 1B4KA 1XKJA 1VFLA 1W0MA 1UA7A 3ITTA 2V5JA 1ZUAX 2PDWA 4B5WA 2VC9A 1PO9A 5F4XA 3QOKA 1Q45A 2GWNA 2FDSA 4XIMA 3R94A 1Z32X 4L1WA 1R38A 4PCSA 3ZVIA 4RE4A 1R8LA 1XHGA 3QHNA 3PZQA 1XV8A 4MNMA 1XP3A 1ZNNA 3VK5A 2FKPA 2GQ9A 2OKTA 3UY8A 1A0DA 4IJBA 2FGBA 2XSBA 1X1NA 2NQ5A 3W4RA 3SI9A 4JFVA 3VOCA 1EIXA 1HVQA 3W85A 3UWEA 4JEJA 1VCFA 4GCXA 4D71A 1Q8JA 2ZWZA 4KW2A 4UB9A 1PTDA 3PNZA 1ZSXA 2WM1A 3UA4A 4UNIA 3DUGA 4M6PA 5GJPA 4H8HA 4LUYA 4GACA 2VD9A 4AUBA 3VMNA 1UB3A 4K2SA 3W2JA 4LALA 3DGBA 4NI8A 3CB3A 3ITLA 5AYBA 5K9DA 1TZ7A 3N2XA 1D3HA 3FHAA 3KVLA 3CC1A 3NXFA 2DZBA 3HB9A 3P0WA 1ZZMA 4GC3A 3TU9A 3WBYA 4NAEA 1GVFA 3UWZA 5AKQA 1UC4A 5HUOA 5DANA 1MFVA 4GH3A 4KCTA 3S5SA 2WNWA 4KQNA 2ZYFA 1K7FA 1OFBA 1TTQA 4TU1A 2W3ZA 4N2YA 3H23A 5CBBA 4V2XA 4YTSA 1HXJA 3LUTA 3TONA 3NQAA 3AICA 2XSXA 3LXCA 2YL5A 4NQ1A 4MADA 1JCNA 3LHVA 3Q94A 1MZRA 3KAOA 3TN3A 1PUDA 3QYSA 1OGGA 5I3JA 1LRTA 1JXJA 3BLPX 3HV9A 1OB0A 3GHUA 3UZXA 5A3HA 1FXQA 3II1A 1SO3A 1HJSA 1PB0A 2Q8LA 3MKVA 2ABBA 1RXOB 2C16A 4RDZA 5CGTA 4C6OA 3FK4A 2VFEA 2PWVA 4ACZA 3B03A 2IPGA 4NJHA 1GQNA 1QTWA 1CNVA 4A3HA 5B7ZA 4JN7A 3VKCA 4A8RA 2BZNA 4FOUA 1YXDA 4CD8A 4ECLA 1EA9C 2XFFA 4LB4A 4LYPA 3EOUA 3BJFA 3IJ8A 6ENLA 5G2HA 4JTKA 2ZZ5A 5K3VA 3UXLA 4EIVA 3SSZA 3I4EA 3GXPA 4D6HA 4W5UA 3LM3A 1JYXA 4UFLA 5AYZA 5H2ZA 2HK0A 4IX2A 4M5PA 2JF7A 3KBVA 1W1PA 1Y7VA 4LFYA 1HJUA 3ABQA 1FWGC 4LS0A 4HPGA 3ZVHA 3MDUA 3LCFA 3EWZA 3GFYA 1GEQA 3P8IA 4UTHA 2YIHA 1L6FA 3SBFA 2UY4A 5FF2A 5DN1A 1MEWA 5DMNA 1MNSA 4C7FA 1QBAA 2FDMA 2VYOA 5A8OA 3ZFHA 1LRQA 3EOOA 3UVAA 2YFNA 2Z1WA 3OEXA 3W00A 1CB2A 1XLCA 4XBKA 2PC4A 2X8RA 2FZDA 3VKJA 1RLCL 2WKJA 3QTPA 1W2PA 2YW3A 1A53A 3SADA 2PD5A 3EX1A 1PZ0A 1Z7AA 4IWWA 4UQCA 3AYTA 4JFWA 1ESWA 1KRCC 1PZ3A 3VU2A 2AMXA 1JUKA 3U0HA 2CCRA 1JCLA 1VCVA 2OO6A 1EXBA 4O8AA 4S2BA 3ARZA 2VZVA 1WXYA 1P0NA 2VL4A 4FALA 3W75A 3PR2A 2WMIA 1P7TB 1UR0A 4W8BA 2ZE0A 3BSGA 3PJWA 1SO4A 3KOFA 3RM9A 1J12A 4DZAA 3MDWA 4DI9A 2NW0A 5A2AA 1O66A 3PUGA 3A5FA 1GZJA 5FOOA 5CZ0A 2YX0A 3PVFA 4Q7IA 2GJXA 1D9EA 2F84A 3BAKA 3PFRA 3V0SA 3TCEA 4NL1A 3HF3A 1W1TA 1JIBA 1N2VA 1CB7B 3VKDA 2OG9A 2HJPA 1I0BA 3WBAA 4HHLA 3IV8A 3UERA 3B97A 4QM1A 1Q7QA 4XAZA 2WSRA 1ZBVA 1GG0A 4Y7EA 3TC3A 4F0SA 2OQHA 3M9YA 5CPTA 1OCJA 3WDIA 5HBFA 4PZVA 4AZ7A 4ZOBA 1DOSA 4P5UA 1HQTA 3NL6A 3KZSA 4B3ZA 1HG3A 3FGCA 2VELA 1ZCCA 2OWXA 2EPLX 3UPMA 2QUMA 3QC0A 2I5IA 3MO7A 2QT3A 3EX6A 5KTLA 1THFD 1V3LA 4N9EA 1V08A 3QY6A 1F05A 1TQXA 1O5QA 2V67A 2VQUA 2V3DA 4JTSA 3V16A 3NDOA 1IGWA 1XLAA 3ZT5A 3C61A 4IF2A 4AX7A 1JYVA 4URIA 5CPLA 1EIBA 3UU0A 2YOCA 4A2SA 3Q58A 1RA5A 1JRBA 4AY8A 3AYSA 3E0LA 1M7XA 1O1HA 3L4VA 1QI5A 1QCWA 4KRUA 4JAWA 3IJQA 2F2KA 2VCCA 1BQGA 2QYGA 4PE8A 4HSOA 3M41A 3SFKA 1GHSA 4MWAB 1VRXA 1H60A 3ENLA 5BRQA 2HQAA 1ZBWA 3E0FA 4EAMA 4IQLA 4XBSA 4CVWA 1E6RA 5DCDA 3MANA 3WK2A 3S8HA 4IFKA 5HINA 4JKLA 1ZHAA 2BGQA 1X8FA 4MGGA 3QHMA 2W66A 1QK2A 1OX4A 1BF6A 3B8TA 1R86A 1Q6QA 1J79A 4KKXA 4C6MA 3VD7A 2OLSA 1VYPX 2YDRA 3STGA 1UD3A 3EPMA 4AWTA 8CGTA 1UBSA 5BWAA 1E70M 4DUWA 3C5QA 4IZGA 2JIEA 3TTSA 3QSTA 4GZEA 2XDFA 3P6LA 5CG7A 7REQA 2GPTA 1UKSA 2EPOA 3LBOA 5REQB 2UZ9A 2X42A 3L9CA 4CLMA 1WXJA 3TYBA 4IISA 3AYRA 2E1WA 5ABHA 4DPPA 4IIHA 4XO7A 2V68A 2XYLA 1RA0A 2JF6A 1IZCA 4KBXA 3NWRA 4JTIA 2HV5A 3MCMA 5EY5A 2WZMA 4EWND 2VUYA 1K3UA 5FJPA 2WANA 4LUTB 1V51A 3HGSA 4H6KA 4K7YA 3VO0A 3B06A 4G7FA 1MDRA 3T2OA 4Q8TA 1IT7A 3UWWA 5FJRA 4JQ3A 1M3UA 4GVFA 4Q4MA 4L6DA 2O9PA 1IIGA 4YHGA 2BP1A 4GY1A 3LTYA 1I60A 1OQFA 1UP0A 4L7ZA 3CIVA 4MMWA 5DT5A 1J10A 3OLDA 1BTCA 5EYWA 3N4FA 2A0NA 4HP5A 5HQLA 4X60A 1PIIA 2POZA 1JVNA 2EGZA 1G7UA 4DELA 1Q2SA 3C6CA 5AY7A 1UD8A 3VCRA 1XSIA 2GUYA 1F74A 3E0IA 3KZPA 3L4UA 4MWAE 3GK0A 4GC4A 4IXHA 2BV9A 5SWUA 5C70A 2WWCA 2TSYA 1DJZA 1GVIA 2O9TA 3IAQA 5I5RA 2Y5SA 3IIOA 1E1CA 3WQVA 1FUYA 2J6VA 3TAKA 3VPLA 1HKJA 3LTSA 4RNFA 4QR6A 1CLVA 1RQHA 3UWQA 5C54A 2QCDA 1XX1A 4L61A 3GXTA 2INEA 4UOZA 3JR2A 2WC3A 3V5CA 1XLGA 4UTWC 4O15A 3A9IA 4OT7A 4HCDA 1XG3A 4MFDA 4QSFA 2J77A 4J3UA 3SCVA 2WW5A 1LM1A 2CLMA 3KTSA 4YYFA 5CBIA 3MI6A 3W01A 3A4JA 5M3WA 4DUXA 1EQCA 5A8QA 3M7WA 3H4XA 1IXNA 4AFYA 5C9RA 1A3WA 1KCZA 3KTXA 5AYYA 2DDXA 2E9MA 4A3YA 3S6OA 4HZ7A 4KEMA 2ZVRA 1J6OA 4DYEA 3FJNA 3QV6A 3VGDA 2I1OA 1K9EA 1WZMA 3GKAA 3M47A 3GXIA 3A3HA 4MY1A 2WVUA 1OYCA 3FKRA 1FHUA 2IKJA 4QRNA 3I3EA 2VTFA 2R82A 1ZQ5A 4LEFA 3TJ4A 2XSAA 3HQNA 3UJ2A 2DVUA 1L6WA 5D8WA 3V36A 2V5CA 1WBHA 6REQB 3WNPA 3AZTA 1FTXA 4LAZA 2CESA 4REQB 1YE6A 3H12A 3OW1A 4B5UA 1J11A 3FY1A 1LL6A 1YEYA 3CXOA 3O6YX 2CU0A 2F6KA 2X1SA 4D6CA 1YTKA 5F1UA 2I14A 2YPIA 4C1NB 5C2XA 3T8QA 4JY9A 2TRSA 3E1F1 4MJ4A 3AUOA 4J3TA 2BY2A 2GVGA 5BMWA 3VNKA 3G2GA 1GEHA 1NAL1 3WNMA 4PFMA 1EA0A 3H4WA 1SJCA 5JH1A 1K9FA 1J01A 4YMZA 1SUXA 5TD4A 1Q66A 1TELA 3LOTA 1G6CA 5F2IA 1VLWA 3CH0A 3DHDA 2DJLA 3CWHA 1EZWA 1GCYA 1SSDA 4M6UA 3WDRA 4J7RA 2A4AA 3COTA 1X1ZA 3MYOA 5HJYA 3W1MA 4GG9A 1D2KA 4PUMA 3WDJA 4WSJA 3NG3A 1OABA 1VB9A 1GPFA 4DWSA 2WLZA 5D37A 4TVCA 2VD8A 3CHDA 2A5HA 3PSWA 4IPNB 4YCPA 3ARWA 1V79A 3QC3A 4ZFMA 3OIHA 1ZAJA 1GKQA 2PU0A 2Z27A 3NYZA 5CBJA 5JIPA 4RZ6A 3WLSA 1ICPA 3MJMA 5DO8A 4B9ZA 4TVDA 1XD1A 1TPFA 4JFTA 4AD1A 5CEWA 4DYJA 2VNCA 3MI2A 2X1IA 5B7YA 4AYSA 2D20A 1UBPC 3L21A 3LLDA 2VEIA 3UCQA 3LXBA 3TNOA 1EKOA 3VNIA 2P53A 1V6XA 4S3GA 5F7UA 1VC4A 3QMTA 3M5VA 4S3FA 2XN0A 3NSMA 4GINA 1JPDX 2QCLA 3OJGA 2WVTA 1JDAA 3ARPA 2ZX7A 3N18A 2VQTA 4B91A 2ISDA 2NQ9A 4QDWA 1V02A 2G4FA 4NAFA 3GX9A 3URNA 1GJPA 4JFUA 3M5ZA 2PGWA 4AH7A 4ZFCA 2Y24A 5G4HC 5EFDA 5E6YA 5HR7A 3F5LA 2PURA 4O17A 4GQGA 1GJUA 1QRQA 1JZ5A 1TRIA 2J75A 2OX4A 1FHDA 5IBXA 2Z4GA 4QTGA 3EPOA 3N34A 2CETA 1U83A 3CJPA 4H8NA 4PCTA 3TFXA 4DX3A 3LCLA 3W7KA 5CKSA 2GOUA 1KBIA 1S1RA 2P3ZA 5F4WA 2DSUA 3QPYA 4EKJA 3T81A 3DFTA 3CS2A 1C8XA 1KRMA 3TDFA 1H5VA 3W27A 3EEGA 1SJDA 3WH7A 4BI5A 2P5NA 2XU2A 3CBWA 4RZ5A 3W2LA 1RSCA 1QI4A 3H2FA 2QPXA 3NXLA 2WQPA 1Z69A 1JFHA 1W3LA 4P8UA 3SW6A 1VFFA 2J7EA 3FDGA 3BGGA 4NXKA 2JKAA 2C14A 1MUMA 3W1NA 4XSLA 1E73M 1ALDA 2PB1A 2WBKA 2NXHA 2PGRA 4YVVA 3SCUA 2E6FA 3LPFA 1IXPA 1O12A 3N1AA 3EA1A 2QCCA 5D30A 3FLUA 3G0XA 4LBSA 2ZA2A 3LI1A 1AUSL 2OT0A 3SUTA 4IG2A 4GO9A 5A6MA 3V5OA 1GOIA 2XFRA 2Q01A 4DJDA 5FF3A 1F6YA 5D03A 4F0HA 1F3EA 1S2CA 2HVMA 4N4PA 3B9EA 3H2NA 1RQBA 1XBXA 1I2NA 4AC7C 5GVJA 4CCCA 1U5JA 4Q3MA 1JDCA 2ATSA 3ARXA 3GTNA 3KVKA 4DZHA 3CM4A 1FWJC 3DG3A 1OF8A 5B80A 5FESA 3ABSA 2Q8ZA 4M3PA 1AW5A 5M17A 4CD5A 1UIOA 1F3XA 1F6PA 4GWEA 3A3WA 5BZAA 3TTQA 5BXSA 2BXVA 1FDJA 3H70A 4DXVA 2X09A 4DF0A 2FJKA 2QJIA 1HW6A 2ZUMA 2JKEA 3DX5A 5G1YA 2QR6A 1N8FA 3ZR5A 4UFMA 2QCGA 3G1AA 4Y8FA 4AZCB 3S1UA 3LHTA 2YB1A 4WUIA 3UR7A 3W1LA 1I2OA 3PBGA 2VHLA 5AZ0A 5EKYA 4JHMA 2Z6IA 4XZMX 2EG7A 4JGDA 3B8WA 4CCZA 3ME3A 3F2BA 5CXPA 1QNRA 4GUJA 3PZNA 3EXRA 1QHOA 1XIBA 4QDPA 4JIHA 3NL2A 1G7VA 4A8NA 4PRWA 3TCSA 3AO0A 2BHZA 1JZ7A 1PV8A 4JX4A 1FWDC 3U7VA 4B2DA 3RG6A 4RXGA 3KBWA 2YA0A 1PAMA 3LRKA 2IXVA 3PPHA 5FJIA 3BLOA 1YPXA 4C90A 1IWPA 4JR5A 3A4AA 4J40A 4GQBA 3VVGA 4LVDA 1HKMA 1OFEA 3S1WA 4M81A 1S2WA 4H6QA 2ZDRA 3CMGA 4JY8A 5H8UA 1UWAA 2GL5A 3ANYA 3SEPA 1Z9AA 1T8XA 1OG0A 3T0CA 3NEVA 2C8NA 4HMEA 1J9YA 1JGMA 2DV0A 2PDGA 3GHRA 4WDTA 3M0XA 1KBJA 4M6QA 3BMXA 4DN1A 3W1RA 2YL8A 3W0KA 3K1DA 5JBDA 4R53A 4YWSA 4S3AA 3RN6A 3WDPP 1OHLA 4AEOA 4HMCA 3CUZA 4Q8UA 2CBJA 3CTLA 3E96A 3O07A 5FD0A 3O6AA 4U4MA 4U5IA 3M6DA 4HHPA 5CZSA 1VFTA 2FQIA 3SCTA 1ZB5A 4XKYA 4L56A 1UZHA 4H9VA 3NCOA 3CO4A 1J8VA 1J0HA 3BANA 4YIWA 3SUVA 4U2YA 4GUHA 4CQ9A 1R9YA 4X2RA 2Y8UA 3CV1A 4TIMA 3TLQA 3VIFA 2A3CA 3VDCA 1JRCA 3HIJA 3ATYA 3HOJA 1F5ZA 3U2OA 5AC8A 3CHVA 4WJXA 4PSPA 3U5YA 2UWFA 4PMOA 4GI6A 4DXKA 5H8MA 3NIYA 2GDQA 4J9JA 1EPXA 1CT5A 5FJUA 1JCYA 3AIWA 1M65A 1LUCB 3IK4A 3FA3A 2OCZA 1W1VA 5KZ6A 3THCA 3CUHA 2G3NA 1DQWA 4O1DA 3WSUA 4J2MA 5KINA 1UKQA 5FEXA 3UD6A 4W7UA 4NASA 1D3GA 4NNAA 1SJBA 4M29A 3D6NA 3DFPA 3ARQA 2ISFA 1LLWA 5K7JA 4HNNA 3MUAA 4G2DA 4IP7A 5BW6A 3HG5A 1GOQA 3KBJA 1TTIA 2QVNA 4QCEA 5C9UA 2TMDA 5DRIA 4S39A 3W82A 4DJDD 3BMVA 2WAGA 5FSDC 3U57A 2GGIA 3M6YA 2OEMA 2HDJA 2V6AA 1FKWA 2XPKA 3HGJA 4GO8A 1FWCC 1EOKA 4O18A 1GNXA 1GPWA 4L9YA 2PLKA 2CLOA 4OOUA 2QAFA 4NSBA 4ZVJA 2IS7A 1FXPA 1QWGA 3TMQA 5CC3A 1E1FA 4DM2A 4R3UA 4MWAC 2VENA 1VD6A 3VIPA 4LJ3A 2FZ9A 5T8GA 3FCPA 4QSHA 3LV5A 1KM6A 1CGUA 3WD1A 3QXBA 3KP0A 4B4FA 1QXLA 2VEPA 3CHEA 3U2EA 3MYPA 1PSCA 4ZO6A 1SW3A 3H2CA 4XTDA 3PPFA 4US5D 2F61A 3GKFA 1A50A 2PD9A 3TVAA 4P7OA 1TV7A 1W1YA 1JF6A 3NQBA 2AL1A 3IUIA 3M1ZA 3SCQA 2XIJA 4DJEA 2J13A 1CCWB 5F4SA 2FTWA 4B5SA 1OGBA 2PMQA 1KM5A 5I03A 1A49A 4JD4A 4PRRA 1V3HA 1HUVA 1S3TC 2PPGA 4EF9A 5F2MA 1UWRA 4JQAA 3W28A 1OFAA 4J35A 3ELFA 2D3LA 2WNNA 3G1YA 2OQLA 1ZENA 4J5NA 4FXRA 4AZIA 4PUWA 5CAKA 5EMKA 4IIFA 1CGXA 4NI3A 4AQLA 3I7QA 3FYOA 1T7LA 1GKRA 4JN8A 4GXWA 1XFBA 4G9PA 1XRFA 5KEZA 3GG8A 3T2PA 1YNPA 1K8CA 3WNLA 2ACRA 1E6NA 1NY1A 1XYCA 2G96A 4KEUA 1C91A 3UZ5A 1KRAC 3WFZA 2VX5A 1S5TA 4GX8A 1S5VA 2FTPA 3R2GA 2CXGA 3PTMA 4OBRA 2WHLA 3TX9A 1BYDA 1UUQA 4KEZA 1J96A 4ZEPA 2R1NA 2QW5A 1GK8A 3N6JA 2DSKA 4ORMA 3NJ3A 1CBGA 1Y5VA 2FZMA 3KHDA 2PWEA 1FBAA 2BY1A 3SCSA 1TMLA 3BLLA 4GUFA 4NJJA 3BCFA 3MUXA 3LGGA 4LY8A 3VMOA 1CDGA 1ZAHA 3E12A 2OELA 4HPXA 1IEWA 1JZ8A 2NWRA 2Z2AA 2WLYA 3N6HA 2RDXA 3S2NA 4ZQCA 3I6TA 5F2LA 2DVTA 3EWWA 3CQJA 5REQA 3GYCA 1HL2A 4QAIA 4NJKA 3WF3A 3M4HA 3B0VC 4RUBA 4KPLA 4LC6A 3TTOA 2GGJA 2BTMA 4QBXA 2CBIA 4LWWA 3GBDA 2Y5EA 2DT2A 3WNNA 1S3HA 1E4MM 1FWRA 2ZQ0A 4PL1A 3W26A 1EZ2A 2F2HA 3ZJ8A 4RPPA 2YDQA 3WNOA 4F3HA 3ONBA 1ECQA 2ZZ3A 1V5XA 3O3RA 1AD1A 2J78A 4GUGA 3ID7A 1YNYA 3OLGA 5L6UA 1XQLA 1T5AA 3UR5A 4BI6A 1DIOA 2NQLA 5JH2A 3SCOA 2ZC8A 2ZX5A 1LWJA 2HMCA 4S38A 2CLEA 3OB8A 3USZA 2D23A 4GUIA 1GZ1A 5HMEA 1FDYA 2HNHA 2PFHA 4O8RA 1JPIA 3IGUA 3N2CA 4XZ9A 5F1VA 2QJJA 3DI1A 4Q8OA 3QGAC 1XS2A 1TV2A 1GUVA 3LNPA 2BY3A 2VFDA 1HJVA 1H1ZA 2PDJA 4IT1A 2HTMA 1MSSA 4WHBA 5I24A 2D22A 3OBAA 3TYCA 3VIKA 4BJHA 4H3DA 3LENA 1AFSA 1AJ2A 5M03A 1QPKA 3MB9A 1HX0A 5A6AA 4QJ3B 2ZX8A 1V0NA 4K8HA 3W7CA 1EJVC 3PZMA 1NDVA 2YA2A 1TWIA 4F48A 3IGHX 2DUZA 4G5DA 3TA6A 5A8MA 3VM5A 1W5OA 4GYFA 3EEZA 1WAWA 3RCNA 3L4XA 4BQ3A 1OX5A 5E0KA 5AHLA 4RE0A 2BMBA 4KRTA 2Q3RA 1GTEA 2REQB 3GDBA 4JQ1A 1KM1A 2PP1A 4UFJA 1IWBA 3KBMA 3BE7A 2NQJA 4FI4A 4R7JA 1A3XA 4JOMA 3TE9A 1F8IA 1LWHA 3LCGA 2FJUB 3W7MA 2ZE3A 5EA9A 4RE3A 3GE7A 3V7PA 3FFSA 2JEPA 1E6XM 1PDZA 4OJYA 3KVJA 2PAJA 3WF0A 1HZYA 3CT2A 1HJXA 2A3EA 4MSSA 5AC6A 5GNYA 1IXQA 4IUOA 2GUBA 1PPIA 3QW4B 1BRLB 2E9BA 2ZZ6A 1OZMA 5DCEA 3SUSA 4B5VA 2AAMA 5DY2A 4D6GA 4F66A 2WSPA 3ARYA 2ICSA 5ABTA 5I00A 1A5SA 3JZEA 3PN8A 4Y90A 4FP1A 3ANVA 1G4SA 3W1XA 2NUYA 3FN9A 4LT9A 1XICA 3BAWA 3O6CA 3RGTA 3P84A 5AECA 4UZSA 2GWGA 4EF8A 1A5AA 5A6JA 4HK6A 4Z2JA 4O52A 1EEXA 2CXEA 2GYIA 4FF5A 1E6PA 1A47A 5C7HA 1CZ1A 4H7ZA 3W2KA 4NU7A 2HE8A 2E9LA 1OINA 1MQQA 1XPYA 4REQA 4A22A 1KFWA 1Q2RA 4L4MA 3TSMA 4AYGA 2YBTA 4PTMA 1R3SA 2XINA 3ZIZA 4C6CA 3BVJA 4JIEA 3DEQA 1YLVA 3IARA 5K2ZA 4MM1A 3V1PA 2ZZ1A 3GHSA 4MWAD 2VEFA 2WZIA 5K9CA 3FAXA 5RUBA 3WENA 2QCFA 3LPPA 1GOWA 3DG7A 1W1B1 1P0BA 3CEPA 4C6KA 4EVZA 1XRTA 3T09A 2QUUA 4GLEA 4XWUA 1ZP4A 4IXXA 2NWSA 1VPYA 3W81A 4M24A 4ENLA 2Y6ZA 3HMJG 3B0UX 3URQA 3VZYA 1TPEA 3G1RA 2XIIA 3RITA 3TMLA 2Y7DA 3UG8A 2ON3A 3GWQA 4G8TA 4PB4A 2VRJA 2P0IA 3E3HA 3BV4A 3MSRA 4CD6A 1YTDA 3KRZA 1O5RA 2ZIDA 1KWKA 3UZZA 2WVVB 4MG4A 4OTKA 5HPOA 3WQPA 3CZJA 4DBSA 1R6WA 1O6IA 4JKMA 2Q71A 3ECQA 2KX9A 4D6EA 1H3GA 3UFYA 1BLIA 4JNYA 2AMGA 1IT0A 4G56A 4JIRA 2ZA1A 4IL2A 4GQRA 4O1CA 3WL1A 2BWGA 4WY0B 1LQ0A 2H9AA 3LN3A 3E2SA 4XIAA 3VABA 3VNJA 2VGFA 4WY0F 4J3WA 4GVGA 4TO8A 2I7GA 2WSYA 2DQWA 1LL4A 1NH6A 4UFHA 5KZDA 1V4YA 2EHHA 3P93A 2DZTA 4PC8A 3VNMA 5FSEC 4HTBA 3W76A 3PAOA 5FJOA 4H8VA 4C91A 2QF7A 1H51A 2J47A 3NQGA 2A3BA 2OLAA 2PS2A 4JPGA 2PRHA 1WKFA 4GX9A 1PZ2A 2WVSA 1IQ8A 4AZGA 2PSNA 2D0FA 1K1DA 1TSIA 1S39A 3USBA 4GQ0A 3KXQA 2ZRUA 2O7SA 4QLJA 1XYMA 4FEZA 2F9RA 3IRSA 4ADUA 3C52A 1W6TA 2J62A 4NZCA 2O55A 1XLEA 1X39A 4XAGA 1QDSA 3W7GA 4HOZA 1RH9A 2VZUA 3WLHA 1W5NA 4X0NA 3C2YA 1DPMA 3MCOA 4YTQA 4MTVA 4AIUA 1QNOA 1GOOA 3G6MA 3TN4A 1R87A 3ZWSA 4IOTA 4WEVX 2RH9A 1UYQA 1X38A 1Q4WA 1A4LA 3D5HA 5IM51 1MRQA 3GFXA 4EOUA 1AA1B 1JAEA 4U5KA 5KZEA 2VZSA 3EMZA 3I4KA 3SJNA 4G1KA 3R5EA 2PUZA 3GDTA 4GXMA 1XIGA 3WD4A 4XUGA 3UWUA 2PRLA 1UKTA 2WMGA 3CHFA 4WRHA 1DKWA 3W02A 4WDWA 1J2BA 1YXYA 1RP8A 3FJ4A 4W89A 1MO0A 1VBGA 2WZTA 3MJYA 1SZNA 4F0KA 1MQPA 1UWTA 7CGTA 8A3HA 4GYJA 4W87A 2WZHA 1RCQA 1UZ4A 1LT8A 2E77A 3WCZA 4C6LA 2F7FA 1E72M 3MUIA 3VGFA 3WN6A 2W5FA 3E0WA 3DHPA 4ZQRA 3B9NA 3CHCA 3T6CA 3JW7A 4P7LA 4QXIA 2AL2B 3NEHA 5FEPA 3OZOA 3M0YA 3L23A 3SIMA 2PC8A 3R8RA 2ZUNA 3N4EA 1A80A 3OYXA 2P3EA 4W88A 4GIEA 4Q4KA 3IJIA 4KWSA 4LEQA 3N9SA 6ALDA 1KC7A 3DERA 2ABAA 4YPJA 3WD0A 1H62A 4TV6A 4AB4A 1E0UA 4GPNA 3SCNA 2FVMA 1DXFA 2VFIA 3AALA 3ITOA 3HQPA 1RBAA 4HPNA 3R0KA 4MY8A 3UNDA 4PCPA 3BG3A 1VFSA 1YPIA 2VX7A 3MT1A 5FIPA 3WQWA 1VZWA 4X3ZA 3MY9A 3APTA 4I5RA 4LV4A 5TQLA 2E67A 1H1YA 3ABRA 5FL1A 3U2ZA 3NURA 4H6EA 1XSKA 1T99A 5DELA 1F07A 4AISA 1PTAA 3CZGA 3FOKA 2W79A 1PIFA 2OPJA 3F2DA 1K8XA 2RDWA 4M6VA 4XZBA 3ONCA 2XGBA 4E3TA 3WO8A 1ZJHA 3DYOA 3WMSA 3I6EA 4YLWA 3TC6A 1QPOA 1BWLA 1WKDA 1I0DA 2I56A 5GNZA 4C6EA 3TYDA 3V75A 3HURA 5H6HA 4ROQA 4ZSUA 3NUKA 5E9AA 1JCJA 3S9IA 4MPQA 3T7VA 4RE2A 4ICMA 3QF0A 1YBQB 1WX0A 3VUPA 1QUMA 2O9RA 1PS9A 2FFCA 3RK8A 1E0WA 1E3XA 3N2TA 4HK5A 4KCVA 1OFRA 4YTRA 3AISA 7ENLA 5BWFA 4RNHA 4NZJA 4F0LA 5LNWA 1W5QA 3VUSA 2Z1VA 2DZXA 2PDFA 1VLIA 4LQ1A 1XUUA 3W2NA 2VZOA 2P76A 2IUZA 3TKFA 1US3A 3KOYA 5ABGA 3K8LA 3VM7A 4UFKA 5FEZA 1W5MA 1K9DA 1DJXA 4GVIA 5LNSA 2QKFA 3NVDA 2G97A 5E1QA 3LGEA 4JDYA 4UCFA 2X2YA 5G4EA 4O11A 2R9RA 3A3XA 2CLLA 1SW7A 5C8BB 3KWSA 4ASTA 5I78A 3C2FA 1K77A 1BYBA 1F61A 5J5DA 3WQEA 4LAMA 3ZM8A 5T26A 3ZR6A 3GTFA 5D2VA 3TAOA 3NPWA 2VWSA 2X1TA 3FXGA 1KV5A 1MVYA 4EXBA 2W0UA 4GJIA 4NJIA 3RCMA 3GNNA 5KSWA 2B0MA 3SSJA 4ERAA 4PB5A 4ZB0A 1S2TA 3NO3A 3STEA 4KS0A 1LUCA 3BLKA 3OZYA 3IJDA 4LBRA 5CPOA 1OK6A 2HVNA 4KGJA 4UQEA 4Q32A 2O9OA 5T9BG 3VIIA 2FMNA 2ACUA 4KWVA 4FK9A 3WF2A 3WUFA 3GDLA 2ALDA 3PTDA 4MJ2A 1LLOA 4WCJA 1W1ZA 1XLLA 1E4IA 1ADSA 4EP8C 3RXZA 3KEHA 4AVFA 3H8AA 2W6RA 1SU5A 4IHCA 5LGXA 3H24A 3C3UA 3ARRA 3PS7A 3M46A 3G3MA 2B7PA 3IS4A 1OVDA 3ATZA 1XDLA 2FZ8A 3JU2A 3ZS4A 1TB3A 1XLDA 2G0WA 1NOFA 1Z42A 5CPNA 1V8EA 3EGJA 4HSHA 1IYXA 3EBVA 4M1RA 5FJTA 1RQEA 2WHJA 3KE0A 3LCHA 3FYYA 4O1AA 2DP3A 1GVSA 4KWUA 1ADOA 3CIWA 1JULA 3WFAA 7ODCA 4W7VA 1XC4A 1V7AA 4GMEA 2Z25A 3AROA 5HANA 3DI0A 4GGHA 4L1XA 5CPMA 2NV9A 3QRHA 3RO8A 4D72A 4MZYA 3BARA 4CQCA 1Q85A 4RPQA 2OWCA 1HFBA 4MUZA 4K8GA 1TIWA 4EPKA 3QPZA 4ZTYA 4B3KA 3FW6A 3OBEA 3BW2A 4Y9AA 3RX3A 1VIWA 1DJIA 3FS2A 3U9IA 5AVHA 1H7WA 2ZXAA 4QE1A 4UTJA 4LW7A 3QZ6A 3QKEA 4ZB5A 5J04A 3K4WA 3T9PA 3BUVA 1B31A 1IE7C 4YU1A 2DQXA 3HA1A 3VCCA 4MUPA 2VOTA 4Q7NA 2JIWA 4LAKA 5ECVA 1C29A 2G37A 1LOQA 4DZIA 3C8NA 2C19A 3BOLA 2VZTA 4LCSA 5I07A 2PTXA 5FCZA 3CAWA 5EMMA 2B4GA 4LUSA 2V9DA 3MKCA 2FMOA 2DU2A 1M6JA 2A6NA 4GOAA 1C9DA 2ZC1A 1SJAA 3W7EA 2YBVA 4ML4A 2W62A 5LNUA 3FVMA 1KWGA 1KV8A 1WUFA 4GJJA 3NZRA 3PSVA 3UXAA 1JNEA 3AIUA 2QQ6A 4AZBA 4C6JA 4E5TA 1R3WA 3F4NA 1A0EA 5E9XA 2OEJA 1Y0EA 3NOYA 3AUJA 2PTWA 1U2YA 1M1BA 3O7UA 4AEEA 2V30A 4UR9A 5FI8A 2QUTA 3OGVA 4L64A 4A05A 2DEPA 2EPMX 3VDBA 1FFRA 3TR9A 2DZAA 2V3EA 3F4DA 5HNUA 2J9YA 4OQVA 5LXEA 3AI0A 3GVVA 2PTYA 1O1ZA 2QLYA 1Q6RA 2Z29A 4NY2A 2WCAA 1OCNA 3GNRA 3EWYA 4JX6A 1MZHA 4JIPA 4DUVA 2Y2WA 1DWFM 3EX3A 1XL9A 1A5LC 1DIDA 2H90A 3AQUA 4JTJA 3KOZA 3WKZA 1O5XA 8RUCA 3A23A 1KM2A 4GYPA 1POJA 1IEXA 1JL8A 4CU8A 2A3LA 1G67A 1BSIA 1ISXA 4HD5A 4ATLA 2I17A 3ERPA 1HL8A 5DMMA 4CQBA 2O92A 2NVAA 1VF8A 1T8QA 5A69A 3NNTA 1VCGA 2XM1A 1FWWA 1ODUA 2BX7A 1KXQA 2PWHA 2GOKA 1PDYA 4HNLA 3G1XA 4AXKA 1V7YA 1JJKA 1K03A 3PWIA 4LOCA 3PJTA 1ITXA 3LNMA 4D8ZA 3SUUA 2YYUA 2YFOA 1E71M 1KW1A 3N14A 4DXXA 1A5UA 2XWEA 4MNJA 1Q13A 4E8DA 1ITQA 4ERIA 2W63A 4H9MA 4UMAA 3G0UA 5D33A 4CD7A 4MVAA 4P7RA 3HPXA 5IFTA 4KWOA 4O4VA 3O16A 1CTNA 1JZ2A 1UP3A 4RLIA 3CO8A 4O0KA 4RV3A 1RVKA 4PBGA 1Q8AA 4O50A 5BROA 3BGJA 4C7GA 3MP3A 3W6LA 1B3WA 2A21A 3FIGA 1W9PA 4FLQA 4D1JA 3N29A 3GYEA 2A85A 3C0SA 5CSUA 2MUCA 1KR0A 4Y6GA 1ISYA 2DT3A 2FFIA 2VI0A 4NF7A 2VXNA 1XPGA 2BVDA 2DSZA 4RNJA 1A5BA 2PLCA 4XAPA 3ALGA 1UOZA 3ZSSA 4XV0A 1QW8A 3CQIA 2Q09A 3IGSA 3DKLA 3L67A 2EJAA 2W4XA 4PMDA 1TZZA 3OYZA 1SO5A 4FNPA 5LSMA 3NQDA 4ICCX 2HNEA 2VDHA 4FIRA 3CUJA 2RUSA 3CYVA 2KZHA 1Q65A 2V63A 4L9ZA 3QZAA 5CGMA 4S1FA 4HMNA 3IIVA 2PBGA 4NP7A 3RRAA 1PKYA 3LRLA 1HT6A 4HU4A 1UPMB 4D6JA 3L5LA 5FF4A 3T55A 1SO6A 3QQWA 2BSLA 3S2LA 4FNSA 1MQRA 3TOPA 4KCUA 4NYYA 2DVXA 3WG6A 2P8CA 2J27A 3CZKA 2R1LA 3MO4A 3W7JA 4OUIA 3QR1A 3EB2A 4B3LA 2FGLA 1LL7A 1EJSC 2O7QA 1UR4A 2DH3A 1BRLA 4PMVA 3WBEA 1CEOA 5DY3A 3T0DA 4H2CA 4R34A 4U3AA 4FNTA 3PG8A 1KCKA 3MWCA 1E43A 4GRSA 2G8ZA 3U6WA 4QHRA 3T8LA 4I5XA 2E40A 1UROA 4WOQA 1NWSA 1BGGA 4IUGA 4J4KA 3S5YA 2WYSA 2QULA 2EG8A 1JF5A 1IEIA 1K9TA 1IHIA 1CW2A 2X1UA 5IDZA 4IIDA 2J24A 3N9KA 2WC7A 3MUCA 2J7HA 3LA4A 5AHIA 1BYCA 3PUEA 1VH7A 4HA0A 3IAPA 2Y7FA 3GDRA 3NZ1A 1FFQA 2UY5A 1QI2A 1NJJA 1AL7A 4MLJA 3EDDA 3OVRA 4LYKA 3QFWA 8XIMA 1M68A 1BKSA 4LRSA 5LIYX 2CBUA 1FP9A 1GOXA 2Y70A 4ZR8A 2Y1HA 1REQA 1N8IA 2TAAA 2QUVA 4J28A 3SR7A 1XISA 3F4VA 2ZZ2A 3C0LA 2W27A 4HN8A 3AZRA 2GVLA 3TC7A 4EPBC 4L6HA 1VGAA 2IQ0A 4IP5A 4PULA 2NT0A 1H7NA 2VR2A 4WKFA 5C0QA 4N4QA 3EKGA 4B90A 1GQKA 3THUA 3CGTA 1R9ZA 2PEVA 2Y89A 3MHFA 1TUXA 2YGYA 4C6IA 1ZFJA 3FYPA 5E0FA 3UWYA 1YXCA 4NZ4A 4NVTA 2HE5A 3WNKA 4LVBA 1V0KA 1QI0A 1EJ7L 3E2VA 3G1VA 4RKAA 2WJDA 1JZ6A 3UPWA 3DH7A 4PB3A 4BWLC 5F2GA 3WEOA 1C8VA 2FVLA 5I02A 4ZTXA 1VEOA 4M0XA 4QS5A 3V4BA 2INZA 3CQKA 1Y5WA 2QVHA 3RNDA 3OGSA 5LA0A 2RHGA 3VX0A 1M53A 2VX6A 1QT1A 3B4YA 1QOXA 2WVVA 5CLWA 1W1IE 1RALA 3OVGA 1KTNA 4FSAA 3OBKA 1NWUA 3C8FA 4Y2WA 4G7EB 2P10A 1X6LA 3AWOA 3G8RA 3C0QA 1R2TA 1RPKA 3K4DA 3UQNA 2FB2A 3I3BA 4AIEA 4WSHA 4FB7A 5FL0A 4TOQA 4FXSA 1JCTA 3KDOA 4JBRA 3K30A 3LX9A 4AEFA 3VA8A 3AMKA 3W7IA 3UYIA 3NPUA 2J6XA 3QV8A 2W91A 4BQ5A 4S23A 3W72A 3DKJA 3AFBA 4IQJA 1B3ZA 3A6OA 4JTUA 4V15A 1TPWA 1FOBA 4O28A 4PL2A 2QCMA 4UTMA 2X05A 4A35A 3PANA 2A2IA 2BVTA 2ISWA 3OA5A 3JVAA 2CIPA 1I1WA 4UIOA 5G2IA 1L6GA 1LTDA 1ECEA 4CGTA 4RL3A 3KFTA 4IM4A 5M1TA 4N42A 4K6AA 3DFYA 3L12A 3QTGA 5TF0A 3MMWA 3RLGA 2IKIA 5AVNA 2CFFA 2ZTJA 4NRRA 2ZCGA 1R3YA 4IPPA 4FZIA 2PGEA 1MNZA 1UZ1A 1NOWA 1IR1A 4E2BA 3W7PA 3CB8A 1UR8A 3VFLA 5TAOA 3B8VA 3B8SA 4NZFA 3PB0A 2QV5A 3AS1A 3MMUA 4NILA 3T0AA 3WMLA 1VBJA 3K46A 3DGRA 2PDLA 4C6PA 3ANUA 3T0BA 4ZE4A 3GW3A 1G4PA 2C71A 1GG1A 2CC0A 3GZ3A 3EB4A 1PE1A 1UA3A 1U1HA 1WCGA 4Z2IA 1I4NA 1N55A 4V1XA 4QJ1A 4CEXC 2WOQA 1DWHM 3B8IA 4AMAA 3HN3A 3R10A 2QGHA 2BLEA 4AWSA 5BXTA 2I5QA 4GBDA 4E8GA 3EDJA 1WNOA 2EKCA 4PEKA 3SM0A 2POTA 4LX4A 4KIEA 1XRSA 3POHA 7XIMA 3KBNA 2DW7A 2EPNA 1DQUA 1YW1A 4WIWA 2GQ3A 3PPCA 4C6FA 1UMLA 2D2OA 4LF2A 2CITA 3F1QA 1XLHA 1JDDA 2VGBA 8TIMA 3W1AA 2OOFA 3EA2A 4N6FA 4D6DA 1QNQA 2E0PA 4OWGA 4I5UA 3WQ5A 3EMCA 4GI4A 3GNDA 4NHVA 3LPGA 2VR5A 3W1TA 1EB3A 4QFUA 1E9ZB 1UH4A 4NKCA 2OLHA 4H7VA 3C56A 4UR7A 1JFXA 4PTNA 4EX4A 4P7NA 4AD2A 1NP0A 3RJXA 3NDYA 3S47A 1D8CA 1KRBC 1H5YA 2NLYA 4QJ5B 2B81A 3A4XA 3CPGA 1PTGA 2VVSA 2BOGX 2YCEA 3WQ6A 4BY3A 4KFNA 1F7BA 1ZL1A 4B92A 1JD9A 5C2CA 4UTTC 4GHRA 3M44A 3TYUA 1TPDA 4UTFA 1N82A 3WK3A 2Q6ZA 2WC4A 4UMCA 2RGMA 1DV7A 1ONEA 2XFWA 1CI1A 3RU8X 5AHMA 2C7FA 5LKYA 4LVFA 3MA8A 3U4AA 1Z8AA 4E8CA 4WD0A 1W3NA 2Y0FA 2P8BA 1AODA 4UTIA 3QFEA 4I6KA 2AGKA 4Z1DA 2OEKA 3KP1A 1V3JA 4UTUA 2NXIA 1EF2A 1TX2A 5HNRA 5HULA 1PYFA 2DORA 2ZA3A 2ZADA 2QPUA 4Z0JA 4P61A 5D09A 3NQFA 2PF0A 5AHFA 3KRUA 3UJEA 3QPEA 4JTRA 1V77A 1YQ2A 4TR9A 1G9HA 3WLJA 2DZSA 3NGJA 3PTQA 1LWIA 3DC0A 2OMAA 4PA8A 3L65A 1JPMA 1GKPA 5DCBA 3CT7A 5AYIA 1G01A 3DESA 1OT2A 3P7YA 4PMRA 1K6WA 4ES4A 4S3EA 4MF4A 3VOFA 3UETA 1HNYA 1F73A 3PUDA 1XKYA 5A5WA 1YBQA 2ZZ7A 3B4UA 1F8MA 1US2A 3EPNA 2V3FA 1WOBA 4Q8PA 1P1MA 5JBEA 2OX1A 4LBUA 2C0AA 2WZEA 1UMYA 1CYGA 1FCVA 1EF3A 2A7PA 2C3ZA 5XIMA 1MFUA 3MKKA 4AG0A 2I9UA 3LGDA 1J5SA 2XVGA 2UY2A 2WMKA 2V3GA 2LLEA 1ZY9A 1T40A 3Q45A 3P8JA 4JIIX 4H01A 4IGSA 3URBA 1GOMA 3V3WA 1W8SA 1I2RA 3ARVA 5G4WA 4D9PA 2NVDA 4XVDA 1F9CA 2VGGA 1EFZA 1QPQA 4H83A 1W56A 4PUNA 3WK1A 2V81A 2D0GA 2E8YA 3BL3A 1OSEA 3TJIA 1R30A 3DU0A 3D3AA 3CLWA 2C91A 3NO5A 3EWBX 4CEUC 1V3IA 1OADA 1AZ1A 2DUXA 4H9UA 4I7UA 2AOSA 3WLRA 3N3MA 1DBTA 4E2OA 1UG6A 3L7RA 3R13A 2NV1A 1K6AA 1JYWA 3O05A 1X7FA 2PDHA 2PDQA 3QW3A 3LXAA 3ZXWA 3ZWTA 4CD4A 1XXXA 2OZTA 3BGAA 1CXIA 4H04A 3ZVHB 5KMYA 1B1YA 2OJPA 3K8MA 3UR2A 4AVNA 2O0TA 4ZGYA 2O56A 1ZCOA 1QNSA 1B3OA 4YVXA 1NIUA 4MNLA 3PB2A 1XIHA 3OQ8A 3VKBA 1S5MA 3IEBA 3UG5A 3B05A 1E9YB 4YNGA 3KL5A 1RPXA 3WLKX 1LJYA 1H7XA 1ZS2A 1C93A 3HTWA 4OVXA 3UNTA 5I3IA 1E4LA 2C15A 5LNVA 2EPHA 3CV7A 5H91A 4MOZA 1VFHA 1FY6A 1ZALA 3TN5A 1E15A 1ZP3A 4MAVA 1BXCA 1OF6A 5E93A 3BW4A 2WM0A 4W4QA 4HCHA 3W6MA 2JEQA 1W91A 4PSRA 4AD5A 4RNIA 4E4PA 1UQYA 4J3SA 5HATA 1GYNA 2CHOA 2VOMA 3ZT7A 1LZOA 2WMIB 1AMYA 4PODA 4BEQA 2FHFA 1WDPA 4Q8MA 2R91A 2PCEA 1YMYA 2CEQA 4CNSA 1CGVA 3DHUA 1NTHA 1OFPA 3APGA 2YBUA 4TX8A 5BU6A 4E4UA 3PULA 1MXGA 4ZBCA 4FAMA 4JIQA 2XH7A 1NVMA 3SN4A 3P81A 2H3DA 1RJQA 2ZXBA 4HHHA 3P3BA 3WIJA 4GIAA 2YZRA 1H0IA 1XGEA 2ASHA 5GQBA 3WQGA 2F6UA 3N11A 5I6SA 1ZJIA 4LAOA 6TAAA 4JTCA 4CNNA 3NFUA 3I68A 2CWXA 2R1MA 2ZXDA 4GK8A 1YDVA 2Y88A 1EO5A 2H3BA 4Z42C 5HMFA 5EU9A 2XVNA 1P0DA 3ES7A 4DM1A 1OFQA 3FGCB 3SB0A 4X63A 3W7RA 3TR2A 2IQTA 4W85A 2PDUA 4O1FA 2WKLA 1Z89A 3VKAA 3AHVA 4QNEA 4H41A 2ZBTA 4Z1BA 2PI6A 4CN4A 1LP6A 5JBFA 2I57A 4I7WA 4MKSA 1R85A 4PRTA 1M9HA 2FTYA 4R27A 4W84A 4ZENA 1OC5A 3FV9A 2ZX9A 4PFHA 3W2MA 5D04C 1NFGA 3BLDA 1XLIA 5GJNA 1DJGA 3GS6A 3W7DA 3GAYA 4A4AA 2OGYA 2VCAA 1FH8A 4DJFC 2Z26A 1OT1A 5TBOA 3LHYA 5HWJA 1YX1A 2G50A 2WV8A 1ITCA 4HCLA 2WJZA 2GJLA 1VJIA 1PX3A 4GFSA 2Y61A 5CCZA 1O94A 1TPUA 3IANA 4IX0A 1NWTA 1TJ0A 2ZRWA 3TWAA 5FF0A 2Z00A 3AJXA 1N7KA 2J9ZA 3GXNA 3WMCA 5HR6A 4HNVA 1OX4B 1KO0A 1QU4A 2R1KA 2XIBA 1BTMA 3KUMA 2PZNA 1XCXA 1UKOA 2I9EA 2OYKA 2SFPA 2R8WA 2WBGA 4UWMA 4K68A 1S2UA 3LB0A 3RM4A 4NXSA 3WH9A 3UPBA 4QGCA 3HBLA 1VHCA 1X97A 3AMGA 1HO4A 2EKGA 4GY7A 4IGNA 4LVGA 4E2DA 4OU1A 1L2QA 1K4HA 1NOUA 4L1GA 6A3HA 3ITVA 4AD3A 1QHPA 2OXNA 4PUKA 1PIGA 2WB5A 3B8DA 2XIOA 1F3TA 2IMRA 3Q37A 3VC6A 3TZNA 4LPCA 1U33A 2G3JA 1C90A 1PKLA 3VGHA 4HQVA 4YS1A 3UBPC 5CSSA 2GVYA 2NQZA 1E51A 4IIBA 4N7QA 2IPFA 3KCJA 3PY2A 2E6DA 1TCDA 4Q22A 1SQ7A 2RGLA 4I9MA 2H8ZA 1A5MC 3OTRA 2D69A 2NX1A 3NR0A 3AIEA 4LNCA 1VPQA 1S2VA 3R0UA 4GE8A 4DNMA 5EGRA 3H4GA 1F76A 3OIXA 4CQ8A 3PTKA 4XBJA 4JNMA 1GVEA 3EAUA 5JQ9A 1Q6GA 1BWVA 3IACA 2V8ZA 3GY1A 1Q63A 4Q8WA 3LV6A 5CC5A 3RPMA 3XISA 5CZJA 1GVYA 3L0GA 6XIAA 4XK2A 3TXVA 4PMXA 1ONWA 1TO3A 2EO7A 2E4TA 2RFGA 5BYWA 3G0SA 3LRMA 4GZ7A 4K38A 3S46A 3PHAA 3LU2A 4LS1A 4N9CA 4ZQPA 1KQYA 4DO5A 1VQTA 2PRMA 5JXQA 4XO6A 1CXKA 5DMYA 1TIMA 3WF4A 1E1CB 2PWDA 1B3XA 2D24A 2CLPA 2GSHA 3CK5A 4JS3A 1UUOA 3G1DA 1XQKA 3WELA 4QISA 1EWEA 2R94A 2ADAA 5A2CA 3UW6A 5LXXA 2QCDB 1QVBA 1TJ2A 1BAGA 2QXWA 4UTWA 2VCBA 1V6VA 3CTTA 2J74A 2J25A 3NQCA 3I7SA 1LRNA 1UD4A 1MUCA 3IUDA 1KQZA 1XC6A 4I8YA 5LHFA 4I7VA 3DECA 3SZ8A 4DAFA 1ME7A 1G4TA 2PDIA 2QJGA 4NZ1A 1EBHA 3CMFA 3L2MA 5I79A 3EX4A 2OZ8A 5H8PA 1XLFA 3P67A 3VOGA 1K8ZA 3N17A 3RUBL 1TA3A 2HPMA 3QMSA 1DTNA 1NFPA 3ZQ9A 1EC9A 1HL9A 5DX7A 1VFOA 3VE7A 3SCPA 1H0GA 5CAHA 1JDFA 2QPSA 1FX6A 3WLOA 2HROA 1RVGA 2OYMA 4DF2A 4FX8A 3H53A 2HXTA 3IVTA 3N25A 4ZOEA 3G6LA 1E40A 3REQA 3T4WA 3L0KA 1RJRA 4KWWA 1U1UA 3AS2A 4ZXOA 5HA7A 3TQVA 4Q8QA 1P1XA 3B3DA 3MZ2A 2GSJA 3TXZA 5HWNA 2P88A 1JDEA 3WQCA 2NLIA 1ONXA 2BY0A 2GK1B 1OCBA 3NQ2A 3BDKA 3TJXA 2GGGA 5EBUA 2CWNA 4UTKA 3UZWA 3WUGA 1FWHC 4M51A 4QS6A 4GJ1A 1TV3A 3IGXA 4JQ4A 4H6RA 2CHNA 5AN7A 3MUZ1 3EOSA 2X7WA 3MSDA 1CXLA 1QATA 4IFOA 3NM3A 2DFAA 1E55A 2OR2A 1OBAA 1JXKA 1DWJM 4FR6A 4H8UA 2GGEA 1TX0A 3WK0A 4F2BA 1TWDA 3BG5A 4Z17A 2Z1XA 4PTWA 4LAUA 3WYZA 1TJPA 3CAQA 3ZT6A 1SYTA 1Z3NA 1DE6A 4W93A 3VD5A 1EUNA 4N9BA 1RJPA 5FJJA 1EJUC 3CAVA 4DWSB 1AJ0A 4K7VA 3MHUA 1QASA 4O4WA 1UWUA 1ZAIA 1V6UA 2VGIA 2QDGA 3GLCA 1TVPA 4CU6A 2J8TA 4A21A 1MXSA 4GZJA 3NQVA 3LHZA 4O13A 3SRHA 2NSOA 3PM6A 4ZQNA 1NQKA 4JL2A 4Z0SA 3SFWA 2JK2A 1TRDA 5C6MA 1KGXA 1UJQA 1XYZA 3AWNA 1PWMA 3UZJA 3VIJA 3VGEA 4D2JA 3GC5A 3BC9A 2ZUUA 4HJFA 4K1WA 3W2UA 4ZSTA 3WF1A 1HKWA 5D9NA 3VDHA 3BCJA 4LRTA 4RCXA 4PEEA 4GIYA 5XIAA 3C4UA 5CZTA 1OC6A 1ADDA 3CUGA 1TR9A 3DDMA 3QLLA 1GTHA 5DBTA 3S5ZA 1M03A 1H09A 4DBUA 1X7IA 4PUUA 1F4HA 1NSJA 4PTVA 4IGMA 4YL2A 1MXDA 3UG4A 1FKXA 2YDSA 1XR2A 3O6DA 4WKAA 3CU2A 1UR1A 2WMFA 4L80A 4IIGA 4LCQA 3EWUA 1S1PA 2GVJA 1JZ4A 1XYBA 3AHXA 2DIJA 4JN6A 4WKHA 4NZ3A 5GPRA 3GW0A 3STPA 4AZHA 5D9OA 2QMKA 2QDHA 3DHFA 2VDGA 1VPXA 2NX3A 4WSKA 3WFLA 5LZLA 2OU4A 1U5VA 1JUBA 3MS8A 3WQDA 1IV8A 3OPSA 1H50A 2YL9A 1XI3A 4O14A 4WXYA 1UOKA 1ZBKA 1AH4A 3E2QA 3IWPA 2BBFA 3OODA 3E38A 3P82A 4US5A 1T96A 4DO7A 3LD5A 4IL0A 1I6NA 2XGIA 2AQOA 2FZNA 4ERGA 4RR4A 2PWUA 5D2YA 4NJGA 4OGZA 4A8LA 4B9YA 3INPA 4I8DA 4EXAA 3DYPA 1HVXA 2ZOXA 1XW8A 2TODA 3CH9A 2QGYA 3G1HA 1QK0A 3EWXA 2CLHA 1EHAA 1H7RA 5DBUA 3S1GA 3H6OA 5C71A 4BF9A 4QEHA 2A3HA 3KWXA 4FNRA 4HMDA 2QDEA 2R24A 1TFVA 3N3TA 4IG2B 1A5NC 2XVKA 1CPUA 4L65A 1V0MA 4M56A 1BVZA 2OODA 4R85A 4LGXA 3TYAA 5M5DA 5CC7A 3ZLHA 4R9XA 4A3RA 2VEKA 4BR1A 1ZRQA 4IMAA 1CXFA 5HPCA 4NX0A 4X9SA 3G3DA 5G2WA 1LQAA 2Y5JA 5C7VA 3QHOA 5TNVA 1W3IA 3L68A 2HVOA 2V5BA 4R88A 1C3FA 5KITA 1WA3A 3MUY1 1OWQA 3DC8A 3KDNA 1X1OA 1WYIA 3QQ0A 3CZEA 1V02E 3B40A 4N02A 4X22A 3RLUA 1EYEA 2GJNA 3NPXA 1LG2A 1MYRA 4HU0A 1WZAA 3HPAA 1R2SA 4HNOA 2XFYA 3VXGA 2YXOA 3P2VA 3ES8A 3B9OA 3CWOX 1R3VA 4UBPC 2ZRYA 5FEWA 3W7LA 1VEMA 1YRRA 2C1GA 4MDPA 3GC2A 1C9WA 3A12A 1EJTC 1H61A 4J3VA 4TV5A 4XG1A 4XX6A 4D8AA 2OSXA 3SDOA 7PTDA 2YCIX 3LQLA 4ILSA 4HZ8A 1YHTA 1I9CB 1EC8A 3WJWA 1MDLA 2P50A 3SCRA 4WF7A 4KF1A 1XBVA 1UR3M 3E6EA 3C2RA 2OSYA 2PTZA 2ZRXA 3G1FA 1A5KC 3H2AA 1J6PA 3HQ1A 4FXFA 1WB0A 4N9DA 4FIQA 5CJ5A 2BXZA 3AS3A 2EPKX 4JNZA 3O2LA 1HF6A 4Y96A 4IMEA 3M64A 4JFSA 1HP4A 1TJ1A 3QV9A 4C6DA 1LBFA 3H2MA 4XD6A 3RHGA 1DE5A 2VFFA 4M19A 3TEVA 4LS2A 4GYKA 5DFAA 1VBHA 1WXZA 1Y8BA 4UOJA 5D02A 1KFEA 2C1HA 4AHQA 4YWIA 4O54A 4WDUA 1FH7A 3FEQA 1Z6KA 4E0CA 3H21A 4IPIA 4Q4SA 3TQPA 1AQFA 1HGWA 3M0ZA 5CPSA 3V18A 1XUZA 1EGMA 3IRDA 1WDRA 1BGAA 4V27A 2J7BA 3MMTA 4AMCA 3M0JA 1MMFA 2A1YA 1XH0A 3FSTA 2X16A 4YYCA 3CMJA 4ZO9A 3WH6A 3QBUA 3BLIA 3SJ3A 4HU8A 1EP1A 2Y63A 4GD0A 4LVAA 1EDGA 3V35A 3PNUA 1UWQA 2XVPA 1XWYA 1NDZA 1Y5XA 4O19A 1HKIA 3E49A 1EJXC 1PEZA 4L9XA 3TUUA 4XSMA 2GZXA 1OEPA 3DFHA 1PWLA 2CNCA 4XUYA 4XKYB 1EBGA 3K8KA 3EYPA 4O10A 5IOBA 3AAMA 3DN5A 3WZ0E 1R5YA 3PC0A 1FH9A 4BF5A 2OGJA 1IEVA 3UGVA 3ZJKA 2NVCA 4CN1A 4ZQOA 4DO6A 3QGVA 1YPFA 2PLJA 4US6A 1P7TA 3B04A 3BXWA 3TQKA 2ZUSA 3PBUA 2PLMA 4IH3A 4CUCA 1J2WA 1PHWA 4A8IA 3A64A 3C86A 3TOYA 2Z1BA 3AMDA 4AAJA 4HTYA 1TYGA 4H9ZA 1KM4A 3QEZA 1JGIA 3RLVA 4I6VA 1GYMA 1WO2A 3RMJA 4WGXA 5BOEA 4NIRA 3O8AA 3M7SA 5KZMA 4WJEA 3W73A 5I3DA 2WO5A 1RD6A 4HK7A 2FPTA 4Q4QA 2B7QA 3T1GA 4O0QA 3RPTA 3W1UA 4HB7A 2WJFA 3QLDA 1FCUA 4V28A 1H49A 4QCFA 4I3GA 2PDMA 2VURA 1US0A 4BFAA 4BZYA 2CERA 3WJXA 3UESA 3B9DA 3DZ1A 1LYXA 1RR2A 3GR4A 2WQDA 3OLIA 1GWJA 4KESA 3RFAA 1UPPA 2BXYA 3GR7A 3BCDA 2HSAA 5CGQA 3WD3A 4LF1A 2PDXA 4JQ2A 1MI3A 1UP2A 1DJQA 3GH4A 1MW0A 3BOXA 1JI1A 3F4CA 2OWWA 4NX5A 3L4WA 3CL6A 4JCMA 4UUIA 3HGRA 1TQJA 1VS1A 2V5DA 4ZA0A 2FYMA 1P48A 1AW1A 2PDYA 4QEEA 3W6YA 3GVRA 1MW2A 4JTAA 1JI2A 3W29A 1SSGA 3L5AA 3RILA 3EZ4A 1OZQA 5D2WA 3W22A 2IXUA 2OYLA 4FA3A 3O15A 5BCAA 5CG0A 4MWAA 4KH2A 4NG3A 4IMDA 4DZ5A 2JE8A 4MJMA 4UNKA 3SQLA 2XGZA 3UCDA 4J27A 2VC5A 2B31A 2IKGA 5K4ZA 1S2AA 4ZZ9A 4IMCA 4ADTA 3TLLA 1TUFA 2NX9A 1QOPA 4EE9A 3G22A 1PHQA 5AB3A 3GNXA 2D3NA 1QMLA 3LYEA 4FNUA 3QGKC 3GIYA 3VGGA 2HBXA 3PZIA 1UHVA 2OTDA 1X6NA 4NZ5A 4AZ5A 3Q65A 2WHMA 3U4FA 2Z6JA 5HOSA 3VILA 1B30A 4KT2A 5I0DA 5LIUX 3KVMA 3RR4A 3KOXA 1R3QA 4ACYA 1UH3A 4M1BA 2JALA 1K7XA 3VIOA 9CGTA 1RZMA 4IPLA 1D7KA 4LUTA 1XJBA 3CZ8A 3DOPA 5AYXA 4CCEA 4XZIA 3H7VA 2RKXA 4YXGA 3SY1A 5M2FX 4MYXA 4IMFA 2J8FA 3UEQA 1IZJA 2FZBA 1ICSA 1EX5A 4W8LA 4CNUA 3WQ4A 1FP8A 3BV7A 4D6IA 2Z1SA 4XZHA 5G1MA 2ZICA 1J0JA 3UJFA 1B4EA 1QNPA 2A6LA 3S9ZA 3GB6A 1X6UA 2VO5A 3B0PA 1Q6CA 3WQFA 3DYMA 1KTBA 4OBSA 3GHTA 3AIRA 4U33A 2ZX6A 5IHSA 4FMVA 3GVWA 3E2RA 5FACA 3GXMA 5H1WA 1V6TA 4S3BA 3L2IA 4FHAA 1PCWA 3EDFA 4POCA 3UJSA 3NQ8A 1W5PA 4TQTA 3H7UA 3LSCA 1ISZA 5JUVA 3GH5A 3T40A 2CLFA 1VRDA 1HN1A 4CU7A 4YJ5A 2HRWA 2CBVA 3F03K 3W86A 4HA1A 4INFA 3GRIA 3C3NA 3R58A 3WMBA 1RCOB 1Z48A 3FA4A 3N12A 2MANA 4HA4A 4QLKA 3OVQA 5A6SA 4DB7A 2HISA 4Y9OA 1U30A 3EOEA 4I9AA 2RJGA 1OD0A 2ZWYA 1BQCA 1XIJA 3RIKA 4FLRA 4XISA 5EB8A 2PTDA 3U7BA 3P80A 5DXYA 4YN5A 3RPDA 1S5WA 1IXOA 4GBUA 3O63A 2EQDA 5D2TA 1KLZA 1TVNA 4DF1A 3NPVA 3LK6A 9XIAA 3F2CA 4HSNA 4RV8A 5AC5A 2OKOA 2X7VA 4XD3A 1JCMP 3QOMA 3TJLA 1AMKA 2CYGA 1HP5A 1OK4A 4HZ6A 2WMHA 4LTSA 1G4EA 3BURA 3TQ0A 4PMNA 1DWGM 4WR3A 1TWWA 2Y4SA 4IJCA 1VIZA 4KGLA 4GZIA 3GSMA 5MF5A 3GDMA 5HQMA 5GNXA 1E9LA 2ZUTA 1QNVA 4PBEA 1XF0A 4QIUA 4ATWA 2O4QA 5BOFA 1VKFA 2E6YA 5I7GA 2WSQA 6REQA 4IPJA 4EAYA 4BCEA 4H00A 3TYEA 3SY8A 3W25A 3DBNA 5FAGA 4Z2KA 3XINA 1DIKA 3V0TA 4Q7BA 1DHKA 4UZUA 5EMJA 3ITYA 4QX4A 4C1NA 1XDJA 4GNKB 5D9PA 1NARA 3ISIX 3BAXA 4N6EA 2XH2A 2BS9A 4UCGA 3BZGA 3G1SA 2PF8A 3T4CA 3DG6A 3HG4A 1NEYA 4G1NA 5A8NA 3RX2A 1V6WA 2DT0A 1E3ZA 1AL8A 1V93A 1Z44A 1ISWA 2GDUA 3VTRA 3VYLA 3IJLA 4AD0A 4MY9A 3TH6A 4E3VA 4AF0B 3W88A 3U2CA 4H2HA 3Q67A 3I10A 1K02A 3E02A 2ESCA 3OZPA 1FWFC 3ZSTA 4QJ4B 5DMLA 4X0VA 1YTEA 3QJAA 2QUNA 2YCLB 5AHNA 1Q6LA 1ZGDA 3WBXA 4QDMA 4CCDA 1ZPTA 3BAYA 1BF2A 3BPWA 3ALFA 4UXDA 1EQPA 3LY0A 2AKMA 1QOQA 3M43A 1MEHA 1E0XA 1WAUA 3E9AA 5BOOA 3T05A 3ZJ6A 1DWIM 1FCQA 1WDSA 1X96A 2W67A 3KLKA 3VD4A 3NZPA 3SIZA 3XIMA 4DWSC 2F8QA 1LCOA 3VC5A 3DFQA 3HU7A 1J18A 1XGZA 3RF9A 1O95A 2G3MA 3RRXA 3NSXA 4Q6JA 4KRZA 3TWBA 3LBCA 1OC7A 2PDPA 1W1A1 1QR7A 2CZEA 1A0CA 4HNCA 4M7TA 2X1RA 1BYAA 2GLKA 2GK1A 4ROPA 3QZEA 4C6NA 5AFDA 1OYBA 4DBEA 3S2JA 3M0KA 3W87A 3AIQA 1L2UA 3BJTA 5IXEA 2XHYA 1EOMA 3MZNA 1L6YA 2X0SA 4DEFA 1RBLA 4LV9A 3DFNA 4QQ3A 2EG6A 1H11A 3LS9A 1XBYA 3UVIA 5D32A 5LA2A 1JPKA 4DLFA 3R25A 2YSWA 1LQ2A 3RLHA 4W8AA 4DBDA 2PBOA 4GH1A 3GU2A 5I23A 4F9JA 1UIPA 4Q6XA 2CPUA 3SY5A 3W1PA 3AU6A 3CUXA 3MC5A 1CGWA 3JUGA 2XISA 2JKPA 3MMDA 2E5CA 1RV8A 1W9DM 3N9RA 4IQEA 5IBXC 1OGSA 4U3CA 4F2TA 3I65A 3IJ9A 3MP5A 4CNPA 5A6LA 4FLOA 1EGVA 1VHNA 1ME9A 2PODA 3GZAA 3LCIA 4XTIA 1OD8A 4ZQMA 3EX2A 1L8PA 3PK7A 1AZ2A 3GIPA 3H55A 4S3KA 4Q4OA 3LZ5A 5TIMA 3T42A 1CLKA 2WCSA 4JX5A 3GVQA 2DH2A 4B5TA 1KFLA 2H6RA 3PAJA 3W7OA 4F0RA 5I77A 5CH9A 1GONA 3GAKA 1GVQA 3BWWA 4TX9A 5JU6A 1GVOA 2YLAA 4OZOA 3WUEA 1M01A 3KRBA 3PBWA 1PXGA 1E0TA 3JRKA 4Z1YA 2PDKA 4XZNX 3W74A 2H9AB 1FHLA 1GQLA 1G0CA 2GGHA 4FR1A 1M04A 4XAYA 2CKSA 2A7NA 1SR9A 1WKEA 5ABFB 4QG9A 1S5NA 4LY4A 5U7SA 2GQAA 1U1JA 5LIWX 4YCOA 3CUFA 1BFNA 4NT0A 1DJYA 4C6QA 3FHQA 3T0TA 3U5UA 2OFJA 4DJDC 2VEGA 1QFEA 2UY3A 2HS6A 1JZ3A 3AS0A 3D0CA 3UP8A 3N6QA 3WLNA 5AOUA 3T44A 4R9OA 1CX9A 2QNEA 1V03A 1KBKA 1WE5A 1ENUA 4QROA 3T78A 4HNTA 3TIMA 1XFCA 3FX4A 1E6ZA 3W38A 4LNYA 1C7TA 4P8WA 3C0JA 3QR0A 1UC5A 1JQXA 4E38A 3KL3A 1XLBA 3TNBA 2VDIA 2YW4A 5J8LA 2PE4A 3VINA 2WJEA 4JTQA 5D2XA 3JS3A 5BXRA 2R6OA 3KOWA 4A2RA 1B9BA 5BU9A 3VI2A 3S42A 3PFMA 3KL0A 4U31A 4GGBA 3S6TA 4V33A 3IV3A 4UC5A 3QKZA 1VBUA 4R5EA 4X9YA 3VAVA 3QM3A 3RDKA 2ISVA 4CNOA 4LANA 1KCLA 3LSBA 4MAZA 3BOFA 2CLIA 1MRAA 2NZLA 4AZCA 1TMHA 4JYDA 4H7CA 4F0MA 2OOGA 2X30A 4MNKA 2I5GA 2DSVA 3DFSA 3WY1A 4GI8A 2YL6A 3WH5A 4HPHA 5BMXA 3ZMRA 1TV5A 3P14A 1UQZA 1C8YA 3HPZA 1NM9A 1SFLA 4R7WA 3KX6A 1DP0A 4PMZA 4NNBA 2X0HA 4AXNA 2O4MA 3CLMA 6XIMA 1J4EA 1VP5A 2MNRA 3ZLFA 3K13A 5CZKA 1MUWA 4DRSA 2JGYA 1O7AA 1B9ZA 2QZRA 3SRKA 3GG0A 3ZR4A 3AHYA 5BRPA 2Q3OA 1TE1A 2JFEX 1FWIC 1KBLA 3D3FA 1AQ0A 1FWNA 2Y7GA 2WNQA 1J0KA 1RD5A 4JHZA 3N2BA 2XVLA 1CXHA 4K3ZA 3WD2A 3WDQA 1EJRC 2ANUA 3MWAA 4FNQA 1KR1A 5EMUA 3LMZA 4QNWA 3J7HA 1EEPA 4X61A 1BHGA 3CNYA 2J8GA 3R4IA 1TCMA 5ECUA 1H4PA 1GHRA 3NSNA 2E09A 3AC0A 1Q6EA 2EBNA 4JTLA 1KXHA 2VKZG 4AU0A 4JTGA 3OG3A 4HIBA 1DJNA 2PCQA 1PBGA 4QE4A 3S2MA 4JTHA 4AY7A 4K1GA 1VFUA 3R12A 2ACSA 1PYMA 1EXPA 2NSXA 3EWCA 2FLIA 4A29A 4RDYA 2ONEA 1DWAM 1WDQA 1TE6A 4ZE5A 3E0VA 4HZMA 1M7OA 1WBJA 3G18A 1RK5A 3GDKA 4F79A 1VJZA 2QIIA 1UWIA 4PH6A 2AQWA 3WL0A 3N2OA 4HHMA 3SURA 5EBAA 1JUEA 4OHQA 5FKYA 3GC4A 3LEPA 1IF2A 2IQDA 4TMBA 2G4JA 4DWSD 1K8YA 1H7OA 4PUEA 4S3CA 1JNDA 4AIOA 4H9YA 2FHBA 4FX6M 4XB3A 2RDUA 3VD9A 4NYUA 1IGSA 4D1IA 2WPBA 2WMJA 4J1OA 4KFPA 1V3KA 3H7RA 1Q6OA 1SMAA 2NQHA 5HJXA 6CGTA 3EDKA 2X0YA 4GXPA 3ABZA 4JYEA 5J5RA 3S2CA 3LTPA 1HJQA 3STCA 3WDHA 4QQUA 3R1ZA 3SN0A 1HKKA 3NTYA 4B15A 3WUBA 1VFMA 3HO8A 3PZ9A 3GH7A 2JBMA 5FF7A 4U28A 4XQ6A 3PWGA 4U2ZA 3GVGA 3F5KA 1L6SA 4OUEA 1GOKA 1SMDA 6PTDA 4ML9A 1SZGA 1TREA 2VUNA 2YA1A 2D2GA 4O12A 2HZGA 4RX0A 3U8GA 1I2QA 3OU8A 4H9TA 1E1EA 3OG2A 1XGDA 1XBZA 3IVUA 2DZUA 4PMQA 1W37A 3H2OA 4HT3A 2BGNE 2YLLA 2BOEX 4EPEC 4TX6A 3QY7A 1EPVA 2ZXQA 1KXTA 4UTLA 2I16A 3P0XA 3FEMA 1NU5A 4YHEA 4S2CA 4PCNA 3PJUA 4PBFA 4HN4A 4E2VA 1ZJAA 1YDOA 3TROA 1P6CA 1PL9A 1W8GA 1VR6A 4PCFA 4C5ZA 2J88A 3AHTA 4S3JA 3A5VA 5EPDA 3FJLA 2IPWA 2BHYA 2NT1A 3BK0A 3I3DA 5MHBA 1BVNP 1O5KA 4QAWA 4Y9MA 1GGOA 1XG4A 4JTTA 3OQEA 1VJSA 3WBWA 3P61A 4B16A 4DJEC 4DQWA 3TTYA 4U10A 3LM7A 3R7MA 1H41A 1KKRA 1LLZA 3KW3A 3WLMA 5D9MA 1H63A 4MB3A 1ZJBA 3EDEA 1W17A 4GQQA 4QG6A 3UZYA 2HS8A 4MZ1A 2CZFA 4CKQA 2J66A 3NQEA 3GR8A 3S5NA 3THQA 2AQVA 5A6BA 1V6YA 3SRDA 2OQYA 3C2VA 1QHZA 1W9VA 5DT7A 3HJEA 3FDKA 3TFCA 3GFZA 4KMQA 4FOKA 4O53A 3SUWA 3HG3A 3UGRA 1Y65A 3W7QA 4DWDA 2NUXA 3VNLA 4KIRA 3BZJA 2PU1A 3APYA 1W3JA 3VIHA 3AXIA 1V3MA 2C18A 4YVPA 3UY7A 3F5JA 4LYRA 3VDGA 3EOLA 3A21A 3UG3A 5LNRA