4WGHA

Crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with nadp and acetate at 1.8 a resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
283
structure length
283
Chain Sequence
VKKTVRFGEQAAVPAIGLGTWYMGEHAAQRQQEVAALRAGIDHGLTVIDTAEMYADGGAEEVVGQAIRGLRDRVVLVSKVYPWHAGKAAMHRACENSLRRLQTDYLDMYLLHWRGDIPLQETVEAMEKLVAEGKIRRWGVSNLDTEDMQALWRTADGEHCATNQVLYHLASRGIEYDLLPWCQQHSLPVMAYCPLAQAGRLRDGLFQHSDIINMANARGITVAQLLLAWVIRHPGVLAIPKAASIEHVVQNAAALDIVLSGEELAQLDRLYPPPQRKNRLDMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldehyde reductase
publication title Crystal structure of aldo/keto reductase from Klebsiella pneumoniae in complex with NADP and acetate at 1.8 A resolution
rcsb
source organism Klebsiella pneumoniae
molecule tags Oxidoreductase
total genus 83
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2014-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wghA00
2A79A 1ZGDA 1ADSA 4DZ5A 4JIHA 4WEVX 4FAMA 3G5EA 4JTCA 3C3UA 4JIIX 3G1RA 3GHUA 3QKZA 2J8TA 1GVEA 2HVOA 3H7RA 3DN5A 2IKGA 3H4GA 1AZ1A 4YU1A 1YNPA 4XK2A 1Z8AA 2PDNA 4FALA 1Z3NA 4JQ2A 2PDCA 1Q13A 3EB3A 4PRTA 4WDTA 2FVLA 2NVCA 3RX4A 1OG6A 4WDWA 2HE5A 3P2VA 1US0A 4L1XA 2IPJA 2BGSA 2PDLA 1AH0A 4LB3A 3CAVA 1X98A 3UWEA 4ZFCA 5C7HA 2HV5A 4HBKA 3LEPA 1AH4A 5M2FX 3T42A 4JTQA 1Z89A 1ZQ5A 5JH1A 3CV6A 1MZRA 3WG6A 1ZUAX 3ONCA 2PDFA 3GUGA 3WBYA 3LQGA 4WRHA 2ALRA 4QBXA 2DV0A 4XZHA 1QWKA 4WGHA 1IHIA 2AGTA 3S3GA 2IKHA 3GHSA 4JTDA 4JTRA 3RX2A 4GA8A 1ZSXA 4EXAA 4XO6A 3EAUA 1Q5MA 4QR6A 1YE6A 2IS7A 3LZ5A 2VDGA 5KETA 3EB4A 2PD9A 5DANA 2NVDA 4XZMX 2C91A 4XZIA 3KRBA 2IPFA 3F7JA 4R9OA 3R8GA 4H7CA 3ERPA 2CLPA 1R38A 1VP5A 1T41A 4G5DA 2PDJA 1XGDA 3BCJA 2PDIA 2I17A 4GCAA 2PDKA 2INEA 4PUWA 2PDGA 4RPQA 5LIKX 1C9WA 1EL3A 4DBSA 3GHRA 3WCZA 3O3RA 3V0SA 4LAZA 4PRRA 1RY0A 3LZ3A 4IJCA 3UZWA 3ONBA 2PDYA 3GHTA 3LN3A 4YVVA 4PMJA 4JQAA 2R24A 3UFYA 2PDXA 5LIYX 3LUTA 2HE8A 3UZZA 3DOPA 2FGBA 4ASTA 4JIRA 1HW6A 2R9RA 4XZNX 1X96A 2F2KA 3FX4A 3B3DA 4H8NA 3BUVA 2PDUA 4IGSA 4GQGA 5AZ0A 1XF0A 2FZDA 1IEIA 4LAUA 1PYFA 1LQAA 2BP1A 2INZA 2F38A 4XAPA 2DUZA 2IPGA 2IPWA 4XVEA 2FZBA 5JH2A 3N6QA 2PD5A 4Q7BA 4GACA 4PR4A 3O0KA 1JEZA 3MC5A 1J96A 1QRQA 2HDJA 4ICCX 3WBWA 2I16A 3LNMA 1S1RA 3Q65A 4JQ3A 5AZ1A 3R94A 3V0UA 2PEVA 1MI3A 4NKCA 1T40A 1K8CA 1VBJA 4Q3MA 4IJRA 1Z9AA 3VXGA 3UP8A 4OTKA 2IQ0A 4PUUA 1PWLA 4L1WA 1YE4A 1RY8A 1AFSA 5HNTA 1HQTA 1A80A 1XJBA 2PDHA 4JQ1A 3V0TA 2IKIA 3U2CA 4FA3A 4FZIA 4WDXA 4XVDA 1EXBA 3R43A 3COTA 5HA7A 2ACUA 1RALA 2WZMA 1M9HA 2DUXA 3RX3A 3H7UA 1SM9A 2PF8A 1FRBA 2PDWA 1PZ1A 4HMNA 1PZ0A 3R6IA 2PDPA 3UGRA 3N2TA 4I5XA 2ACRA 4XZLX 2WZTA 4JQ4A 4DBUA 3CV7A 4F40A 4EXBA 3FJNA 4GIEA 1EF3A 3NTYA 3D3FA 2QXWA 2P5NA 3UG8A 1X97A 3CASA 4QX4A 3M4HA 1UR3M 3M0IA 3CMFA 3LBOA 2PDBA 4LBSA 2PZNA 3M64A 2IKJA 2FZ8A 3R58A 4GQ0A 2FZ9A 3V35A 1AZ2A 2HVNA 4AUBA 2PFHA 4YVPA 3WBXA 3Q67A 5LIWX 3LD5A 3MB9A 1MRQA 3LENA 1AH3A 1S1PA 4XO7A 1S2CA 4WDUA 1S2AA 3R7MA 4DBWA 4LBRA 3UZXA 3LQLA 2PDQA 2ACQA 1PWMA 3V36A 1YNQA 2BGQA 2IQDA 5LIUX 4QXIA 3BURA 3BV7A 4JTAA 5LIXX 4MHBA 5HNUA 4YVXA 3UYIA 4YS1A 2ACSA 3CAQA 2HEJA 4GABA 2PDMA 3R8HA 1LWIA 4LB4A 1EKOA 2ISFA 3UZYA
chains in the Genus database with same CATH superfamily
1ZGDA 1VR6A 2P53A 1F9CA 4MB3A 4PMZA 3CL8A 3MI2A 1X7IA 3W53A 4BJHA 2WC4A 3KP1A 3OBKA 1T7LA 4UBPC 1GVIA 3USZA 3E0FA 5F4XA 2JF7A 4V1XA 5FL1A 2Q8LA 4B90A 4B5XA 1XYZA 4WDTA 3V5FA 2X0YA 1R2TA 4PFMA 3Q58A 5LNWA 1TUFA 2WQDA 3I4KA 3RK8A 4KKXA 3CPGA 4WCJA 4C60A 1F74A 3RJXA 1O66A 1DJHA 1H50A 4F48A 1S5WA 2E9MA 4P7QA 1R2RA 1SUXA 3UPWA 3I7RA 2V3EA 1GOWA 2ZUTA 3N04A 1VEMA 3MUZ1 2E67A 4PMRA 3EX3A 4IP5A 3SADA 1E55A 1QWKA 1IHIA 5LHFA 5MHBA 1ITUA 1RJPA 3RX2A 1L6WA 1FVPA 2Y89A 3MYPA 4X2PA 3IJ8A 3QY8A 4UNIA 5KINA 2Z1VA 4ALDA 5BZAA 8CGTA 2C79A 4IWWA 3T2QA 1I2OA 1AD1A 1UIPA 4G9PA 1YTKA 4K39A 5HUPA 3T07A 2GDQA 1VPQA 4HZ8A 2XVPA 3G0SA 2OEJA 1W9XA 8XIMA 3KRBA 1S2WA 2DFAA 4S3FA 2FH6A 2X1TA 3ARUA 4X22A 3WYZA 4XG1A 3ERPA 4OKDA 1CB2A 3GFXA 3V18A 1KBIA 4C7GA 1BWKA 2BHZA 2GYIA 4N0RA 3STPA 2JBMA 4X9YA 2A7NA 4GMEA 3URQA 3GTIA 2OWXA 4M7SA 1KCZA 3GNRA 4JD4A 3BSMA 5C9WA 5REQA 2ZUNA 3ABOA 2HNEA 1AMKA 4PE8A 2VOMA 2X0HA 1ZY9A 2C3ZA 4CQAA 3BAWA 4MY9A 1XUUA 3RMEA 3NZQA 2XH0A 2FH8A 3EX6A 1R3RA 4AHQA 3TLQA 4IGNA 4MFEA 3BAKA 3SJ3A 2YGYA 2QJMA 3UPMA 4NSBA 1AK5A 1HW6A 5AC6A 4QS6A 1QATA 1Q66A 1YDYA 3D6NA 3P74A 4BZYA 3O6CA 1S5VA 2XZ7A 4NI8A 3NQAA 1LZOA 3T4WA 3U7VA 4H7VA 1UWAA 1IGSA 4GC4A 2A7RA 4NNBA 3PZNA 1EJWC 4RE2A 2IPWA 1E6ZA 2OGYA 2FZBA 3GTNA 1F6YA 3KBJA 4JCMA 1UWQA 3KTSA 4O0ZA 1OC6A 3B06A 4HQVA 2DZPA 4ICNA 4ZMGA 1C90A 3PULA 3KS5A 3WBWA 2TODA 5HPOA 5CG7A 4GISA 5HMDA 2D24A 1E1CA 2ZUMA 3ARPA 4B5NA 5GNZA 2XVNA 2YCJA 2VI0A 4F2UA 1TZZA 5C70A 1UR0A 4Z2JA 1K8CA 3DHFA 1R5YA 2XIJA 1UZ4A 5JIWA 2O92A 3TJXA 3IACA 3AS2A 4U5IA 2F84A 2W62A 1VCGA 2FMOA 1U5JA 2GL5A 4A2SA 2V5CA 3IS4A 5G4HC 1XG4A 2VGGA 5HPCA 3KWXA 1J8VA 4FIRA 2WPBA 4Y9PA 2WMGA 1XH1A 1R9XA 2ZWZA 2NV2A 3AZSA 4Y9MA 1QNPA 4FA3A 4XVDA 4CKQA 3CEUA 2WOQA 3PPHA 5T8GA 3KVMA 3OZYA 5AVNA 4HK6A 2V81A 3LV6A 4C6PA 2PDWA 2KAUC 1DTNA 1OCBA 4JFVA 2OTDA 3OGSA 2OJPA 4C6IA 3DAQA 3GSMA 4FX8A 2WC3A 3N2MA 3W1TA 2ACRA 2GWGA 4OQVA 3S1XA 4JHMA 4DF1A 1SMDA 4F40A 4GQRA 3NL6A 5CSUA 5I77A 1UYQA 2Y1HA 3RR4A 1Z7AA 4R7JA 4H9YA 3ABQA 3WD0A 1YLVA 1Q8JA 2UY4A 3O6YX 3OHIA 4RDZA 1ZFJA 1NWRA 1VJIA 1S39A 1ZPTA 2KX9A 4NZ1A 3E5PA 3GDRA 2C18A 2J6XA 1Q6FA 4J5NA 1A5OC 4UFIA 1V6UA 3RITA 3OGRA 3AIBA 3AZTA 1QHPA 3IPWA 3NWRA 1C7TA 1JF6A 3RGTA 4UWMA 4R3UA 4FF7A 3V35A 3PWGA 1TE1A 3W2MA 4JICA 1IXPA 2PFHA 3WBXA 3NYDA 3N3MA 4F2TA 3ABZA 3HURA 1H2JA 3AUOA 2QYGA 4GUFA 4WDUA 1S2AA 4J3SA 2EO7A 3M5XA 3LQLA 4A3HA 4DO7A 1R7OA 1DOSA 1XLAA 1JXJA 1WP6A 4ZFMA 1XX1A 2ZX6A 3QR3A 4ACZA 1NFPA 2BGQA 4IMCA 1BTMA 4E8DA 1C93A 3DI1A 1G7VA 1XLHA 2BS9A 4LYKA 3VM7A 5FEXA 3LB0A 4JCLA 2EPMX 1XRFA 4PUNA 3TTYA 3K8KA 1EF2A 3CLWA 4OFCA 3BG3A 3FVDA 5A8NA 1CLXA 1FWTA 1GQKA 2FTPA 1PX8A 4I5UA 2WC7A 5HJXA 2E09A 5EL1A 4BWLA 1WZLA 2XN0A 5DELA 1KO0A 1U1UA 4H1ZA 5D2VA 1VJSA 5I06A 3B8TA 1EJUC 5HMSA 2V5JA 1EJVC 3KVJA 1JVNA 1WPCA 1ISXA 3VIJA 4ICMA 4E3VA 2W63A 4HYRA 2H3DA 2OLHA 4WDWA 2ZWYA 3UWUA 1GQJA 4L7ZA 3VD4A 3B0VC 4ERGA 3CWNA 5AYBA 3GIYA 3KBVA 2OKOA 4BQ3A 3MVIA 3JS3A 3P80A 5C5YA 2WMFA 3P61A 2VZVA 1XLDA 1IEXA 1EC8A 4M3PA 5M2FX 3DX5A 4YCPA 3D5HA 1RA0A 2V0TA 3CV6A 3W70A 2QUVA 1MZRA 5G1MA 3W7GA 4XKYB 2YA2A 2RKXA 1X6UA 4KT2A 4S2CA 3R0UA 2HZGA 1IWBA 3LBMA 5IHRA 1V3JA 2OYLA 5LNSA 4RE3A 4KH2A 1KV8A 3ISIX 4FS9A 4FXFA 4LVDA 3VM5A 1O5KA 1MXSA 3W01A 3IWPA 3S6DA 4A29A 2XVKA 4LS0A 2OSWA 3B4UA 1RCQA 3LZ5A 2CZVA 5IFTA 4PCNA 1IWPA 1FXQA 5IHSA 2FYMA 2BOGX 3VIOA 3A3XA 3O16A 4LOCA 2VRJA 5ABFA 5GQBA 4EWJA 4O15A 1J79A 4F0HA 1W3HA 4QAIA 1W8SA 1ONRA 5C0QA 4HA3A 3HV8A 1P6WA 2W3ZA 4RW5A 2A0NA 2OWWA 3TR2A 4XIAA 4IMAA 1H11A 1QJWA 4EP8C 3MU7A 4Q6XA 4EPBC 4REQA 5GJMA 2E8ZA 3ARXA 3LGEA 4EPKA 5LGZA 3MWCA 5B7ZA 4I5RA 3QGKC 4LAZA 1AQFA 3BLIA 2QJHA 4GKTA 4RNIA 4CNNA 1QHZA 1QPQA 4RXGA 4BWLC 1A5BA 4WF7A 1R3SA 3YPIA 4C6NA 2JFEX 3C0JA 3SY5A 3GM8A 5FACA 2BB0A 2PGFA 3CTTA 3RYSA 1C29A 3PAJA 1XM3A 3AMCA 1U33A 2DT1A 5G4EA 3WH5A 1CIUA 3NSXA 3HN3A 4O1FA 3RIKA 9XIMA 3R5EA 1G67A 5AVHA 3PNZA 1DQWA 3V4BA 5A6MA 3UG5A 1E9ZB 2F2KA 4BQ2A 3L66A 3B3DA 3QGAC 5GPRA 4IZGA 3GO2A 1BF2A 4S2BA 2WHLA 2WO5A 4GGHA 4IP4A 2V5LA 5EFDA 2WVVB 1H49A 3E0WA 1WO2A 4XVEA 4AD4A 1QNRA 4UOJA 1JYWA 2XVGA 1FWIC 3WY1A 2AKZA 2HXTA 4JR5A 1UWUA 3EWDA 2BV9A 4GQBA 3TE9A 4J4KA 3RU6A 2C15A 3PC0A 3UG3A 2YYUA 2CKRA 2NX1A 2ZUSA 3CEPA 4Y8FA 3UVAA 3EPNA 2PMQA 3FGCA 4PSRA 4FX7A 4S39A 4TMCA 2VGFA 5ABTA 1YNYA 5M5DA 2YZ5A 3W83A 4LPCA 3W24A 5TIMA 3IV3A 1P1XA 4LC8A 5I7GA 3F2BA 3ARQA 4YHGA 1A50A 4FR1A 5DCDA 2V2DA 3OB8A 4PMVA 1HQTA 1B57A 1BXCA 4HSHA 4LC6A 2QHAA 4NP7A 3QYQA 3W9ZA 4AZGA 4OV4A 4DXVA 3CZGA 2VD8A 1M7XA 4DJEA 1BRLB 1JRBA 1M9HA 1H1ZA 4RNFA 2PF8A 3THUA 1XXXA 1DKWA 4C6LA 3FLUA 3VDAA 3EYPA 2QLYA 1WDPA 4BA0A 3GD6A 1IIHA 3SSJA 3N13A 2FGLA 2D2OA 4DBUA 1I9CB 4ML4A 3PZUA 1XLJA 2F6XA 3LHWA 5DQPA 2WM1A 2ZFAA 3DDMA 4IIFA 1YDVA 3GTHA 1WB0A 5FEPA 4JTTA 4KGLA 3WH9A 4HIBA 3B0XA 2ZE3A 3TQVA 2GJRA 5F1VA 1RQHA 1ENUA 1VRXA 5HMFA 1LUCB 3BZJA 1MWOA 2P88A 2E28A 3EKLA 2PDBA 4GUHA 4LBSA 3DFSA 4AIOA 2B4GA 4Z2LA 2VRQA 2CNCA 2WJFA 1XYBA 3MHGA 2G97A 5KZDA 5LIWX 2Y5EA 4JL1A 4E2BA 3SQMA 4Z1AA 3FAXA 1JQVA 3R7MA 1GVOA 5CJMA 3TWBA 1PWMA 1TSIA 3RCNA 3MS8A 3EXTA 1H41A 1YPIA 3OYZA 1C8VA 1XFBA 4URIA 1VKFA 2ACSA 2QDGA 2J7FA 2Y24A 4NZ3A 3OLEA 1C8QA 3W1QA 3GG8A 1EHAA 4IFKB 3KLKA 4X2RA 1ADSA 2ZXBA 3C86A 2OX4A 4O4WA 4D9PA 3G5EA 3FA3A 3H2MA 3LRLA 3QC0A 1J11A 3VDHA 3MTWA 4YWIA 5FF7A 4GJJA 4UR9A 1EH9A 2YPIA 2TPSA 2A3LA 2PB1A 3P8JA 1XIMA 4YU1A 1LROA 3IRDA 3S2CA 1PKMA 4DJEC 2E9BA 4KRTA 3S2NA 2H3BA 5MF5A 2EKCA 1BYCA 2CXGA 1Z3NA 2JEPA 3NXLA 1F05A 4NZCA 3NQ2A 3WJYA 5FJRA 1XBZA 5JMUA 1ZBCA 3P2VA 4A8LA 3BLEA 1JXKA 4ZA0A 4HCDA 4KEUA 3B9AA 2P8CA 1R87A 1DXIA 3AFBA 2FQIA 3EKGA 3OZPA 2ZYFA 4HBKA 3VKDA 3THQA 3WLKX 5BXTA 1EWEA 1XLGA 4C1LA 2VT0A 5AHMA 1UC5A 4RJEA 1R47A 3UG4A 4CD8A 1GOKA 2Y88A 4DLFA 1EBGA 1K4GA 3U48A 4JPGA 2EPHA 4IHCA 1UA7A 2DV0A 4Q8PA 4R33A 3QV9A 3AHYA 1EYWA 1GJUA 1U22A 2YXXA 3I68A 1UMYA 4GA8A 2X40A 4IPJA 2X1RA 4S3GA 3BMXA 2VKZG 4G8TA 1XIFA 4D71A 4MUZA 1LLWA 4L64A 3QXBA 3FYPA 4W93A 3DERA 1T99A 4DYEA 2VM8A 4DM1A 3VK5A 4W7WA 3O63A 2ISSA 2R1NA 4Z42C 3MMTA 2BVYA 3ATYA 4OBSA 4AIUA 1WUEA 4ZODA 1JI2A 3MBDA 3OLDA 2CLOA 4UFLA 3UJRA 4JIPA 1XQKA 1QNOA 2CLPA 1XR2A 4GE8A 5DO8A 4Q8TA 5D32A 1WOBA 2PDJA 1WDWA 4MPKA 4MJMA 1WDRA 2PDKA 3RPDA 4UUIA 1CXKA 3DGRA 1C9WA 1UROA 4XD4A 3QTGA 3O3RA 4LX4A 1KTBA 1Z32X 4P2VA 2WNQA 1WXYA 4PCSA 2Z1KA 1XG3A 1FP9A 1K6WA 4NIRA 2XPKA 1W5OA 3Q37A 3E5BA 1JD7A 3GE7A 1P43A 4IOTA 3VKAA 1ZLPA 4LEQA 2HMCA 1MYRA 4EPEC 5E0CA 4I9AA 3UFYA 4IPLA 1J0HA 4N9BA 1IYXA 1M01A 2VMFA 1IXNA 3UZZA 5FSDC 3LCFA 3NAVA 4ZOBA 3VCNA 1GGOA 2ZZ4A 4EAYA 4PTNA 3VDGA 4HMDA 1TPFA 2H8ZA 1H3GA 4KWOA 5IM51 4ZL1A 3ZJ6A 4NRSA 4ZOEA 2E7FA 4KS0A 4UQAA 5XINA 4H7ZA 4QDMA 1EHNA 4DZIA 4X0NA 2W79A 4W85A 3OW1A 1SR9A 4KPLA 4J3VA 3GW0A 4ZQPA 1GVYA 5IRPA 5A6LA 5GVJA 5JH2A 1YX1A 2WSPA 4JTJA 1O4UA 1W3NA 1K8XA 3TN5A 4B2DA 1QRQA 3VNKA 2Z6JA 2ABAA 4NX5A 3E1F1 2OO0A 1XUZA 2CLFA 1ZB5A 2NXGA 4LTSA 2VVSA 4M51A 3HQOA 2X41A 1TPH1 1TWDA 3NNTA 2O9PA 2H6RA 1HKWA 4QQ3A 1BXNA 5B80A 1SO4A 1OSEA 1S5NA 3MHUA 2QUUA 3BLFA 1BGGA 2J88A 3GXFA 2E77A 2NWSA 1RY8A 4GFIA 4E8CA 1EC9A 3TQKA 3S0CA 4Z1YA 2Z24A 3E12A 3KOYA 3DHUA 4HTYA 1S46A 4F66A 4WDXA 4HYWA 3WQDA 3R43A 3H24A 4NILA 1FHUA 1BYAA 1RALA 1ZALA 3CC1A 3TYAA 2OKTA 2HSAA 2J25A 3MBFA 3R6IA 4MJ2A 4HU8A 3VNYA 3N2TA 3H6OA 4I5XA 5HULA 4D6JA 4JQ4A 1P0KA 2VP8A 1ONEA 3ARYA 4RK8A 3NTYA 4BI6A 1M6JA 1ZCOA 3C6CA 3GXIA 2AGKA 1JPHA 4MJZA 1LOSA 1X97A 5A8OA 3N6HA 1ADOA 3M4HA 3P0WA 5FD0A 3W74A 5CEWA 3KFTA 3UT0A 4GWEA 4ECLA 4TVCA 4P8XA 3TQPA 3MV01 1OZMA 3TYBA 1JCXA 3I6TA 1PKYA 4LUYA 4F8XA 1J4EA 4JKLA 5FI8A 1KRBC 3WH7A 1WDSA 4CCEA 4BEQA 1U1HA 3W7JA 4WOZA 3LCHA 4H9UA 3S1VA 1TRDA 5BMXA 1M1BA 3M07A 4C6BA 5I23A 3GNDA 1PE1A 2VD9A 1MEHA 5IDIA 3QMSA 1OZQA 2C7FA 3BOFA 2WVTA 4LVGA 4R34A 1KFWA 1V7AA 2OR2A 4O19A 2GGIA 1TMHA 5IXEA 3QY6A 4Q8MA 1PYMA 5A6KA 2AL2B 4PL1A 4JTAA 5AY7A 2DVTA 3IUDA 4MB5A 4OECA 4DB7A 1U83A 4CNPA 2QCDB 3BVJA 3NM3A 1OHLA 4AZIA 3UZJA 3KVLA 4FXJA 4KFOA 3ABSA 3EMZA 1K6AA 1J0ZA 3SFKA 4KRZA 3JUGA 3MUY1 1T96A 5CSSA 4FMVA 3WLOA 4CCCA 1TR1A 4MKVA 1QW8A 1YNPA 3KUMA 2XUCA 2XN2A 3KBMA 4PULA 4E2OA 2IXUA 1NDZA 1BF6A 4EPDC 1OCJA 2GJPA 3EOEA 2CBJA 5DY3A 4HPHA 1W31A 4L6DA 3APYA 1JL8A 1JDFA 4WY0B 3TOYA 3EXRA 1E70M 4US5D 1Y65A 1UR8A 4UMAA 3VZYA 3PBWA 4XKYA 1S2TA 1OYAA 3MI6A 5CJNA 3HG3A 3W2NA 1OX5A 5DMYA 2XWDA 4DF0A 1BXBA 3AHZA 1KGUA 1VJZA 3LCLA 3FEQA 2H8XA 3WG6A 4GVFA 1M04A 1O5XA 3ZSTA 3BGAA 3SCWA 3WBYA 3T0CA 3LCWA 5DT5A 1KGXA 1JDDA 2VC9A 1BKSA 4UFJA 1G5AA 4HHHA 4LVAA 1GZGA 3QLDA 3GHSA 4KERA 3BAIA 2PTXA 1A5LC 1B3XA 4HHLA 2BY2A 4DJDA 1LG1A 5HJYA 3BZGA 3F4DA 4QR6A 1KLYA 2CPUA 1N55A 1NDWA 4S38A 1PSCA 2DH3A 4J2MA 2NVDA 3PSWA 3S5OA 2JGQA 4A3QA 1AW5A 3CQJA 4DY1A 4W89A 1DVJA 4JX6A 2A7PA 4XTIA 1AJ0A 2W67A 5TQLA 3VGBA 2J8FA 2Z7GA 1T41A 3A22A 2AMXA 1EUNA 4C6QA 3G1XA 1VHNA 4GI4A 4PUWA 5CBJA 2R82A 2FPTA 4AC1X 1JD9A 3GHRA 4PRRA 5CC3A 3A5FA 4IJCA 2VEKA 3QPZA 2DZTA 3N6JA 4Q4RA 4HOXA 1GPWA 2E8YA 5AN7A 2MUCA 3B9NA 4R7WA 3EEGA 4CNSA 5AYIA 1UH3A 2YCKX 3PZGA 3M0LA 3CQKA 3VA8A 3E0VA 1TX0A 1V02E 1QI4A 3O2LA 3PN8A 1B90A 1JCLA 4LCRA 4QE1A 2D73A 3GXMA 1YEYA 1UD3A 2WVVA 2D0FA 1X1ZA 3LG3A 1B0IA 5I0DA 3SCRA 4Q7IA 1XP3A 3AROA 2CBVA 5XIMA 1PEZA 1PYFA 2P0IA 1JPDX 4C91A 1PVNA 1LQAA 1ZTVA 2DUZA 5IOBA 3L67A 3B03A 1RV8A 3CWHA 4H2CA 2EPNA 2CFFA 3AHXA 7XIMA 1J96A 3N9RA 3SM0A 1ZP4A 4O57A 1G7UA 2I56A 1C7SA 1DORA 1S1RA 5JVLA 1E9IA 3GG0A 4V1YA 3TVAA 4DJDC 3VD5A 1KFEA 2J6VA 1DHKA 3RCYA 5JBDA 1XLKA 3PM6A 5AOUA 4AF0B 3TSMA 2Y61A 3WF4A 3OBEA 4U5KA 3W85A 4YTQA 4CU6A 3BE7A 3RM8A 1V7YA 5D9PA 4ORIA 3I3BA 4L1WA 4JY8A 3NQ6A 3TW9A 2GVGA 2WW5A 1BRLA 3GDLA 4AYGA 3CO4A 2G3NA 4MLRA 5FF3A 3W7MA 3W38A 4F0RA 2ISWA 2TSYA 1OFRA 3COTA 3LHVA 1UP2A 5TNVA 2GGHA 1YDNA 4QJ4B 1SM9A 4D8ZA 4W88A 3HPXA 2J74A 1PZ1A 1HJXA 3CYVA 3L0KA 4E4UA 4WOQA 2D22A 4F0KA 3A3WA 5HR6A 3QY7A 3TTOA 2NW0A 3PZOA 4GJIA 3PB0A 1LUCA 1RPXA 3HPAA 2OZ0A 1CNVA 1W37A 4TQTA 1DWAM 4MF4A 1XIEA 2A85A 2DORA 3USBA 3W84A 2P5NA 4XZBA 3WK3A 3UG8A 3VIMA 4DWSC 4R5EA 4TV5A 4JNYA 3TAKA 2ZRYA 1SQ7A 1A0CA 2YKKA 3UJSA 3M0IA 2HK0A 5KMYA 1CENA 4ZQCA 3E02A 3FKKA 4QCFA 3OVGA 4AMCA 3A4JA 3TTSA 5BOOA 4P8WA 2YXGA 3BSHA 4ZTYA 3SIZA 3H7VA 3SQLA 3LD5A 5HINA 1AH3A 3RG6A 4BCEA 1GKRA 4O16A 1KA9F 5FJPA 1L2QA 3QW4B 3WFAA 3WF2A 4BHYA 3T0AA 1FWFC 2VZSA 1RVKA 1TTPA 4BF5A 1GOMA 4RV3A 2JK2A 5C9RA 3S83A 4UOQA 3RNDA 4IFKA 1ZAHA 1KCLA 2DUAA 4RW3A 5AHFA 2ZUWA 2C0HA 2EG6A 1TKKA 2W4XA 3CAQA 4AVOA 1UUOA 4JKMA 1BEUA 3UXLA 4MNLA 3W29A 4CCDA 3VD9A 1L6YA 2E5CA 2I14A 4GHRA 3VC5A 3WQ5A 4QDPA 1OVDA 2P0OA 2E1DA 4PMDA 2WYSA 3ZR4A 1M3UA 5DRIA 3C3UA 3UJFA 4WJEA 4GIAA 1W1TA 1GTHA 2X8RA 5JXQA 3KHJA 4Y9OA 1K7FA 1F73A 2ZRVA 1XD1A 4G6CA 1J5SA 1E0VA 2W6RA 4LUSB 1KCKA 1V6TA 1QPNA 1AQHA 4FHAA 1GEQA 4IQJA 2XG9A 3WL1A 4DO6A 3BLPX 1OG6A 2HE5A 1N8WA 2WZHA 4P8VA 2JIWA 3C5QA 6TAAA 1QW9A 4NASA 1AH0A 4ROQA 3NA8A 3UR2A 4K68A 2YBUA 1NELA 1JAEA 3HA1A 3QFEA 1TJ1A 2WJDA 4JNMA 4XBJA 1NWUA 5KZMA 3EZ4A 4XZ9A 1GTEA 3M5VA 1FA2A 3RXZA 4DUOA 4K7VA 4E4FA 4JAWA 4HP5A 3LHYA 3H55A 1KRMA 5I6SA 1B4KA 4ZOAA 3L5LA 1TJ2A 4QBXA 4QROA 3VFCA 3IRSA 1EDQA 3L9CA 2AGTA 1H63A 4JHOA 3IIVA 1XYAA 2QDDA 3CJPA 2XH4A 2ZX5A 3WDPP 5K9DA 1E0TA 3G77A 4MDPA 1Q5MA 5I24A 4YWSA 4CD6A 4GBDA 4LCSA 2OWCA 1RR2A 4S3CA 1E3ZA 2YB1A 5D05A 1JUEA 3H2NA 4YIWA 3AYVA 1OF8A 3EGJA 3NCOA 3VO0A 1R38A 3AALA 3OU8A 3EB2A 3UXDA 2ZZ2A 2ATMA 5HATA 4PMOA 3WO8A 2PDIA 2PU0A 4PBGA 2JKPA 3VIFA 3WLJA 4DEFA 1E1EA 3S6OA 3FVMA 4WXYA 1YADA 1FWSA 3CT7A 1WV2A 2ZBTA 3BAYA 3QH2A 2HWGA 4UQEA 3BOXA 3OPSA 4LYQA 4U28A 1VB9A 2PC4A 4DX3A 5BWAA 4M56A 3VOGA 1UUMA 1J18A 5G2WA 3BO9A 4MB4A 1XC6A 2OX1A 3DYPA 4J3TA 3CPUA 1SFSA 2XN1A 4EKJA 1P48A 4DAIA 3ZWSA 3GH5A 3SUSA 5M1TA 2V6AA 2Q8XA 4MNJA 1B3OA 1O5QA 2FGBA 4P7NA 3TC3A 3KOZA 4FNUA 1O6IA 4PA8A 2Q09A 5JQ9A 3N9KA 1VBUA 4QSFA 3IJ6A 1XI3A 3WMSA 3WUEA 2JGYA 2YW4A 4AWEA 5HQMA 5JIPA 3FA4A 4ONVA 2AQOA 4EANA 2INZA 2PU1A 1OFAA 5G2HA 2W92A 1EP1A 3TMLA 2OSYA 3SURA 4DXXA 1LL4A 4M82A 1BKHA 1FWWA 3AQUA 4M6VA 2OXNA 1SJDA 2PGEA 3E9AA 1WYIA 3ANYA 4PR4A 1ZJBA 2HROA 2JQXA 3BK0A 3UF9A 1WDDA 2C1HA 3Q65A 4O17A 4MYXA 1OBAA 3A4WA 4NZJA 3WMBA 1TQXA 1UPPA 3V0UA 1ZJAA 1R3TA 2OYMA 3VKBA 2E6FA 1JCTA 1RSCA 4LT9A 3DC8A 1JQXA 4AZ7A 4DNHA 4JIQA 1YTEA 3TJ4A 1RQEA 3MKVA 2OQYA 8A3HA 3LCGA 2Z29A 2TMDA 1F8MA 2XJ7A 3OLIA 4AZBA 3AJ7A 3QPYA 5I2UA 1MQPA 2ZZ7A 1EA9C 4FLRA 1AFSA 5D09A 3M0XA 3W37A 3RM9A 6CGTA 2HVMA 1QCWA 4OV9A 3U2CA 3ORWA 3EWCA 4AX6A 1EXBA 3Q2DA 3O15A 2WWCA 2PLJA 3P14A 4OGZA 3PFMA 4ZQRA 4G1KA 1V3MA 2QIIA 4M19A 4ZZ9A 2WMJA 3XINA 3OQEA 4GIYA 5AHNA 3POHA 2PDPA 1XINA 1BHGA 1EB3A 1DV7A 2QGHA 2VCCA 1XKJA 3WLQA 4DIAA 3TC6A 1JYNA 2XIBA 1I2QA 3PTQA 1SO6A 2J9YA 3C8FA 3UA4A 1DPMA 4FPSA 3UWZA 1TE6A 3F2CA 5D2TA 1TJ0A 2A4AA 4C7FA 2V5DA 3QV8A 5GJNA 4L6OA 1GG0A 3GAYA 4QG6A 4LRTA 4B9ZA 2PZNA 5CXPA 3PUEA 1B1YA 4OBRA 2VUNA 4IFRA 1TREA 3LDVA 2OT1A 5C55A 1AZ2A 4MZ8A 4W4QA 1JCMP 1FKWA 5HUOA 1XBXA 3GU9A 4AUBA 3G1AA 3UY7A 3Q67A 4HOWA 1HF6A 2VR2A 2NQLA 2ODOA 3IV8A 3POCA 1QNVA 5U4NA 6REQB 1HKMA 4JTSA 2AL2A 4H01A 2ACQA 2QPSA 1O12A 3ZVHB 3A21A 3DYOA 3H2OA 3SFWA 2F9RA 1CI1A 3ITXA 1UD8A 3RUBL 2WSQA 1Q6CA 4MKSA 2QCDA 2UY3A 1YDOA 1S5TA 3N17A 1Z6KA 4TX9A 4D6FA 3BV7A 2Q6ZA 2UY2A 1FWRA 3BW3A 2DSUA 1VPXA 1KR1A 1E4NA 2PDMA 1OT1A 1LWIA 3GLCA 4C5ZA 3RFAA 5D33A 2VFDA 3L4TA 4JIHA 3P7YA 1ZAJA 3TYCA 3NVTA 2INFA 5I00A 1TUXA 5I3JA 3NGFA 4XB3A 2ZA3A 3VIIA 3R79A 4JIIX 2PUZA 3PNUA 1EGMA 2YCLB 4TR9A 1UD2A 2WLYA 4H9TA 3UWVA 4R9XA 3V5CA 4WY0A 2UBPC 4K7YA 1XIHA 1XHGA 4GNKB 4PMYA 1LM1A 1W9VA 4NJJA 3GNXA 5EMYA 4H4IA 1HP5A 3ZIZA 3B9DA 3B0PA 3GXTA 4FR6A 3WJWA 5I3KA 4GC3A 4ATLA 3ARTA 3T44A 3CUXA 1V02A 2GJNA 4F2BA 2HQAA 1NP2A 1QOPA 3LOTA 4NAFB 1CB7B 1SW3A 3PUGA 4QJ5B 1WAUA 3WLHA 1XIJA 4I6VA 2JE8A 5C6MA 2ZZ1A 3W1MA 4KIEA 1PKLA 4IGMA 4NJIA 3LQGA 3L4WA 3SI9A 3KVKA 3LCIA 1SVDA 2W91A 1R2SA 1OFBA 3URNA 1F3WA 2BOEX 2WSYA 3AMGA 2WHMA 3KCLA 2PZ0A 4XO6A 2WCAA 2BFGA 1R85A 2G4FA 3D47A 3W7HA 3GBDA 1UA3A 3TCSA 4ZSUA 4JKKA 3AYRA 3WUGA 1W5MA 1G9HA 4OU1A 4DVOA 3WNLA 1K7EA 5EPDA 3EWWA 4MY8A 4XZIA 3WMLA 4R9OA 4C90A 1E1FA 3MMDA 4KF1A 3JRKA 4WKHA 1C8YA 5AHEA 2V69A 2G95A 5G1TA 1EJSC 1IR2A 3SSZA 4BEUA 2VXNA 4QJ3B 2I17A 2XU2A 4RZBA 1KBJA 1VF8A 5J5RA 2QEZA 4LYRA 2XFRA 1YQ2A 1H4PA 3IEBA 4AMAA 3V0SA 4IIEA 4V2XA 1KXVA 3U2OA 3E96A 1LBMA 1HN1A 1CLVA 5CAKA 4KFNA 4DZHA 3EA2A 4AYSA 3VU2A 1XPYA 3OVPA 1W3IA 2VNCA 1QAPA 1SJBA 1DXFA 7PTDA 2VX7A 3EX1A 4X60A 3DOPA 3GTXA 3PTMA 4UTHA 2PWVA 1RK6A 3U7BA 2QCLA 2C1IA 2VOTA 3LPGA 3DG3A 2BX7A 4IIDA 1JZ7A 2OMAA 2X1SA 5FJIA 3M0ZA 4K8GA 5C8BB 5E93A 3MSRA 4AWUA 5LZLA 1LCOA 4ZXLA 1HJQA 1IEWA 3WD1A 4GZJA 4IT1A 4E4PA 3IVSA 3M5YA 2BP1A 4L4OA 1PZ2A 1QPKA 5GNXA 3JZEA 2QF8A 3B0UX 2NQZA 1JZ3A 2QUMA 4TX8A 4H2HA 1QK2A 3G6LA 3K2GA 3TNOA 4QLLA 3O7UA 1SJAA 2GZXA 3ITCA 3E49A 5E0FA 3WK1A 2Z25A 1CGXA 2GDUA 3D3AA 3LCXA 2V38A 1MUMA 3MC5A 1YPFA 1NF7A 4GYFA 4AF0A 4V15A 3TOPA 2Q3OA 3K30A 4GFSA 5D2XA 1QXLA 3LK6A 2FDSA 4D8AA 1XLIA 3AOFA 1MW1A 1VBJA 4UQCA 4LUJA 2OLSA 4AVFA 2UZ9A 2OODA 1POJA 1SZFA 1MXDA 1UR2A 3LTSA 1BQGA 3B8UA 2IQ0A 4F0SA 4HNTA 1ZJIA 3BW2A 2PTWA 2JIEA 1MW2A 3O8AA 4NQ1A 4YTTA 1Q6LA 1IXOA 1LG2A 1XJBA 1TPEA 4WX2A 2PRMA 2X2GA 3W2JA 2I5GA 4LUTB 2E40A 1XBVA 4Y8EA 4ERIA 4FZIA 3VNLA 1VENA 5SWUA 3TA6A 2DY3A 3WIJA 4LV4A 2VHLA 4KWSA 3F5LA 3KRZA 4FK9A 1XKYA 2VYOA 1T5AA 3M9YA 3TSDA 4XZLX 2WZTA 1VEPA 1VFHA 3PK7A 1G4SA 2ZA2A 4YCOA 2PF0A 4QE5A 3AI0A 3W7PA 4QS5A 1CXIA 3GK0A 3RRAA 1KFKA 3AS1A 3CQHA 3U5UA 3CIWA 2CITA 1C91A 4HZ6A 4O8RA 1O5RA 4FNRA 4FEZA 3T08A 3GYCA 1F3EA 3TTEA 5H1WA 4IQEA 1JYVA 2Y4SA 4BR1A 1FCBA 3CZKA 1I2NA 3WBAA 1LLZA 2OVLA 1V6XA 3PG9A 3EWYA 4PTDA 3ITVA 3GDKA 2R14A 1THFD 1EZWA 2NT1A 5E70A 1MW3A 1RBLA 4L80A 1XISA 4UTUA 1B9BA 4MSSA 1HKJA 1VFLA 2GGGA 3ARZA 4C6FA 3I7SA 3TA9A 1VYSX 2GSJA 1K70A 4LBRA 1TZ7A 2R91A 2G4JA 4BF9A 4D8LA 3QBUA 4LNCA 4TX6A 5AC7A 5ABEA 3SY8A 3SRDA 5LIUX 4P61A 1EPXA 5I02A 3WH6A 2OG9A 2G41A 4YL2A 3QTPA 3F1QA 3KBNA 4Q4QA 4DJFA 3M43A 2GUYA 2C8NA 1SR0A 2CLEA 1HKKA 5FEZA 4CN6A 1TX2A 5CC5A 1WAWA 3N18A 5T9BG 1S2UA 4LAMA 4FAMA 1VFFA 3MCMA 2WBGA 1JCNA 1EBHA 4LUSA 4A3RA 3BLKA 4FB7A 1PPIA 2ZUVA 5E6YA 5EGRA 3GHUA 4BS0A 2BVDA 2GUBA 3R0KA 1XIBA 3H7RA 1F2JA 1AZ1A 4GY1A 4MG4A 1WX0A 5FF4A 4EWND 3KCJA 2UWFA 1VRDA 3M6DA 4IX0A 4QISA 4J28A 4O1CA 2PGWA 1L8NA 4Z0SA 3W25A 1J01A 2IPJA 2CERA 2QPUA 2G3MA 3VGEA 3S4TA 1BSLA 1RP9A 3L4VA 2DGAA 5ECUA 5I78A 4IFOA 1J0IA 2A3EA 2DZBA 3AWNA 1VPYA 1Q7QA 3N15A 3EDFA 1KKRA 4I90A 2PWFA 1ZQ5A 4RLIA 4DBEA 1AW1A 3MUXA 2FHCA 2Y8UA 1EQPA 4XAZA 3HPZA 4CVWA 3MUAA 3KS6A 5CG0A 2ALRA 2WQPA 4ZTXA 3CHDA 3EPOA 3LS9A 4KWVA 3CZJA 2QPXA 3AZRA 3H4WA 3WEMA 3GFYA 4NYUA 2O4QA 1YXYA 3QF0A 3VIGA 1NSJA 3D0CA 3SCOA 4IM4A 1PAMA 3OA5A 2GSEA 3ZSSA 4JY9A 1ONWA 5HNRA 1UMLA 4DN1A 1E6NA 2RH9A 4P8UA 2YIHA 3TSBA 3OA3A 2QJGA 3N9SA 3MP5A 3QOKA 1M65A 3JU2A 1FWGC 4IXHA 4UTLA 4I7WA 4IGHA 4G5DA 5FESA 2XHYA 1QI5A 1EA0A 4PEEA 3WBEA 2ON3A 5CZTA 5LIKX 1MW0A 1NDVA 3AO0A 3NQFA 3LERA 4EF8A 1GQIA 1D3CA 2Y7EA 4ORMA 3WQEA 3UZWA 4JEQA 3R25A 4J3UA 4H41A 6XIMA 5EMKA 3WNNA 3AS0A 5DF0A 3W02A 5DCBA 4UCFA 4MOZA 5H91A 4B5WA 1XSIA 5AYYA 1QTWA 4RXFA 4CN4A 1GYLA 2R1MA 4TOQA 3I7QA 1DQUA 3OVRA 3VCRA 5HANA 3RLHA 2GVLA 2G8ZA 1CYGA 2O56A 3ALGA 4QIUA 4L9YA 3VX0A 1H62A 3SRFA 1V0MA 1EC7A 2PBOA 4GQGA 4M8UA 1NIUA 3A23A 1UWRA 3QVQA 1IT0A 1TELA 1ECEA 4WKAA 5D2YA 4X9SA 4GYJA 1L2UA 4XAPA 6ENLA 3BC9A 4Q7NA 3ZWTA 3C56A 3U57A 1X6LA 1JDEA 1XSKA 3GZ3A 4NL1A 1WKYA 2HBXA 4PL2A 1DWJM 1QO2A 3F4WA 1XBYA 3WK2A 2BSLA 3PPFA 4RE4A 2V2HA 2X0SA 4GACA 3PG8A 3O0KA 1JEZA 1EOMA 2CLLA 4GXWA 4DWDA 1R3VA 2NSOA 2CESA 3OG3A 4X61A 3O9NA 2WHJA 2PP0A 5FEWA 2PAJA 5K9XA 3VOCA 4UQBA 1GORA 2G5WA 2ZZ5A 1XIIA 3GXPA 3SCVA 1ONXA 5LKYA 2XIQA 3A47A 3GBEA 3W87A 1L6FA 3S46A 1VGAA 1BWVA 1U30A 4QSHA 3HQNA 1I2PA 3LV5A 3UWWA 3EWZA 3T0BA 2IKIA 2PE4A 3WELA 4WK9A 4G56A 3W1LA 3OVQA 5H8MA 4DUXA 1FDJA 3ELFA 4AX7A 1R30A 2WHKA 3CHVA 1EGZA 3UGVA 3A24A 3CBWA 3MP3A 2XTKA 3NQEA 4YNGA 3NQDA 4AH7A 5BXPA 2J24A 3K4WA 4GI6A 5D8ZA 1FCQA 2I5QA 4W8LA 3G3MA 5DXXA 4Z08A 3I6RA 4MADA 3PJUA 4PUMA 1HL9A 4QX4A 1NM9A 2OSXA 3BL3A 3HBLA 2PP3A 3SB0A 2MNRA 5TBOA 1YBQB 3GC5A 4W5UA 3EMCA 2VL4A 2E5BA 4OE7A 4ZQOA 4OHQA 2ZQ0A 2VR5A 4WR3A 2DSVA 3W22A 2FZ8A 4DUWA 4GQ0A 1GNXA 5EB8A 4OUEA 6REQA 3AXMA 2PCEA 4ADSA 4MAVA 3VD3A 1XH0A 2HTMA 2V3FA 2Y85A 1UKSA 2E25A 3ZVHA 4AD3A 4JEJA 3ZO9A 3F03K 5DMLA 1Q4NX 1RUSA 3GXDA 4F9DA 2E6AA 3PPGA 1JDCA 4GUIA 3GYEA 3HM7A 3QMTA 3DG6A 2YDAA 1FY6A 3B4YA 2Y62A 3IJ9A 2IMRA 2POTA 2VENA 1OFQA 4HVXA 3HFYA 1OCQA 3WLIA 2OZ3A 1TJPA 2P3ZA 1WA3A 1UD4A 4N9CA 1OJXA 2P3EA 1VLIA 4O53A 1E6SM 1AG1O 3KCOA 4MHBA 4H04A 1H61A 1JCYA 2VURA 1UWIA 3M16A 3WQ4A 2ZTJA 5CLWA 1EIBA 1DE5A 2Q3RA 4KQNA 2YCLA 3H2AA 5KSWA 5EBUA 4DZ5A 1T6MA 3CAWA 4JN8A 2GVEA 2YZRA 2X1IA 1ADDA 3G1RA 4AW7A 3GDMA 3AXKA 3VE9A 3NO3A 3DG7A 4D6HA 1RLCL 1GOQA 2VQTA 2IKGA 3ZVIA 1K02A 5TD4A 5DMNA 3WDRA 3KOFA 3ES8A 2PDCA 3ANVA 2A3HA 3DFOA 4JYDA 5JBEA 3MUIA 2FJKA 3LLDA 4NAFA 1IZKA 3W23A 4IIHA 3PUOA 5FF0A 4INFA 4MWAD 2J47A 3MT1A 4KGJA 1O95A 5BOFA 1D2KA 5AC4A 2HNHA 5KZ6A 4PUDA 2C19A 4H8VA 4DJFD 1S5MA 4BQ4A 8RUCA 1TV4A 1W9BM 2RFGA 4F0MA 4GO9A 3O05A 1Z89A 2TYSA 2BBFA 2V30A 4X3ZA 2J9ZA 2J4GA 1PXGA 1ZUAX 4W87A 4YTUA 3ONCA 7ODCA 4GVGA 2YL6A 4KIRA 4E8GA 5FIPA 4WRHA 2D0GA 1DTUA 3MI3A 4KCUA 4K2SA 2NZLA 2DSKA 3PANA 4W8AA 2IKHA 2RUSA 3WQOA 3LA4A 5DCEA 4AZ6A 2ZRZA 2YJQA 2CLHA 3ARVA 4EXAA 3ALFA 4IUOA 4Q8WA 5A8PA 3CMGA 1W1A1 2DZWA 1Q45A 1E40A 1CLKA 1B3WA 1G01A 4M29A 2NT0A 4HHMA 4MB1A 1GJPA 1IWAA 2WANA 4LNYA 1VBRA 1J0YA 2BXYA 3MCNA 1BTCA 2NLYA 1BGAA 4Z2GA 3ME3A 3BCJA 2Z1BA 1MNZA 4PBEA 4PMXA 1C3FA 3ZQ9A 2INEA 3RLGA 2B31A 3WJSA 1MEIA 5K9CA 4RPQA 1JCJA 3QQ1A 2W0UA 5H8PA 2DJLA 1Q63A 5LA0A 4MUPA 2BDQA 1YYAA 4LCQA 1BG9A 4GXPA 1J0JA 4RNHA 1CWYA 5A6AA 5F2GA 1PZ3A 3RMJA 1GHSA 3NQMA 4O0QA 4NJHA 2PDYA 3GB6A 5CKSA 2CHOA 2PLKA 2QVHA 3EA1A 3DENA 4JTIA 2B7QA 3U6WA 1ZBVA 1XV8A 4IG2B 3VGDA 5D8WA 1ESWA 4P7LA 3QSTA 5DY2A 4OVXA 4B5TA 4FOKA 3B8IA 2DDXA 3KOXA 3LUTA 3M7WA 1W17A 2D2JA 3P8IA 4S3BA 4N7QA 1Z44A 2Q71A 1OYBA 1TPDA 3THCA 1MDRA 2XFYA 3AU6A 2PA6A 4XZNX 2EPLX 4GZEA 3FX4A 4HHPA 3K5XA 3SZ8A 1XFCA 4HNNA 5M03A 4IGSA 3JVAA 3SR7A 3VIHA 1B30A 2CZ5A 3E2QA 5F2LA 2FFCA 1Q6OA 1VZWA 4LJ3A 2Z26A 4UFHA 1H7PA 4D6GA 3ENLA 5BXRA 3PAOA 4KCVA 3STEA 1LBLA 4Q7BA 1NP0A 1BLIA 1I8JA 4JDYA 4LQ1A 4ICCX 3R12A 4L61A 3W6MA 4Q22A 3M1ZA 3QM3A 1Z48A 4U33A 4ERAA 1RPKA 4MGGA 3VDBA 4LANA 4ZENA 4B92A 4Q33A 3TYDA 4LUTA 4OTKA 1P5BA 4PUUA 3KL0A 2VZOA 1YHTA 4CU8A 2QF7A 3II1A 4UTTA 3KHDA 2CHRA 2QKFA 2FPVA 4GPNA 1OFDA 4EACA 3EOLA 2BNJA 4JGDA 1NOWA 4FOUA 3PBUA 4UZUA 3CMJA 3DESA 1D7KA 2BVWA 4HJWA 2VCAA 1DIEA 2DUXA 4L65A 3VUPA 1J2BA 4BQ5A 3NSNA 2MANA 3A4AA 3R89A 1W32A 2Q8ZA 1E6PA 5DEZA 3W4RA 4ZXOA 2PI6A 3PS7A 1L8PA 3AMLA 3CT2A 2DZUA 1SPQA 3AMKA 4U4MA 3UGRA 4GY0A 4AB4A 3N2XA 3SUTA 2VWSA 2OOFA 4MYAA 2G3FA 3P0XA 5TAOA 1UUQA 2Y7DA 3KE0A 3OHMB 3MANA 3K13A 2VX6A 1VC4A 3VGGA 2HISA 1MQRA 1KFJA 3FN9A 1AMYA 5C2XA 1SFLA 2FZNA 3MZNA 3OODA 1R7AA 3KZPA 5B7YA 4GIRA 1FWCC 4QTGA 2BOFX 3D46A 4UTJA 1QT1A 1GKQA 1V77A 2NX3A 5FJUA 1QOQA 2VX4A 1QVBA 4WJ8A 1OB0A 4QDWA 5IBXA 4TO8A 2X09A 2BODX 3HMJG 3R58A 4GNVA 2G37A 5U7SA 2O7SA 3BLLA 1W3TA 3AIWA 3GWQA 3L4UA 1JUBA 2WLZA 4GI9A 1MRAA 2QAPA 3IJQA 3FY1A 2EEXA 1EP2A 3CUJA 2EKGA 2ZXDA 2E9LA 4Q32A 1UH2A 3LPPA 3RPTA 2RDWA 2YLAA 1WOAA 4DBWA 3EDEA 2CBIA 2Y63A 1K7XA 3H22A 3E0LA 1HGYA 2WSRA 3EWBX 5JU6A 2DSWA 3VKKA 2B7OA 3KBWA 4LS1A 3C2EA 3FFSA 1KFCA 2WXDM 3WL0A 2ALDA 2IXVA 1XIDA 2AOSA 3WF3A 2BY0A 4YVXA 4RZ4A 2ZX8A 2ZRWA 3QHOA 1RA5A 4UIOA 2OB3A 1G4EA 2XIIA 4JL2A 1SZNA 3R8HA 3MMUA 3LU2A 1U5VA 1E9YB 3A13A 3UZYA 2CU0A 4Y9NA 3G18A 3VKCA 1LRQA 4M1RA 2HPMA 5L6UA 1CGWA 1UP0A 3NL2A 4JTCA 2B81A 3QKZA 1DIDA 3AIQA 1J12A 3G3DA 1HTIA 4UQDA 1AA1B 1PV8A 4ATWA 2X7VA 3W7QA 1CXHA 5A2CA 1E4LA 1O94A 4MKNA 1HGWA 4J40A 3GIPA 1NWSA 1XDLA 2Z6IA 1US0A 3NDOA 4TU1A 3CGTA 2WVSA 1XYCA 1H1YA 5FKYA 4RE0A 2W5FA 4IICA 3IAQA 3PWIA 2X16A 1KXTA 5GJPA 1QBAA 3GR4A 1I0BA 1YMYA 5ECVA 1ICQA 1YPXA 1TMQA 1ELSA 1YW1A 3LEPA 3P6LA 5HWJA 3OQ8A 1TO3A 4XAYA 3NEVA 3V1HA 4NI3A 2NV1A 2OGJA 2B7PA 4TUFA 4UTWA 3HG5A 3I10A 1V4YA 2RDXA 3GUGA 4HA4A 2PWHA 2PLCA 2AQWA 5IBXC 5HNNA 2VTFA 5E09A 3THDA 3CUHA 4B4FA 4JTRA 1MNSA 4UTKA 4LVFA 5FJTA 3UR5A 3PZVA 3C52A 4PCTA 2WNZA 4NYYA 3EAUA 2J78A 4DYJA 4S23A 4HK5A 2FTYA 4HSNA 3A12A 2VDGA 5I07A 1AQMA 4UZSA 1KWGA 4C6KA 3R13A 4D1JA 5A2AA 4ZO9A 4ILSA 3WQFA 3EDKA 1HZYA 4CVUA 1XGZA 4ZE4A 1GJWA 1DWGM 3EX2A 3ZS4A 1DBTA 3GNNA 1KXHA 3C0SA 1JPMA 1HKIA 3V1PA 2J27A 3GVQA 2G3JA 4HT3A 1TWIA 3THAA 2FIQA 2Z27A 4JNZA 3SAZA 2CLKA 2VJXA 1JZ5A 3K1DA 2C1GA 2ADAA 4L9ZA 1JYXA 5DT7A 3KEHA 3QEZA 4A05A 1VEOA 2DH2A 3FHQA 2F7FA 1FP8A 2PDXA 1C92A 3LTYA 4YXGA 3WSUA 1D3HA 1HL2A 1PO9A 2F6KA 2WAGA 4AY1A 1G69A 4YPJA 1TIMA 2CZEA 1HUVA 4WZHA 1A3HA 1IXQA 4FNQA 4JIRA 3L2MA 4C1KA 2PSNA 3KRSA 4WQ6A 1L6SA 2QCNA 5KTLA 3L2IA 5BU9A 4EF9A 2PDUA 1FFRA 3AIVA 4OOZA 4YJ5A 1XF0A 3BQ5A 1JNEA 1NAL1 5E6ZA 4AISA 3N2OA 1V03A 1S3HA 2WCGA 4MTVA 3NPXA 2QT3A 3WN6A 5T26A 5AFDA 2VGBA 3B0YA 3PSVA 5CZKA 1DWFM 3DBPA 3N29A 1UWTA 4FLSA 3VYLA 4RDVA 4L4PA 4U31A 1NJJA 4LRSA 3TMQA 3WLPA 4UMBA 2QCMA 4MDOA 4O1DA 1A5CA 5A1AA 2DW7A 3UQNA 4CEUC 2EG7A 5D2WA 3TLLA 3OG2A 1QI0A 4V28A 4Y7EA 4ZQMA 3WQVA 4Q4SA 4BF7A 1OQFA 3B9EA 4AEFA 4US5A 4Z2IA 2QV4A 2VQUA 3ZLFA 5A6BD 2E5DA 3T0TA 4QITA 4UNLA 1PTDA 3C0QA 4WVXA 3WENA 3V0TA 2DP3A 5BOEA 1PDYA 4HNVA 4HZMA 2ACUA 3R2GA 1FWDC 2EXOA 3BARA 4Y96A 4G1NA 1I6NA 1OFPA 2JEQA 1UC4A 1W2PA 4J3WA 4HMNA 3HZ3A 4XD6A 1BYBA 2VEPA 3TEVA 3TYUA 1CBGA 4NX0A 4NNCA 3N4FA 4O12A 3W2LA 4CD7A 1YIXA 3ECQA 3KRUA 3LBCA 1YBQA 3STCA 2CYGA 4DBDA 4HN8A 3RU8X 3C2OA 3AXHA 3UR7A 3G22A 3UCCA 1WBHA 5C9ZA 5IDZA 2JKAA 1OGGA 3FK4A 3TROA 4GNJA 1XICA 4J9JA 2ZICA 3EOUA 3F4NA 3CIVA 4HPXA 2ZXAA 4LXFA 1VBHA 2UY5A 2G50A 5EBAA 2XFWA 4M5PA 2QDEA 4JN6A 4AZ5A 3GX9A 4ZGYA 2DEPA 3CTLA 2CETA 3IIXA 1ZZMA 4I9TA 1JAKA 1E5JA 5BRPA 4G7FA 1XH2A 3W6YA 4AD1A 1NEYA 3EDJA 2JKEA 4F9JA 4TVUA 2NUWA 1MQQA 4H6EA 4HU0A 4MAZA 1Q6EA 1VFSA 2DW6A 3UXAA 1IR1A 1CGTA 2ZDRA 3DZ1A 3E74A 3SCTA 2BWGA 1PHWA 4DAFA 3MJMA 2HEJA 2R1LA 4D2JA 1B54A 4O0KA 1VFOA 3W2KA 4I8YA 4B4HA 4WEVX 3GR7A 1O1HA 4JTEA 1CECA 4O1BA 1A0DA 5C9UA 1FWHC 1PTAA 5BYWA 1FX6A 2FZMA 4AXKA 2PWDA 3FYYA 4AVNA 3EEZA 4AZCB 3BANA 2CCRA 1ZBWA 9XIAA 3CM4A 4JS3A 1LQ2A 5E1QA 1HP4A 4K1WA 1KRAC 3GVVA 3ARSA 2CKSA 3SCNA 4JQ2A 2YYTA 1DIOA 4P7RA 3UZ5A 2TAAA 4GVIA 2GWNA 1GOXA 2DQWA 4L1XA 4L5ZA 3AS3A 2Z4GA 1OK6A 3DH7A 3M7SA 4O1AA 3WEZA 4J1OA 4NJGA 1IT7A 3GU2A 2NUXA 2VFIA 1A5NC 1XWYA 3UWEA 4AY7A 6XIAA 1HIZA 3GQYA 1H09A 4F0LA 1W1IE 3NR0A 1O60A 5JUVA 4GZIA 1W9DM 1SSDA 3TZNA 5EMUA 3SW6A 4YTSA 1YXCA 3N2CA 2QCFA 5HWMA 3S3GA 1ZNNA 2WBKA 1UJQA 3HFTA 2FLIA 3N11A 4MLJA 4HOZA 3OGVA 3E2VA 2G0WA 5FL0A 5HR7A 1QMLA 1WZKA 4GO8A 4I9JA 1R46A 3NIYA 4XV0A 3MCOA 4DELA 4GBUA 4KCTA 3KAOA 5DX7A 1B3VA 2XGZA 3SN4A 3UBPC 2XM2A 3W73A 3CAKA 3CK5A 2BY3A 3KM8A 3VOIA 3EKZA 5AC5A 4Q4OA 1WNOA 3MV11 1V51A 2VFGA 1VP5A 1SZGA 2OCZA 2QJNA 4WD0A 2AAAA 3AIEA 7CGTA 5I3IA 3WKZA 4CGTA 4AG0A 5FAJA 2YX0A 3AIRA 3IK4A 3RN6A 1MFVA 4ADUA 2H9AB 1EJRC 2YA1A 1EL3A 1KCXA 3WNMA 4DBSA 3CUZA 5LSMA 4IG2A 2FVKA 3LZ3A 1P1MA 3QJAA 4B3LA 4N2YA 1K03A 4ENLA 1E6XM 5I3DA 3TIMA 5T91A 1ALDA 4ZBCA 1GUVA 3HGRA 3A4XA 3NJ3A 1UKTA 4TXEA 3QKEA 1J9YA 3EOSA 1LT8A 3VNJA 2QR6A 3S1GA 3HU7A 3AHVA 4PN2A 4PUEA 5CZSA 2C13A 2NSXA 3UU0A 2PURA 1EDGA 3NZPA 2VWTA 2GQ8A 1H0IA 3LXBA 1KBLA 3DHPA 1AODA 2YXOA 2BMBA 4I9MA 3L2LA 2E1WA 2PTDA 3FIGA 1IEIA 4HMCA 2WJZA 3BDKA 3W1AA 5BU6A 1E51A 5BROA 1RBAA 7A3HA 1EGVA 4XD3A 3W07A 3TONA 1UKOA 5CCZA 4CCZA 4PH6A 1BD0A 2Z00A 4UTIA 5BMWA 1OF6A 6ALDA 3DEQA 1Q2RA 1SFTA 1IGWA 1NARA 2BGNE 4R88A 3FJ6A 2XGBA 2I16A 2W9MA 3BSGA 3UXIA 4XKMA 5EMMA 2YLLA 2ABBA 5CPLA 4R85A 1DJWA 4PRWA 4A8RA 4IQLA 1Z9AA 3G24A 4C6DA 3CWOX 3S2LA 3UP8A 3N14A 2Q01A 1UKPA 1U1JA 1KLZA 1UIOA 2YSWA 4JTUA 4Z1CA 2I1OA 2ZA1A 4ZR8A 1NFBA 1OGBA 4LUIA 3UNTA 3H26A 2PP1A 1R6WA 5MKGB 1R3WA 1JPKA 4PB3A 1GHRA 1K9DA 1GG1A 1J93A 3NZGA 2AQVA 1RCOB 1PIFA 2J9XA 1WKDA 3VNIA 1P6BA 3VMOA 4LV9A 5C7VA 1F8IA 1TV5A 1A5MC 1FRBA 2J7HA 3RO6A 1ZRQA 3TW6A 1OY0A 2PBGA 3M0MA 3R11A 4FIQA 2NQJA 2NV9A 4CNUA 4C6MA 5A95A 2ONEA 4LEFA 2CLIA 3EX4A 3ITTA 4L4MA 4JYFA 3URAA 1O68A 1EF3A 1UJPA 1JULA 1QWGA 4NNAA 1G0CA 5CGMA 3R1ZA 3BXWA 3EMQA 1LYXA 4XTDA 3ES7A 1E71M 1E43A 1KTCA 2P1FA 3W1RA 4XISA 1KB3A 3AXXA 4AEOA 2QGYA 1LWJA 1XRSA 4ACYA 1E0WA 3WFZA 2GJXB 3MSGA 3N3TA 2X2YA 3RAOA 3SO7A 4CD4A 4RCXA 1RP8A 4RL3A 2XVLA 3AAMA 1KFBA 1CTNA 4G2DA 3WEOA 1CZ1A 3W7KA 1XDJA 3CZEA 3KDOA 3MQTA 1MRQA 3LENA 4HD5A 3W1XA 1WKEA 2YDRA 3TU9A 4ZO6A 1TZ9A 4AQLA 1QFEA 4MFDA 2PDQA 1AL8A 5K7JA 3NDZA 1IT8A 1FDZA 5ABHA 3QFWA 1RAKA 2YDSA 1F7BA 1QO5A 1DL3A 1RD5A 1SO5A 3HGJA 1SO3A 1XLBA 4B16A 3I3DA 1MO0A 3IGXA 3U8GA 4H9XA 2QUTA 1T0OA 1TWZA 3RJYA 2ZVRA 3PBMA 3AYTA 2WKJA 2V82A 1ISYA 3EWXA 4MM1A 1X1NA 1TV2A 2ZC8A 3PTDA 3GDBA 3A9IA 3GR8A 2ISFA 2BZNA 1J0KA 3PP7A 1F76A 1CXLA 3BCDA 3N2BA 3TTQA 2J7BA 4GYPA 3GS6A 1B4EA 2ZZ6A 2HPIA 1ZCCA 3SECA 2QCGA 3W7NA 3DUGA 3C3NA 3W28A 4O11A 3CZ8A 3XIMA 4HPJA 1KM2A 1PIGA 1PX3A 4D72A 3UXKA 4AAJA 1Z8AA 3GU1A 3G1HA 2J7GA 1I4NA 3L0GA 3S9YA 1Y0EA 1CX9A 3TC7A 2DT2A 2D20A 1JNDA 4PRTA 3WLLA 1SW7A 1EIXA 2NVCA 3RX4A 4XAFA 3W82A 1D3GA 3L21A 4LS2A 4Z17A 2X7WA 3QMRA 3N34A 1EOKA 1TV8A 4MZYA 3NOYA 3WQ6A 4UB9A 1W1B1 5CBIA 1GONA 1KW1A 4ZFCA 2Y5SA 1SGJA 2HV5A 4N4QA 4WLCA 2Y7GA 4O50A 4C6OA 1J10A 4KESA 3UCDA 2DIJA 1CW2A 2WCSA 3VTRA 5JH1A 4XSLA 3FJLA 5I79A 3HPFA 1P0NA 3DC0A 1FHLA 3VOJA 3SUWA 2V67A 4IF2A 1KM5A 3RM4A 1WUFA 1V3IA 5E0KA 4L56A 1ECQA 3VD7A 3H53A 4BKNA 1UR4A 3T7VA 3CH0A 4BFAA 4JTGA 4JTDA 3CB3A 4EXQA 1WBJA 3WLMA 2O9TA 2VEFA 4LF1A 5D4YA 1SU5A 2CC0A 3APTA 3PJWA 4MMWA 2IS7A 3DKLA 4E3TA 1C8XA 5KETA 1A5KC 3WJZA 1AW2A 3EB4A 2XGIA 3BJTA 4WY0F 3TDFA 2IQTA 4CD5A 5DLCA 1E9LA 3GW3A 3VE7A 2XH2A 2RAGA 2C6QA 3R8GA 4CQBA 3H2EA 3N19B 3URBA 1UPMB 3BG5A 1TFVA 3TXVA 1TTIA 3MWAA 3ABXA 4Z2KA 3A6OA 1I1XA 2POZA 1KGWA 4A3YA 3RR1A 3ARWA 5HXMA 3WDJA 3H8AA 1VCVA 1Q3NA 1D8WA 4GUJA 2Q02A 4W8BA 3VILA 4UNKA 4XIMA 4AY8A 1OABA 3ID7A 4GYPC 1BVZA 9CGTA 1FKXA 1TPB1 1W3JA 5E9AA 1Y5VA 5L9FA 4QAWA 3QV7A 3QV6A 4TTGA 3LI0A 1XYMA 2WKLA 2ANUA 3LSBA 1S3TC 3SY1A 3AU2A 2YOCA 5A6SA 3HJZA 2Z0IA 2WSKA 1LP6A 1QPOA 4HZ7A 2PTYA 2QV5A 1R8LA 4J7RA 4E5TA 4FNSA 4PCPA 1UG6A 2OZTA 1SSGA 3G1FA 3O6DA 4S1FA 2IUZA 2XSBA 4IPIA 4XUYA 1LOLA 1TA3B 1K3UA 1I1WA 3ZM8A 4IQDA 1GPFA 2VGIA 2ZE0A 3G1YA 4H8UA 3BGGA 1KRCC 3R10A 3WD2A 2ZX9A 2BVTA 3C4UA 2F61A 1RBOB 1XRTA 2A1YA 3UWQA 5CH9A 3LXCA 2YFNA 1SZRA 7TIMA 3LNMA 4PTMA 4RZ5A 3DKJA 2Z1WA 3HV9A 3G1DA 3TCEA 1ME9A 3ZR5A 4ROPA 2EF9A 4IMEA 4GQQA 4QEHA 4PBFA 1H51A 3E0IA 4W86A 3VXGA 3WQ8A 1E15A 2QS8A 3WH8A 3TR9A 3WDQA 2FFIA 2R6OA 4RPPA 3K8LA 5T9CE 2VEGA 3L0NA 3LSCA 4JXCA 4W84A 1J6OA 1E6RA 1KR0A 5H8UA 2VR4A 4HB7A 1XCFA 5GNYA 1OD0A 3S47A 1GYNA 4MWAB 5LA1A 3QGVA 1HX0A 5I3GA 1LLOA 4IXXA 5HA7A 3HGSA 2XWEA 4AXNA 2DZSA 1XPGA 3W7IA 4PEKA 1TPC1 2A21A 4HA0A 2VCBA 1GQLA 1VAHA 1L6GA 3LHTA 3CHEA 3KL5A 2Y8VA 4AWSA 3SGZA 4AD2A 3WNOA 3SCUA 4HN4A 1GEHA 2D23A 4YN5A 3UJEA 2WK2A 1UR1A 3NM1A 3O1NA 1ZS2A 2ZTKA 4M7TA 4QRNA 4CN1A 4GIEA 1DQXA 4FXSA 4ZCWA 4DWSB 1OEPA 4YLWA 3L4ZA 1W3KA 1BYDA 1XCWA 1JF5A 2PTZA 3VI2A 5A3HA 3GNOA 4QM1A 3W7CA 1XCXA 3IANA 3SCSA 3T09A 3ZT7A 5D04C 2DVXA 3QZEA 4H6QA 1V6VA 3KWSA 2CW6A 3ZJKA 1T8QA 2C16A 1V5XA 1IV8A 2NQ9A 1XLLA 1N2VA 4GOAA 1PJ9A 1RQBA 3MB9A 4LAKA 1OIMA 5G1YA 1FWEC 3DCPA 4TMBA 1GWJA 1NFGA 4R7OA 3TP4A 3PPCA 3WUBA 2OQHA 3LMZA 2FVMA 4HK7A 3V36A 5G2IA 1M68A 5H6HA 1W1ZA 1AQ0A 4O28A 4Y2WA 1FQ0A 1A5UA 5BRQA 1UQZA 4C5YA 4QXIA 3KL3A 4NJKA 2V63A 4MWAE 2GOKA 1MZHA 1P0EA 3HPSA 4QNEA 1KM0A 1D7FA 3BLOA 3TWAA 4GABA 3E3HA 4XWUA 4LB4A 5EMLA 1DE6A 2NXIA 4AZCA 1V3LA 1VD6A 4HNUA 2D1ZA 2BXVA 2BHYA 1NQ6A 4Q8UA 3U9IA 3G0UA 3VC6A 4D6CA 1W91A 3EBVA 4I8DA 1PHQA 1YKWA 3CU2A 4WUIA 3C61A 3FW6A 3OZOA 3PHAA 3VZXA 1GVSA 3DN5A 1A3XA 3I65A 1UZDA 1V93A 4R27A 5LGXA 4LW7A 1OADA 2V5KA 1BSIA 4CNOA 2X30A 3M46A 2J7CA 1Q13A 1L0PA 4R53A 5A6TC 2VC5A 5FCZA 2SFPA 1RZMA 4LFYA 4B15A 1W1YA 1HJVA 3VMNA 3S9IA 2FB2A 1XW8A 3MY9A 1QDSA 3QRHA 1RHCA 1VH7A 3AHTA 4MJ4A 2OOGA 3CAVA 3HOJA 3DFNA 1X98A 3TFCA 3L65A 5AKQA 2YR1A 1H7WA 1N8FA 1AH4A 1HKVA 5F1UA 3FEMA 2V3DA 4XQ6A 1CCWB 3NL5A 1M53A 3NZRA 3T2PA 2WMHA 3GRIA 3REQB 2XDFA 3Q45A 4MVAA 2AL1A 1X8CA 2PDFA 2QW5A 4LGXA 4WKFA 5DBUA 3QQ0A 3MO4A 3W86A 4LVBA 4QQUA 3KTXA 1GVRA 3GVRA 1FWBC 3EXSA 3ITGA 4IIBA 1ZSXA 3PZIA 1FTXA 4FLOA 2VUYA 1OK4A 3G8RA 1FCVA 4AIEA 1ITXA 4DRSA 2RDUA 2ZIDA 4LBUA 5DANA 2C91A 3Q94A 3F7JA 2KZHA 2DVUA 1Y8BA 3PJTA 2Y6ZA 4ZO8A 1BG4A 5F2IA 3UCQA 2H9AA 3NO5A 3FXGA 1DXEA 2V5BA 3L23A 4Y90A 3OBAA 4ZEPA 1AJZA 1KV5A 2NQ5A 2ISDA 2ZCGA 4B3KA 3P67A 3MPGA 4B5UA 3PTKA 3I4EA 1TWSA 3LPOA 4MNKA 1VYRA 1P7TB 1G6CA 2E0PA 5K4ZA 3IVTA 1V6WA 1JFXA 3G0XA 1QW7A 1BFNA 3LGGA 1JPIA 4PMJA 4QCEA 1P0DA 2QCEA 2AKMA 5D30A 4GRSA 3FNDA 4HU3A 4LSBA 5H2ZA 2VZTA 1EJXC 2W66A 4ASTA 2FKPA 3HQPA 2ZZ3A 3RILA 4H8NA 1FFQA 4NG3A 4HGXA 3SN0A 2HCVA 4LAUA 5ABGA 4DLMA 4I3GA 3K4DA 1TVNA 4H19A 5D38A 2O55A 1FWAC 1KTNA 3E38A 3FJ4A 3QR0A 4O54A 4AU0A 5J8LA 2Y7FA 3T1GA 3QZAA 5FAGA 3C2RA 5C71A 2REQB 4CNTA 2GGJA 3SJNA 1MUCA 3MZ2A 2CXEA 1US2A 1C9DA 2Z7KA 2GOUA 1H7XA 2EJAA 3W7DA 2HJPA 4H6KA 2PGRA 4DO5A 2C71A 1NOUA 4M1BA 4D6DA 5AZ1A 3R94A 4EOUA 3NQGA 2PEVA 3FDKA 2OELA 3DXIA 2ATSA 4IPPA 1T40A 3QC3A 4Q3MA 3UW6A 4Z1DA 4W7VA 5MKGA 2DQXA 2ZXQA 5A2BA 2CEQA 4ZQNA 3CQ0A 3WNPA 3J7HA 4CQCA 4M0XA 2J13A 2J62A 3GC4A 5C2CA 5K4XA 1EXPA 1DJGA 3ZR6A 3L4XA 5AHIA 3O06A 8TIMA 2HS8A 1Q7ZA 4JFWA 2Z2BA 3PF3A 3W7LA 3V3WA 3AMDA 1JR1A 1SYTA 3GY1A 4Q8QA 3LI1A 3INPA 1V0LA 1JGIA 3T8QA 1QK0A 3R8RA 3IGSA 3TQ0A 5FA5A 1TPUA 1TV7A 1FDYA 2VEIA 4FNPA 3QHNA 3M0HA 4RDYA 2DT0A 3F5KA 1KM4A 4A35A 2CWNA 3GKAA 1FH8A 3FAWA 1E56A 1GOOA 3SGGA 1FH9A 4O1EA 3OP2A 3VNMA 2GJXA 3W1PA 3R4IA 1V08A 1ME7A 2Z2AA 1I60A 3CYJA 3QW3A 3T55A 1UOZA 4QG9A 2W27A 4JTFA 3ZZ1A 4KEVA 4CUCA 1NWTA 1KQZA 2YFOA 3B8VA 3GC2A 3VCCA 4I6KA 4JDBA 4RKAA 2B0MA 3L5AA 1H0GA 4NHVA 2EAWA 3MMWA 3BMWA 2E3ZA 1I0DA 1RJRA 3U4AA 4N6EA 5DMMA 2PS2A 3M0YA 1W2VA 1GVQA 2NX9A 6TIMA 1IZJA 4S3AA 1OINA 3W81A 4WXZA 4FF5A 4LYPA 2ZRUA 4Q4PA 2ASHA 5RUBA 1DWIM 3P81A 4KW2A 4S3KA 2IW0A 1XLEA 3NUKA 1YNQA 4W5ZA 1DYSA 3CLMA 3UD6A 3ZLHA 4MNMA 1QNSA 4PUKA 1V0KA 4K38A 1OM0A 3UWYA 4JZ5A 4CQ8A 2TRSA 5LIXX 4OUIA 4EVZA 2ZDSA 3TFXA 1EEPA 4M6PA 4C65A 1GW9A 4KRUA 3IK2A 1VS1A 1ISVA 2Y0FA 1E4MM 2PWEA 3E2RA 3GNPA 2BTMA 2FPYA 3DYMA 1XDMA 3TAOA 4PTWA 3BAXA 3ZMRA 3IGHX 4A6GA 3FA5A 1R86A 3IJLA 1R3YA 4GGBA 1GT8A 3T2OA 2HVOA 3PZQA 4OOUA 4RNJA 5D02A 4W9TA 2QAFA 5HAOA 4LH8A 4FALA 3UPBA 1XIGA 3VOFA 3UY8A 1VFMA 1TTQA 3TN4A 1ZBKA 3VIPA 3B8WA 1IIGA 1TCDA 3APGA 3VAVA 2XIOA 2BGSA 4PSPA 1VBGA 4FX6M 4LB3A 4GUGA 1UD6A 1Y5XA 4A3UA 2YBTA 4KEZA 4JHZA 1F61A 3R0DA 2V8ZA 1OX4B 3IIPA 1FXPA 1X38A 1ZHAA 1Z41A 3S9ZA 3DFTA 4DJED 1GVFA 2R1KA 4O8AA 2D3NA 1A47A 1UOKA 4UTMA 4XZHA 4M81A 3GG1A 2RDTA 3BPWA 4PGLA 1LRNA 2ZUUA 3NPWA 2WMIB 4AD5A 4EE9A 2QQ6A 1W6TA 4PMQA 1M03A 1YE6A 3LTPA 4S3JA 3FSUA 1VIZA 1KBBA 3S5YA 4D6IA 4DI9A 3LXAA 3H23A 3VPLA 1PIIA 2PD9A 2O0TA 3VNDA 4H83A 4M6UA 5M3WA 4PODA 2BHUA 3G1SA 3MA8A 5FJOA 2X05A 3DFHA 4QFUA 3AICA 4HTBA 3PY2A 4HCHA 3UEQA 1E72M 2A3BA 1FHDA 1M5WA 4JTLA 2J7DA 5ENLA 6PTDA 4IMFA 3S2MA 5E5CA 4O14A 3MHFA 1Q6RA 3TN6A 3NFUA 3VVGA 1UBPC 1RY0A 1V3KA 4XAGA 3ICJA 2XZ9A 3GHTA 3LN3A 4J3ZA 3VMPA 2ZOXA 1U2YA 3CNYA 3NQCA 3NPUA 4IIGA 4QJ1A 3MKCA 3SUUA 4E38A 2DJXA 2R24A 2EHHA 3LHZA 7REQB 4J2PA 4ES4A 1LDCA 4P5UA 4ADTA 1XYLA 4EAMA 1FOBA 1UB3A 3FOKA 1AL7A 3W27A 3DI0A 2Z1XA 2Z1SA 3DIPA 4CQDA 1TA3A 4Q4MA 3BUVA 1E5NA 3KBSA 1US3A 1KKOA 4GLEA 4U3CA 1A0EA 1K9EA 2FZDA 3BQ6A 1X1OA 2H90A 4PMNA 4L4LA 4H9MA 2I9EA 4J27A 2HRWA 3RCMA 3PVFA 4X0VA 2ZKMX 4DM2A 2I9UA 3NPVA 5M17A 5CPSA 2EQDA 4UOZA 1UWSA 1XRVA 1LJYA 4M6QA 1BVWA 3WF0A 3NEHA 1E4IA 3BWWA 3S8HA 1JJKA 4IUGA 2HDJA 5KITA 4MPQA 4PTXA 1Q6QA 4JQ3A 4NAEB 2BXZA 3MVTA 4FI4A 4GKLA 2YCIX 2GUUA 3OYXA 3CL7A 4F3HA 1KM3A 1MDLA 3DFYA 1NVMA 4GY7A 2J7EA 3STGA 2QNEA 4NUWA 1E6QM 3MDWA 4N4PA 1RK5A 2QCHA 3G8EA 3PJXA 4MWAA 3B40A 1ZJHA 1PWLA 1YE4A 4DO4A 3CXOA 3V16A 1W1VA 2PDHA 3SGUA 4JQ1A 4YTRA 3NGJA 4JOMA 5JBFA 3ZJ7A 1WZAA 3BCFA 3NOEA 4D6EA 3T9PA 2WZMA 3RF9A 5A6JA 1ML1A 4KETA 5LHEA 4L6HA 3LHUA 3K4AA 1LL6A 1PZ0A 1NTHA 4IL0A 4DWSA 1UQYA 1VQTA 1H5VA 1G4TA 3KXQA 3GDTA 2G96A 1EWDA 1B31A 5HQLA 3CH9A 1K9TA 1ZENA 2D0HA 4IX2A 3TXZA 4EXBA 3FJNA 3NSMA 2QXWA 4GINA 5A69A 4AEEA 2NXHA 1CDGA 3S1UA 4WHBA 3IJDA 2O4MA 1TRIA 4RZ6A 3W7OA 1K8ZA 2DT3A 1OFEA 4K1GA 3KDNA 3M44A 4WSJA 1FH7A 1Q7MA 3M64A 3NQ8A 3N12A 1DHPA 3NQBA 1AUSL 4PMUA 3HG4A 3IAPA 3GG7A 4K8EA 4WJXA 4ATDA 1R0MA 1W0MA 3K1GA 4PB4A 4TIMA 2E4TA 3CV2A 1WE5A 4YVPA 1HNYA 3WD4A 2D2HA 1W5QA 4BI5A 4XO7A 4EIVA 2PPGA 3U5YA 2ZX7A 4GJ1A 3AC0A 5LNRA 1OG0A 3KZSA 2B7NA 2J66A 2F6UA 1TWWA 5A94A 3T81A 3ZYZA 4DPQA 3DBNA 2A5HA 3BURA 2PC8A 1M7JA 3U2ZA 3KP0A 1RCXB 4PYSA 4Y6GA 8XIAA 4C1NB 4QNWA 4O13A 5LA2A 2P8BA 1MSSA 3AXIA 4MWAC 5F4WA 2NLIA 4S3EA 1CXEA 3RO8A 1UD5A 1EZ2A 2YL8A 3IIZA 4DJFC 5CJ5A 4KBXA 3NXFA 3VX1A 1GKPA 4AFYA 1UW9A 4DYKA 4A2RA 4DNMA 4B2DD 2PCQA 5AYXA 4E6MA 4ZE5A 1HT6A 2C14A 2PODA 4H3DA 3WX7A 5A5WA 2QCCA 1EJ7L 1JDAA 3BAJA 1W1PA 3S2JA 2AAMA 2VVNA 3MW7A 1VLWA 1UR9A 4GXMA 2W61A 3VDCA 1NDYA 3EB3A 2J8GA 3HIJA 1SJCA 2J77A 3IIOA 4Q8VA 2FVLA 2CIPA 3M47A 4HA1A 1ICPA 4MZ1A 1F4AA 2OPJA 3IJ7A 4GK8A 4IMGA 3S42A 1B2YA 3W6LA 3REQA 3ABRA 1BPLB 1EX5A 5C7HA 3N25A 2OEKA 4XBSA 3LY0A 5CPTA 1HL8A 3ZXWA 4JTQA 3TJLA 3QQWA 4JTHA 3WLNA 3KTCA 4NZ4A 3OTRA 5EKYA 1X6NA 1EP3A 1FBAA 3T8LA 3VKJA 4DPPA 3LM7A 3N4EA 4HCLA 1H7OA 4ZB5A 5HBFA 1BQCA 3VGHA 3H2CA 1DP0A 4GI8A 4S3DA 4K37A 3UVIA 5E9XA 3PZMA 2GPTA 1KWKA 4AWTA 2OZ8A 3WF1A 1RVGA 2FTWA 1X8FA 2XIMA 4B5VA 3PR2A 5CSRA 3H12A 4NXSA 3L5MA 1H5YA 1TQJA 3ZOAA 4ZB0A 2A6NA 1XSJA 2VEMA 3N1AA 3W2UA 2IPFA 5F7UA 1Q85A 3RHGA 3STFA 1BAGA 3IUIA 1B3ZA 1X39A 4JBRA 3P82A 3M41A 3T40A 4NY2A 2NQHA 1REQB 3C2YA 1TR9A 1AD4A 1AJ2A 3M0JA 2EPOA 3LMYA 1PUDA 1W9PA 3Q4DA 2V3GA 1P7TA 1NOFA 5C54A 1QUMA 4GCAA 1E73M 3EWUA 2A3AA 2VC6A 3W0KA 4QLJA 5AHLA 3HGOA 3QYSA 2BASA 1VHCA 3ZJ8A 1DJQA 2XH7A 3OEXA 3SN1A 4K3ZA 4GH3A 3P5YA 3RDKA 3PUDA 1QBBA 2GGEA 4I7UA 6A3HA 1K9FA 1PTGA 3B8DA 3H4XA 4J35A 1MVYA 4JQAA 4EX4A 5D03A 1MXGA 5CZ0A 2WNNA 2VFEA 4LY4A 1DJIA 5K3VA 4HNOA 2HE8A 2BG5A 1AVAA 3F4VA 3GFZA 1W8GA 5HMEA 2YA0A 3JZUA 4DXKA 1BVNP 3HB9A 1ISZA 2V2CA 1FWJC 2R9RA 1TMLA 3TK7A 5PTDA 4ZB2A 5CPNA 3T4CA 3WUFA 1X7FA 1RXOB 2R8WA 4C7DA 4UFKA 3G2GA 4KMQA 5AZ0A 2GSHA 4UQ9A 4G7EB 1MUWA 4L1GA 4XZWA 2REQA 3QZ6A 3C0LA 5I5RA 4O10A 1CGVA 1WXJA 5D37A 3TJIA 1CGYA 3B97A 3CB8A 1WKFA 2GJLA 2Y5JA 5FJJA 3GH4A 4FO4A 1OGSA 2ESCA 2PRHA 1E0UA 1QNQA 5CPOA 3LPFA 4RV8A 1MI3A 1F6PA 4KEMA 3BTNA 3RRXA 3B04A 1JZ6A 3BGJA 1FCUA 3PBVA 3RPMA 4IH3A 4D1IA 2FJUB 1E0XA 3LX9A 3IJIA 3CHFA 1OYCA 4B5SA 1JZ2A 2WKGA 3UETA 3F2DA 3U2EA 3HQ1A 1KFLA 1MEWA 2G3IA 3TH6A 1A80A 4XX6A 1JFHA 5I09A 4U3AA 2OEMA 3QOMA 4TV6A 2GVYA 2UV8G 4ML9A 5XIAA 3A9BA 2J79A 3FKRA 3CUIA 1K8YA 3CL6A 3KW3A 2QZRA 3GUWA 1KD0A 2ZRXA 3H70A 5CSYA 4DJDD 3BICA 1F5ZA 4BI7A 1LWHA 1HG3A 2GK1B 2PRLA 2QMKA 3QN3A 3IUHA 1UH4A 1V3HA 4NZ5A 3MYOA 1H60A 1KXQA 2OO6A 4QEEA 4Y9AA 4GD0A 1EDTA 3A64A 1T8XA 1LL7A 1ZAIA 3D3FA 1P6CA 3CASA 3NQVA 3H2FA 2AMGA 1V8EA 4GVHA 2NVAA 3WZ0E 2LLEA 5KEZA 1EUAA 2DZAA 2O9RA 3W72A 2X1UA 4POCA 3WQGA 3V7PA 3TYEA 1UKQA 1GYMA 3BJFA 3WD3A 3NZ1A 1OC7A 3O07A 4N9EA 1LT7A 4JFUA 3ZT6A 3WNKA 2BLEA 2HVNA 3U4FA 1WDQA 1JZ8A 1IF2A 1Q8AA 5D9OA 1R3QA 3C2VA 1VFTA 3DHDA 1B3YA 1S2CA 4DWSD 4HKPA 3UZXA 5I3FA 3UNDA 3NG3A 4AZHA 2OT0A 1Q65A 1GOIA 2D3LA 2VELA 4Z2HA 2J75A 4AHOA 3TV8A 3OLGA 1FWNA 3SCQA 1POKA 1W54A 3UYIA 3WLSA 4YS1A 3FXYA 3QLLA 4QGCA 3P60A 3L68A 4C6CA 5BWFA 3SUVA 4QHRA 2RGLA 2FMNA 1N7KA 4LWWA 1MMFA 1J6PA 4UFMA 2FB3A 4FP1A 3M0KA 2A79A 2YDQA 4H00A 5J5DA 1HVXA 5D9MA 4WIWA 3DFPA 3QHMA 4UR8A 5DN1A 1WCGA 3G6MA 3PBGA 1R9ZA 3T78A 1JRCA 1Q6DA 3GKFA 4U2YA 4CQ9A 2WZIA 2QUNA 2OQLA 3MO7A 1I45A 5HK4A 3GH7A 3B9OA 1O7AA 4BY3A 1OC5A 4JX4A 2YB4A 3W3OA 2WM0A 1LTDA 3HF3A 2ICSA 5DBTA 3JR2A 2EPKX 4AC7C 1PCWA 3QPEA