4WGHA

Crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with nadp and acetate at 1.8 a resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
283
structure length
283
Chain Sequence
VKKTVRFGEQAAVPAIGLGTWYMGEHAAQRQQEVAALRAGIDHGLTVIDTAEMYADGGAEEVVGQAIRGLRDRVVLVSKVYPWHAGKAAMHRACENSLRRLQTDYLDMYLLHWRGDIPLQETVEAMEKLVAEGKIRRWGVSNLDTEDMQALWRTADGEHCATNQVLYHLASRGIEYDLLPWCQQHSLPVMAYCPLAQAGRLRDGLFQHSDIINMANARGITVAQLLLAWVIRHPGVLAIPKAASIEHVVQNAAALDIVLSGEELAQLDRLYPPPQRKNRLDMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aldo/keto reductase from Klebsiella pneumoniae in complex with NADP and acetate at 1.8 A resolution
rcsb
source organism Klebsiella pneumoniae
molecule tags Oxidoreductase
molecule keywords Aldehyde reductase
total genus 83
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2014-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wghA00
2DUXA 2IQ0A 3P2VA 1R38A 1RY8A 4L1XA 2FZ9A 4XO7A 2AGTA 3GHUA 1A80A 3UG8A 3M64A 3FX4A 1S1RA 3QKZA 1AFSA 1X96A 3R7MA 1LWIA 1PZ1A 3RX4A 2FZDA 4LBSA 4DBWA 4JQ4A 4JIHA 1US0A 4FAMA 4DBUA 2J8TA 2IKHA 2PDWA 2PDUA 4XZMX 2BGSA 2HV5A 3ONBA 4JTDA 3EB4A 2PDPA 1Z89A 4PR4A 4WDWA 1AH3A 2CLPA 4YVPA 1X97A 3MB9A 1ADSA 3CMFA 4XZIA 3G1RA 1XF0A 3H4GA 2IPGA 4WDUA 3GUGA 1AH0A 1VP5A 3LD5A 4ZFCA 3LQLA 2HVNA 3GHTA 3V0SA 3U2CA 5LIXX 2PDBA 4GCAA 3D3FA 1HQTA 1S1PA 1AH4A 2HVOA 3C3UA 2FZ8A 2P5NA 3G5EA 4XK2A 1ZSXA 1JEZA 5HNTA 2WZTA 1RY0A 3DOPA 1Z8AA 3KRBA 2ACQA 3LZ5A 3UWEA 3BV7A 3CV7A 3DN5A 5LIUX 2ACUA 3LUTA 2PZNA 2IKGA 3CAVA 2I16A 1PWLA 4QR6A 1MRQA 3R8GA 2IKIA 2IPWA 2PDMA 2FVLA 1QWKA 4GQGA 4YVVA 2IS7A 4GABA 4WGHA 2IPJA 4H8NA 5C7HA 3UZYA 2PDGA 3H7RA 3N6QA 2F2KA 3V35A 1M9HA 1YE6A 2HE5A 5DANA 1HW6A 2NVCA 5LIYX 4XZHA 3ONCA 3EB3A 2PDNA 4XVEA 1S2CA 2NVDA 4PUUA 1MZRA 4XZLX 4WDTA 1XGDA 2IKJA 2PEVA 3Q67A 4JQ3A 3R6IA 3N2TA 1PYFA 4WDXA 3WCZA 3R43A 2PDIA 2FGBA 4Q7BA 4QX4A 1K8CA 1C9WA 2PDYA 1IHIA 5LIWX 3WBWA 2R24A 4JQ2A 1QRQA 4NKCA 5HA7A 4PRRA 4GQ0A 4FALA 3LQGA 1GVEA 1FRBA 1IEIA 2DV0A 1VBJA 1EL3A 4OTKA 2F38A 4JIIX 3S3GA 4WEVX 1YNPA 2ACSA 1T40A 3UZXA 4LAUA 2R9RA 2PF8A 3UP8A 2HE8A 4LAZA 3UYIA 3LENA 1S2AA 3CASA 5LIKX 3LZ3A 2INEA 3R8HA 2PD9A 4GA8A 1Z3NA 3V0UA 4ICCX 2ACRA 4LB4A 2C91A 3NTYA 1AZ2A 4DBSA 4IJCA 2IPFA 2FZBA 3RX2A 4XAPA 4PMJA 2DUZA 2PFHA 3VXGA 2PDJA 4XO6A 3V36A 4GIEA 2BGQA 4LB3A 1ZGDA 4JQAA 2BP1A 2I17A 3H7UA 2IQDA 3R58A 3COTA 5KETA 1ZUAX 3CV6A 4JTQA 4PUWA 4IGSA 3M0IA 2PDXA 3WBYA 4PRTA 4ASTA 3GHSA 1LQAA 2PDHA 2A79A 2VDGA 3FJNA 4I5XA 3ERPA 2PDFA 3Q65A 1PZ0A 2PDQA 4FZIA 2PDKA 3B3DA 4XVDA 1UR3M 4JTAA 4JIRA 5M2FX 3O3RA 4EXAA 4JQ1A 1AZ1A 1YNQA 4HMNA 5HNUA 2HEJA 3WBXA 4WRHA 3T42A 2PDLA 3LN3A 5JH2A 3UZWA 1OG6A 2ISFA 5AZ1A 3LEPA 2WZMA 1YE4A 3M4HA 2PDCA 2ALRA 3BCJA 1Z9AA 1T41A 1EKOA 4LBRA 3GHRA 1J96A 3O0KA 4YU1A 4GACA 4EXBA 1EXBA 2INZA 1SM9A 1EF3A 4G5DA 4QXIA 4MHBA 3CAQA 4RPQA 3LBOA 1PWMA 3R94A 4JTCA 4H7CA 4YVXA 1XJBA 1ZQ5A 3WG6A 4QBXA 1Q5MA 1Q13A 4XZNX 3EAUA 3MC5A 4YS1A 4DZ5A 1RALA 3RX3A 1MI3A 1X98A 3UGRA 4AUBA 4Q3MA 4HBKA 4R9OA 5JH1A 4JTRA 3UFYA 3F7JA 3UZZA 4FA3A 2QXWA 4F40A 3LNMA 3V0TA 4IJRA 3BUVA 2HDJA 2PD5A 5AZ0A 4L1WA 3BURA
chains in the Genus database with same CATH superfamily
4RE4A 4AHQA 2DEPA 3GTIA 3V5CA 4JX5A 2EJ1A 4MKVA 1O5KA 1UA7A 1XBYA 1A80A 1PHWA 3UG8A 3R8RA 5E0KA 3B9EA 1YTKA 1S1RA 1M7PA 4PA8A 3S5ZA 2VKZG 3R7MA 3W37A 1TPUA 4O12A 5SWUA 1QXLA 1A4MA 1FDYA 3BARA 4FAMA 1PO9A 2J77A 2J8TA 3GS6A 1B3YA 2WVUA 5BWAA 4GO8A 4DYEA 4F2UA 1HJSA 3TTQA 3SN1A 3B9DA 5I06A 4KEVA 1Z89A 1DJZA 4AWEA 3AXHA 4KGJA 4XTDA 3M7WA 4P8WA 1MRAA 1KFKA 1OWQA 3DC0A 3C61A 4FNRA 1NAL1 1XLFA 5REQA 1ZJHA 2OLHA 2Z7KA 4J9JA 1DHKA 3FGCA 1VR6A 3BJTA 3C4UA 4AY1A 2DZWA 3NYZA 2OWXA 4ZQPA 4HSNA 4ZO6A 4BCEA 2ZX9A 3TOPA 5LIXX 3J7HA 2FZNA 2ZZ6A 4A3QA 5AOUA 3KUMA 3WF3A 4UCFA 2PA6A 1PIFA 3KBVA 3RG6A 4MVAA 1EA9C 1ONEA 3IVTA 3N2OA 2WMIA 3WJSA 1W5MA 1UR8A 4LS1A 4GVIA 5DT5A 1FWIC 5BNKA 3AZRA 4IL2A 3B4UA 3IANA 4BHYA 2ZRVA 4PFHA 2GOKA 4GX8A 3AI0A 2RJHA 4UR9A 1A5CA 2PGRA 3MBFA 2QAPA 1B3VA 2C1IA 2WHLA 1XIGA 4EKJA 4HVXA 7REQB 4DM1A 3B0XA 3ZJ6A 3OA3A 4GQGA 3MMWA 4O0ZA 2A0NA 2CNCA 3HMCA 4K39A 3FFSA 2GVJA 3WSUA 2CEQA 1DL3A 2X40A 4GIAA 3BLFA 3O6AA 1XFCA 3IIXA 4TX6A 1R6WA 3V35A 3MV11 4E6MA 3GDRA 1R87A 3TWAA 4DO4A 1XDJA 3SR7A 5EMJA 2J25A 4TX9A 3NVTA 4JYEA 4GQQA 3TN3A 4QP0A 4N9DA 3E49A 1V6XA 4LRSA 2C71A 3N18A 2JGYA 4XBSA 1S2TA 1C3FA 3KP0A 4P7OA 3XISA 5I3DA 4ICNA 3ZYZA 5HWJA 4Q7BA 4QX4A 5D9MA 2HJPA 4NL1A 1B3OA 1AW1A 4KCUA 3R4IA 2RDTA 3IARA 1K02A 2XYLA 5F2MA 1P0EA 1JG9A 2Z6JA 4C6KA 5G4HC 1C90A 4NF7A 1O68A 3HMJG 1WUFA 4GI6A 3TX9A 3B4YA 4FPSA 4RZ5A 4GQ0A 3WH6A 1HL8A 1JF5A 3GVGA 4IPIA 4K8EA 1TPB1 1CB7B 5G1TA 1TRIA 1TZ7A 1LBMA 1TPDA 2A3HA 1XSKA 2PF8A 3LI0A 4GYJA 3GNRA 4AZ6A 4WOQA 3QV9A 5AN7A 5FEZA 1TA3A 1OX4B 1GHRA 4GA8A 1W2PA 1KFWA 3BMWA 4U2YA 1JDFA 1L8NA 5FEWA 1VBUA 3W1TA 3WD3A 1NP0A 4W8BA 3AHXA 4CCCA 1QNOA 3EA2A 4LF1A 3IIPA 1ZFJA 2QCCA 4TVUA 3EOEA 3EWWA 4JQAA 3I3DA 2VUYA 4ZSUA 5KZDA 3OPSA 3R58A 4MZ1A 6PTDA 4N7QA 4JTGA 1M3UA 3KVLA 2DZAA 4NZ3A 4LH8A 1M6JA 1PUDA 3K8KA 3TR9A 5MKGB 1W2VA 4I8DA 1MW0A 1S2UA 3P82A 3L2MA 4J4KA 3L4TA 1PX3A 3CPRA 3B8SA 5GPRA 3IGSA 4L64A 3L5AA 4LEFA 3STEA 1L6GA 1E5NA 2IW0A 3P8JA 2ZBTA 5BZAA 1B54A 4IPLA 1UZHA 2HK0A 1NOUA 2H9AB 1GW1A 2FGZA 4MWAE 1XPGA 3WMCA 4DPQA 2GYIA 2VMFA 3LS9A 3W7HA 3SFKA 3WBAA 5JH2A 4GNJA 1SJCA 2TODA 3A13A 3KTXA 2OEJA 1OG6A 1Q7ZA 2DH3A 5A5WA 2OG9A 3HZ3A 4UZSA 1QBBA 4LNCA 4RDVA 4Y9NA 1EBHA 1G67A 1TV3A 3W1NA 2WSQA 4OU1A 3WLHA 4MNKA 1D9EA 4UOZA 2ZOXA 1TJ2A 1A3XA 1W9BM 3PJXA 4C7FA 3BGJA 4G7EB 2Z26A 2YYUA 2HXUA 1R3YA 1Y8BA 1FBAA 3E5BA 1UWRA 1J01A 2HS6A 4LWWA 3W7GA 1ME7A 3VDBA 1WKYA 3S5NA 2Z6IA 4Y96A 3WG6A 4C6CA 1W1VA 3B04A 1V3LA 4ZE4A 4GE8A 3WD2A 3RX3A 5M3WA 1A49A 2NSOA 3KVJA 3CLWA 4KWOA 4CNPA 5FF4A 3OO2A 1UA3A 1VRDA 3VGGA 3L2LA 4R33A 4I6VA 1WOBA 3PNUA 1NDYA 3PZGA 8XIAA 1SW0A 4IP4A 3W6LA 3IACA 1U30A 3B0UX 1WO2A 3MHFA 2CLMA 4O28A 4H3DA 1HO4A 3RN6A 3VZXA 1B90A 4AAJA 5AZ0A 2PP0A 4GXPA 3W75A 5E9XA 1DJYA 5GQBA 3BJFA 1DE6A 2AGTA 4NZ1A 1I4NA 2RHGA 1GOKA 3W7NA 3T2QA 1IR1A 3U5UA 4H9UA 4HMEA 3KZPA 3UYCA 1SR9A 4LXFA 3UG3A 4HNOA 4AEEA 3AOFA 4QRNA 2NWRA 1BYDA 3QR3A 4PUJA 1G4PA 3TFCA 1AD4A 4UQAA 2BGSA 3QFEA 5A8QA 1ZHAA 1OK6A 3JUGA 3HQPA 5BU6A 1WDSA 2H8XA 1AH3A 4LUIA 1PDYA 3IGXA 3MI2A 4UXDA 3CTTA 1I60A 4JEJA 3SUTA 1FHDA 2ZIDA 3AICA 1EP1A 1SQ7A 4YL2A 1U1UA 5JIWA 1G5AA 4K7VA 1KD0A 3TCSA 1SW3A 3HQOA 4A8LA 1OVDA 1UKTA 2G0WA 2QV5A 1A0DA 3GNOA 3MYPA 3BAWA 3U5YA 2Y7GA 4WXYA 2V5LA 1I9CB 5DQPA 3WMSA 4L9XA 5D04C 3SY8A 4PMZA 2NUYA 3UWEA 2C8NA 2B4GA 4S3GA 4S3FA 2NV2A 3WNMA 2R1PA 1OX5A 1T8QA 2V9DA 1XH1A 4GBDA 3O16A 4IHCA 3B8DA 1V02A 4G1NA 4EE9A 5CC3A 1H1YA 2Z2BA 1B0IA 2VCAA 1QWKA 4GUJA 3UWZA 4DO6A 4CD8A 1WV2A 4MF4A 3VIJA 2FB3A 4DQWA 1VEOA 5JIPA 2GUUA 1BGGA 2GQ9A 3NQCA 3ES8A 1LLWA 1M68A 1V0MA 2Z24A 3VOJA 4ZB0A 4CQAA 5AHIA 3NQMA 5G1YA 4UFMA 3BCFA 5CZ0A 2O4MA 4C6OA 4F2BA 2J62A 2J7HA 1S5NA 1UWTA 3G1VA 2QJNA 1LT8A 4DWSD 4E3TA 3W88A 3ITGA 3W72A 4BFAA 4O14A 1HP4A 3MZ2A 4QEEA 5AHLA 3WUFA 1YNYA 3IAQA 3N13A 4Z2HA 2VO5A 4NJHA 3DUGA 3TYCA 3DXIA 2QPSA 5D9OA 4EPEC 1BWLA 1OFDA 1UR1A 3K1GA 3UY8A 3NO3A 4BI5A 4NT0A 5FOOA 4ZXLA 3SQMA 4CCEA 3SUWA 1LL4A 3LTYA 1B5TA 3P67A 3QZ6A 1KWKA 1R0MA 4EAYA 1PZ2A 2HBVA 4WY0B 4IQLA 5CG7A 2F6XA 2R9RA 3P5ZA 1ZNNA 3DX5A 1EJ7L 3LERA 5LIKX 1ZAHA 2INEA 3R8HA 1JNEA 3VFCA 4F66A 1BQGA 3GU2A 3AAMA 3UEQA 1VAHA 1CEOA 3LY0A 4PCNA 3U2ZA 1HNYA 1MQPA 1V3HA 1ZZMA 2IPFA 3UQNA 4F3HA 3G24A 2YCLA 1F3WA 1XLJA 3BOXA 2GOUA 1QDSA 1UD6A 2MUCA 4KRTA 4WK9A 2TAAA 1WX0A 5J5RA 2GQ8A 4I7WA 1YTEA 4W4QA 4QNEA 3A4XA 5H8UA 1ZGDA 3CPGA 4FLQA 3TDFA 3H22A 1W37A 3CV6A 5A6LA 5HDRA 3WQ8A 3S2MA 2EKGA 3V5OA 3B8IA 3WBYA 1H7NA 3SSJA 2PDHA 3SCSA 2DW6A 2DZTA 4JCLA 3II1A 3P60A 2Q09A 2AKZA 3MSYA 1O5XA 3GIYA 2BASA 4WKFA 4C90A 4IFRA 4RCXA 1GTEA 2DT3A 2ODOA 3HJEA 4MKNA 1N8IA 5LKYA 4S3AA 1CTNA 3C0JA 3NPVA 4HMNA 2CIPA 2QHAA 5CBJA 4XAZA 4WRHA 4AD5A 2PDLA 3BW4A 3QLLA 3LN3A 3WL1A 1AQHA 5AHMA 3MI3A 4GI9A 3PPGA 1WAUA 3L2IA 1OGSA 5AZ1A 4DYKA 1A0EA 4H83A 1VRXA 2F9RA 3LEPA 1RLDA 4ZQOA 3MO4A 4RDYA 1TE1A 4GOAA 4IWWA 4D6DA 1E6ZA 3WDPP 1Z9AA 3A21A 4IIGA 1J4EA 3LHTA 5DT7A 4HPJA 1E1FA 4OV9A 3V4BA 3AZSA 1E73M 2BG5A 3VUPA 4WX2A 1RK6A 3E12A 5FF3A 4JN8A 3C0SA 3DDMA 2QPXA 1FHVA 9CGTA 5D2VA 4DRSA 2E9MA 4PBEA 4GCXA 3STCA 1BHGA 3LCGA 4UR8A 4QITA 5ECVA 1E6RA 2BB0A 3OVPA 3N4FA 2OSYA 3R89A 1FVPA 3HGSA 2CZVA 4X3ZA 3EPOA 4MWAA 2Q8ZA 4JTKA 3S42A 1A5KC 4DJDD 4XUGA 3RILA 1X38A 2VD8A 3AHVA 4JTRA 2UV8G 3UJEA 1DJHA 3BZGA 4BF5A 3PZIA 5GJPA 3OQ8A 1DBTA 1E70M 2JEPA 3TH6A 4QCFA 4IJRA 4N9BA 3NPUA 1FXPA 4NJKA 3SURA 2WW5A 1GJUA 3SN0A 1DPMA 1OCJA 1ZJAA 3D0CA 5HNRA 3MP5A 5K4XA 3RGTA 5TD4A 4XIMA 3M5VA 3RXZA 4I9MA 5EFFA 3W7DA 4DUOA 1RR2A 2FH8A 1IT0A 2ZA1A 3KRSA 4L65A 4Y9PA 3CZ8A 4D6CA 2A5HA 3FEQA 2ZFAA 2BOEX 5KINA 3WLQA 4GMEA 3W7MA 2F7FA 5CJNA 3L0KA 1MW3A 3M9YA 2GPTA 3ONBA 2VOTA 2FDMA 3PZOA 1VFFA 3QOKA 2E67A 1NU5A 4JFTA 1RUSA 4XQ6A 3TYUA 3AXIA 3PSWA 3N11A 3V1HA 4JX4A 4O0KA 3AYTA 3F4VA 3ARUA 3T4CA 5LNRA 4IXXA 3N15A 4MIMA 1EFZA 2GQAA 2OEKA 5CH9A 5BXPA 4U2ZA 4H6RA 4HGXA 3O8AA 3GUGA 1ZRQA 1OBAA 1X6NA 4M51A 3QPYA 4Y7EA 3MDWA 3SUSA 3BGGA 4ERGA 2V2CA 1HKKA 4HOZA 1BLIA 4JYDA 3OVRA 3CB3A 3G2GA 3WX7A 2X7WA 4N4PA 2GGIA 5KZEA 4GH1A 3WFAA 3OJGA 3Q94A 3EX4A 4QLKA 1WPCA 1WZLA 2EQDA 4KIRA 4DY1A 2WZTA 2FTPA 4UOQA 1FWBC 3QY6A 3CZKA 1HXJA 3CWOX 3LZ5A 2NXGA 4PMYA 1BYCA 4H9YA 5ABFA 3BANA 4TX8A 1OADA 1ZAIA 1BAGA 4XTIA 4XKYB 4Z1BA 1KFCA 5AC8A 2GVLA 4KCVA 3MKVA 2O9TA 3QYQA 3CQKA 4J3TA 3UWUA 4NU7A 4Z42C 3GU9A 4TO8A 3PZTA 1TX2A 2ASHA 1TIWA 4YN5A 3RPMA 3WLMA 1YPIA 4O50A 4J2MA 1SZNA 1HX0A 2YR1A 1AODA 1LORA 3OG2A 3TAOA 3URQA 3CIVA 3UJRA 1ZCCA 3UNDA 5I3HA 1PYFA 1AW5A 3K4AA 2ZVIA 4PMRA 3WEMA 3DI0A 2E7FA 5HINA 3W85A 3OB8A 5HMEA 4C6MA 3DYOA 4XG1A 1G94A 1A3WA 5CSRA 1YKWA 4PSPA 1KGXA 5EKYA 1LRQA 1VBHA 4WXZA 5AECA 3OW1A 2E5CA 3BLIA 4RZBA 3ARPA 1CCWB 1MQQA 1OCBA 1HN1A 1QAPA 1ITUA 1HJVA 1KRBC 1MUMA 3NQEA 4X0NA 5A94A 2YA0A 1E0WA 3G1DA 4H6EA 1QOPA 2EPMX 4FNTA 3VKKA 1TZ9A 4GQRA 1JPDX 4DNMA 4DUXA 1IEWA 4UUIA 3CASA 2OLAA 1FWRA 4TIMA 1RPXA 1LWJA 4PUNA 4X22A 1A5OC 4NXSA 3NTYA 3BLKA 1FHLA 2X41A 2PTYA 3RX2A 3QN3A 3WLRA 3UCQA 1F05A 1VD6A 1QPRA 2F84A 3UD6A 3MUZ1 4LAKA 2VC9A 4X63A 1Q6DA 4X0VA 3SM0A 3WQVA 2PLCA 3S1UA 2X1IA 3ITTA 4UMBA 3WD0A 4Q22A 3NDZA 2ATSA 4DWSB 2F6KA 3H2MA 3TUUA 1GG0A 3AXKA 4RUBA 1KRCC 1IEVA 1MFVA 3N9KA 3H6OA 2PDXA 2CPUA 2D2HA 1EC8A 4PFMA 1TYGA 4I5XA 4MJMA 4N9CA 4POCA 4D6FA 5BYWA 4YCPA 4GFIA 3AIBA 1J6PA 5BXSA 4CUCA 4XVDA 3SUVA 3E6EA 1XSIA 1B3ZA 2Z7GA 1ZLPA 4LVAA 3I3BA 3GXFA 4DJFA 5DMNA 4YWSA 4PTWA 3O3RA 4AYSA 4MLJA 1TRDA 3SEPA 4PL2A 2VFHA 1GOXA 3I10A 4YNGA 5HNUA 4NX0A 4HHPA 1TPC1 1TMLA 2XZ7A 2DT2A 4LW7A 2EPNA 1AJ0A 3MS8A 1AQMA 1DV7A 4M0XA 2PGWA 4RDWA 5D2YA 3RMJA 4DX3A 1ZENA 3PNZA 1CECA 1M03A 1UH4A 1FY6A 3AJ7A 1YE4A 3M46A 5A8GA 3WJWA 2B81A 4BR1A 3V3WA 3LCHA 5DX7A 2FHCA 3GIQA 1JCTA 4BQ5A 4DLFA 4P5UA 5IFTA 1HG3A 4RZ4A 4ZOCA 4QJ3B 1EYEA 2J66A 3WDRA 1XDLA 3M0XA 1P48A 4H8UA 2ZTJA 5CBBA 5L9FA 4LS0A 4D71A 4KKXA 3SGGA 4O0QA 1UR2A 3WH8A 4MPKA 2QGYA 1CDGA 5DMMA 5FJIA 4J35A 1XG4A 3WLNA 1DWGM 4PN2A 4NASA 1YDVA 1K3UA 2QCNA 2C13A 4DB7A 2YLLA 4YMZA 3S4TA 1EDGA 2YFNA 2WM0A 4HNVA 2D2GA 4Y9MA 3GH5A 3GAKA 4MY1A 2Z00A 1DE5A 1TPFA 1TPVA 4PMNA 3ECQA 5CPOA 2DDXA 1NJJA 1J12A 2CZDA 4W88A 3PZVA 3XINA 1VEMA 1PAMA 1POKA 4IMGA 1R2RA 4MZYA 1EO5A 3WF4A 1GEQA 1UUQA 3V0TA 3FY1A 3W27A 2HDJA 4O10A 4XD4A 2YX0A 1X8FA 3NA8A 1UP0A 2X2GA 5BXTA 2VR4A 2DPEA 4CD5A 4F0RA 5I77A 3VGEA 1ML1A 4J3SA 1CI1A 3QMTA 4JGDA 2NXIA 4S23A 4GJIA 4EX4A 4CQ8A 3S2NA 4B2DA 4JIHA 4NAEA 1RBLA 3VOHA 3H2NA 3UA4A 3CB8A 3OG3A 4U3AA 3SCTA 4HU8A 4A2SA 2GL5A 1TV7A 1Q6LA 2WAGA 3WDIA 1EJWC 1VJZA 3MB9A 1F8MA 5EB8A 4IIBA 3CMFA 4R3UA 1V5XA 2E6FA 2CLKA 3ZFHA 5LA1A 4HZ7A 4ZFCA 2GK1B 1KWGA 2WMKA 3I68A 2I5IA 4V33A 1XI3A 3K46A 5IXEA 3DHPA 4DM2A 4EWJA 3E0WA 5EBUA 4PZVA 3OIXA 3PPCA 3N6JA 4UZUA 2GZXA 3TNOA 4JOMA 4GYPC 4O18A 4US6A 2F6UA 4RV3A 4H00A 4KWVA 1E6QM 2CLOA 3W1UA 4YTQA 3CL6A 8RUCA 3P14A 1F8IA 1TG7A 4IL0A 2R82A 3TSDA 4ZXOA 4R27A 1ME9A 3ABRA 1SO6A 5I23A 1JCYA 5FSDC 5LA2A 4W8LA 3ARQA 4IGNA 1TVLA 3WDHA 1P7TB 3KOFA 1BWVA 2WOQA 1QOQA 4HN4A 3UG4A 3KW3A 1PKMA 4AIOA 4DWSC 3MTWA 2VENA 4GY1A 4OZOA 4XZLX 1Z42A 3WCZA 4MB4A 2OKOA 1O1HA 2FYMA 3M0ZA 3LX9A 3DG7A 5HANA 3IUDA 3LHUA 5A6SA 2E9LA 3WUGA 1K8CA 1NELA 1NP2A 3NSNA 1C9WA 3SAZA 2ISDA 1BVWA 3BSGA 3M5XA 2PDYA 3P3BA 4J3UA 1V08A 1QW7A 2QUUA 3AWNA 2G3IA 2Y7EA 2CBJA 4PRRA 1J10A 2G4FA 4M3PA 5B7YA 1Q6CA 2BGNE 1GQJA 1TV8A 2G3NA 3BAXA 4HYRA 4CN6A 2JIWA 1JYNA 3TJ4A 3H4WA 1G01A 3P6LA 5A6JA 2X0HA 4JKKA 1O5RA 2MANA 2R8WA 4LYKA 3EXRA 4AIUA 2HE8A 3M16A 3Q4DA 1P6WA 3GWQA 5RUBA 3M7SA 4JHMA 1Z3NA 2D22A 1WOAA 3VNJA 1TREA 4JIQA 4NXKA 2QAFA 1OFQA 4UQ9A 2J75A 5B7ZA 2EF9A 3PBUA 1J0JA 2XFYA 3GDMA 1OC5A 5FEPA 1VPXA 2BXVA 4LUTA 2NWSA 1EB3A 2AAMA 4NNBA 4HA4A 2VQUA 3K2GA 2Y88A 3WLLA 1SZGA 3C5QA 2BFGA 4K68A 4LYQA 3G8RA 3GR7A 1AVAA 3U3HA 1X39A 5ABEA 3CM4A 3E9AA 4MY9A 2V82A 3EDJA 2XGZA 2VX4A 5HQMA 4BZYA 2VELA 1EP2A 1LLOA 1JRCA 2WO5A 4Q4SA 3T7VA 1PX8A 2IMRA 3P84A 3SY1A 4QG9A 3TC3A 1GVIA 3NG3A 1KBLA 1WE5A 4JIRA 1FUYA 1GVOA 2C0AA 4CKQA 3VM7A 4Z2GA 2VHLA 5K2ZA 3UBPC 3FS2A 3FKRA 3KHJA 1GYNA 2VI0A 2V81A 1ECEA 3AC0A 3SQSA 3T0DA 4OFCA 2AL2A 1EWDA 1TR9A 3WJYA 3ARSA 2P0IA 3TIMA 3HOJA 2OYLA 3WD4A 3URAA 3C2FA 2C14A 4ML9A 2QDGA 5LXXA 1FWCC 3MUAA 2PWGA 1KBIA 1Q65A 3TQVA 4JDYA 1SM9A 3NIYA 4FXSA 3BW2A 2A3LA 3DFTA 3ARWA 1A5MC 3W2MA 3R2GA 1R2SA 3TYBA 3KDOA 4H9VA 2WMJA 3UW6A 1XW8A 1Q5MA 1S5WA 2QPUA 3AHYA 3L4UA 4D2JA 4QAWA 4D6HA 1J0ZA 2PWEA 1RP9A 3I6TA 3ICJA 3PBYA 2GJXB 1H0GA 4Z08A 1XIEA 4H9ZA 7XIMA 4FX7A 1U2YA 2VM8A 4R9OA 1KFLA 4QGCA 4U33A 1IYXA 2H3DA 4FA3A 4G9PA 2WCAA 4AIEA 1O4UA 3W1QA 3CO8A 4JR5A 1H49A 1P7TA 3T1GA 1KCLA 1M1BA 3C2RA 3CHVA 3KBSA 4O1DA 3TQKA 4FXFA 1TELA 1WXZA 1IGWA 1NF0A 4AZ5A 2AMGA 3BURA 4XX6A 4DJEC 1QHZA 1LG2A 1NWSA 4GINA 1EQPA 2X8RA 3ZJ8A 2QGHA 3MUXA 3RR1A 2RKXA 5CGTA 5CGMA 1R9ZA 1RQEA 3ARTA 4BF7A 1E56A 5CPTA 3MP3A 4UMCA 2V5KA 1QK0A 5GNXA 1US0A 2QJMA 1DJIA 4LY4A 3I6RA 3OU8A 3C52A 1I0DA 1ZCOA 1OT1A 4AC1X 2DIKA 4ACZA 1GW9A 1UIOA 4U3CA 2DORA 4X61A 1PZ3A 4N4QA 1EJRC 3RM9A 4WHBA 3MUIA 4IICA 1D2KA 2NX1A 4IJBA 3L67A 2BNJA 3OLDA 3OYZA 3R0KA 4C6NA 4G1KA 2QMJA 1U1JA 3E2VA 2Y0FA 1V79A 4O1FA 4AEOA 4JFVA 4LCRA 2XN2A 2QCDB 2OKTA 1RH9A 2VGFA 1CGUA 1HKMA 1Y5WA 3PZMA 1FH9A 1UZ1A 4EWND 4WLCA 3LGDA 2QUNA 3B8WA 1F4AA 3QQWA 1QI3A 4FI4A 1F3XA 3TP4A 3SGZA 3H2CA 3BH4A 2OPJA 1FCBA 3BQ6A 1D3GA 1V0LA 2ZC1A 3KOWA 4R7WA 5FI8A 4KEZA 2Y5JA 4HSHA 3F4DA 5HNNA 2I16A 4PODA 1KFEA 4QHRA 3BV4A 3I3EA 4DAIA 5JXQA 4WY0F 1POJA 1Q6RA 4Q8TA 3PJWA 2XVKA 4NZJA 1JCXA 3KCOA 3ARZA 1SVDA 4B3ZA 1C92A 3TNBA 4U10A 1XC6A 3RPTA 2PDGA 5A2CA 4Q8WA 3H2EA 1JUEA 3MP4A 3W26A 4MB3A 4H1ZA 3MQTA 4NSBA 5BMWA 2WM1A 3NOYA 5D2XA 1I1XA 3LCWA 4QDMA 3VC5A 3DECA 4FLOA 1G1YA 3S6TA 4RE3A 2QJIA 5A3HA 1OM0A 4O1CA 1OF6A 3ELFA 4A3YA 1JZ6A 1ISVA 1CNVA 2HMCA 5AY7A 2YA2A 2Q3OA 3LLFA 1HJUA 2Z1XA 3MW7A 5AVNA 1LROA 1HTIA 1VKFA 3EZ4A 1TV4A 1DWIM 1F6YA 2AL1A 2OB3A 2BHYA 2NV9A 3MI6A 4ERAA 3QKEA 3EXSA 4ML4A 3LQGA 3WQGA 4D1IA 4HPGA 2ZDSA 4EPKA 3BQ5A 3POHA 3S3GA 2ZUWA 2Z0IA 3KOZA 2FPTA 3M0MA 1REQB 3TA6A 1BXBA 4AFYA 3W22A 4BKNA 3UETA 2ZA2A 1Y7VA 5HQEA 1Q3NA 3LLXA 2X42A 3W07A 2XVGA 3LZ3A 4QE4A 1DQUA 1QT1A 3P80A 3THCA 1JZ5A 3C56A 3N2BA 2I9EA 3B8TA 3KHDA 4JTHA 1XLDA 3R10A 4GYKA 3VU2A 4LB4A 3M5ZA 2GK1A 1E71M 3MUCA 1HT6A 2Z29A 2FZBA 4A29A 4MGGA 2GJLA 3SFWA 4W9TA 2J7EA 5C70A 1W6TA 5G2WA 2WCSA 3ZVHA 2D69A 1RJPA 2E1DA 1LZOA 2ALDA 1GPFA 4AYGA 1RLCL 4WVXA 3O07A 4LV4A 4HHLA 4HP5A 3GDKA 4L6OA 4H2CA 5DF0A 3NQ7A 2ZUSA 3M0IA 3ABXA 3GHSA 4GC3A 2QCFA 2A79A 3LV5A 3PJTA 1BVNP 1W8SA 2XIIA 1OZMA 5A1AA 1X6UA 1OYAA 3S0CA 2FH6A 2YOCA 1RZMA 1UD2A 3RF9A 1EQCA 4ZEPA 3G8EA 4QG6A 1UYQA 3QW3A 2QIIA 2O56A 1F4HA 4J1OA 2DUAA 1UKPA 1CW2A 3QMSA 1ITCA 3WNKA 1JZ3A 1IEXA 2ZZ1A 2VZUA 3EOSA 4IQJA 5LNWA 3BCJA 3NL5A 3THQA 1GG1A 4GXMA 5MKGA 3O0KA 1I2RA 1JJKA 2BHUA 4DNHA 3FJLA 3KTSA 1QCWA 4HTYA 4RKAA 4GGBA 1OGBA 5GNYA 5T9CE 4XSMA 1BYAA 2R14A 3MMUA 1KLYA 1ZBVA 3P0XA 4AD0A 3IJIA 2WHJA 1RJQA 2DZPA 2YZ5A 4H7ZA 3W7RA 2CZ5A 2H9AA 2QJHA 5JVLA 1WAWA 1Q8AA 2A2IA 1Q13A 3NXFA 2YBUA 3MC5A 3H4XA 3EBVA 4H8HA 3LPPA 1DVJA 3UR8A 1WA3A 1HVQA 2WVTA 4PBGA 1BSLA 1YQ2A 2PWDA 3MWCA 1YYAA 3VDCA 3S1GA 4MYAA 4EPBC 3ZLGA 1XIFA 3FW6A 2V68A 2VTFA 2JEQA 3UFYA 5K3VA 4W85A 3NDYA 4AZIA 2QXWA 3VILA 3LYEA 1VFHA 3RO8A 3LCFA 1IWAA 1NSJA 1O5QA 4DZAA 1VJSA 4UOJA 3SCVA 3IIOA 3SZ8A 4ZL1A 1B9ZA 4H8VA 5EMYA 2QCMA 4QISA 1P6CA 4MKSA 2CKRA 3KAOA 4NJJA 1R3TA 5GNZA 4AX7A 3IGUA 1PKLA 1XFBA 1W3JA 2PSNA 3USBA 5F2IA 5JBDA 4RV8A 3G18A 1T96A 4LBSA 1KTNA 3KWXA 2JFEX 3RFAA 2I9UA 3WIJA 2ANUA 2HV5A 1RCXB 4Y2WA 3LNPA 3G1YA 4GGHA 1FA2A 2D2JA 3TXZA 3ME3A 2P76A 3EX3A 3MY9A 2PWFA 1Q63A 2WJZA 4OUEA 4C6PA 1ESWA 3ZWTA 4UNLA 1XF0A 2HCVA 4FOUA 4X2PA 3C2OA 2DVXA 2EO7A 2VGGA 4I9AA 1KCZA 3WNOA 2C18A 2P88A 2HVNA 1HGWA 1W3TA 4JTJA 2G95A 5EMUA 2UY2A 3D3FA 3MBDA 2WNNA 3W87A 4I5UA 2FFCA 2QDEA 4NJGA 1HL9A 3C3UA 4F48A 4J2PA 1UD5A 2X1SA 5LXEA 7ODCA 3EWCA 2X1TA 1ADDA 4ICMA 2A7PA 3W7QA 3TK7A 1G69A 2Q71A 2FMOA 2X30A 3CLMA 3VFLA 4H9XA 3FCPA 4R9XA 4REQA 3SW6A 1JPIA 2B7NA 4XZ9A 4G7FA 1W0MA 5E6ZA 3USZA 3DGBA 5CPQA 3I65A 2W4XA 1E40A 3G1AA 1W31A 2G97A 4FLRA 4QQUA 3NZQA 4F9JA 3BVJA 4WGHA 2HNHA 1DJNA 5A95A 3VNDA 4QTGA 4TV5A 3S1VA 2WQPA 4MYXA 2E28A 1V3KA 2WWDA 3L4XA 2FMNA 3B0PA 1BTCA 4PMQA 2E8ZA 2NVCA 4C6LA 4A6GA 2WHKA 5LGXA 2XPKA 2FPVA 3I4EA 5HJYA 3UWQA 2DSKA 2J27A 1F74A 2PAJA 2XIOA 3N2TA 1KGUA 4MDOA 1V3JA 4IT1A 2V0TA 4ZO7A 5DCEA 3WMLA 2FGBA 3GDTA 3RPDA 3CYVA 4GO9A 4HNNA 2WZIA 4PRWA 3LI1A 4HNLA 4PUEA 3WBWA 1ZJIA 1R7AA 2H3BA 4JQ2A 1JDEA 4AW7A 2EXOA 4OHQA 4LVBA 4UC5A 1OF8A 5C8BB 1GVEA 4OWGA 5IBXA 3TJLA 4Q4PA 4M8UA 2PMQA 2VNCA 2DV0A 1L6WA 3PBMA 3IVSA 4JIIX 4NNAA 1KXTA 3FOKA 2RDUA 1I2OA 1Q8JA 1XIHA 1OEPA 2O9OA 4D6IA 2DGAA 2OYMA 3UP8A 3FYPA 2X05A 1WXJA 1J0IA 3N29A 4JXCA 4FS9A 4LYRA 3W38A 4QE5A 2W62A 4IIEA 5CBIA 1JZ7A 1V0NA 1GQLA 3OQEA 3AS3A 1FDJA 4OE7A 3N9RA 4PE8A 2YSWA 4HOWA 3QY8A 2EPKX 4ROPA 4C1KA 3GVWA 3QRHA 1XIDA 3EMQA 1M7JA 1C7SA 1T8XA 3ALGA 3CU2A 4I9JA 1Z69A 5G4EA 1YPXA 1W3LA 1JDAA 1JULA 5KETA 2UY5A 1R8LA 1EZ2A 1Q7QA 1OX4A 4Q8QA 3HU7A 4QLJA 5ABFB 2OQHA 3FA3A 4OJYA 1AUSL 1QTWA 1FP8A 1PZ0A 4ZO8A 3UJSA 2CLFA 2OLSA 3D5HA 4RPPA 1JPKA 4O8AA 2PTWA 3TYZA 3STPA 2WYSA 1TTJA 4MUPA 1FCQA 1XLGA 1OC6A 2VDIA 4RL3A 1S5MA 2D3LA 5FF7A 4FNQA 1SO4A 2DU2A 5A2AA 4UTFA 2HK1A 3M43A 3W6MA 4OUIA 3PUGA 2G37A 3LHZA 3A64A 3L12A 1W3HA 3M0LA 1UWQA 4HZ6A 4DXKA 1Q6FA 3IV3A 2A3AA 1HKVA 2WVVA 1TX0A 3UERA 2QNEA 3FVDA 4DJFC 4EXBA 3E0LA 3BLOA 4DVOA 3LTPA 4CD4A 1PTGA 2HPIA 1GOMA 3QBUA 4Q32A 1W1B1 3IUIA 3GFYA 5FF2A 4HCDA 4HMCA 4WCJA 2TPSA 4Z1CA 3VI2A 4OBSA 3TQ0A 1V3MA 1K6AA 3CGTA 2E09A 4U28A 1BVZA 4XISA 1QPOA 1U5HA 2RUSA 4GISA 3GYEA 2CLHA 4YS1A 4AD4A 4FIQA 1BXCA 3AYVA 3VIGA 4DXXA 2CYGA 1A47A 4UTJA 3DIPA 1MI3A 2GVEA 3C6CA 2Y62A 3SDOA 1GYLA 2NQZA 3DI1A 3PTMA 4G7EA 3VABA 3LA4A 4Q3MA 1ICQA 4H6QA 5FESA 5KTLA 3WNNA 3H54A 3VOGA 4ZZ9A 3PPFA 3HBLA 2OZ8A 3UZZA 4G6CA 3CL8A 4GKLA 4B92A 1TJ0A 2AMXA 1J0HA 1V6VA 1SW7A 4MJ2A 4EAMA 3BUVA 1XISA 3L65A 4FX8A 4J28A 1WDRA 3I6EA 3JW7A 3GTXA 5DY3A 2YCIX 3SCRA 4B5NA 3NSXA 4JKLA 1QI2A 4XO7A 3U6WA 1WZAA 4UFIA 3GQYA 1D7FA 2IXVA 3PZQA 1UBPC 4LVFA 1VLIA 1Z6KA 2PBGA 3RX4A 5CSSA 2FZDA 3HN3A 2ZC8A 4HA3A 4JQ4A 5CGQA 2WMIB 2A21A 3NR0A 5L6UA 1LTDA 4NYYA 1UW9A 1ISWA 1P43A 2VFFA 5D37A 3NL6A 4HQVA 2XINA 3HFYA 1P0NA 2ZWYA 4S3EA 3W2LA 2CU0A 4MOZA 4B5XA 4HD5A 5AYIA 2VRKA 3MCMA 2VQTA 2QF8A 3W23A 3G1HA 4O4WA 1J2BA 4IPNB 2QCLA 4K7YA 1LL7A 4J3VA 4K38A 5FEXA 3VA8A 3WFZA 2WKGA 1BSIA 3BPWA 4TOQA 3L21A 3O06A 3EKLA 2P5NA 3G5EA 4QIUA 4NYUA 1R9YA 4RNHA 4NRRA 3LRKA 1D3HA 4MUZA 4IGHA 2QDDA 1GKPA 1Z8AA 4XUYA 1THFD 1T7LA 1MMFA 4UCGA 1JVNA 2VRQA 3HG2A 1EYWA 5LIUX 3AIWA 5CAKA 1I8JA 4Q4RA 1KBKA 3FHQA 2P50A 3EDEA 3N3TA 1MRQA 1QASA 2ZZ7A 1I2QA 1RQHA 3WLIA 1ISYA 1MO0A 4LRTA 1KTBA 2OT0A 2FGLA 4MM1A 2OO0A 2R1NA 1K9FA 1YLVA 3L5MA 5AC6A 1EJVC 1GHSA 3AROA 4TTGA 5KSWA 1OC7A 1ADOA 2Y70A 4AMCA 3DCPA 3FDKA 3FIGA 5J8LA 2YL8A 1P0DA 4N2YA 3ONCA 3ZIZA 3S5SA 2IQTA 4UB9A 4NRSA 2XIMA 5A6AA 1QNQA 1TTIA 2QIWA 1Q2SA 4Q8MA 1J0YA 4W89A 3S9ZA 3MUY1 1L6SA 3EX1A 1VQTA 3A22A 3D47A 3WQFA 1XLIA 1F73A 3GXIA 3U9IA 3PBWA 1F2JA 4MMWA 4IH3A 1E1CA 5D30A 3NL3A 3CAKA 1OT2A 2HS8A 3SUUA 2BBFA 2D3NA 3RLUA 1ZPTA 3QC3A 1KXHA 2OWWA 1H7OA 2OTDA 5LYRA 2YDRA 5H2ZA 2WMHA 4DWSA 2OR2A 1VBJA 3QHNA 2B0MA 1RBAA 2EGZA 1WYIA 3HM7A 2RFGA 1CYGA 5M17A 5AC7A 4IG2A 4MWAB 2RDWA 3KDNA 2G41A 3GG7A 1Z32X 1JF6A 1FWEC 1HUVA 3M0HA 4B5SA 3CUJA 2J24A 1IV8A 1B31A 2HZGA 1VPYA 3B0YA 1IGSA 3LOTA 1UR0A 2GJNA 1EXPA 1WKFA 5D8ZA 4G56A 3NPXA 4MNJA 2VEFA 1HF6A 1F07A 4I3GA 4LUSA 4J3XA 2DUZA 4AVFA 1K9DA 2PDJA 1B4KA 2GJPA 3BAYA 3VMNA 1PB0A 1UASA 2WNQA 1SR0A 2NQLA 4NAFA 3H7UA 1W5QA 4C91A 1TE6A 3SCNA 3C2VA 3Q2DA 4PUWA 3UT0A 2XVLA 3TU9A 2XFRA 1XM3A 1JQXA 2OWCA 3V7PA 3ARYA 3FSUA 2E9BA 1R9XA 4JTIA 5I6SA 4AVOA 3IJ6A 4LUJA 2E25A 3N25A 4FZIA 1FH7A 5DY2A 4FP1A 2VEKA 2A85A 3GH7A 1SGJA 4J7RA 3E74A 3JVAA 3WF0A 2W3ZA 3WQDA 3ITXA 1VFTA 4DBEA 3GVVA 1AZ1A 1FWJC 1VLWA 3WH7A 4I6KA 5JBEA 4IUGA 5C71A 5FJUA 4TV6A 3H2FA 1NH6A 2GGJA 4CCZA 1RD5A 1NOWA 4KEMA 4ZOAA 1EDQA 1PDZA 3PR2A 2ALRA 2ZQ0A 1IZCA 3FK4A 3VOCA 3N14A 2NQHA 1E4NA 1ODZA 3IJLA 2C79A 4M6VA 5IFPA 3TXVA 3R1ZA 2AOSA 2A3CA 3M1ZA 3TC7A 2PP3A 1TTPA 1MWOA 3KCJA 3SSZA 1MZHA 3ISIX 2XVNA 1XLEA 5CEWA 4RPQA 3LBOA 1Z48A 3VPLA 2PLJA 4A3HA 3KVMA 4ZQMA 4LX4A 2ZZ2A 3VK5A 2DQXA 3LB0A 1ZQ5A 3QC0A 3M0JA 5BOOA 2QDHA 4J3ZA 2WSRA 3QYSA 4JNZA 1FWDC 4DZ5A 1PJ9A 4DJDA 3H26A 1BYBA 2C16A 3TKFA 2CXEA 3E2RA 1LRTA 3GDLA 5EPDA 4YCOA 4FNSA 2DH2A 5G1MA 3WZ0E 1XIIA 2W9MA 1W32A 3LU2A 1V6WA 1WDWA 2LLEA 2A1YA 3GBDA 2QS8A 3OGSA 1F76A 1CGYA 4IX0A 2OO6A 4HHHA 4ACZB 1QBAA 1LUCA 1NDVA 4PL1A 4MNMA 4LJ3A 1Q7MA 4OOUA 1DQWA 1RY8A 3OZMA 4LCQA 1EH9A 1XCXA 2RH9A 1YMYA 2XZ9A 3NQ2A 3L68A 4AXNA 5CZKA 4E8GA 1R3QA 4UFKA 3UG5A 1MW2A 3U4FA 1XC4A 1E0VA 4HTBA 4X9SA 1Q2RA 3OVQA 2CBVA 1QO2A 4E8CA 5EMMA 4QQ3A 4CEUC 4DBUA 1KA9F 1FCUA 1XYAA 1OFBA 2POTA 2PDUA 2YL6A 1JYVA 2HRWA 1QNSA 1UD4A 2ZXAA 3GO2A 4WGXA 3WKZA 5I3FA 2QV4A 1DIDA 3UNTA 2J4GA 3TROA 4E4PA 3AYSA 4ZTYA 1SFTA 3VAVA 4DI9A 1HP5A 3GK0A 4HB7A 5M03A 3UPMA 3GTNA 3SRHA 5K9CA 1YIXA 2QVHA 2F2HA 1RBOB 2V3FA 2PTDA 3G1RA 4M5PA 1QK2A 5ABTA 2ZRXA 2CITA 2W91A 4FXJA 2ZZ3A 2V2HA 1NFBA 1XUUA 2AL2B 5LSMA 2GWNA 5D05A 4M81A 6REQB 1XCFA 7TIMA 3A12A 3ZSTA 4BI7A 5F7UA 2WVVB 1KO0A 3V16A 2PLKA 6A3HA 2FVKA 4ORMA 3FYYA 2P8CA 1Q6EA 3GNPA 5D9PA 4M1RA 5CPMA 2QUMA 2ZCGA 4WKHA 3B05A 3M6YA 3RRAA 3ALFA 4FR6A 5MF5A 2ACUA 5PTDA 3FXYA 4O1BA 4WKAA 3E5PA 4QR6A 2AAAA 4JYFA 4OQVA 5I79A 2BVWA 4N6FA 1RSCA 1UUOA 2EJAA 2ZRWA 3N73A 3S5OA 1A0CA 1TR1A 4H8NA 2WLYA 4IMEA 1XLMA 2J8FA 3SJNA 3W1PA 3AO0A 2GJXA 5CZJA 3NL2A 3BG5A 2GUYA 4IIFA 3BSHA 1YE6A 2XTKA 3A4AA 1EHAA 1FWGC 1HW6A 1G4TA 4WD0A 5BCAA 2ISVA 3URBA 4UFHA 1Y5VA 3MKKA 4XZHA 1K7FA 3M6DA 2REQA 4PUUA 5HBFA 1JAEA 2A6NA 1W1A1 3C2EA 4UQEA 4XKYA 3TVAA 2CXGA 3PSVA 4UQDA 2XFFA 2P1FA 3GXTA 2DT1A 5AYZA 3BOLA 1VCGA 4Q4OA 4TMBA 2GVGA 5DO8A 4RNIA 4LVDA 2L5HA 1TMQA 1MQRA 5AHFA 2R24A 1A3HA 2JE8A 5E6YA 4FHAA 2VFGA 1N55A 1AG1O 1PSCA 3KX6A 2ICSA 3B40A 4KCWA 4EXQA 4ECLA 1NFPA 2Y1HA 5DBTA 1UD3A 4KETA 2D24A 3TSMA 3HGRA 5REQB 5F4XA 4WEVX 3DAQA 4GZEA 1UC4A 1F7BA 4LYPA 1K7XA 3DFNA 2J74A 2OQYA 3NNTA 4B3LA 1DXIA 4LAZA 1QU4A 2R1KA 1KFBA 3E02A 2Y7DA 3DGRA 4YYFA 4UTHA 4IIDA 1CXFA 4BF9A 3N34A 2CERA 4PMJA 2ONEA 3RCNA 1ONXA 5DCBA 3VXGA 4DUVA 1J5TA 3KBWA 1REQA 2HROA 3HF3A 4DO5A 1UROA 3D6NA 3Q45A 3GZ3A 4AU0A 1US3A 2XN0A 3L4YA 4QS6A 1ZUAX 4HNTA 1R3WA 2BVTA 4D8LA 2WC3A 3L4WA 3TJXA 5HWNA 1FP9A 3ERPA 5KITA 1JYXA 4I5RA 4MTVA 3CZGA 4IUOA 4JIEA 4XD6A 5K4ZA 4L4MA 2YBVA 3CUFA 4ZENA 4JTAA 3GD6A 3CV1A 4JCMA 3TV8A 3NZ1A 1D7KA 1SZRA 3RNDA 1GKRA 5I0DA 2P0OA 1N8FA 3W81A 3PUEA 5LHFA 1GCYA 1UKSA 3T4WA 3F2CA 4IF2A 3UZWA 1KM1A 4B91A 2G96A 3U7VA 5CKSA 3NQ8A 5AYYA 5E0FA 3S47A 2E3ZA 2OJPA 3M4HA 1VBGA 3PB0A 1WBJA 1W9XA 4CVWA 4ATDA 5CPSA 3AXMA 3ZT6A 4L80A 5DBUA 4GACA 1I75A 1HL2A 2D73A 3S2JA 2XM2A 1S46A 1E1CB 3CMGA 1HZYA 3BW3A 2QLYA 4FX6M 4JTLA 3G3MA 2I5QA 1ONWA 3LHWA 1L8PA 1D8WA 4Z2KA 1QNPA 1I0BA 3SN4A 2GGHA 3ZS4A 3VNKA 1V03A 2VXNA 3AXXA 1KB3A 3O0FA 4GHRA 4IOTA 2JGQA 4HN8A 3EWUA 1HKWA 2WMFA 4NP7A 4HOXA 5A6TC 4S3CA 4WJ8A 1E15A 4RJEA 3AQUA 3NWRA 4C6DA 4DELA 1Q4NX 3OZOA 4P7QA 4EPDC 4MG4A 2CZEA 1BTMA 2WBKA 3T2OA 4ZO9A 3SADA 5G5IA 2CLIA 1FFRA 5FAJA 1EUAA 2ZVRA 3BZJA 2DP3A 3MMTA 4WUIA 5EYWA 1IZKA 2JKAA 4LGXA 1O7AA 1AD1A 5CLTA 3NO1A 1YADA 3CTLA 2J6XA 2BSLA 1ODUA 1JL8A 2IQ0A 2H6RA 5H8PA 2REQB 3EWZA 4L1XA 1FKXA 1OFPA 3GHUA 1W17A 3U2EA 1A5SA 1TZZA 2V3DA 4UFLA 3RU6A 1UH2A 1JNDA 1LWIA 4L61A 5DEZA 3TEVA 1H3GA 2XH4A 3NVDA 4NJIA 4ONVA 3B9NA 4DF0A 2QUVA 3ENLA 1KGWA 2QW5A 3M07A 3NAVA 2FFIA 4XZMX 9XIMA 3QSRA 1QATA 2PWUA 2XIJA 1VZWA 3O9NA 4KPLA 1KM4A 2PDPA 3DHUA 2E6YA 4AHPA 2TSYA 5HJXA 4P61A 3SJ3A 4M7SA 2TRSA 4PMXA 1VB9A 1IWPA 3TLQA 1J6OA 5FF0A 1OB0A 3PBGA 3QMRA 4S1FA 4J3WA 4PMVA 3CJPA 4XZIA 5E0CA 1K03A 2YB4A 1VP5A 3GM8A 4Z1AA 3KFTA 3LD5A 4NAEB 4UNIA 4GNVA 4N6EA 3GW3A 3WQWA 4CQBA 2HQAA 4WJEA 1E6NA 5AFDA 2Q01A 5IHRA 1WKEA 4BWLC 4I7UA 4GX9A 3ZR5A 2Q8LA 3BAJA 1OK4A 2W61A 4LALA 2NQ5A 4Z2JA 1KV5A 1LF1A 4EVZA 2GDQA 1CXIA 2ACQA 3VX0A 1UJQA 1KW1A 2XWEA 1V7AA 2Z1BA 3IK2A 1DHPA 3APTA 3CAVA 4KQNA 3EWBX 1CZ1A 4I8YA 2DIEA 4ALDA 2HVMA 1RP8A 2VX6A 4GABA 4ZE5A 4GVHA 3PUDA 3QJAA 3SECA 1J79A 4E0CA 4HMDA 1OQFA 3AIQA 3CXOA 4C6BA 1CWYA 4B5UA 5DANA 3ES7A 5IHSA 3UPWA 4AVNA 2FJUB 2Y8KA 3DENA 5LNUA 3AHTA 3E38A 1U1HA 2ZXBA 1NWRA 2XM1A 3CUXA 3HO8A 2GVYA 3EB3A 4AISA 1WDDA 4J40A 3MCOA 4WDTA 2PEVA 1IXQA 3IJQA 1PV8A 3ID7A 3OVGA 3UXKA 4ZMGA 2GSEA 3NSMA 5H6HA 3SIZA 3IWPA 1QMLA 2OVLA 4HU0A 1GQIA 3INPA 3URNA 1GOIA 3TAKA 7A3HA 4XAYA 2PURA 3A5FA 2Z1KA 5I02A 3CH9A 3R25A 1EO7A 4B90A 2CKSA 4W87A 1KNWA 3NQVA 5E09A 3H23A 2WKLA 1EL3A 2CFFA 3PJUA 2V3EA 2JALA 3D46A 4YTUA 3LGEA 3BMVA 5E5CA 2XJ7A 3KS5A 4GJJA 3K4WA 5EGRA 2C1HA 1XBVA 3GG8A 3VZZA 2ZYFA 3UYIA 1DWFM 2CHNA 4QJ4B 3FVMA 3KE0A 3FAXA 1UOKA 2VEIA 3QVQA 4RW5A 1EGVA 2CCRA 2Q6ZA 4TVCA 3DZ1A 1EWEA 3W25A 2Q3RA 2V69A 5TQLA 5C9ZA 3VOIA 4XAPA 2FKPA 4O4VA 5IBXC 3AU2A 3UR5A 1OCQA 2J7BA 3MYOA 2YCEA 2HXTA 3RLHA 3P74A 1XLKA 2I7GA 3NGFA 2XFWA 1VH7A 4MSSA 1W91A 2IQDA 4RE2A 1P1XA 3EEZA 3B03A 3PTKA 2PBOA 1F3EA 4IGSA 4D8ZA 2QF7A 4PB3A 3NXLA 3GC4A 2VDGA 3NO5A 3GR4A 3IIZA 2ZICA 1BXNA 2W0UA 1WZKA 1W5PA 3V5FA 3LK6A 3ZSSA 5MHBA 4JN7A 1JDDA 3GNNA 2VYOA 2BY2A 1LDCA 1UR3M 1OIMA 3CK5A 5TIMA 1MYRA 1OX6A 1NQKA 3WK0A 1XUZA 1KXVA 3PY2A 1PIGA 1JZ4A 3DFYA 1GVQA 3LDVA 3APYA 2D0GA 4QCEA 3NURA 3KRUA 2HEJA 3R12A 3WBXA 1E6XM 2RGLA 5D8WA 2YXGA 2FPYA 4CQDA 3FN9A 2DSWA 1MUCA 2ATMA 3QFWA 3BG3A 1E6SM 3CWHA 5HPOA 3E0FA 1MDLA 4KWSA 1S3TC 1K70A 1EIXA 2WQDA 2BXZA 3ABZA 4ADSA 3H12A 4IIHA 1MFUA 2BVYA 3MSGA 1ZY9A 3TONA 3EOUA 4FK9A 2FTWA 3QEZA 4MWAD 3EB2A 2Y4SA 5TF0A 1UUMA 4OV4A 1ITXA 3AISA 2CBUA 1C7TA 3WDQA 3SBFA 3AMLA 1TIMA 1V7YA 1NDZA 4AZCB 2BY0A 2INFA 2Y5SA 4YVXA 1XJBA 4RNJA 5HAOA 1CXEA 4CD6A 3MDUA 2DSZA 4FNUA 1PBGA 4I7VA 2BX7A 3QW4B 4HYWA 3UWWA 2J7GA 1YBQB 3H70A 5F1UA 2GFTA 3I7SA 4GD0A 1IE7C 3W84A 4HBKA 3R0DA 2C6QA 3E3HA 3RR4A 4MAVA 3MMDA 4GXWA 5E1QA 3IIVA 3LMYA 3KEHA 4IQDA 3T8LA 4L6HA 6XIMA 3IGHX 3MVTA 3VD7A 3ZR4A 1YDOA 3LRLA 3F1QA 1TWWA 1MNSA 5C7VA 2H90A 4V1YA 2W79A 2DUXA 3PB2A 4KWWA 3PG8A 4V2XA 1NWTA 3LM7A 4GY0A 3PZNA 3KBMA 1G7UA 3WK1A 4RZ6A 3VIFA 5BMXA 4DXVA 4JHOA 1UC5A 4UTWC 1WBHA 1AQFA 3QKZA 1X96A 3HGJA 4PBFA 1H5VA 1JCLA 4K36A 3N4AA 5HK4A 4CEXC 1UH3A 1S2VA 3JU2A 1DP0A 3QPZA 2AQOA 1A5LC 2Z1VA 3WLSA 2OFJA 2HBXA 1T99A 4K3ZA 2F61A 1B3XA 3AMGA 2ISSA 2YKKA 2PODA 3R13A 7CGTA 1Y0EA 1EP3A 1X97A 1KV8A 2PU1A 5A8NA 5HMFA 2IPGA 4IP7A 3ZZ1A 3MJYA 2PLMA 2VR2A 3QV8A 2FHBA 1M04A 3ZVIA 2VX5A 2ZX6A 1P4CA 4EACA 1V51A 1IEQA 1UWIA 1TCMA 1C93A 3S9IA 4DO7A 1HQTA 1S1PA 4O52A 3EGJA 4BS0A 4XK2A 4GI8A 1RCOB 5U4NA 1QHOA 1B2YA 2EPOA 1RY0A 3DOPA 3MVIA 4HK6A 1DWAM 3GDBA 2QQ6A 3CEPA 1XLHA 1GOQA 5K9XA 1PWLA 3H55A 1X1NA 2VP8A 2DIJA 3LV6A 1NFGA 1P5BA 3VKDA 4NZ4A 2UWFA 3TYEA 4LANA 3CHDA 1G7VA 1GZGA 3W7JA 4E2BA 1M9HA 2JKPA 3MT1A 3BLLA 2Q8XA 3VNMA 4AWTA 4PH6A 1XDMA 4E3VA 4C6FA 1IT7A 2CBIA 4GYPA 2QT3A 1S2CA 2PI6A 5AC5A 3BDKA 1OFRA 1XGDA 3F4CA 4WDXA 3EEGA 1RXOB 1ENUA 3L66A 1FWTA 3OBKA 4AG0A 4YLWA 1VIWA 1ZL1A 2Y2WA 3N04A 4S2CA 3UWYA 1PX4A 3UR7A 3WQ5A 1IHIA 1IT8A 3DEQA 4TMCA 3AZTA 5HATA 1S3HA 3DFQA 7ENLA 3U8GA 4R5EA 2Y89A 4S3JA 3TW6A 2PP1A 3AS2A 4C5ZA 1TV2A 4F8XA 4ADTA 4QJ5B 3LHVA 3N2MA 2Z4GA 4A8IA 4LUYA 4E2OA 1VIZA 1JD7A 2FB2A 4C60A 1QO5A 1CB2A 3OGRA 3LG3A 2DW7A 2WV8A 4KESA 4KRZA 4IGMA 1RV8A 2OYKA 1K8XA 4MY8A 5DRIA 3PG9A 1TQXA 1BRLB 2E1WA 4LSBA 3BICA 4F4RA 3WLKX 1LCOA 3QR1A 2C91A 4GQBA 4B5WA 1J0KA 3F4NA 2Z27A 3C86A 4F0MA 2FVMA 3O2LA 5D03A 1XWYA 3IK4A 2FHFA 3PBVA 1FDZA 3FJ6A 1XHGA 3T08A 3LGGA 1XR2A 4RLIA 1VPQA 4XO6A 3V36A 2CESA 4ZQCA 1FWSA 1XIJA 3FV9A 1JCMP 4IG2B 3JS3A 3O6CA 4XV0A 1QNVA 4GI4A 3BK0A 1UWUA 3HV9A 4L6DA 2E68A 2BXYA 4MAZA 3SGUA 3VE7A 2GQ3A 3ZXWA 3FJNA 3GIPA 3GLCA 4U5IA 4R85A 1LL6A 1AMKA 1PTDA 1I2NA 4H7VA 2Y7FA 1S39A 1L9WA 2WJEA 4LF2A 2WNZA 1US2A 4B2DD 3WLOA 3CUZA 1N82A 1S2WA 1IIHA 4M24A 3CO4A 3W1AA 3HV8A 3RYSA 3W01A 3WF1A 4TTUA 1U83A 3ZQ9A 3GBEA 3PZUA 1OABA 3I7RA 4B5TA 1VJIA 4D6GA 1DJQA 3T0CA 4IFKB 1OGGA 3NDOA 1UWSA 3NZGA 3SRDA 4ATLA 3DERA 3VYLA 3EOOA 4PMOA 3GAYA 1O12A 1XKJA 2BOGX 4DN1A 1JI1A 5KZMA 4YU1A 2WLZA 2F8QA 1G6CA 1UHVA 3LXAA 4H19A 3S83A 2ZUNA 3W2UA 4G5DA 2OGYA 3FA4A 1HJWA 1UMYA 1IR2A 2YGYA 1XLLA 5AYBA 1B4EA 4IXHA 3WQPA 1PWMA 2ZXDA 3GC2A 4PTNA 5F1VA 4JTSA 2RAGA 3O05A 1GT8A 2QJJA 4OOZA 3PULA 1Y5XA 1CLKA 2EEXA 2C3ZA 3WLTA 1GKQA 3T78A 4OIFA 2EPHA 1CT5A 2VT0A 4HIBA 1HJQA 4FLSA 5HOSA 1KKOA 1A50A 2YCJA 2WC7A 5EMLA 1CIUA 1PKYA 4MPQA 1ISXA 1P1MA 2CHRA 3ZO9A 1X98A 1KM3A 1MDRA 4M1BA 2JBMA 2XU2A 1CGXA 2PC4A 2A6LA 4AUBA 4CU6A 4M82A 1E0UA 3WN6A 3TMQA 3G0XA 3R0UA 4J5NA 1K4GA 1RA0A 4H2HA 1XG3A 2DSUA 4JL1A 4NVTA 2WNWA 4NZFA 1Q4WA 4S3DA 3CQIA 3WY1A 2FTYA 1WKDA 3KZSA 1QWGA 3N2XA 1EHNA 3G1SA 4W86A 2PD5A 1GZJA 3KWSA 3EPMA 4K1WA 1AW2A 3K8LA 5GJMA 5XIMA 3P2VA 3WK3A 3GKFA 3Q58A 2FZ9A 4DJDC 4A21A 3ZLFA 3GTFA 4D1JA 4OBTA 3EX6A 4ZGYA 3M64A 1X7IA 1BG4A 2XGIA 3KTCA 1OYCA 4M7TA 3KBJA 4H9TA 4KFNA 4C1LA 4QFUA 4HU3A 1R3VA 3TQPA 1PTAA 1TWSA 3H21A 1OG0A 4PEEA 4KW2A 3OODA 1TWIA 1BQCA 3LLDA 4WSHA 1IXOA 2XSXA 2CZFA 2C1GA 4LFYA 1AMYA 1FOBA 3K5XA 4NUWA 3T9PA 3E0VA 2CWXA 1W54A 4HNUA 3FLUA 3ITOA 2CLPA 3G22A 1EF2A 4OT7A 1F3TA 4DJEA 3WQ4A 4IPJA 4RW3A 4MJZA 1S5VA 3EA3A 4AWUA 3R11A 5C0QA 4GPNA 1QJWA 3LXCA 1XXXA 4J27A 2O7QA 2VURA 1CGTA 1ISZA 5EFDA 1AA1B 3VCRA 1XQLA 2W92A 3VNIA 3V0SA 2UBPC 1XICA 3NGJA 3K1DA 2O7SA 3H8AA 2VR5A 3P7YA 4RR4A 5DXYA 2HVOA 3EOLA 5D9NA 1S5TA 1ZSXA 4PCSA 1TJ1A 3A9BA 1XD0A 3QXBA 4NIRA 3PK7A 3LTSA 5TAOA 3BOFA 3KRBA 2DZBA 2DQWA 1F61A 4M29A 4P7NA 2P3ZA 1XYMA 3KLLA 2PB1A 1UP2A 2CETA 2GSJA 3CV7A 3UZ5A 3LUTA 2IKGA 1R3RA 1UP3A 2VD9A 4QS5A 4C6EA 3R8GA 2IKIA 2ZUMA 4QJ1A 1KQYA 2C7FA 5J5DA 4WSKA 4KS0A 4HCHA 4AEFA 1H4PA 1YX1A 4BY3A 4AF0B 4O15A 3N12A 2X0SA 3K13A 3ABSA 2PWVA 3F03K 3N6QA 3HURA 4R53A 4ZOEA 4B4FA 1YBQA 3KCLA 1DIEA 4K2SA 1PE1A 3TYDA 1SZFA 1ZBWA 1SSGA 1PCKA 4TUFA 6TAAA 5CJ5A 2IKJA 3R6IA 1ZAJA 1LUCB 1K9EA 2EG6A 2OSWA 1FKWA 2PRMA 3ITVA 1AK5A 4DWDA 3VINA 3RIKA 1E55A 1LWHA 5K7JA 3OOQA 4LUSB 3NM3A 3PAOA 3QM3A 1EUNA 3BMXA 4NAFB 2YFOA 2I1OA 3GUWA 1QPKA 4XZBA 1BF6A 3ANUA 3SB0A 2F38A 2JIEA 2PRHA 1CXLA 3W02A 3CNYA 1YNPA 3TSBA 1OHLA 2ZX7A 5I2UA 2VCBA 1VC4A 2E77A 4N0RA 3UZXA 1TVNA 3N9SA 1RK5A 1FCVA 5C9XA 4P8VA 4F0LA 1RVGA 1J11A 5FJTA 2O92A 1JDCA 4ICCX 5JMUA 3IAPA 1AZ2A 1XGEA 4IJCA 2D2OA 4BEQA 2ON3A 2RGMA 3A4WA 2WSPA 4B9ZA 3G0SA 1ZS2A 2PFHA 3D3AA 4KFOA 3NCOA 1Q6QA 4PSRA 1QNRA 1NIUA 4X2RA 3RJXA 3V18A 1R5YA 3A5VA 3NQBA 4ZFMA 3UCDA 1HJXA 3WEOA 2I17A 2G50A 2P53A 5AHEA 3T0BA 2D23A 2VGIA 2YDQA 3CHEA 3SI9A 2Z25A 2PF0A 2X0YA 1K7EA 1LQAA 2VOMA 5HJLA 3KM8A 4DI8A 4ZQNA 1O60A 4B3KA 1UIPA 5JBFA 2TMDA 4CNNA 3T0TA 1SZEA 1T5AA 4NZ5A 3B8UA 3UWVA 4PUKA 3T55A 5I3JA 1Q6GA 2YXXA 1NEYA 3W53A 1VHNA 1LBLA 1E43A 2W6RA 5DELA 3RK8A 5D32A 3UXIA 1NF7A 2ISWA 1FXQA 4ILSA 3T42A 1HGYA 2X09A 1JI2A 1JCNA 2ZZ5A 2Z1WA 4ATWA 3N2CA 1KR1A 4Q6XA 3L4VA 4CU8A 4IMFA 3SY5A 1TJRA 4ZBCA 3B9OA 2UY3A 3VKBA 1V6TA 2NX3A 2PCEA 4KH2A 3GB6A 5BROA 4ZODA 4LQ1A 2XHYA 3CT7A 4O16A 4IQEA 3HQNA 5HR6A 1XBXA 1PCWA 4HYVA 1UR4A 3APGA 5DMYA 5D38A 3I7QA 4NZCA 4PTVA 2YXOA 4H7CA 3IJ8A 5I78A 4QBXA 2EG7A 3EAUA 1O6IA 1BD0A 1LM1A 3PTDA 2NZLA 3H2OA 2OODA 3O63A 1WCGA 4Z0SA 4ZB5A 2WWCA 1W1YA 3S2CA 3RITA 2X7VA 1H61A 3EWDA 4LPCA 3QOMA 1X6LA 3GFXA 1M65A 3L4ZA 3E0IA 3LSCA 1H11A 3VGBA 2B7OA 4K37A 3NFUA 1TQJA 3MPGA 2OOGA 4OBRA 3ARRA 5C2CA 5ECUA 3WMBA 4LY8A 1XQKA 2XUCA 3SCQA 3P93A 4IP5A 4Z2IA 3ZMRA 3W7LA 4FF5A 4AD1A 1XLBA 1IZJA 3EA1A 4O19A 2O0TA 2FLIA 4WR3A 4EIVA 3LSBA 1H63A 3OHIA 3K8MA 2VZSA 1JZ8A 3QY7A 1CX9A 5FA5A 2PDWA 1KCKA 1U5JA 2XGBA 1QVBA 1CENA 4E5TA 4JTDA 4O57A 1JXJA 1XIBA 4C65A 3SRFA 1TJPA 3DKLA 4WDWA 2J7CA 1E0TA 2IXUA 5I3GA 3KOYA 1IXNA 4EANA 2QULA 1H7XA 1YDYA 2J9XA 1GORA 1RJRA 4XD5A 1EJSC 2G5WA 4FOKA 4DF2A 5FSEC 2WB5A 5C9RA 3VKCA 1GJWA 1BG9A 4NI3A 3CS2A 2Y61A 3LPGA 3PWAA 3NQ6A 3U2CA 4IX2A 3TTYA 3UXDA 3DG6A 3HIJA 5M1TA 4B15A 1JR1A 4LV9A 3EMZA 3TFXA 1JGIA 1E9IA 1GONA 3ZJ7A 1SFLA 1UG6A 3S1XA 4BQ3A 1QI0A 2YYTA 1SYTA 1XGZA 1A5BA 2VFDA 3HB9A 3M44A 4CN1A 4IPPA 2QR6A 3NZRA 4LVGA 4U31A 2BZNA 1EEPA 2HSAA 3S6OA 5D4YA 3DN5A 2DJXA 1UQZA 1XP3A 4M6QA 1NDWA 3T05A 1PEZA 2FZMA 4PMDA 1AL8A 1R2TA 3RJYA 1ZBCA 5CPLA 5BOFA 1XYFA 2DJLA 2JF6A 2YB1A 2YBTA 4BWLA 1EX5A 4E38A 3VX1A 1XX1A 2C0HA 2ZUUA 3H7RA 4RXGA 2J9YA 2HE5A 2NSXA 2ZUTA 5LIYX 4KT2A 5IDIA 3W73A 2J7DA 4CNTA 3VKJA 4AY8A 2BV9A 3WLPA 4P2VA 4YHEA 2NVDA 1W3NA 1GNXA 5LZLA 1PS9A 2FDSA 1RCQA 2NT0A 2PDIA 3L0GA 4AHOA 5AHNA 1YXCA 3PP7A 4WF7A 1KM5A 1WZMA 2V2DA 2NUXA 3IPWA 2VC7A 5A6BA 1NWUA 3CBWA 2WZHA 4W93A 2QYGA 5D2WA 1A53A 3TJIA 1DTUA 4NKCA 2BS9A 1DJWA 3SCWA 4BJHA 1ZBKA 1H1ZA 3AS1A 1UB3A 1C8VA 3A6OA 1KCXA 3N19B 5FD0A 3GNXA 5CC7A 3N3MA 1XPYA 1JPMA 3CQHA 2XWDA 4S2BA 4JFUA 1X8CA 2DY3A 5BRQA 3DYPA 1XYZA 3P0WA 1T40A 4AZGA 3W7EA 3CUGA 3NEVA 4R7JA 3CYJA 3F4WA 4Y6GA 3WQCA 2YDAA 1GOWA 4R7OA 1QFEA 1DOSA 1CGVA 2VC5A 1TMHA 2NX9A 2SFPA 3ATZA 4S3BA 1E5JA 4XAGA 2VL4A 1E9ZB 1K4HA 3U7BA 1NTHA 1TWDA 1H7WA 1FWNA 2VZOA 3QV6A 4PULA 4Z0JA 5KEZA 3TYAA 5I5RA 2E5BA 3ATYA 2VGBA 3H2AA 3GXPA 4ADUA 1HO1A 1FWWA 4GIEA 1E72M 3KOXA 1SJAA 5BOEA 3BAKA 3U2OA 3W71A 2PTZA 1NVMA 1OZQA 3COTA 1KLZA 1VYPX 2W5FA 3GTHA 1LQ2A 2OZ0A 2VEPA 4P7LA 1TA3B 2PS2A 3DH7A 4ASTA 4PGLA 3UPBA 4AZ7A 3S2LA 4CCDA 2WJFA 5H1WA 7REQA 4INFA 4Z2LA 3NOEA 3EYPA 1OYBA 3U57A 1TSIA 2XIQA 5M2FX 3AYRA 3F5KA 3AU6A 1ZJBA 3DG3A 3U4AA 2VWSA 1A4LA 2VFEA 3L7RA 1PIIA 2R94A 1H1NA 2VVSA 4G8TA 1EBGA 1EGZA 3VIHA 2FQIA 5AKQA 1KRMA 3W29A 2QEZA 5LNVA 1W3KA 4QROA 1Q45A 5CJMA 5IRPA 4W5ZA 4F0HA 3N17A 3LHYA 3NJ3A 1UPPA 1UBSA 1J96A 1RQBA 1JPHA 2Q02A 4DUWA 1XRTA 1R30A 4CQCA 4C7DA 3P5YA 3CEUA 3ZM8A 4C6JA 3MANA 3M0KA 3ZJKA 1OJXA 1HKJA 3AHZA 4Z1YA 4NX5A 2QJGA 3PS7A 3TLLA 4ZCWA 3AIEA 2VCCA 5CZTA 1Q66A 1LJYA 1GYMA 3FHAA 3W83A 2EG8A 1RPKA 4WJXA 4D9PA 2G3MA 1V77A 4EF8A 9RUBA 1F6KA 5LNSA 1QR7A 3IV8A 4K1GA 3Q37A 3ANYA 5FL0A 3NQFA 3CWNA 1J18A 4GC4A 4HPXA 1H7PA 1XRSA 1EJXC 4DJFD 1EC9A 1AJZA 1EZWA 3S1WA 2PE4A 2YW4A 3ZWSA 5A8OA 4AZCA 5BXRA 2D0HA 1WQ5A 1TWZA 4F40A 1UQYA 5XIAA 3E1F1 3W1MA 2QCEA 3PWGA 4KMQA 2J47A 3CH0A 3GVRA 3PPHA 1NM9A 1XSJA 2EKCA 2OU4A 4Q8OA 1VGAA 5D02A 3P62A 1OD8A 3NQGA 3MA8A 3JZUA 2NT1A 8TIMA 1D3CA 2VJXA 3I4KA 2ZZ4A 1R85A 1J9YA 3W00A 2PTXA 3GH4A 1SFJA 3GRIA 4M6PA 3OYXA 3UXAA 4UQCA 2V38A 4P8UA 1E9YB 3G0UA 6REQA 3H53A 3VO0A 2YLAA 1YDNA 3MHUA 1LRNA 3U48A 1PKNA 4IMAA 5F2LA 4UMAA 3PFMA 2XH7A 1MSSA 4N9EA 1TVPA 4Z17A 2Z28A 1AH0A 1QI5A 2Y85A 5DFAA 4AD3A 2XH0A 3CHFA 1FWAC 4LCSA 3WENA 5DRCA 3GHTA 3WQOA 5C55A 1C8XA 5BRPA 2PDBA 4GCAA 2ZX5A 4GK8A 4K8HA 3GKAA 3QSTA 2FZ8A 1V6UA 2I56A 4HPHA 2WK2A 1K9TA 1DEDA 3PZ9A 3OZPA 4FNPA 5T91A 5F2GA 2CW6A 3MZNA 1GVSA 3DFSA 2FIQA 4Q6JA 3BV7A 3WFLA 1SJDA 3CHCA 3OBEA 2ZRUA 4HK7A 1GVYA 1NQ6A 4YPJA 1M5WA 4C1NA 3OA5A 3VOFA 3T8QA 3GE7A 4D72A 3G3DA 1V8EA 1ME8A 3VE9A 1EOMA 1AL7A 2X1UA 1DYSA 3BLPX 1A5UA 2PGEA 3UZYA 2Y6ZA 3POCA 3OEXA 1PHQA 2F2KA 3E96A 3OZYA 4U5KA 2YZRA 1CPUA 1XH2A 2JF7A 2ZXQA 3HPXA 5EA9A 3VVGA 2WBGA 3W1RA 3B0VC 3O7UA 1PL9A 3FAWA 3Q67A 2YA1A 5I03A 2VEMA 1N7KA 1C8QA 5C2GA 1V3IA 4GIRA 3W28A 5CG0A 2CLLA 3E2QA 3RO6A 4V27A 3NUKA 5A8PA 2VZTA 2CLEA 3GG0A 1JYWA 3A3WA 4XAFA 2QZRA 5IOBA 1ALDA 1CXKA 3PF3A 2Y24A 1B1YA 1QW8A 4HA0A 4BEUA 3PAJA 3RU8X 4JD4A 4EOUA 4UTUA 4Q4KA 1KC7A 3LBMA 1Z44A 4Q4MA 4NI8A 1SMDA 4ZSTA 4UNKA 4UTTA 5B80A 3PC0A 4JN6A 4OTKA 4KBXA 5CCZA 4B5VA 4ROQA 2V67A 3VNZA 2ACSA 4GJ1A 1XCWA 4L1WA 2OSXA 1QPNA 1G0CA 4BQ2A 4E8DA 4LAUA 4AZHA 2NQ9A 4GVGA 3WL0A 3DFPA 5IM51 4MFEA 2RDXA 4M19A 1OSEA 4YXGA 1V93A 5CLWA 3LENA 4H41A 2ADAA 1NARA 4MJ4A 1H60A 4MB1A 4QDWA 1UKOA 1R86A 4QG8A 4DBSA 2GDVA 1TPEA 1SPQA 1WNOA 4FO4A 1BPLB 1E4LA 4ES4A 5CAHA 3PUOA 1RAKA 3WYZA 1JRBA 2XVPA 1UWAA 1XS2A 3AFBA 4Q33A 2UY4A 4S38A 4REQB 2E6DA 3JR2A 2BGQA 3TR2A 5A8MA 4Q7NA 3T2PA 4JTQA 3WNPA 3TOYA 4JY8A 5HULA 4F0SA 4UWMA 6ENLA 4W5UA 4PRTA 3IS4A 1KTCA 1PVNA 4G2DA 4L9ZA 4YHGA 3ITCA 2KX9A 3W7KA 1QPQA 2ZA3A 2PDFA 3OLGA 4ZTXA 1GOOA 3SCPA 2I14A 3BLDA 4HK5A 4UTWA 4F0KA 4KFPA 3H7VA 1UPMB 4HCLA 4W84A 5FCZA 3SQLA 3PVFA 4GLEA 4LBUA 4HA1A 4F2TA 3ZLHA 2A7RA 1L2UA 4B16A 1YHTA 1LOQA 3HJZA 4DHGA 4R34A 4HHMA 1U22A 1FHUA 2V5BA 1SMAA 4WIWA 3T40A 2NLIA 3TE9A 4O53A 1I2PA 2CHOA 2XH2A 1MNZA 4IMCA 2WSYA 5HXMA 2PDCA 2Y5EA 1P0BA 3TCEA 4CU7A 3RAOA 4AX6A 1J8VA 2NXHA 1JAKA 1OY0A 4TU1A 1FWFC 1FFQA 2BTMA 3GFZA 3CZJA 4QSHA 2VDHA 3RLGA 3EXTA 3STFA 2OQLA 3VMOA 3QHMA 4CN4A 3EDFA 4FF7A 4LNYA 5LHEA 3WELA 1UZDA 5BW6A 8XIMA 3R94A 4NNCA 3LBCA 1ONRA 3GXDA 4PB4A 1BKHA 3TA9A 4MZ8A 3OLIA 1K8ZA 3WJZA 1UCWA 1ECQA 2X16A 2XSAA 2V5DA 1XLCA 1SSDA 4DJED 4UQBA 1MUWA 3HG4A 1CGWA 1XD1A 2DZXA 3B06A 3VZYA 5G2HA 3HPAA 3QF0A 2PPGA 4C1NB 2O4QA 1DKWA 1NY1A 1VFLA 4O8RA 2V8ZA 4C7GA 4YTRA 3THAA 1YXDA 5A2BA 3BL3A 3ZR6A 4GNKB 3HA1A 3KS6A 1QHPA 2O55A 2VZVA 1AJ2A 3WDJA 3VDAA 3AS0A 2B7PA 3LNMA 1MEIA 2EBNA 3WF2A 3ARXA 5LA0A 4JIPA 1YTDA 4GYFA 1GK8A 5CC5A 7TAAA 4H4IA 4FB7A 3MSDA 1LP6A 3T09A 4KERA 2TYSA 3H24A 3L0NA 4GZJA 4GY7A 4TR9A 3S5YA 4ZQRA 2GDUA 3REQA 5CSUA 4MDPA 2P8BA 2DSVA 5DXXA 2KZHA 5FKYA 1SFSA 4GRSA 3DU0A 5I07A 5I3IA 3QGKC 3R79A 5AYXA 1S38A 3ZT7A 1I1WA 1VFSA 4XBKA 4E4FA 2XIBA 3RLVA 2Y8VA 3ITYA 1XIMA 4EP8C 3BXWA 1VYSX 4MFDA 3UGVA 3LRMA 4JEQA 3EB4A 4PC8A 1MW1A 4AY7A 3LMZA 4LAOA 3IEBA 2E40A 1H7RA 2YCKX 3A24A 3UR2A 4UBPC 2V6AA 2G4JA 5CZSA 3E2SA 4LU0A 1ADSA 3OLEA 4IZGA 2ZRZA 1PYMA 2Y8UA 4HZ8A 4JY9A 4Z1DA 4Y9AA 3RDKA 4GVFA 5I00A 3GR8A 1X1OA 5D33A 5FJPA 4W7UA 3TN5A 2PUZA 1KR0A 5KZ6A 1CBGA 5H91A 1SU5A 4KCTA 4NQ1A 2V5CA 1JEZA 5GJNA 3RM4A 2P10A 2A4AA 1GGOA 1L6YA 1LT7A 3HFTA 2HISA 5C9UA 3SRKA 3WLJA 4KEUA 3FNDA 3QZAA 4L4OA 4PMUA 1WXYA 4XBJA 4A2RA 1XINA 4GUFA 4I90A 2J6VA 4PUDA 5BWFA 1B3WA 2HWGA 2PDMA 4A8NA 2FVLA 4IISA 2V3GA 1K6WA 1TTQA 3F5JA 3FYOA 2IPJA 2YW3A 4O13A 3P81A 4PB5A 1SUXA 1ZALA 2HPMA 3IRDA 1VFOA 1TKKA 3CIWA 3BO9A 4JX6A 1G9HA 1T0OA 3UU0A 3V75A 3B8VA 1O94A 1IXPA 1GJPA 1TV5A 1UOZA 4V1XA 1VCFA 2PDNA 2G3JA 4QE1A 3VD5A 1ZP3A 1ZTVA 2CWNA 3M41A 5HWMA 3R43A 3W7IA 2JKEA 4ZA0A 2WPBA 2Z2AA 4PYSA 2FJKA 1TPWA 3DKJA 3CUIA 1LBFA 4Q8UA 4Q8NA 4AH7A 2QVNA 2ZRYA 3HPZA 5LIWX 3AJXA 4CNOA 4ZB2A 1W8GA 3OP2A 2J78A 1QRQA 5HA7A 4E2VA 5KMYA 2Y63A 4UTMA 3ITLA 3KXQA 4FALA 4QDPA 4HZMA 3MCNA 3AMCA 1J5SA 3AIRA 4DZIA 4GZ7A 2D20A 1E51A 2WKJA 5A69A 3FGCB 4L4LA 3TTEA 1MEWA 3QPEA 6ALDA 5GVJA 3F2BA 1LOSA 5D2TA 3NZPA 1JFHA 3WH9A 2P3EA 1O66A 1FH8A 3QGAC 2KAUC 3UA3A 3G6MA 2YJQA 1W5NA 4HSOA 4OKDA 3VIIA 4A35A 3C8FA 3V0UA 3LCLA 3EKZA 5E70A 1LQ0A 3B97A 3BE7A 3SCOA 3W1XA 3VCCA 1OFOA 3QHOA 3BC9A 1W1TA 3VDGA 1MVYA 3OHMB 4O11A 4XZWA 4LB3A 2ZKMX 5M5DA 3QLDA 1TUFA 2BP1A 1MEHA 1H62A 4DPPA 4KRUA 2DFAA 4YIWA 4Q8PA 2ABAA 3S8HA 3W70A 2VVNA 2XN1A 1FQ0A 1IIGA 3GVQA 4JZ5A 4Y8FA 1P0KA 1XH0A 2PDKA 1MXSA 3A47A 3NYDA 4GBUA 1H41A 4US5D 4A3RA 3W74A 1JD9A 5FACA 4B4HA 1O95A 1VFUA 4ZOBA 3VD4A 2D1ZA 2GWGA 1XLAA 3O6YX 4RNFA 1EJTC 2G3FA 4PCPA 3T6CA 3W0KA 2X2YA 1BF2A 3IJ7A 3JRKA 4URIA 3UF9A 3TN6A 2EAWA 2ZTKA 3BCDA 3VGDA 4NG3A 1DWJM 4O1AA 3GXMA 3VNYA 4K6AA 4JKMA 3GZAA 4W7VA 3VIMA 1EKOA 4FEZA 2OZTA 2GUBA 3FJ4A 2QUTA 3GHRA 1C91A 2YIHA 4JICA 3IUHA 3WQ6A 4PCFA 3O6DA 2BHZA 3ABQA 4O17A 3LCXA 4QXIA 3VDHA 3QTPA 4S39A 3WUBA 2AQWA 1EGMA 4DAFA 4JPGA 5HUOA 4JTCA 3PN8A 4N42A 4JL2A 5FJRA 1OFEA 1JUKA 3TW9A 1XKYA 1XYCA 3UCCA 1D8CA 3DYMA 4U4MA 5ENLA 1M53A 4XZNX 5K9DA 1C29A 3L9CA 4DZHA 1TCDA 1H51A 5CPNA 3VIPA 3GX9A 4MNLA 2C19A 4GWEA 1LG1A 3BJSA 4UTKA 2NUWA 3WK2A 4H6KA 5H8MA 1Q85A 3K4DA 4UR7A 1R3SA 2E4TA 3GY1A 3HG5A 2OZ3A 3PANA 8A3HA 1KM2A 3DESA 1H50A 4N02A 1GVRA 4D6JA 2Z1SA 4QLLA 4E2DA 4L4PA 3SO7A 5LGZA 1XYBA 1CLVA 3HGOA 4LAMA 3VD9A 4L56A 3LPFA 1VHCA 4A3UA 1R38A 1V6YA 2ZX8A 2GSHA 3CAWA 4DLMA 5A6KA 1CXHA 3FX4A 1YRRA 4S3KA 2DZVA 2VC6A 3THUA 4C6IA 1KM6A 2AKMA 5FIPA 4YYCA 2BWGA 1KKRA 1L0PA 1W1IE 2IKHA 1KM0A 3UXLA 1G4EA 3KBNA 1V0KA 3TMLA 3A9IA 4Y8EA 1HIZA 3CL7A 1ZP4A 2Z2UA 2E6AA 4E4UA 3VNLA 5XINA 3IJ9A 1B30A 3W3OA 3EDDA 4A22A 4HPNA 3VUSA 3KVKA 1B57A 4YVPA 3M5YA 3R5EA 2WJDA