4WGJA

Crystal structure of bepc protein (virb-translocated bartonella effector protein) with bound amppnp from bartonella tribocorum
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
210
structure length
210
Chain Sequence
HHMEQNYLYKGTTTLKNKYGIKDPNKLYERCNHDVVKEAVNFRHEPPPQNFDAAYLSLIHWSLFHKTFEWAGHTRDTSFTFEDGTTARMPAMRPKGYEAPFAIGPQIKKELKQLEKTLNQKNNLKGLSHQEFAENAADVFMALEHAHPFRKGNGRANRMFMEKLGQAAGHTVDFSFITKGRMTTACIEAMQYGNSQPMKDLFEDITHPQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of BepC protein (VirB-translocated Bartonella effector protein) with bound AMPPNP from Bartonella tribocorum
rcsb
source organism Bartonella tribocorum
molecule tags Transferase
molecule keywords BepC protein
total genus 77
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4wgjA00
5CGLA 4X2DA 4LU4A 2G03A 4U0UA 4ITRA 4X2CA 2JK8A 3ZCBA 5JFFA 3SN9A 4WGJA 4X2EA 3ZLMA 4U0SA 5CMTA 3CUCA 4U04A 5JFZA 5JJ7A 4XI8A 4N67A 3ZC7A 3N3UA 2VY3A 4U07A 5EU0A 5JJ6A 4PY3A 3SE5A 2VZAA 3S6AA 3SHGA 4U0ZA 2F6SA 5CKLA 4NPSA 4M16A 3LETA
chains in the Genus database with same CATH superfamily
5CGLA 4X2DA 4LU4A 2G03A 4U0UA 4ITRA 4X2CA 2JK8A 3ZCBA 5JFFA 3SN9A 4WGJA 4X2EA 3ZLMA 4U0SA 5CMTA 3CUCA 4U04A 5JFZA 5JJ7A 4XI8A 4N67A 3ZC7A 3N3UA 1NH1A 2VY3A 4U07A 5EU0A 5JJ6A 4PY3A 3SE5A 2VZAA 2NUDA 3S6AA 3SHGA 2NUNA 4U0ZA 2F6SA 5CKLA 4NPSA 4M16A 3LETA
chains in the Genus database with same CATH topology
5CGLA 4X2DA 4LU4A 2G03A 4U0UA 4ITRA 4X2CA 2JK8A 3ZCBA 5JFFA 3SN9A 4WGJA 4X2EA 3ZLMA 4U0SA 5CMTA 3CUCA 4U04A 5JFZA 5JJ7A 4XI8A 4N67A 3ZC7A 3N3UA 2VY3A 4U07A 5EU0A 5JJ6A 4PY3A 3SE5A 2VZAA 3S6AA 3SHGA 4U0ZA 2F6SA 5CKLA 4NPSA 4M16A 3LETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CGL A;  4X2D A;  4LU4 A;  2G03 A;  4U0U A;  4ITR A;  4X2C A;  2JK8 A;  3ZCB A;  5JFF A;  3SN9 A;  4WGJ A;  4X2E A;  3ZLM A;  4U0S A;  5CMT A;  3CUC A;  4U04 A;  5JFZ A;  5JJ7 A;  4XI8 A;  4N67 A;  3ZC7 A;  3N3U A;  2VY3 A;  4U07 A;  5EU0 A;  5JJ6 A;  4PY3 A;  3SE5 A;  2VZA A;  3S6A A;  3SHG A;  4U0Z A;  2F6S A;  5CKL A;  4NPS A;  4M16 A;  3LET A; 
#chains in the Genus database with same CATH topology
 5CGL A;  4X2D A;  4LU4 A;  2G03 A;  4U0U A;  4ITR A;  4X2C A;  2JK8 A;  3ZCB A;  5JFF A;  3SN9 A;  4WGJ A;  4X2E A;  3ZLM A;  4U0S A;  5CMT A;  3CUC A;  4U04 A;  5JFZ A;  5JJ7 A;  4XI8 A;  4N67 A;  3ZC7 A;  3N3U A;  1NH1 A;  2VY3 A;  4U07 A;  5EU0 A;  5JJ6 A;  4PY3 A;  3SE5 A;  2VZA A;  2NUD A;  3S6A A;  3SHG A;  2NUN A;  4U0Z A;  2F6S A;  5CKL A;  4NPS A;  4M16 A;  3LET A; 
#chains in the Genus database with same CATH homology
 5CGL A;  4X2D A;  4LU4 A;  2G03 A;  4U0U A;  4ITR A;  4X2C A;  2JK8 A;  3ZCB A;  5JFF A;  3SN9 A;  4WGJ A;  4X2E A;  3ZLM A;  4U0S A;  5CMT A;  3CUC A;  4U04 A;  5JFZ A;  5JJ7 A;  4XI8 A;  4N67 A;  3ZC7 A;  3N3U A;  2VY3 A;  4U07 A;  5EU0 A;  5JJ6 A;  4PY3 A;  3SE5 A;  2VZA A;  3S6A A;  3SHG A;  4U0Z A;  2F6S A;  5CKL A;  4NPS A;  4M16 A;  3LET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...