4WGYA

Crystal structure of cytochrome c' from alcaligenes xylosoxidans ncimb 11015 at ph 10.4
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystallographic Elucidation for the Alkaline High-spin State Transition of Iron(III) Cytochrome c' from Alcaligenes xylosoxidans NCIMB 11015
doi rcsb
molecule tags Electron transport
molecule keywords Cytochrome c'
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2014-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4wgyA00
3QW1A 3DE9A 3TOLA 3FOOA 256BA 3M4BA 4JEAA 2XL6A 1E86A 2CCYA 2YL0A 3C62A 1E83A 3M4CA 1APCA 5JS5A 5JT4A 2YL3A 2XLDA 1E84A 2J8WA 2XM4A 3VRCA 3M79A 4CJOA 4ER9A 2XLVA 4WGYA 5JRAA 3QVZA 2XM0A 4N6HA 1JAFA 2QLAA 1M6TA 3HNJA 2XLEA 1LM3B 3ZTMA 5JLIA 2J9BA 5JSLA 1MQVA 1CPRA 3HNLA 2XLHA 3M15A 3QW0A 3QVYA 1NBBA 1EKYA 1CGOA 3HNKA 4IAQA 2YLGA 3L1MA 4D4XA 5JP7A 3ZTZA 4N4WA 5JUAA 1BBHA 4EIYA 2XL8A 2YLIA 5AGFA 2YL1A 4ULVA 3DE8A 1E85A 3NMJA 4CDYA 1GQAA 2YLDA 4IARA 2XLWA 5JVEA 4CDAA 4JEBA 4WGZA 1CPQA 3C63A 4JKVA 2BC5A 4JE9A 1YZAA 3ZWIA 1QPUA 3U8PA 4IB4A 3TOMA 4CIPA 4D4NA 4U9DA 4NC3A 1S05A 3IQ5A 2YL7A 2XLOA 3NMKA 3ZQYA 1YZCA 2YKZA 4CDVA 1CGNA 1YYJA 1QQ3A 3IQ6A 1YYXA 3FOPA 1A7VA 2XLMA 3NMIA 5B3IA 4CX9A 3HNIA 4CJGA 4U9EA 4L6RA 3ZQVA 1RCPA
chains in the Genus database with same CATH superfamily
1IZMA 1O87A 3QW1A 3FAPB 1A41A 1PV3A 3DE9A 1L3PA 3FOOA 2KQ9A 3M4BA 1O3UA 4H4KC 1OW6A 1D1BA 1TKNA 1LIHA 2Q3TA 2CYDA 1UG7A 3CEXA 4JJGA 3SNHA 3ZDLA 2CCYA 5B3SC 1H7IA 2AP3A 3C62A 5KYUB 3ITFA 2YVKA 3M4CA 3VM6A 5A6KA 5DVWA 2G62A 2P6VA 1GM5A 5A6JA 4K1OA 1YARO 2HV6A 1HE1A 2AWYA 2ZXOA 3AG4C 3L8JA 3PCVA 4LDKA 1M2VB 2PX3A 2XLDA 2UUIA 1YJGA 2J8WA 2OEXA 3AG3C 3M79A 3VRCA 1D0ZA 1IW7F 2CGEA 2XLVA 1K04A 3H65A 1YAUO 4HFFB 2QE9A 2XM0A 1LKXA 1JAFA 2QLAA 2UUHA 4N6HA 2XXAB 2ETSA 3QTHA 3HNJA 3LESA 2VCBA 3AOUA 5JLIA 2J9BA 1MQVA 3R2PA 3W2WA 4YWQA 1Z6AA 1FTSA 3K1HA 2NUPA 1LS4A 2R02A 2P0NA 3S9OA 4OIQF 2Q9BA 2P1AA 2C03A 2RSEB 4U5CE 4YN0B 3L0IA 1HMDA 4MQ9F 4YT4A 1ORSC 2NPUA 2PNOA 2XLHA 3M15A 3SXKA 2PP4A 4LLEA 4MTOA 3AGTA 4KNVA 4E7SA 3NYJA 1TWGA 1NBBA 3TD7A 1I4YA 4O7GA 2R7VA 3PHF2 1OQCA 3GM1A 2OJQA 2HFIA 4E0IA 2YLGA 5B1AC 1OW8A 4JCZA 1S7ZA 3EG9B 3T4RA 2KJGA 3IQTA 3ZTZA 3NRHA 2A1DD 1QZXA 5L0JA 2WZLA 4MTFA 1ZZPA 2B0JA 3GM2A 5T3WA 4BJ1A 3A9CA 3U0CA 1OCOC 1ZU5A 3EHNA 4NQFA 2OQMA 5BQGA 5A69A 2YL1A 3BRJA 3KKBA 3FDQA 3ABLC 2R7WA 1T6IA 3OWTA 4GEHA 4HFKB 4DRJB 2L7AA 4IJJA 4E17A 1VYIA 4JVSA 3X1OA 2A0UA 1KTMA 1RKEB 4Q4ZF 4PK4A 4QI2A 1J8YF 3KYJA 2R7XA 2D4UA 2YLDA 2W45A 2L81A 1MMNA 4IARA 4DBRA 1LVKA 2VC9A 4BEMJ 3DAGA 2Q9AA 4CDAA 1BR1A 1H6GA 3JYYA 1PD0A 2CW0F 1Q0GA 5A6BD 4CS7A 3GEEA 1OW7A 3LS1A 2WVNA 2HV7A 5K0IA 1ZHYA 2VB6A 4E18A 1T01A 2PX0A 3C63A 1EI7A 2YWAA 4YT8A 3BEHA 2HSQA 1A7EA 2LCHA 4W8PA 1EQ1A 3O39A 3ZSUA 4Z9HA 4J30B 3CSKA 4BJ6A 3UGOA 1OKKA 2I15A 3ZG1A 4BJ6C 4ZLCA 4G7ZF 4WABA 4I1OB 2HMZA 4MVRA 1NZEA 5A6BA 1Q0DA 3AG1C 2PBEA 3C8ZA 1ZHWA 3GM3A 2YHSA 4DXWA 1I5NA 1AUEA 1TQGA 1WOLA 1K40A 4NC3A 1NU9C 2L9JA 4YT5A 1OR2A 1TWAA 3TJ5A 3B0VC 3G4ZA 1T6UA 1YA9A 2IOQA 2L6GA 2LIGA 1H9GA 3IHUA 4BEJA 4G7OF 2Q9CA 4KBLA 3U9JA 3O6XA 1TWCA 2YKZA 1YYJA 2LFFA 3FHDA 2KW3C 2ZPAA 1YYXA 2IXMA 3EZHA 2LD6A 3JSEO 4NTBA 3J06A 4DRHB 4U5DE 1WWPA 2XLMA 4EUKB 3TULA 1JRAA 4GYTA 3LLKA 3W8IA 5B3IA 1ZW2A 1ZYRF 4MW8A 2EIJC 3E70C 1HW1A 4L6RA 2ICWG 1J8MF 1QKRA 3I5QA 3Q7GA 2J46A 3EH2A 4PFPA 4U5FE 2E87A 5DQZA 1RMVA 3NG1A 3MLGA 3TOLA 2VH3A 3DI5A 3WODF 2LK4A 1G5ZA 1D0YA 3LUTB 4CSAC 2R7OA 2EPLX 3DAFA 1E86A 1WGWA 2FAPB 1QVXA 1Q0FA 1SF8A 4EKWA 3S0XA 4B6IA 3UGPA 2XS8A 3LNMB 1PD1A 4E0HA 1E83A 3E9VA 4XLNF 5L0HA 1E2XA 2G3KA 4PJNA 3M1CB 1MMAA 4G7HF 5JS5A 4MVZA 5E3AA 2JD3A 4NTAA 1OXKA 4YL1A 5JT4A 2YL3A 3F47A 2HJ3A 1M57C 1NFOA 3NYLA 4JW1A 2EIMC 1VTMP 5KYYB 2ZXWC 1A7DA 2EINC 4OIPF 1KU2A 4J32B 4FWVA 1Y6DA 3V7OA 5IY5C 1BZ4A 1C03A 2QNLA 2XXAA 1RJ9A 2WVOA 1FMVA 4CS9C 3IPMO 1T5OA 2OKUA 2MYSA 2Y3DA 3S27A 2IXNA 4E7ZA 2WVQA 1AVOB 4XEFA 2EPKX 5BUOA 2R7UA 3EFOA 2J9WA 3KH2A 5HV9A 2F22A 1JMWA 2WZGA 3NYMA 1D0XA 2R9RB 1ZVZA 3UMHA 3W4YA 4LACB 1OCRC 4JRZA 1LE4A 1TFKB 1FR0A 2M64A 1A0BA 3W2VA 1D1CA 5L0IA 2Q7RA 4JTAB 4U5GA 1Q0MA 4Q5SF 5E33A 4D4XA 1XZQA 5BQHA 2Q4FA 3MBGA 4YT2A 2KSFA 3S29A 4RBNA 4EIYA 4Z9IA 3WAQA 1TR2A 4MTGA 3UNGC 2DI3A 3ZC4A 4MVUA 5DLJA 2HUJA 1I4ZA 3SZRA 4YL0A 4JCHA 4ULVA 2V3CC 2P61A 3FXHA 1NSGB 4YL3A 4G78A 4I1MA 5L0GA 1GQAA 3EZIA 3NKDA 3LNRA 4XQ1A 1NU7D 2J7PA 3CQZA 1OKKD 2J0WA 3EJNA 5COFA 2Y69C 4JEBA 3C8GB 1FFHA 5E2QA 5AC5A 1UFBA 4NY3A 2ZXRA 3IEEA 3GEHA 1VK5A 4LERA 1OCZC 4WGZA 3MYFA 2BE5F 2VCAA 2D5RB 1U6HA 4ANJA 2GA0A 3DZAA 4RD9A 1SYQA 3ASNC 2BC5A 1GGQA 2P7VA 2IXOA 4BJTA 5CI8A 3DXJF 4AE4A 2YZSA 1L7CA 3B29A 2EIKC 2J7PD 2OG2A 2JX0A 3RFYA 4QI0A 3VYWA 5KYXA 3K1IA 5D92A 3EGDB 1VLSA 2G3VA 3LEOA 3T9OA 4K0DA 1N1CA 3ZVRA 4D4NA 4U9DA 1OXBA 1M2OA 4NCQA 3JZ0A 1V4AA 5KYYA 4O6NA 1YDIA 1NLXA 4XPXA 3WG7C 4K7BA 1V55C 3SXZA 2Y3HA 3A11A 1F1MA 3IQ5A 3RQGA 2YL7A 2XLOA 2B0HA 4MVSA 4CBEA 1U89A 1Z23A 3NMKA 1Z63A 1MNEA 3JYHA 3ZQYA 2KYHA 3JCUQ 2DGJA 3EFOB 4OIRF 4CS9A 1G4US 5KYUA 1Q0KA 3FOPA 3HJCA 1V54C 3HKKA 4J7TA 4PJLA 4CS8C 2LQGA 4EHPA 2DYRC 3EGDA 3KYIA 3MFNA 3NMIA 1U0BB 1NFNA 4XTKA 3L8IA 3K66A 1AEPA 2Y3BA 3FAJA 1YA7O 2XSEA 3RKOF 3ZQVA 5BQIA 1LI5A 4EWCA 2HKVA 2A6EF 3Q6MA 4JTCB 1DOVA 3UMIA 1JOGA 3TJ6A 3LS0A 5GPGB 4DRIB 4HE8D 3EPVA 3ZIBA 3RIPA 1ORJA 3SYNA 1H9TA 3AGUA 4DVZA 3QMKA 3MYIA 4XWJA 2AWCA 2J45A 4I3MA 5DS5A 2HS5A 3GWLA 2LSEA 1BR2A 3T6BA 1APCA 3G50A 2R7RA 2XS1A 2L6HA 2EPNA 3C8GD 3QZCA 5DQTA 4ZLDA 1E84A 1VB5A 3FMSA 2R7SA 4CJOA 3K7DA 3ECSA 4KNWA 4ULWA 4ER9A 5JRAA 2OU6A 2M4EA 3QVZA 5T3TA 3U3FA 4AX2A 4BJ5A 1HE9A 1JPNA 4BG0A 1LM3B 4Z9JA 3S28A 3ZTMA 1CGME 4KI2A 4AE4B 1JPJA 3IQCA 4PJJA 1CPRA 5COMA 3EGXB 3H2VA 1BDJB 2EPOA 4RDAA 2NSGA 2H7OA 2OOCA 2QUPA 3QW0A 3RYLA 4X0RA 1FNTc 2OCCC 2LFDA 2IBFA 4Q7CA 3S84A 4CIHA 1D1AA 1CGOA 5DS4A 3JTLO 3DMDA 4IAQA 3SP1A 4P6IC 3L1MA 2GFHA 2NUTA 5EGYA 2WZFA 5JP7A 5L0DA 4J7YA 4N4WA 2A0BA 2GWWA 1FAPB 1BBHA 5E3CA 1RXQA 1LS1A 3U2MA 4AL0A 5L0CA 3JSZA 2YLIA 4O79A 5AGFA 4EBBA 4IAOA 3OA1A 3DKAA 1HY5A 2HJMA 2HSBA 4BPMA 1W2WA 4C3DA 4CDYA 1QLEC 2IM8A 4FAPB 2KK1A 3UR3C 3ASOC 4OD4A 3AG2C 2I8BA 2IXPA 5L3QA 5JVEA 1ZW3A 3B71A 4XEKA 3TK0A 3NDBB 4IWBA 5AC4A 1ST6A 1EA8A 3OEOA 1KNYA 4N6CA 4C7OA 3PDMP 4KC9A 1HW2A 4JC7A 1JR8A 2JPUA 2W4BA 1OCCC 2MWQA 5KYXB 1TWHA 2R7QA 3AQCA 1LI7A 4I44A 4IB4A 5HSWA 4OIOF 3K33A 1G8XA 3RQEA 4YJWA 3TOMA 4CIPA 3B9QA 3U3BA 3U9MA 3N2ZB 1RKEA 4LDQA 4A4AA 5EHHA 2X51A 3NKEA 4LDRA 4N06A 2A68F 5DS6A 3KMIA 4JZAA 1S05A 1YVIA 2R05A 2CDQA 3PMRA 4XEVA 2V26A 1VYKA 2BL2A 2C04A 2XRHA 3C7JA 4JJFA 3SXYA 1SZIA 4ONSA 1RKCA 4WJ0A 3U2LA 3US6A 1YZCA 1PCXA 1ZU4A 2VCCA 3RQFA 1WN0A 2TMVP 2YEVA 1QQ3A 3O55A 4IGGA 4PR9A 1HMOA 3N24A 3T6JA 4P9FA 4H54A 2HZ8A 3SXMA 2IYLD 3RW0A 4G0HA 4CS8A 2KNHA 2NUPB 4O6MA 2QY9A 5F28E 3WHNA 4EBJA 3EGXA 2HMQA 2LP4A 2WL8A 3RVZA 3DWWA 3EHMA 4CX9A 3HNIA 3JT1A 2ASRA 4MNDA 3UMKA 4U9EA 2NUTB 3VF0A 2Q00A 2H8AA 4XPYA 3POVA 2R7TA 5EK0A 4A2NB 2FFHA 4C3EA 5KYWA 3L34A 3V5XA 1T6QA 3C8GA 1XWJA 3ABMC 3AJMA 256BA 3LEVA 4JEAA 1ZHTA 4OD5A 3RF3A 1Y4CA 2EPMX 3GODA 1K05A 1VMAA 5CIVA 1T9KA 2XL6A 3FVYA 4MS2A 3EQLF 4PACA 2W4MA 2YL0A 4XLPF 5F5FA 3B0UX 5L0FA 3C18A 5A6AA 2KC3A 4M63A 4W8KA 4EBKA 1Z3IX 1G4WR 2EILC 3O10A 5D91A 3HTKC 2Y3GA 4PJMA 4U5BE 1BR4A 3AQBA 4U5HA 2XM4A 2L6FA 2O9XA 3GANA 4JURI 5FCLA 3LLIA 3DM9B 1M6TA 2VASA 1LPEA 2XLEA 3RH3A 4UDVA 4WGYA 3N0TA 2WB7A 3ABKC 5JSLA 2W9YA 2J9VA 3H2UA 3HNLA 1WATA 1M56C 1YLMA 3Q7LA 4GQHA 2AVKA 5TJ5E 2NG1A 3HLZA 2OEVA 3CAXA 3EH1A 3X2QC 3QVYA 1FFTC 2AU5A 3RVYA 2H7VC 2NSFA 4NTFA 1EKYA 3VAYA 1Z5ZA 3EG9A 3HNKA 3V5YA 1ZHZA 2MHRA 2DB4A 5JUAA 3F46A 4JTDB 4IRUA 4OINF 1XZPA 2OJED 5L3VA 1RJ9B 3DM5A 3LAYA 2H7BA 2XL8A 2ZXPA 3B0PA 5F5HA 4P9TA 3S90A 2XL4A 3DE8A 1E85A 1B68A 1GS9A 2CNWA 1FMWA 3NMJA 1WASA 4QDLA 3DJNB 1MMGA 3K1IC 3I4UA 4O6YA 3GEIA 1V74B 3DD7A 4AL1A 1WTYA 3GORA 1SMYF 3G4XA 4DVYP 2XLWA 1M2VA 1MNDA 2RD9A 4YK5A 3W8HA 3KPHA 2KGOA 1DOWA 5KYWB 4C7OB 3JRMO 3Q6NA 3LJBA 1Z7Qc 4CSAA 3SEOA 3U8VA 1C02A 1LE2A 2J9UA 5T1DB 4MVMA 1C17M 1CPQA 2CNWD 2A69F 2FGYA 1QSPA 2ZD9A 4JIOA 1SR2A 4JKVA 4JE9A 4BJ5C 1YZAA 3ZWIA 1QPUA 3ATPA 4LLCA 3U5SA 3U8PA 5CI9A 3MX3A 2J0XA 3K6BA 4C3BA 2A6HF 4AK9A 4DJ9A 3KL4A 1OR3A 2QTVA 4XPWA 4U5EE 5KYNA 3I5PA 2PFDA 3TQOA 4FESA 1R4TA 4R32A 1TFOB 1R5ID 4FX5A 4MVQA 5FZTA 3JRTA 1ORYA 2Z15A 5COGA 4MW3A 1MMDA 2GDCA 1O5HA 1ZHXA 1CGNA 2Y39A 2YRFA 3DJUB 3R7CA 3IQ6A 4CDVA 5B1BC 2YQYA 4DBQA 1VLTA 3GWNA 2X0CA 1NG1A 1A7VA 2PF4E 4F4BA 3T6GB 2GAQA 2R03A 4HEAJ 4MVOA 4PFOA 1VOMA 3V5ZA 4CJGA 2DYSC 3CZ6A 2R25A 4DOZA 1RCPA
chains in the Genus database with same CATH topology
3QW1A 3DE9A 3TOLA 3FOOA 256BA 3M4BA 4JEAA 2XL6A 1E86A 2CCYA 2YL0A 3C62A 1E83A 3M4CA 1APCA 5JS5A 5JT4A 2YL3A 2XLDA 1E84A 2J8WA 2XM4A 3VRCA 3M79A 4CJOA 4ER9A 2XLVA 4WGYA 5JRAA 3QVZA 2XM0A 4N6HA 1JAFA 2QLAA 1M6TA 3HNJA 2XLEA 1LM3B 3ZTMA 5JLIA 2J9BA 5JSLA 1MQVA 1CPRA 3HNLA 2XLHA 3M15A 3QW0A 3QVYA 1NBBA 1EKYA 1CGOA 3HNKA 4IAQA 2YLGA 3L1MA 4D4XA 5JP7A 3ZTZA 4N4WA 5JUAA 1BBHA 4EIYA 2XL8A 2YLIA 5AGFA 2YL1A 4ULVA 3DE8A 1E85A 3NMJA 4CDYA 1GQAA 2YLDA 4IARA 2XLWA 5JVEA 4CDAA 4JEBA 4WGZA 1CPQA 3C63A 4JKVA 2BC5A 4JE9A 1YZAA 3ZWIA 1QPUA 3U8PA 4IB4A 3TOMA 4CIPA 4D4NA 4U9DA 4NC3A 1S05A 3IQ5A 2YL7A 2XLOA 3NMKA 3ZQYA 1YZCA 2YKZA 4CDVA 1CGNA 1YYJA 1QQ3A 3IQ6A 1YYXA 3FOPA 1A7VA 2XLMA 3NMIA 5B3IA 4CX9A 3HNIA 4CJGA 4U9EA 4L6RA 3ZQVA 1RCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QW1 A;  3DE9 A;  3TOL A;  3FOO A;  256B A;  3M4B A;  4JEA A;  2XL6 A;  1E86 A;  2CCY A;  2YL0 A;  3C62 A;  1E83 A;  3M4C A;  1APC A;  5JS5 A;  5JT4 A;  2YL3 A;  2XLD A;  1E84 A;  2J8W A;  2XM4 A;  3VRC A;  3M79 A;  4CJO A;  4ER9 A;  2XLV A;  4WGY A;  5JRA A;  3QVZ A;  2XM0 A;  4N6H A;  1JAF A;  2QLA A;  1M6T A;  3HNJ A;  2XLE A;  1LM3 B;  3ZTM A;  5JLI A;  2J9B A;  5JSL A;  1MQV A;  1CPR A;  3HNL A;  2XLH A;  3M15 A;  3QW0 A;  3QVY A;  1NBB A;  1EKY A;  1CGO A;  3HNK A;  4IAQ A;  2YLG A;  3L1M A;  4D4X A;  5JP7 A;  3ZTZ A;  4N4W A;  5JUA A;  1BBH A;  4EIY A;  2XL8 A;  2YLI A;  5AGF A;  2YL1 A;  4ULV A;  3DE8 A;  1E85 A;  3NMJ A;  4CDY A;  1GQA A;  2YLD A;  4IAR A;  2XLW A;  5JVE A;  4CDA A;  4JEB A;  4WGZ A;  1CPQ A;  3C63 A;  4JKV A;  2BC5 A;  4JE9 A;  1YZA A;  3ZWI A;  1QPU A;  3U8P A;  4IB4 A;  3TOM A;  4CIP A;  4D4N A;  4U9D A;  4NC3 A;  1S05 A;  3IQ5 A;  2YL7 A;  2XLO A;  3NMK A;  3ZQY A;  1YZC A;  2YKZ A;  4CDV A;  1CGN A;  1YYJ A;  1QQ3 A;  3IQ6 A;  1YYX A;  3FOP A;  1A7V A;  2XLM A;  3NMI A;  5B3I A;  4CX9 A;  3HNI A;  4CJG A;  4U9E A;  4L6R A;  3ZQV A;  1RCP A; 
#chains in the Genus database with same CATH topology
 1IZM A;  1O87 A;  3QW1 A;  3FAP B;  1A41 A;  1PV3 A;  3DE9 A;  1L3P A;  3FOO A;  2KQ9 A;  3M4B A;  1O3U A;  4H4K C;  1OW6 A;  1D1B A;  1TKN A;  1LIH A;  2Q3T A;  2CYD A;  1UG7 A;  3CEX A;  4JJG A;  3SNH A;  3ZDL A;  2CCY A;  5B3S C;  1H7I A;  2AP3 A;  3C62 A;  5KYU B;  3ITF A;  2YVK A;  3M4C A;  3VM6 A;  5A6K A;  5DVW A;  2G62 A;  2P6V A;  1GM5 A;  5A6J A;  4K1O A;  1YAR O;  2HV6 A;  1HE1 A;  2AWY A;  2ZXO A;  3AG4 C;  3L8J A;  3PCV A;  4LDK A;  1M2V B;  2PX3 A;  2XLD A;  2UUI A;  1YJG A;  2J8W A;  2OEX A;  3AG3 C;  3M79 A;  3VRC A;  1D0Z A;  1IW7 F;  2CGE A;  2XLV A;  1K04 A;  3H65 A;  1YAU O;  4HFF B;  2QE9 A;  2XM0 A;  1LKX A;  1JAF A;  2QLA A;  2UUH A;  4N6H A;  2XXA B;  2ETS A;  3QTH A;  3HNJ A;  3LES A;  2VCB A;  3AOU A;  5JLI A;  2J9B A;  1MQV A;  3R2P A;  3W2W A;  4YWQ A;  1Z6A A;  1FTS A;  3K1H A;  2NUP A;  1LS4 A;  2R02 A;  2P0N A;  3S9O A;  4OIQ F;  2Q9B A;  2P1A A;  2C03 A;  2RSE B;  4U5C E;  4YN0 B;  3L0I A;  1HMD A;  4MQ9 F;  4YT4 A;  1ORS C;  2NPU A;  2PNO A;  2XLH A;  3M15 A;  3SXK A;  2PP4 A;  4LLE A;  4MTO A;  3AGT A;  4KNV A;  4E7S A;  3NYJ A;  1TWG A;  1NBB A;  3TD7 A;  1I4Y A;  4O7G A;  2R7V A;  3PHF 2;  1OQC A;  3GM1 A;  2OJQ A;  2HFI A;  4E0I A;  2YLG A;  5B1A C;  1OW8 A;  4JCZ A;  1S7Z A;  3EG9 B;  3T4R A;  2KJG A;  3IQT A;  3ZTZ A;  3NRH A;  2A1D D;  1QZX A;  5L0J A;  2WZL A;  4MTF A;  1ZZP A;  2B0J A;  3GM2 A;  5T3W A;  4BJ1 A;  3A9C A;  3U0C A;  1OCO C;  1ZU5 A;  3EHN A;  4NQF A;  2OQM A;  5BQG A;  5A69 A;  2YL1 A;  3BRJ A;  3KKB A;  3FDQ A;  3ABL C;  2R7W A;  1T6I A;  3OWT A;  4GEH A;  4HFK B;  4DRJ B;  2L7A A;  4IJJ A;  4E17 A;  1VYI A;  4JVS A;  3X1O A;  2A0U A;  1KTM A;  1RKE B;  4Q4Z F;  4PK4 A;  4QI2 A;  1J8Y F;  3KYJ A;  2R7X A;  2D4U A;  2YLD A;  2W45 A;  2L81 A;  1MMN A;  4IAR A;  4DBR A;  1LVK A;  2VC9 A;  4BEM J;  3DAG A;  2Q9A A;  4CDA A;  1BR1 A;  1H6G A;  3JYY A;  1PD0 A;  2CW0 F;  1Q0G A;  5A6B D;  4CS7 A;  3GEE A;  1OW7 A;  3LS1 A;  2WVN A;  2HV7 A;  5K0I A;  1ZHY A;  2VB6 A;  4E18 A;  1T01 A;  2PX0 A;  3C63 A;  1EI7 A;  2YWA A;  4YT8 A;  3BEH A;  2HSQ A;  1A7E A;  2LCH A;  4W8P A;  1EQ1 A;  3O39 A;  3ZSU A;  4Z9H A;  4J30 B;  3CSK A;  4BJ6 A;  3UGO A;  1OKK A;  2I15 A;  3ZG1 A;  4BJ6 C;  4ZLC A;  4G7Z F;  4WAB A;  4I1O B;  2HMZ A;  4MVR A;  1NZE A;  5A6B A;  1Q0D A;  3AG1 C;  2PBE A;  3C8Z A;  1ZHW A;  3GM3 A;  2YHS A;  4DXW A;  1I5N A;  1AUE A;  1TQG A;  1WOL A;  1K40 A;  4NC3 A;  1NU9 C;  2L9J A;  4YT5 A;  1OR2 A;  1TWA A;  3TJ5 A;  3B0V C;  3G4Z A;  1T6U A;  1YA9 A;  2IOQ A;  2L6G A;  2LIG A;  1H9G A;  3IHU A;  4BEJ A;  4G7O F;  2Q9C A;  4KBL A;  3U9J A;  3O6X A;  1TWC A;  2YKZ A;  1YYJ A;  2LFF A;  3FHD A;  2KW3 C;  2ZPA A;  1YYX A;  2IXM A;  3EZH A;  2LD6 A;  3JSE O;  4NTB A;  3J06 A;  4DRH B;  4U5D E;  1WWP A;  2XLM A;  4EUK B;  3TUL A;  1JRA A;  4GYT A;  3LLK A;  3W8I A;  5B3I A;  1ZW2 A;  1ZYR F;  4MW8 A;  2EIJ C;  3E70 C;  1HW1 A;  4L6R A;  2ICW G;  1J8M F;  1QKR A;  3I5Q A;  3Q7G A;  2J46 A;  3EH2 A;  4PFP A;  4U5F E;  2E87 A;  5DQZ A;  1RMV A;  3NG1 A;  3MLG A;  3TOL A;  2VH3 A;  3DI5 A;  3WOD F;  2LK4 A;  1G5Z A;  1D0Y A;  3LUT B;  4CSA C;  2R7O A;  2EPL X;  3DAF A;  1E86 A;  1WGW A;  2FAP B;  1QVX A;  1Q0F A;  1SF8 A;  4EKW A;  3S0X A;  4B6I A;  3UGP A;  2XS8 A;  3LNM B;  1PD1 A;  4E0H A;  1E83 A;  3E9V A;  4XLN F;  5L0H A;  1E2X A;  2G3K A;  4PJN A;  3M1C B;  1MMA A;  4G7H F;  5JS5 A;  4MVZ A;  5E3A A;  2JD3 A;  4NTA A;  1OXK A;  4YL1 A;  5JT4 A;  2YL3 A;  3F47 A;  2HJ3 A;  1M57 C;  1NFO A;  3NYL A;  4JW1 A;  2EIM C;  1VTM P;  5KYY B;  2ZXW C;  1A7D A;  2EIN C;  4OIP F;  1KU2 A;  4J32 B;  4FWV A;  1Y6D A;  3V7O A;  5IY5 C;  1BZ4 A;  1C03 A;  2QNL A;  2XXA A;  1RJ9 A;  2WVO A;  1FMV A;  4CS9 C;  3IPM O;  1T5O A;  2OKU A;  2MYS A;  2Y3D A;  3S27 A;  2IXN A;  4E7Z A;  2WVQ A;  1AVO B;  4XEF A;  2EPK X;  5BUO A;  2R7U A;  3EFO A;  2J9W A;  3KH2 A;  5HV9 A;  2F22 A;  1JMW A;  2WZG A;  3NYM A;  1D0X A;  2R9R B;  1ZVZ A;  3UMH A;  3W4Y A;  4LAC B;  1OCR C;  4JRZ A;  1LE4 A;  1TFK B;  1FR0 A;  2M64 A;  1A0B A;  3W2V A;  1D1C A;  5L0I A;  2Q7R A;  4JTA B;  4U5G A;  1Q0M A;  4Q5S F;  5E33 A;  4D4X A;  1XZQ A;  5BQH A;  2Q4F A;  3MBG A;  4YT2 A;  2KSF A;  3S29 A;  4RBN A;  4EIY A;  4Z9I A;  3WAQ A;  1TR2 A;  4MTG A;  3UNG C;  2DI3 A;  3ZC4 A;  4MVU A;  5DLJ A;  2HUJ A;  1I4Z A;  3SZR A;  4YL0 A;  4JCH A;  4ULV A;  2V3C C;  2P61 A;  3FXH A;  1NSG B;  4YL3 A;  4G78 A;  4I1M A;  5L0G A;  1GQA A;  3EZI A;  3NKD A;  3LNR A;  4XQ1 A;  1NU7 D;  2J7P A;  3CQZ A;  1OKK D;  2J0W A;  3EJN A;  5COF A;  2Y69 C;  4JEB A;  3C8G B;  1FFH A;  5E2Q A;  5AC5 A;  1UFB A;  4NY3 A;  2ZXR A;  3IEE A;  3GEH A;  1VK5 A;  4LER A;  1OCZ C;  4WGZ A;  3MYF A;  2BE5 F;  2VCA A;  2D5R B;  1U6H A;  4ANJ A;  2GA0 A;  3DZA A;  4RD9 A;  1SYQ A;  3ASN C;  2BC5 A;  1GGQ A;  2P7V A;  2IXO A;  4BJT A;  5CI8 A;  3DXJ F;  4AE4 A;  2YZS A;  1L7C A;  3B29 A;  2EIK C;  2J7P D;  2OG2 A;  2JX0 A;  3RFY A;  4QI0 A;  3VYW A;  5KYX A;  3K1I A;  5D92 A;  3EGD B;  1VLS A;  2G3V A;  3LEO A;  3T9O A;  4K0D A;  1N1C A;  3ZVR A;  4D4N A;  4U9D A;  1OXB A;  1M2O A;  4NCQ A;  3JZ0 A;  1V4A A;  5KYY A;  4O6N A;  1YDI A;  1NLX A;  4XPX A;  3WG7 C;  4K7B A;  1V55 C;  3SXZ A;  2Y3H A;  3A11 A;  1F1M A;  3IQ5 A;  3RQG A;  2YL7 A;  2XLO A;  2B0H A;  4MVS A;  4CBE A;  1U89 A;  1Z23 A;  3NMK A;  1Z63 A;  1MNE A;  3JYH A;  3ZQY A;  2KYH A;  3JCU Q;  2DGJ A;  3EFO B;  4OIR F;  4CS9 A;  1G4U S;  5KYU A;  1Q0K A;  3FOP A;  3HJC A;  1V54 C;  3HKK A;  4J7T A;  4PJL A;  4CS8 C;  2LQG A;  4EHP A;  2DYR C;  3EGD A;  3KYI A;  3MFN A;  3NMI A;  1U0B B;  1NFN A;  4XTK A;  3L8I A;  3K66 A;  1AEP A;  2Y3B A;  3FAJ A;  1YA7 O;  2XSE A;  3RKO F;  3ZQV A;  5BQI A;  1LI5 A;  4EWC A;  2HKV A;  2A6E F;  3Q6M A;  4JTC B;  1DOV A;  3UMI A;  1JOG A;  3TJ6 A;  3LS0 A;  5GPG B;  4DRI B;  4HE8 D;  3EPV A;  3ZIB A;  3RIP A;  1ORJ A;  3SYN A;  1H9T A;  3AGU A;  4DVZ A;  3QMK A;  3MYI A;  4XWJ A;  2AWC A;  2J45 A;  4I3M A;  5DS5 A;  2HS5 A;  3GWL A;  2LSE A;  1BR2 A;  3T6B A;  1APC A;  3G50 A;  2R7R A;  2XS1 A;  2L6H A;  2EPN A;  3C8G D;  3QZC A;  5DQT A;  4ZLD A;  1E84 A;  1VB5 A;  3FMS A;  2R7S A;  4CJO A;  3K7D A;  3ECS A;  4KNW A;  4ULW A;  4ER9 A;  5JRA A;  2OU6 A;  2M4E A;  3QVZ A;  5T3T A;  3U3F A;  4AX2 A;  4BJ5 A;  1HE9 A;  1JPN A;  4BG0 A;  1LM3 B;  4Z9J A;  3S28 A;  3ZTM A;  1CGM E;  4KI2 A;  4AE4 B;  1JPJ A;  3IQC A;  4PJJ A;  1CPR A;  5COM A;  3EGX B;  3H2V A;  1BDJ B;  2EPO A;  4RDA A;  2NSG A;  2H7O A;  2OOC A;  2QUP A;  3QW0 A;  3RYL A;  4X0R A;  1FNT c;  2OCC C;  2LFD A;  2IBF A;  4Q7C A;  3S84 A;  4CIH A;  1D1A A;  1CGO A;  5DS4 A;  3JTL O;  3DMD A;  4IAQ A;  3SP1 A;  4P6I C;  3L1M A;  2GFH A;  2NUT A;  5EGY A;  2WZF A;  5JP7 A;  5L0D A;  4J7Y A;  4N4W A;  2A0B A;  2GWW A;  1FAP B;  1BBH A;  5E3C A;  1RXQ A;  1LS1 A;  3U2M A;  4AL0 A;  5L0C A;  3JSZ A;  2YLI A;  4O79 A;  5AGF A;  4EBB A;  4IAO A;  3OA1 A;  3DKA A;  1HY5 A;  2HJM A;  2HSB A;  4BPM A;  1W2W A;  4C3D A;  4CDY A;  1QLE C;  2IM8 A;  4FAP B;  2KK1 A;  3UR3 C;  3ASO C;  4OD4 A;  3AG2 C;  2I8B A;  2IXP A;  5L3Q A;  5JVE A;  1ZW3 A;  3B71 A;  4XEK A;  3TK0 A;  3NDB B;  4IWB A;  5AC4 A;  1ST6 A;  1EA8 A;  3OEO A;  1KNY A;  4N6C A;  4C7O A;  3PDM P;  4KC9 A;  1HW2 A;  4JC7 A;  1JR8 A;  2JPU A;  2W4B A;  1OCC C;  2MWQ A;  5KYX B;  1TWH A;  2R7Q A;  3AQC A;  1LI7 A;  4I44 A;  4IB4 A;  5HSW A;  4OIO F;  3K33 A;  1G8X A;  3RQE A;  4YJW A;  3TOM A;  4CIP A;  3B9Q A;  3U3B A;  3U9M A;  3N2Z B;  1RKE A;  4LDQ A;  4A4A A;  5EHH A;  2X51 A;  3NKE A;  4LDR A;  4N06 A;  2A68 F;  5DS6 A;  3KMI A;  4JZA A;  1S05 A;  1YVI A;  2R05 A;  2CDQ A;  3PMR A;  4XEV A;  2V26 A;  1VYK A;  2BL2 A;  2C04 A;  2XRH A;  3C7J A;  4JJF A;  3SXY A;  1SZI A;  4ONS A;  1RKC A;  4WJ0 A;  3U2L A;  3US6 A;  1YZC A;  1PCX A;  1ZU4 A;  2VCC A;  3RQF A;  1WN0 A;  2TMV P;  2YEV A;  1QQ3 A;  3O55 A;  4IGG A;  4PR9 A;  1HMO A;  3N24 A;  3T6J A;  4P9F A;  4H54 A;  2HZ8 A;  3SXM A;  2IYL D;  3RW0 A;  4G0H A;  4CS8 A;  2KNH A;  2NUP B;  4O6M A;  2QY9 A;  5F28 E;  3WHN A;  4EBJ A;  3EGX A;  2HMQ A;  2LP4 A;  2WL8 A;  3RVZ A;  3DWW A;  3EHM A;  4CX9 A;  3HNI A;  3JT1 A;  2ASR A;  4MND A;  3UMK A;  4U9E A;  2NUT B;  3VF0 A;  2Q00 A;  2H8A A;  4XPY A;  3POV A;  2R7T A;  5EK0 A;  4A2N B;  2FFH A;  4C3E A;  5KYW A;  3L34 A;  3V5X A;  1T6Q A;  3C8G A;  1XWJ A;  3ABM C;  3AJM A;  256B A;  3LEV A;  4JEA A;  1ZHT A;  4OD5 A;  3RF3 A;  1Y4C A;  2EPM X;  3GOD A;  1K05 A;  1VMA A;  5CIV A;  1T9K A;  2XL6 A;  3FVY A;  4MS2 A;  3EQL F;  4PAC A;  2W4M A;  2YL0 A;  4XLP F;  5F5F A;  3B0U X;  5L0F A;  3C18 A;  5A6A A;  2KC3 A;  4M63 A;  4W8K A;  4EBK A;  1Z3I X;  1G4W R;  2EIL C;  3O10 A;  5D91 A;  3HTK C;  2Y3G A;  4PJM A;  4U5B E;  1BR4 A;  3AQB A;  4U5H A;  2XM4 A;  2L6F A;  2O9X A;  3GAN A;  4JUR I;  5FCL A;  3LLI A;  3DM9 B;  1M6T A;  2VAS A;  1LPE A;  2XLE A;  3RH3 A;  4UDV A;  4WGY A;  3N0T A;  2WB7 A;  3ABK C;  5JSL A;  2W9Y A;  2J9V A;  3H2U A;  3HNL A;  1WAT A;  1M56 C;  1YLM A;  3Q7L A;  4GQH A;  2AVK A;  5TJ5 E;  2NG1 A;  3HLZ A;  2OEV A;  3CAX A;  3EH1 A;  3X2Q C;  3QVY A;  1FFT C;  2AU5 A;  3RVY A;  2H7V C;  2NSF A;  4NTF A;  1EKY A;  3VAY A;  1Z5Z A;  3EG9 A;  3HNK A;  3V5Y A;  1ZHZ A;  2MHR A;  2DB4 A;  5JUA A;  3F46 A;  4JTD B;  4IRU A;  4OIN F;  1XZP A;  2OJE D;  5L3V A;  1RJ9 B;  3DM5 A;  3LAY A;  2H7B A;  2XL8 A;  2ZXP A;  3B0P A;  5F5H A;  4P9T A;  3S90 A;  2XL4 A;  3DE8 A;  1E85 A;  1B68 A;  1GS9 A;  2CNW A;  1FMW A;  3NMJ A;  1WAS A;  4QDL A;  3DJN B;  1MMG A;  3K1I C;  3I4U A;  4O6Y A;  3GEI A;  1V74 B;  3DD7 A;  4AL1 A;  1WTY A;  3GOR A;  1SMY F;  3G4X A;  4DVY P;  2XLW A;  1M2V A;  1MND A;  2RD9 A;  4YK5 A;  3W8H A;  3KPH A;  2KGO A;  1DOW A;  5KYW B;  4C7O B;  3JRM O;  3Q6N A;  3LJB A;  1Z7Q c;  4CSA A;  3SEO A;  3U8V A;  1C02 A;  1LE2 A;  2J9U A;  5T1D B;  4MVM A;  1C17 M;  1CPQ A;  2CNW D;  2A69 F;  2FGY A;  1QSP A;  2ZD9 A;  4JIO A;  1SR2 A;  4JKV A;  4JE9 A;  4BJ5 C;  1YZA A;  3ZWI A;  1QPU A;  3ATP A;  4LLC A;  3U5S A;  3U8P A;  5CI9 A;  3MX3 A;  2J0X A;  3K6B A;  4C3B A;  2A6H F;  4AK9 A;  4DJ9 A;  3KL4 A;  1OR3 A;  2QTV A;  4XPW A;  4U5E E;  5KYN A;  3I5P A;  2PFD A;  3TQO A;  4FES A;  1R4T A;  4R32 A;  1TFO B;  1R5I D;  4FX5 A;  4MVQ A;  5FZT A;  3JRT A;  1ORY A;  2Z15 A;  5COG A;  4MW3 A;  1MMD A;  2GDC A;  1O5H A;  1ZHX A;  1CGN A;  2Y39 A;  2YRF A;  3DJU B;  3R7C A;  3IQ6 A;  4CDV A;  5B1B C;  2YQY A;  4DBQ A;  1VLT A;  3GWN A;  2X0C A;  1NG1 A;  1A7V A;  2PF4 E;  4F4B A;  3T6G B;  2GAQ A;  2R03 A;  4HEA J;  4MVO A;  4PFO A;  1VOM A;  3V5Z A;  4CJG A;  2DYS C;  3CZ6 A;  2R25 A;  4DOZ A;  1RCP A; 
#chains in the Genus database with same CATH homology
 3QW1 A;  3DE9 A;  3TOL A;  3FOO A;  256B A;  3M4B A;  4JEA A;  2XL6 A;  1E86 A;  2CCY A;  2YL0 A;  3C62 A;  1E83 A;  3M4C A;  1APC A;  5JS5 A;  5JT4 A;  2YL3 A;  2XLD A;  1E84 A;  2J8W A;  2XM4 A;  3VRC A;  3M79 A;  4CJO A;  4ER9 A;  2XLV A;  4WGY A;  5JRA A;  3QVZ A;  2XM0 A;  4N6H A;  1JAF A;  2QLA A;  1M6T A;  3HNJ A;  2XLE A;  1LM3 B;  3ZTM A;  5JLI A;  2J9B A;  5JSL A;  1MQV A;  1CPR A;  3HNL A;  2XLH A;  3M15 A;  3QW0 A;  3QVY A;  1NBB A;  1EKY A;  1CGO A;  3HNK A;  4IAQ A;  2YLG A;  3L1M A;  4D4X A;  5JP7 A;  3ZTZ A;  4N4W A;  5JUA A;  1BBH A;  4EIY A;  2XL8 A;  2YLI A;  5AGF A;  2YL1 A;  4ULV A;  3DE8 A;  1E85 A;  3NMJ A;  4CDY A;  1GQA A;  2YLD A;  4IAR A;  2XLW A;  5JVE A;  4CDA A;  4JEB A;  4WGZ A;  1CPQ A;  3C63 A;  4JKV A;  2BC5 A;  4JE9 A;  1YZA A;  3ZWI A;  1QPU A;  3U8P A;  4IB4 A;  3TOM A;  4CIP A;  4D4N A;  4U9D A;  4NC3 A;  1S05 A;  3IQ5 A;  2YL7 A;  2XLO A;  3NMK A;  3ZQY A;  1YZC A;  2YKZ A;  4CDV A;  1CGN A;  1YYJ A;  1QQ3 A;  3IQ6 A;  1YYX A;  3FOP A;  1A7V A;  2XLM A;  3NMI A;  5B3I A;  4CX9 A;  3HNI A;  4CJG A;  4U9E A;  4L6R A;  3ZQV A;  1RCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...