4WGYA

Crystal structure of cytochrome c' from alcaligenes xylosoxidans ncimb 11015 at ph 10.4
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title X-ray Crystallographic Elucidation for the Alkaline High-spin State Transition of Iron(III) Cytochrome c' from Alcaligenes xylosoxidans NCIMB 11015
doi rcsb
molecule tags Electron transport
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2014-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4wgyA00
3M79A 4WGYA 3FOOA 2XLEA 3HNIA 5JLIA 2XLVA 4U9EA 2YLGA 1BBHA 2XLMA 5JSLA 2YL0A 2YL1A 4CDAA 3DE9A 3DE8A 3ZTZA 4U9DA 4CIPA 3IQ5A 3FOPA 1EKYA 5B3IA 2XLHA 5JUAA 1E85A 1GQAA 1YYXA 1M6TA 4JE9A 3M4CA 3NMJA 3IQ6A 3NMIA 4JEBA 3QVZA 2XL6A 2XLOA 4L6RA 3M15A 3C63A 2XLDA 1CGNA 3HNLA 4CJOA 4JKVA 3L1MA 3ZTMA 2CCYA 4CJGA 2XM4A 3QVYA 5JP7A 3U8PA 1JAFA 4ULVA 256BA 1YZAA 1A7VA 1APCA 3QW0A 4N4WA 3HNJA 3ZWIA 2XM0A 2J9BA 4CDYA 5JS5A 2YLIA 3ZQVA 1CPRA 1S05A 4IB4A 1LM3B 2YL3A 3HNKA 2BC5A 4D4NA 4IAQA 4WGZA 3VRCA 2YL7A 3TOMA 1MQVA 3NMKA 1NBBA 5JVEA 3QW1A 1YYJA 4CX9A 4JEAA 2XL8A 4IARA 4N6HA 5JRAA 1CGOA 1QQ3A 3M4BA 3C62A 2J8WA 5JT4A 2QLAA 3ZQYA 3TOLA 1RCPA 1YZCA 1E86A 2XLWA 4D4XA 4EIYA 5AGFA 1E83A 4NC3A 1QPUA 1E84A 2YKZA 4ER9A 4CDVA 1CPQA 2YLDA
chains in the Genus database with same CATH superfamily
3EGDB 2NG1A 2L81A 1OW7A 2EIJC 4B6IA 1TWGA 1ZZPA 1MMGA 2HFIA 4P9FA 1I5NA 4XPXA 5GPGB 4X0RA 2YHSA 2D5RB 3DJNB 2X0CA 2R7UA 2DGJA 1KU2A 2R7QA 3AGTA 2R7XA 1BZ4A 2YLGA 2NSGA 3JYHA 4U5EE 3GM3A 4W8KA 1A0BA 2NUTA 3GORA 1Q0KA 3QTHA 2XLMA 3EJNA 3RKOF 3TULA 2YL0A 2JX0A 2XS8A 5KYNA 1VK5A 1Q0FA 1J8YF 1M57C 3DE8A 2L6HA 3C8GD 3CZ6A 4U5GA 3KYIA 4ONSA 5FZTA 1DOVA 3MX3A 4CIPA 3SXZA 1D0XA 4I3MA 1H7IA 1OR2A 2Q9BA 3GM2A 5B3IA 5L0GA 1M2VB 3C18A 3V5XA 5KYYA 3ATPA 1WWPA 3H2UA 1Q0MA 4GYTA 2XLHA 4R32A 1IW7F 4NQFA 4E0IA 3S0XA 2XSEA 5TJ5E 2AWCA 2AWYA 3I5QA 1T6IA 3N2ZB 2FAPB 2ZPAA 2G3VA 4JEBA 3QVZA 2XLOA 4JIOA 4CSAA 2Y3HA 5L3QA 2P61A 5L3VA 3G4ZA 2VASA 1ZVZA 1HMOA 2CNWA 3E70C 3OEOA 4JKVA 3RQEA 1WTYA 3S9OA 5L0FA 4XLPF 2DI3A 2CCYA 4GQHA 3EG9A 1E2XA 3I4UA 3NYJA 2WL8A 4MVRA 1NU9C 2GWWA 3QVYA 4U5FE 3PHF2 3U8PA 1JAFA 3N0TA 4ULVA 2IXMA 2IM8A 3IQTA 3M1CB 5T3WA 3FDQA 1NU7D 2JPUA 3HNJA 4PACA 5DVWA 4CS9A 4J7YA 1OKKA 3WHNA 4NTAA 1JOGA 3DJUB 4PJJA 4CDYA 3GWNA 3SZRA 1H9GA 3O55A 4J32B 4U5BE 3EQLF 3RQGA 3OWTA 4OD4A 5KYXA 2OKUA 2QY9A 3B0PA 4HFKB 2C03A 4IGGA 3U2LA 3EHMA 3ABLC 4DBQA 3ZSUA 5KYUA 2YL3A 2BC5A 4AE4A 2EPOA 3DAGA 4MNDA 4G7ZF 1UFBA 5T1DB 3RVZA 4YT2A 2LCHA 3NKEA 4LERA 5DQTA 2QUPA 1VB5A 1T6QA 1ZU4A 3DWWA 3B0UX 1GGQA 3TOMA 2OU6A 4FESA 3RIPA 2R7RA 4Z9IA 4YL1A 3PDMP 3AQBA 4CX9A 2G62A 4RD9A 4NY3A 3GEEA 3ASNC 4DJ9A 1QLEC 4KI2A 2KQ9A 3K66A 1D0ZA 3Q6MA 5L0HA 2A0BA 1Z5ZA 3S90A 3V5ZA 4HE8D 3KPHA 1LPEA 1QQ3A 1FFTC 1QVXA 2HKVA 3S29A 3AG3C 3JYYA 2OCCC 5E3CA 3ABKC 3UMHA 5AC4A 2BL2A 3L34A 3EZIA 2HSQA 4C3EA 1ZHXA 2J46A 4AL0A 4WJ0A 4DOZA 2VC9A 3MFNA 4C7OA 3S27A 3AG1C 4MVZA 1PD0A 4YT8A 4K7BA 2KSFA 3CQZA 4M63A 2W4BA 4EIYA 4O6MA 3NG1A 3NYLA 4NTFA 5AGFA 1E83A 1YVIA 1LIHA 4PR9A 5DS4A 3EH1A 3SP1A 1O5HA 5F28E 1V4AA 1JR8A 4BJ5A 3JSEO 4CS8A 2ZXPA 3M79A 2J9UA 1OXKA 1LVKA 3B9QA 3JCUQ 4U5CE 1WOLA 5A6KA 4BJTA 1RKEA 2WZFA 3FOOA 1VOMA 3RH3A 1L7CA 1OQCA 5JLIA 1G5ZA 2ZXWC 1TKNA 3W2WA 1YDIA 1GS9A 1RJ9B 4NCQA 2XLVA 4NTBA 3ZC4A 3AJMA 2J45A 1PV3A 4U9EA 1FMWA 1Z6AA 4I44A 1VYKA 4MQ9F 2CW0F 1JRAA 1OKKD 5A6BD 1V55C 3O39A 2AP3A 4JTAB 5B1AC 2WZGA 2JD3A 2PP4A 3DE9A 2DB4A 1ZHWA 2HMZA 2EPKX 2LP4A 2VCCA 4MVUA 5HV9A 3KKBA 1EKYA 3DM5A 5D91A 4RBNA 4WABA 1M2VA 3C8GB 1Y6DA 2WVOA 3W8IA 4CBEA 1SZIA 2XRHA 3EZHA 4I1OB 2Y3GA 4AK9A 5JUAA 4PJMA 4YK5A 1E85A 1FFHA 1GQAA 3QMKA 1RKEB 3NMIA 1ZHTA 3IQ6A 2Z15A 2HUJA 2KW3C 3KH2A 3M15A 3O10A 4C3DA 4DBRA 3C63A 4J7TA 1TFKB 2XXAB 3T4RA 3HNLA 1CGNA 3IPMO 4CJOA 2R7VA 4QDLA 2VB6A 2Q7RA 3L1MA 3R7CA 5E3AA 4CJGA 3X1OA 1NFOA 3U2MA 2J0XA 5E33A 2PFDA 4HEAJ 2I8BA 4AL1A 1WASA 4OIRF 2IXOA 2ZXOA 1YZAA 3QW0A 4N4WA 3AG4C 3AGUA 1MMDA 2GDCA 1A7DA 1TR2A 4JRZA 3RF3A 3W2VA 2V3CC 1QZXA 4Q4ZF 4P6IC 1D1BA 2YLIA 1Q0DA 5EGYA 3L0IA 1MMAA 1H9TA 3PCVA 1HW1A 2QE9A 3W8HA 2RSEB 5COMA 1FTSA 1MMNA 1LM3B 3SXYA 1PD1A 3JRMO 3GEIA 1AUEA 3LEOA 2WVQA 4BPMA 1SF8A 2IOQA 1NLXA 2Q9AA 2PNOA 4WGZA 3IQCA 3JSZA 3VRCA 4A4AA 2EPNA 1C02A 2KGOA 3DMDA 2YL7A 1W2WA 3JRTA 4XEKA 2J7PA 3T6GB 2ASRA 1LI7A 2WZLA 3LAYA 1AVOB 2H7BA 2PX0A 3A11A 2CGEA 4LDKA 4MVQA 1CGME 4HFFB 1XZQA 2Y39A 3FAJA 3FMSA 3ZVRA 2W9YA 3X2QC 2A68F 3LESA 1OCOC 2H8AA 1IZMA 4JEAA 4XPYA 1NSGB 4JVSA 3C7JA 4XWJA 1MNDA 2NSFA 3K33A 4CSAC 1CGOA 4JJGA 3ITFA 2H7OA 4MVMA 3RQFA 3IHUA 4IRUA 2ICWG 3TJ6A 5BQGA 4DVZA 1EA8A 4E0HA 5JT4A 5A6JA 3S84A 4Q5SF 1ZU5A 1OW6A 1VMAA 3F46A 3JZ0A 3ZQYA 3Q7GA 4Z9JA 3RW0A 3UGOA 4K1OA 3TOLA 1E86A 5B3SC 1N1CA 2AU5A 1SR2A 4MS2A 4BG0A 5L0CA 3B0VC 2XLWA 3MYFA 4D4XA 3ABMC 4CS9C 1LE4A 4NC3A 4I1MA 1I4ZA 3SNHA 4ER9A 4CDVA 4G7HF 2YLDA 1J8MF 2KYHA 1ZHYA 1VLTA 1EI7A 1SYQA 4OIOF 4JJFA 1Z63A 1U0BB 1FAPB 2HMQA 1HMDA 1K04A 2LSEA 4O6YA 2A0UA 4UDVA 3POVA 3RFYA 1BDJB 4A2NB 1LE2A 1TWHA 1QKRA 3RYLA 1RJ9A 2OEVA 1G4US 3UMIA 1BBHA 1LS4A 3HTKC 5L0JA 3B71A 1ORJA 1HE9A 1OCZC 5JSLA 5A6AA 4OIPF 2EIMC 3JT1A 1DOWA 4FWVA 2YL1A 2YQYA 4U9DA 2HV7A 4C3BA 3SEOA 4LACB 1AEPA 4MW3A 2TMVP 5KYWB 2G3KA 1C17M 3IQ5A 4IWBA 3MBGA 3T9OA 1QSPA 5BQIA 3PMRA 3AQCA 3C8GA 4EUKB 3F47A 2CNWD 2Y69C 3LNRA 4MTFA 2YWAA 3N24A 2Q9CA 2D4UA 2Q4FA 5CI9A 3TK0A 1B68A 3NMJA 4L6RA 2OJED 4P9TA 3TJ5A 1D1CA 3L8IA 2IYLD 2HJMA 1YJGA 1GM5A 3GWLA 2XLDA 2W4MA 1D1AA 1YA9A 3LNMB 4PK4A 5IY5C 2XXAA 3K1IA 2LK4A 2R05A 3KMIA 4XTKA 5CI8A 2YEVA 1Z7Qc 5COFA 3H2VA 4QI2A 2XM4A 1NZEA 2EINC 2IXPA 1WN0A 3CEXA 5DQZA 1YA7O 3BRJA 4MVOA 4N6CA 4N06A 4MTGA 4YN0B 1FR0A 1NG1A 1H6GA 2UUHA 3AG2C 3EFOB 2WVNA 2VH3A 1A7VA 3L8JA 4BJ6A 3ECSA 3EH2A 4G0HA 3MYIA 4JTDB 3EPVA 2XM0A 4LLCA 3WAQA 2J9BA 3A9CA 2R7WA 3K1HA 3T6BA 4BJ5C 1Y4CA 4CS8C 1WATA 2R25A 1ORYA 2EPMX 2HV6A 2LIGA 2W45A 3EGXB 3ZG1A 4KC9A 1VYIA 3U5SA 4MVSA 2L9JA 2ZXRA 2VCAA 4IB4A 1JPJA 1RXQA 1TWCA 4IJJA 3HNKA 4XEFA 4U5DE 3EHNA 3UMKA 4DRHB 4DRIB 4D4NA 2MHRA 1Z23A 1ST6A 2I15A 2H7VC 4JCHA 3TQOA 3BEHA 4J30B 2YZSA 4BJ1A 1TFOB 4E18A 4EWCA 3C8ZA 2GA0A 3DD7A 1T01A 3NYMA 4ANJA 4G7OF 1NBBA 1O87A 4H4KC 3Q6NA 5JVEA 3QW1A 2B0JA 1D0YA 2FFHA 2XS1A 3FAPB 3LS0A 3JTLO 3J06A 3VM6A 2NUPB 2P0NA 3U8VA 3DZAA 3SXMA 4O7GA 1NFNA 2V26A 1S7ZA 2HSBA 3SYNA 1RKCA 3FVYA 2L7AA 2XL8A 4KNVA 3WODF 2KNHA 4JCZA 4LDQA 1FMVA 1A7EA 5JRAA 2DYRC 2QNLA 4LDRA 5DS6A 3IEEA 4QI0A 1LKXA 4W8PA 5D92A 3FHDA 5B1BC 4FAPB 4DRJB 1KNYA 3KYJA 1VTMP 1C03A 4MTOA 5EK0A 2QLAA 2MWQA 3G4XA 1A41A 2ZD9A 3US6A 1LS1A 2P7VA 2Y3DA 3LUTB 1YZCA 1ZYRF 2ETSA 4EBKA 4GEHA 4ZLCA 5BQHA 3U3BA 2P1AA 1BR1A 3Q7LA 3NDBB 2L6FA 2R03A 2R7SA 1WGWA 3HLZA 5T3TA 2X51A 4ZLDA 1L3PA 2J0WA 1QPUA 3E9VA 3SXKA 3TD7A 5DLJA 5HSWA 2GAQA 2YKZA 1BR4A 3ZWIA 4Z9HA 4ULWA 2HZ8A 2XL4A 2L6GA 4WGYA 4F4BA 1ZW3A 2A6HF 2XLEA 1K05A 3HNIA 2M4EA 1OXBA 3HJCA 2QTVA 2OOCA 1T5OA 4BEMJ 4E7SA 5DS5A 2FGYA 3G50A 2NUTB 3OA1A 1BR2A 2Q00A 3WG7C 3DM9B 2O9XA 1M2OA 5FCLA 2OEXA 4CDAA 3ZTZA 1LI5A 2DYSC 3U9MA 5A69A 1G8XA 1JPNA 1ORSC 4DXWA 2J9VA 4PJLA 1YAUO 5A6BA 5KYWA 3FOPA 5KYYB 1HW2A 2OJQA 4JC7A 1XZPA 1U6HA 3S28A 4PFOA 3VAYA 2PX3A 4CS7A 2PBEA 2R7OA 1U89A 2LFDA 3GM1A 3GEHA 1YYXA 3LEVA 1M6TA 5CIVA 3M4CA 4JE9A 1OCRC 3K6BA 2Q3TA 2UUIA 4MW8A 2XL6A 2EIKC 3ZDLA 5F5HA 1YARO 2KJGA 1EQ1A 2A6EF 2LD6A 3K7DA 2BE5F 3ZTMA 4K0DA 4XPWA 3EG9B 3CSKA 4AX2A 4EKWA 2HS5A 5L0DA 5JP7A 2AVKA 4O79A 2NPUA 2EILC 1JMWA 2Y3BA 4LLEA 3VYWA 256BA 2MYSA 3EFOA 1APCA 3GODA 4U5HA 3B29A 1I4YA 1PCXA 2WB7A 3RVYA 2LFFA 2KC3A 4FX5A 4JURI 2EPLX 1OW8A 1UG7A 2VCBA 3U3FA 4JTCB 3MLGA 3GANA 4XEVA 4YWQA 3UGPA 1XWJA 5JS5A 2YVKA 3H65A 4BEJA 5KYXB 1K40A 4G78A 3ZQVA 3EGXA 2R7TA 1CPRA 1F1MA 3FXHA 1SMYF 4EBJA 1VLSA 1S05A 2F22A 1G4WR 2J9WA 4KBLA 5BUOA 5KYUB 1YLMA 1R4TA 5EHHA 4AE4B 3R2PA 2A1DD 2J7PD 4H54A 2R02A 2C04A 2GFHA 3UR3C 4IAQA 1ZHZA 3V5YA 4EBBA 1RMVA 4PFPA 3U9JA 1MQVA 1Q0GA 2OQMA 3NMKA 2IXNA 1M56C 1V74B 4XQ1A 2OG2A 3NKDA 4IAOA 1HE1A 1YYJA 4JZAA 3DAFA 5K0IA 3ASOC 2A69F 3AOUA 4YL0A 2PF4E 3LS1A 4DVYP 2NUPA 2P6VA 4YL3A 2R9RB 1T9KA 4E17A 3EGDA 4YT4A 2RD9A 3CAXA 4OD5A 4PJNA 4IARA 3T6JA 3ZIBA 4N6HA 3U0CA 4CIHA 3V7OA 2YRFA 3DI5A 4O6NA 4KNWA 2M64A 1KTMA 3M4BA 2HJ3A 3C62A 3DKAA 2J8WA 1V54C 3I5PA 3K1IC 4OIQF 3W4YA 5AC5A 2KK1A 2CYDA 4C7OB 1ZW2A 4OINF 4YT5A 5E2QA 1TQGA 1TWAA 3UNGC 3KL4A 3HKKA 1RCPA 1T6UA 2LQGA 1O3UA 4XLNF 1FNTc 3LJBA 4RDAA 4EHPA 2E87A 4YJWA 4E7ZA 1MNEA 2IBFA 5F5FA 4BJ6C 5L0IA 3NRHA 4Q7CA 1OCCC 3QZCA 1OR3A 1HY5A 4JW1A 3VF0A 1E84A 1Z3IX 2CDQA 3O6XA 3DXJF 3LLKA 3LLIA 2B0HA 1CPQA 5COGA 1R5ID
chains in the Genus database with same CATH topology
3M79A 4WGYA 3FOOA 2XLEA 3HNIA 5JLIA 2XLVA 4U9EA 2YLGA 1BBHA 2XLMA 5JSLA 2YL0A 2YL1A 4CDAA 3DE9A 3DE8A 3ZTZA 4U9DA 4CIPA 3IQ5A 3FOPA 1EKYA 5B3IA 2XLHA 5JUAA 1E85A 1GQAA 1YYXA 1M6TA 4JE9A 3M4CA 3NMJA 3IQ6A 3NMIA 4JEBA 3QVZA 2XL6A 2XLOA 4L6RA 3M15A 3C63A 2XLDA 1CGNA 3HNLA 4CJOA 4JKVA 3L1MA 3ZTMA 2CCYA 4CJGA 2XM4A 3QVYA 5JP7A 3U8PA 1JAFA 4ULVA 256BA 1YZAA 1A7VA 1APCA 3QW0A 4N4WA 3HNJA 3ZWIA 2XM0A 2J9BA 4CDYA 5JS5A 2YLIA 3ZQVA 1CPRA 1S05A 4IB4A 1LM3B 2YL3A 3HNKA 2BC5A 4D4NA 4IAQA 4WGZA 3VRCA 2YL7A 3TOMA 1MQVA 3NMKA 1NBBA 5JVEA 3QW1A 1YYJA 4CX9A 4JEAA 2XL8A 4IARA 4N6HA 5JRAA 1CGOA 1QQ3A 3M4BA 3C62A 2J8WA 5JT4A 2QLAA 3ZQYA 3TOLA 1RCPA 1YZCA 1E86A 2XLWA 4D4XA 4EIYA 5AGFA 1E83A 4NC3A 1QPUA 1E84A 2YKZA 4ER9A 4CDVA 1CPQA 2YLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M79 A;  4WGY A;  3FOO A;  2XLE A;  3HNI A;  5JLI A;  2XLV A;  4U9E A;  2YLG A;  1BBH A;  2XLM A;  5JSL A;  2YL0 A;  2YL1 A;  4CDA A;  3DE9 A;  3DE8 A;  3ZTZ A;  4U9D A;  4CIP A;  3IQ5 A;  3FOP A;  1EKY A;  5B3I A;  2XLH A;  5JUA A;  1E85 A;  1GQA A;  1YYX A;  1M6T A;  4JE9 A;  3M4C A;  3NMJ A;  3IQ6 A;  3NMI A;  4JEB A;  3QVZ A;  2XL6 A;  2XLO A;  4L6R A;  3M15 A;  3C63 A;  2XLD A;  1CGN A;  3HNL A;  4CJO A;  4JKV A;  3L1M A;  3ZTM A;  2CCY A;  4CJG A;  2XM4 A;  3QVY A;  5JP7 A;  3U8P A;  1JAF A;  4ULV A;  256B A;  1YZA A;  1A7V A;  1APC A;  3QW0 A;  4N4W A;  3HNJ A;  3ZWI A;  2XM0 A;  2J9B A;  4CDY A;  5JS5 A;  2YLI A;  3ZQV A;  1CPR A;  1S05 A;  4IB4 A;  1LM3 B;  2YL3 A;  3HNK A;  2BC5 A;  4D4N A;  4IAQ A;  4WGZ A;  3VRC A;  2YL7 A;  3TOM A;  1MQV A;  3NMK A;  1NBB A;  5JVE A;  3QW1 A;  1YYJ A;  4CX9 A;  4JEA A;  2XL8 A;  4IAR A;  4N6H A;  5JRA A;  1CGO A;  1QQ3 A;  3M4B A;  3C62 A;  2J8W A;  5JT4 A;  2QLA A;  3ZQY A;  3TOL A;  1RCP A;  1YZC A;  1E86 A;  2XLW A;  4D4X A;  4EIY A;  5AGF A;  1E83 A;  4NC3 A;  1QPU A;  1E84 A;  2YKZ A;  4ER9 A;  4CDV A;  1CPQ A;  2YLD A; 
#chains in the Genus database with same CATH topology
 3EGD B;  2NG1 A;  2L81 A;  1OW7 A;  2EIJ C;  4B6I A;  1TWG A;  1ZZP A;  1MMG A;  2HFI A;  4P9F A;  1I5N A;  4XPX A;  5GPG B;  4X0R A;  2YHS A;  2D5R B;  3DJN B;  2X0C A;  2R7U A;  2DGJ A;  1KU2 A;  2R7Q A;  3AGT A;  2R7X A;  1BZ4 A;  2YLG A;  2NSG A;  3JYH A;  4U5E E;  3GM3 A;  4W8K A;  1A0B A;  2NUT A;  3GOR A;  1Q0K A;  3QTH A;  2XLM A;  3EJN A;  3RKO F;  3TUL A;  2YL0 A;  2JX0 A;  2XS8 A;  5KYN A;  1VK5 A;  1Q0F A;  1J8Y F;  1M57 C;  3DE8 A;  2L6H A;  3C8G D;  3CZ6 A;  4U5G A;  3KYI A;  4ONS A;  5FZT A;  1DOV A;  3MX3 A;  4CIP A;  3SXZ A;  1D0X A;  4I3M A;  1H7I A;  1OR2 A;  2Q9B A;  3GM2 A;  5B3I A;  5L0G A;  1M2V B;  3C18 A;  3V5X A;  5KYY A;  3ATP A;  1WWP A;  3H2U A;  1Q0M A;  4GYT A;  2XLH A;  4R32 A;  1IW7 F;  4NQF A;  4E0I A;  3S0X A;  2XSE A;  5TJ5 E;  2AWC A;  2AWY A;  3I5Q A;  1T6I A;  3N2Z B;  2FAP B;  2ZPA A;  2G3V A;  4JEB A;  3QVZ A;  2XLO A;  4JIO A;  4CSA A;  2Y3H A;  5L3Q A;  2P61 A;  5L3V A;  3G4Z A;  2VAS A;  1ZVZ A;  1HMO A;  2CNW A;  3E70 C;  3OEO A;  4JKV A;  3RQE A;  1WTY A;  3S9O A;  5L0F A;  4XLP F;  2DI3 A;  2CCY A;  4GQH A;  3EG9 A;  1E2X A;  3I4U A;  3NYJ A;  2WL8 A;  4MVR A;  1NU9 C;  2GWW A;  3QVY A;  4U5F E;  3PHF 2;  3U8P A;  1JAF A;  3N0T A;  4ULV A;  2IXM A;  2IM8 A;  3IQT A;  3M1C B;  5T3W A;  3FDQ A;  1NU7 D;  2JPU A;  3HNJ A;  4PAC A;  5DVW A;  4CS9 A;  4J7Y A;  1OKK A;  3WHN A;  4NTA A;  1JOG A;  3DJU B;  4PJJ A;  4CDY A;  3GWN A;  3SZR A;  1H9G A;  3O55 A;  4J32 B;  4U5B E;  3EQL F;  3RQG A;  3OWT A;  4OD4 A;  5KYX A;  2OKU A;  2QY9 A;  3B0P A;  4HFK B;  2C03 A;  4IGG A;  3U2L A;  3EHM A;  3ABL C;  4DBQ A;  3ZSU A;  5KYU A;  2YL3 A;  2BC5 A;  4AE4 A;  2EPO A;  3DAG A;  4MND A;  4G7Z F;  1UFB A;  5T1D B;  3RVZ A;  4YT2 A;  2LCH A;  3NKE A;  4LER A;  5DQT A;  2QUP A;  1VB5 A;  1T6Q A;  1ZU4 A;  3DWW A;  3B0U X;  1GGQ A;  3TOM A;  2OU6 A;  4FES A;  3RIP A;  2R7R A;  4Z9I A;  4YL1 A;  3PDM P;  3AQB A;  4CX9 A;  2G62 A;  4RD9 A;  4NY3 A;  3GEE A;  3ASN C;  4DJ9 A;  1QLE C;  4KI2 A;  2KQ9 A;  3K66 A;  1D0Z A;  3Q6M A;  5L0H A;  2A0B A;  1Z5Z A;  3S90 A;  3V5Z A;  4HE8 D;  3KPH A;  1LPE A;  1QQ3 A;  1FFT C;  1QVX A;  2HKV A;  3S29 A;  3AG3 C;  3JYY A;  2OCC C;  5E3C A;  3ABK C;  3UMH A;  5AC4 A;  2BL2 A;  3L34 A;  3EZI A;  2HSQ A;  4C3E A;  1ZHX A;  2J46 A;  4AL0 A;  4WJ0 A;  4DOZ A;  2VC9 A;  3MFN A;  4C7O A;  3S27 A;  3AG1 C;  4MVZ A;  1PD0 A;  4YT8 A;  4K7B A;  2KSF A;  3CQZ A;  4M63 A;  2W4B A;  4EIY A;  4O6M A;  3NG1 A;  3NYL A;  4NTF A;  5AGF A;  1E83 A;  1YVI A;  1LIH A;  4PR9 A;  5DS4 A;  3EH1 A;  3SP1 A;  1O5H A;  5F28 E;  1V4A A;  1JR8 A;  4BJ5 A;  3JSE O;  4CS8 A;  2ZXP A;  3M79 A;  2J9U A;  1OXK A;  1LVK A;  3B9Q A;  3JCU Q;  4U5C E;  1WOL A;  5A6K A;  4BJT A;  1RKE A;  2WZF A;  3FOO A;  1VOM A;  3RH3 A;  1L7C A;  1OQC A;  5JLI A;  1G5Z A;  2ZXW C;  1TKN A;  3W2W A;  1YDI A;  1GS9 A;  1RJ9 B;  4NCQ A;  2XLV A;  4NTB A;  3ZC4 A;  3AJM A;  2J45 A;  1PV3 A;  4U9E A;  1FMW A;  1Z6A A;  4I44 A;  1VYK A;  4MQ9 F;  2CW0 F;  1JRA A;  1OKK D;  5A6B D;  1V55 C;  3O39 A;  2AP3 A;  4JTA B;  5B1A C;  2WZG A;  2JD3 A;  2PP4 A;  3DE9 A;  2DB4 A;  1ZHW A;  2HMZ A;  2EPK X;  2LP4 A;  2VCC A;  4MVU A;  5HV9 A;  3KKB A;  1EKY A;  3DM5 A;  5D91 A;  4RBN A;  4WAB A;  1M2V A;  3C8G B;  1Y6D A;  2WVO A;  3W8I A;  4CBE A;  1SZI A;  2XRH A;  3EZH A;  4I1O B;  2Y3G A;  4AK9 A;  5JUA A;  4PJM A;  4YK5 A;  1E85 A;  1FFH A;  1GQA A;  3QMK A;  1RKE B;  3NMI A;  1ZHT A;  3IQ6 A;  2Z15 A;  2HUJ A;  2KW3 C;  3KH2 A;  3M15 A;  3O10 A;  4C3D A;  4DBR A;  3C63 A;  4J7T A;  1TFK B;  2XXA B;  3T4R A;  3HNL A;  1CGN A;  3IPM O;  4CJO A;  2R7V A;  4QDL A;  2VB6 A;  2Q7R A;  3L1M A;  3R7C A;  5E3A A;  4CJG A;  3X1O A;  1NFO A;  3U2M A;  2J0X A;  5E33 A;  2PFD A;  4HEA J;  2I8B A;  4AL1 A;  1WAS A;  4OIR F;  2IXO A;  2ZXO A;  1YZA A;  3QW0 A;  4N4W A;  3AG4 C;  3AGU A;  1MMD A;  2GDC A;  1A7D A;  1TR2 A;  4JRZ A;  3RF3 A;  3W2V A;  2V3C C;  1QZX A;  4Q4Z F;  4P6I C;  1D1B A;  2YLI A;  1Q0D A;  5EGY A;  3L0I A;  1MMA A;  1H9T A;  3PCV A;  1HW1 A;  2QE9 A;  3W8H A;  2RSE B;  5COM A;  1FTS A;  1MMN A;  1LM3 B;  3SXY A;  1PD1 A;  3JRM O;  3GEI A;  1AUE A;  3LEO A;  2WVQ A;  4BPM A;  1SF8 A;  2IOQ A;  1NLX A;  2Q9A A;  2PNO A;  4WGZ A;  3IQC A;  3JSZ A;  3VRC A;  4A4A A;  2EPN A;  1C02 A;  2KGO A;  3DMD A;  2YL7 A;  1W2W A;  3JRT A;  4XEK A;  2J7P A;  3T6G B;  2ASR A;  1LI7 A;  2WZL A;  3LAY A;  1AVO B;  2H7B A;  2PX0 A;  3A11 A;  2CGE A;  4LDK A;  4MVQ A;  1CGM E;  4HFF B;  1XZQ A;  2Y39 A;  3FAJ A;  3FMS A;  3ZVR A;  2W9Y A;  3X2Q C;  2A68 F;  3LES A;  1OCO C;  2H8A A;  1IZM A;  4JEA A;  4XPY A;  1NSG B;  4JVS A;  3C7J A;  4XWJ A;  1MND A;  2NSF A;  3K33 A;  4CSA C;  1CGO A;  4JJG A;  3ITF A;  2H7O A;  4MVM A;  3RQF A;  3IHU A;  4IRU A;  2ICW G;  3TJ6 A;  5BQG A;  4DVZ A;  1EA8 A;  4E0H A;  5JT4 A;  5A6J A;  3S84 A;  4Q5S F;  1ZU5 A;  1OW6 A;  1VMA A;  3F46 A;  3JZ0 A;  3ZQY A;  3Q7G A;  4Z9J A;  3RW0 A;  3UGO A;  4K1O A;  3TOL A;  1E86 A;  5B3S C;  1N1C A;  2AU5 A;  1SR2 A;  4MS2 A;  4BG0 A;  5L0C A;  3B0V C;  2XLW A;  3MYF A;  4D4X A;  3ABM C;  4CS9 C;  1LE4 A;  4NC3 A;  4I1M A;  1I4Z A;  3SNH A;  4ER9 A;  4CDV A;  4G7H F;  2YLD A;  1J8M F;  2KYH A;  1ZHY A;  1VLT A;  1EI7 A;  1SYQ A;  4OIO F;  4JJF A;  1Z63 A;  1U0B B;  1FAP B;  2HMQ A;  1HMD A;  1K04 A;  2LSE A;  4O6Y A;  2A0U A;  4UDV A;  3POV A;  3RFY A;  1BDJ B;  4A2N B;  1LE2 A;  1TWH A;  1QKR A;  3RYL A;  1RJ9 A;  2OEV A;  1G4U S;  3UMI A;  1BBH A;  1LS4 A;  3HTK C;  5L0J A;  3B71 A;  1ORJ A;  1HE9 A;  1OCZ C;  5JSL A;  5A6A A;  4OIP F;  2EIM C;  3JT1 A;  1DOW A;  4FWV A;  2YL1 A;  2YQY A;  4U9D A;  2HV7 A;  4C3B A;  3SEO A;  4LAC B;  1AEP A;  4MW3 A;  2TMV P;  5KYW B;  2G3K A;  1C17 M;  3IQ5 A;  4IWB A;  3MBG A;  3T9O A;  1QSP A;  5BQI A;  3PMR A;  3AQC A;  3C8G A;  4EUK B;  3F47 A;  2CNW D;  2Y69 C;  3LNR A;  4MTF A;  2YWA A;  3N24 A;  2Q9C A;  2D4U A;  2Q4F A;  5CI9 A;  3TK0 A;  1B68 A;  3NMJ A;  4L6R A;  2OJE D;  4P9T A;  3TJ5 A;  1D1C A;  3L8I A;  2IYL D;  2HJM A;  1YJG A;  1GM5 A;  3GWL A;  2XLD A;  2W4M A;  1D1A A;  1YA9 A;  3LNM B;  4PK4 A;  5IY5 C;  2XXA A;  3K1I A;  2LK4 A;  2R05 A;  3KMI A;  4XTK A;  5CI8 A;  2YEV A;  1Z7Q c;  5COF A;  3H2V A;  4QI2 A;  2XM4 A;  1NZE A;  2EIN C;  2IXP A;  1WN0 A;  3CEX A;  5DQZ A;  1YA7 O;  3BRJ A;  4MVO A;  4N6C A;  4N06 A;  4MTG A;  4YN0 B;  1FR0 A;  1NG1 A;  1H6G A;  2UUH A;  3AG2 C;  3EFO B;  2WVN A;  2VH3 A;  1A7V A;  3L8J A;  4BJ6 A;  3ECS A;  3EH2 A;  4G0H A;  3MYI A;  4JTD B;  3EPV A;  2XM0 A;  4LLC A;  3WAQ A;  2J9B A;  3A9C A;  2R7W A;  3K1H A;  3T6B A;  4BJ5 C;  1Y4C A;  4CS8 C;  1WAT A;  2R25 A;  1ORY A;  2EPM X;  2HV6 A;  2LIG A;  2W45 A;  3EGX B;  3ZG1 A;  4KC9 A;  1VYI A;  3U5S A;  4MVS A;  2L9J A;  2ZXR A;  2VCA A;  4IB4 A;  1JPJ A;  1RXQ A;  1TWC A;  4IJJ A;  3HNK A;  4XEF A;  4U5D E;  3EHN A;  3UMK A;  4DRH B;  4DRI B;  4D4N A;  2MHR A;  1Z23 A;  1ST6 A;  2I15 A;  2H7V C;  4JCH A;  3TQO A;  3BEH A;  4J30 B;  2YZS A;  4BJ1 A;  1TFO B;  4E18 A;  4EWC A;  3C8Z A;  2GA0 A;  3DD7 A;  1T01 A;  3NYM A;  4ANJ A;  4G7O F;  1NBB A;  1O87 A;  4H4K C;  3Q6N A;  5JVE A;  3QW1 A;  2B0J A;  1D0Y A;  2FFH A;  2XS1 A;  3FAP B;  3LS0 A;  3JTL O;  3J06 A;  3VM6 A;  2NUP B;  2P0N A;  3U8V A;  3DZA A;  3SXM A;  4O7G A;  1NFN A;  2V26 A;  1S7Z A;  2HSB A;  3SYN A;  1RKC A;  3FVY A;  2L7A A;  2XL8 A;  4KNV A;  3WOD F;  2KNH A;  4JCZ A;  4LDQ A;  1FMV A;  1A7E A;  5JRA A;  2DYR C;  2QNL A;  4LDR A;  5DS6 A;  3IEE A;  4QI0 A;  1LKX A;  4W8P A;  5D92 A;  3FHD A;  5B1B C;  4FAP B;  4DRJ B;  1KNY A;  3KYJ A;  1VTM P;  1C03 A;  4MTO A;  5EK0 A;  2QLA A;  2MWQ A;  3G4X A;  1A41 A;  2ZD9 A;  3US6 A;  1LS1 A;  2P7V A;  2Y3D A;  3LUT B;  1YZC A;  1ZYR F;  2ETS A;  4EBK A;  4GEH A;  4ZLC A;  5BQH A;  3U3B A;  2P1A A;  1BR1 A;  3Q7L A;  3NDB B;  2L6F A;  2R03 A;  2R7S A;  1WGW A;  3HLZ A;  5T3T A;  2X51 A;  4ZLD A;  1L3P A;  2J0W A;  1QPU A;  3E9V A;  3SXK A;  3TD7 A;  5DLJ A;  5HSW A;  2GAQ A;  2YKZ A;  1BR4 A;  3ZWI A;  4Z9H A;  4ULW A;  2HZ8 A;  2XL4 A;  2L6G A;  4WGY A;  4F4B A;  1ZW3 A;  2A6H F;  2XLE A;  1K05 A;  3HNI A;  2M4E A;  1OXB A;  3HJC A;  2QTV A;  2OOC A;  1T5O A;  4BEM J;  4E7S A;  5DS5 A;  2FGY A;  3G50 A;  2NUT B;  3OA1 A;  1BR2 A;  2Q00 A;  3WG7 C;  3DM9 B;  2O9X A;  1M2O A;  5FCL A;  2OEX A;  4CDA A;  3ZTZ A;  1LI5 A;  2DYS C;  3U9M A;  5A69 A;  1G8X A;  1JPN A;  1ORS C;  4DXW A;  2J9V A;  4PJL A;  1YAU O;  5A6B A;  5KYW A;  3FOP A;  5KYY B;  1HW2 A;  2OJQ A;  4JC7 A;  1XZP A;  1U6H A;  3S28 A;  4PFO A;  3VAY A;  2PX3 A;  4CS7 A;  2PBE A;  2R7O A;  1U89 A;  2LFD A;  3GM1 A;  3GEH A;  1YYX A;  3LEV A;  1M6T A;  5CIV A;  3M4C A;  4JE9 A;  1OCR C;  3K6B A;  2Q3T A;  2UUI A;  4MW8 A;  2XL6 A;  2EIK C;  3ZDL A;  5F5H A;  1YAR O;  2KJG A;  1EQ1 A;  2A6E F;  2LD6 A;  3K7D A;  2BE5 F;  3ZTM A;  4K0D A;  4XPW A;  3EG9 B;  3CSK A;  4AX2 A;  4EKW A;  2HS5 A;  5L0D A;  5JP7 A;  2AVK A;  4O79 A;  2NPU A;  2EIL C;  1JMW A;  2Y3B A;  4LLE A;  3VYW A;  256B A;  2MYS A;  3EFO A;  1APC A;  3GOD A;  4U5H A;  3B29 A;  1I4Y A;  1PCX A;  2WB7 A;  3RVY A;  2LFF A;  2KC3 A;  4FX5 A;  4JUR I;  2EPL X;  1OW8 A;  1UG7 A;  2VCB A;  3U3F A;  4JTC B;  3MLG A;  3GAN A;  4XEV A;  4YWQ A;  3UGP A;  1XWJ A;  5JS5 A;  2YVK A;  3H65 A;  4BEJ A;  5KYX B;  1K40 A;  4G78 A;  3ZQV A;  3EGX A;  2R7T A;  1CPR A;  1F1M A;  3FXH A;  1SMY F;  4EBJ A;  1VLS A;  1S05 A;  2F22 A;  1G4W R;  2J9W A;  4KBL A;  5BUO A;  5KYU B;  1YLM A;  1R4T A;  5EHH A;  4AE4 B;  3R2P A;  2A1D D;  2J7P D;  4H54 A;  2R02 A;  2C04 A;  2GFH A;  3UR3 C;  4IAQ A;  1ZHZ A;  3V5Y A;  4EBB A;  1RMV A;  4PFP A;  3U9J A;  1MQV A;  1Q0G A;  2OQM A;  3NMK A;  2IXN A;  1M56 C;  1V74 B;  4XQ1 A;  2OG2 A;  3NKD A;  4IAO A;  1HE1 A;  1YYJ A;  4JZA A;  3DAF A;  5K0I A;  3ASO C;  2A69 F;  3AOU A;  4YL0 A;  2PF4 E;  3LS1 A;  4DVY P;  2NUP A;  2P6V A;  4YL3 A;  2R9R B;  1T9K A;  4E17 A;  3EGD A;  4YT4 A;  2RD9 A;  3CAX A;  4OD5 A;  4PJN A;  4IAR A;  3T6J A;  3ZIB A;  4N6H A;  3U0C A;  4CIH A;  3V7O A;  2YRF A;  3DI5 A;  4O6N A;  4KNW A;  2M64 A;  1KTM A;  3M4B A;  2HJ3 A;  3C62 A;  3DKA A;  2J8W A;  1V54 C;  3I5P A;  3K1I C;  4OIQ F;  3W4Y A;  5AC5 A;  2KK1 A;  2CYD A;  4C7O B;  1ZW2 A;  4OIN F;  4YT5 A;  5E2Q A;  1TQG A;  1TWA A;  3UNG C;  3KL4 A;  3HKK A;  1RCP A;  1T6U A;  2LQG A;  1O3U A;  4XLN F;  1FNT c;  3LJB A;  4RDA A;  4EHP A;  2E87 A;  4YJW A;  4E7Z A;  1MNE A;  2IBF A;  5F5F A;  4BJ6 C;  5L0I A;  3NRH A;  4Q7C A;  1OCC C;  3QZC A;  1OR3 A;  1HY5 A;  4JW1 A;  3VF0 A;  1E84 A;  1Z3I X;  2CDQ A;  3O6X A;  3DXJ F;  3LLK A;  3LLI A;  2B0H A;  1CPQ A;  5COG A;  1R5I D; 
#chains in the Genus database with same CATH homology
 3M79 A;  4WGY A;  3FOO A;  2XLE A;  3HNI A;  5JLI A;  2XLV A;  4U9E A;  2YLG A;  1BBH A;  2XLM A;  5JSL A;  2YL0 A;  2YL1 A;  4CDA A;  3DE9 A;  3DE8 A;  3ZTZ A;  4U9D A;  4CIP A;  3IQ5 A;  3FOP A;  1EKY A;  5B3I A;  2XLH A;  5JUA A;  1E85 A;  1GQA A;  1YYX A;  1M6T A;  4JE9 A;  3M4C A;  3NMJ A;  3IQ6 A;  3NMI A;  4JEB A;  3QVZ A;  2XL6 A;  2XLO A;  4L6R A;  3M15 A;  3C63 A;  2XLD A;  1CGN A;  3HNL A;  4CJO A;  4JKV A;  3L1M A;  3ZTM A;  2CCY A;  4CJG A;  2XM4 A;  3QVY A;  5JP7 A;  3U8P A;  1JAF A;  4ULV A;  256B A;  1YZA A;  1A7V A;  1APC A;  3QW0 A;  4N4W A;  3HNJ A;  3ZWI A;  2XM0 A;  2J9B A;  4CDY A;  5JS5 A;  2YLI A;  3ZQV A;  1CPR A;  1S05 A;  4IB4 A;  1LM3 B;  2YL3 A;  3HNK A;  2BC5 A;  4D4N A;  4IAQ A;  4WGZ A;  3VRC A;  2YL7 A;  3TOM A;  1MQV A;  3NMK A;  1NBB A;  5JVE A;  3QW1 A;  1YYJ A;  4CX9 A;  4JEA A;  2XL8 A;  4IAR A;  4N6H A;  5JRA A;  1CGO A;  1QQ3 A;  3M4B A;  3C62 A;  2J8W A;  5JT4 A;  2QLA A;  3ZQY A;  3TOL A;  1RCP A;  1YZC A;  1E86 A;  2XLW A;  4D4X A;  4EIY A;  5AGF A;  1E83 A;  4NC3 A;  1QPU A;  1E84 A;  2YKZ A;  4ER9 A;  4CDV A;  1CPQ A;  2YLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...