4WGYA

Crystal structure of cytochrome c' from alcaligenes xylosoxidans ncimb 11015 at ph 10.4
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title X-ray Crystallographic Elucidation for the Alkaline High-spin State Transition of Iron(III) Cytochrome c' from Alcaligenes xylosoxidans NCIMB 11015
doi rcsb
molecule tags Electron transport
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2014-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4wgyA00
4L6RA 2YLIA 1M6TA 1CPQA 3HNJA 3QW1A 256BA 1EKYA 1YYXA 3VRCA 3QVYA 4CIPA 5JUAA 4U9EA 1RCPA 4WGZA 5B3IA 3ZTMA 3HNIA 3IQ5A 5JSLA 3FOOA 4EIYA 1E84A 2XL6A 5JLIA 3ZWIA 4U9DA 4CDYA 2XM0A 4JKVA 4CJOA 1E86A 2YL1A 1YZCA 2XLHA 5JS5A 1MQVA 4N4WA 2YKZA 1CGOA 5JT4A 2YL7A 3HNKA 4NC3A 4D4XA 2CCYA 4JE9A 3IQ6A 2XM4A 5JRAA 3ZQVA 3NMKA 2XLDA 3NMIA 1NBBA 2XL8A 2XLEA 3NMJA 2BC5A 4CX9A 4CDAA 3DE8A 4JEAA 5AGFA 3U8PA 1APCA 3DE9A 2QLAA 1CGNA 1CPRA 4IAQA 4IB4A 1E83A 1QPUA 3C62A 4ULVA 4CJGA 4WGYA 1YZAA 2YLDA 3M4CA 3ZTZA 3M79A 3ZQYA 3HNLA 1E85A 1GQAA 3QVZA 5JP7A 4D4NA 1S05A 2XLMA 1QQ3A 3TOLA 2YLGA 2YL3A 1A7VA 2XLOA 2YL0A 5JVEA 3M15A 1JAFA 4JEBA 1BBHA 3M4BA 2XLWA 4CDVA 3TOMA 2XLVA 3FOPA 2J9BA 1LM3B 1YYJA 3L1MA 4N6HA 3QW0A 2J8WA 4IARA 4ER9A 3C63A
chains in the Genus database with same CATH superfamily
2HKVA 3ECSA 2VCAA 1Z6AA 4DRIB 4CS8C 4L6RA 2YLIA 1PV3A 1D1AA 3I5PA 1LKXA 256BA 2J0XA 3EFOA 3CAXA 2YRFA 5F28E 4FX5A 3VYWA 5DQTA 4EBJA 4KI2A 3ZDLA 2WVOA 5KYWB 3UMKA 5JUAA 4XLPF 4K0DA 4PACA 1VB5A 1VMAA 4U5GA 3RKOF 4JC7A 3HNIA 1GGQA 3ZTMA 1D0YA 4I1MA 1OR3A 1TR2A 2R9RB 1E84A 3ABKC 2EPNA 4AL1A 1N1CA 1H7IA 4U9DA 2LCHA 2LD6A 3PDMP 2KYHA 4XLNF 2XS8A 2Q00A 3EZHA 1YZCA 2QUPA 3W8HA 4JVSA 3S9OA 5JS5A 3K1HA 4N4WA 2A0BA 5TJ5E 1L3PA 2YKZA 5JT4A 3SP1A 2RD9A 4YT2A 3EH2A 1I5NA 5D91A 1HMOA 4IWBA 4QI0A 3TJ5A 3GANA 1ZHYA 2HSQA 1MMNA 2AVKA 2VC9A 4XWJA 5E3CA 5L0CA 2KK1A 1OCRC 4O6YA 1ZHWA 2NSFA 1R4TA 2V26A 3LUTB 4FESA 4PJNA 5F5FA 2HFIA 1XZQA 2J7PA 2L81A 1WGWA 2R05A 2XLDA 4EWCA 2IXOA 1NBBA 2CDQA 3NMJA 1YDIA 5FZTA 5FCLA 2Q7RA 4PR9A 2LQGA 4MTFA 3V7OA 2W9YA 1XZPA 3JRTA 4JIOA 4N6CA 2G3VA 5AGFA 2OEVA 3NG1A 1Q0FA 2OEXA 4MVRA 1LS1A 3U2MA 2OQMA 4C3EA 1CGNA 1Z63A 2KQ9A 4G0HA 4YT8A 2PX3A 2J9VA 4J7YA 4IB4A 4PK4A 1E83A 2QE9A 4LDKA 1QZXA 3EGXA 4DVZA 4NTFA 3EGDB 3HKKA 1LS4A 1D1BA 1I4ZA 1G4US 4U5FE 1SMYF 2QTVA 3TQOA 2J46A 3M4CA 1C17M 3SXMA 2A6HF 1V55C 2RSEB 2WVQA 3PCVA 4I3MA 3RF3A 4E0IA 3ASNC 2R7UA 3HJCA 1GQAA 1YLMA 3VF0A 3AOUA 1J8MF 3GODA 3X2QC 1Z3IX 1A7EA 5EK0A 3ZC4A 3NKDA 1PD1A 4XTKA 5B1BC 1NFNA 2WL8A 1ZU5A 1TWCA 4LACB 4BJ6A 3S84A 2YL3A 1OCCC 3LLKA 4C7OA 4R32A 2R7SA 1BR1A 1V54C 3N0TA 5AC4A 4I44A 2YL0A 3K1IC 1JOGA 4MQ9F 4NTBA 2EPLX 2GFHA 3I4UA 3LAYA 2VASA 3ASOC 2PF4E 4MVSA 1ORSC 2H7BA 3V5XA 3M4BA 1SR2A 3DJNB 3FAPB 1T6IA 2HMQA 3T9OA 4M63A 3S29A 2Q3TA 3SZRA 3B0PA 2HV7A 1LM3B 3L1MA 4G7ZF 5F5HA 1NZEA 2EINC 4AE4B 3ABLC 5KYUB 2AP3A 5A69A 1BDJB 1MNEA 1YARO 3M1CB 3DJUB 3LESA 1DOWA 1LIHA 2XS1A 3AG3C 1HE1A 2ZXWC 1OW6A 5KYNA 2G3KA 1H6GA 2PBEA 4HE8D 5COFA 2OJQA 1VYKA 1MMAA 3H2VA 2NPUA 3FHDA 2EIJC 2X51A 2OKUA 2P6VA 3AQBA 3E9VA 3NKEA 3GEEA 3B29A 4LLEA 1WATA 4O79A 3F47A 4P6IC 3HNJA 4ZLCA 3QW1A 1EKYA 1T5OA 4LDQA 2KJGA 4G7OF 4DJ9A 3SNHA 2W4BA 2DI3A 1JPJA 2ASRA 3G50A 1JR8A 4IGGA 4OINF 5L3VA 4CIPA 4XEFA 1QKRA 1NFOA 2B0JA 2MHRA 4CIHA 5B3IA 3LLIA 2EILC 1OKKD 3IQ5A 5B3SC 1Z23A 2BL2A 4ANJA 1A7DA 4EIYA 4WABA 5L0GA 1HMDA 1RMVA 2C03A 5DVWA 2PP4A 1ZYRF 2OU6A 2EPOA 1VLTA 1HE9A 4MVZA 3ITFA 2XM0A 1TQGA 4KNVA 1MNDA 4JJFA 1M2VA 1T01A 2Y69C 2WVNA 2NUTA 2YL1A 5A6AA 3KYIA 3R7CA 4CSAC 4GQHA 2Q9CA 4FAPB 2Q9AA 5L0HA 2HJMA 3U0CA 2PFDA 5E33A 3VAYA 3JSZA 2BE5F 4O6MA 4J32B 3U3FA 5CI8A 4Q5SF 1ORJA 4NQFA 1G4WR 2QY9A 1TKNA 2EIKC 2FFHA 2UUIA 2VCCA 3GORA 3KPHA 4Q7CA 4HFFB 4MNDA 3SYNA 4C3BA 2LFFA 4RBNA 1G5ZA 1PD0A 3NMIA 3GWLA 4OD4A 5CIVA 3KYJA 5L0JA 2XXAA 4KBLA 4G78A 1V74B 1WN0A 2BC5A 5L3QA 4OIOF 1ZZPA 3V5ZA 3NYJA 1ZVZA 2J45A 4JTAB 3DE8A 2LSEA 3RVZA 4A4AA 4DVYP 4CSAA 2P7VA 3EJNA 2NUPB 3U8PA 3K66A 1VK5A 5COGA 1RJ9B 3EHMA 1MMGA 2J9WA 2Y3HA 1ZHZA 5BQHA 1GS9A 1OKKA 1Q0DA 3KH2A 4YT5A 3ZVRA 4KNWA 5K0IA 5A6JA 3UMIA 4O6NA 2WB7A 3GWNA 4ZLDA 1WWPA 2ZXOA 1VTMP 2P61A 2Q9BA 4AL0A 1CGME 1D0ZA 1KNYA 3L8JA 5L0IA 5IY5C 3M79A 3GM1A 2C04A 3HNLA 1ZW3A 3ZQYA 1OW7A 1NSGB 1O5HA 2IXPA 4CS9A 2L6GA 4LERA 1E2XA 1WTYA 2LFDA 3EG9B 3OA1A 1YJGA 2GA0A 2J9UA 1S05A 1OQCA 4D4NA 3DXJF 2ZPAA 3RQGA 4A2NB 1OW8A 2XLMA 4BPMA 2I8BA 2HZ8A 1QQ3A 4E18A 3S27A 1EI7A 2CGEA 2AWCA 3HLZA 1Y4CA 5KYWA 1KTMA 2FAPB 3OEOA 3GM3A 1Q0MA 4NY3A 3T6JA 3MFNA 4U5CE 5B1AC 2VCBA 4BJ6C 5A6KA 2UUHA 2R7QA 3DAFA 4X0RA 5L0FA 3FDQA 4YN0B 5T3WA 1JAFA 1RKEB 4PJLA 4JEBA 3Q7GA 3ATPA 3V5YA 1DOVA 3X1OA 5DLJA 4OIRF 2PX0A 2XLVA 3FOPA 3G4XA 2H8AA 3Q6NA 3TULA 2R7TA 3G4ZA 2X0CA 2OJED 2XL4A 3GEIA 5GPGB 4MW3A 2A1DD 2J8WA 4IARA 5EHHA 3RQFA 2A68F 4EBKA 2IOQA 4QDLA 3RYLA 3UGPA 5DS5A 4MW8A 3RQEA 1HW2A 3B9QA 2Q4FA 2ZXRA 1H9GA 3LEOA 5KYYB 3K7DA 3J06A 2HV6A 4E17A 3C8GB 1K04A 1YYXA 2W45A 3MBGA 5T1DB 2YZSA 4IAOA 3U3BA 2Y3BA 3VRCA 3QVYA 3R2PA 1FMVA 3L34A 4WGZA 1B68A 2XRHA 3WAQA 2EPMX 5BQIA 5JSLA 3AJMA 2M64A 1MMDA 3Q7LA 3ZSUA 3LS1A 1U0BB 1VOMA 2HJ3A 4QI2A 3LNRA 3KMIA 4HEAJ 3WODF 3L8IA 2I15A 5JLIA 1Z7Qc 3ZWIA 1UFBA 3I5QA 4CDYA 4RD9A 1BR4A 3W4YA 4OIPF 3EQLF 4MVMA 1FAPB 2HS5A 1E86A 1BR2A 3EGDA 2XLHA 5DS6A 5HV9A 4EBBA 1IW7F 2JPUA 5AC5A 4NCQA 4AX2A 3SXZA 1C02A 2EPKX 1FNTc 1C03A 2KW3C 4PJMA 1G8XA 4YL0A 5DS4A 3WG7C 1FR0A 4YWQA 1EA8A 2LK4A 1PCXA 2ETSA 2JD3A 3HNKA 3QZCA 4NC3A 3T6BA 3W2VA 1NG1A 3FAJA 1W2WA 4D4XA 1YA7O 4N06A 4BJ5A 3QTHA 4JE9A 4BJ1A 3EFOB 4Z9IA 4DOZA 1ZU4A 5KYXA 5JRAA 3ZQVA 3NMKA 3JYHA 4U5HA 2OOCA 3B0VC 1A0BA 1M2OA 2DYRC 1OCZC 2XLEA 3IQTA 3UNGC 4NTAA 1IZMA 1LPEA 2DB4A 2IM8A 2IXMA 1U89A 4GYTA 1NU9C 3AGTA 3IQCA 4OD5A 3RVYA 4CDAA 2XXAB 3DI5A 1LE4A 1APCA 2R25A 3DE9A 3JT1A 4DRHB 2LP4A 1UG7A 1CPRA 4Q4ZF 4CBEA 1SZIA 4ONSA 4IAQA 1TFOB 3NYMA 1O87A 1VYIA 1M56C 4YL3A 1K05A 2L6FA 4ULVA 3TD7A 4CJGA 4WGYA 5L0DA 2KGOA 4AE4A 2XSEA 3CSKA 1AVOB 1YZAA 2DGJA 3MYIA 1JRAA 4MVUA 5KYUA 2H7OA 4MVQA 2L6HA 4XPXA 2Y3GA 3ZTZA 4XPYA 4PJJA 1T6UA 5E2QA 3EZIA 3T6GB 1ZHTA 3SXYA 4H4KC 3U9MA 4E7SA 2PNOA 1O3UA 2ICWG 4GEHA 3NRHA 4FWVA 1HY5A 3PMRA 1R5ID 3BRJA 3RH3A 4EKWA 4EHPA 3GM2A 4YL1A 1JMWA 4DRJB 4C3DA 2Z15A 2J0WA 4CS9C 3S0XA 2YLGA 3CZ6A 1A7VA 1TWGA 4I1OB 3DD7A 1AUEA 3F46A 1LE2A 2KNHA 3CQZA 4XEKA 2VH3A 3HTKC 2GDCA 4E0HA 3MX3A 3K33A 2XLOA 3Q6MA 3W8IA 4XPWA 1GM5A 4Z9JA 2HSBA 5JVEA 4K1OA 3U5SA 1L7CA 3M15A 2YHSA 4W8PA 4CS7A 5COMA 1BBHA 4BEJA 5T3TA 4OIQF 1YA9A 4CDVA 3UGOA 1XWJA 4Z9HA 2JX0A 3TOMA 1M57C 1YYJA 1S7ZA 3BEHA 3EGXB 2B0HA 4XQ1A 1D1CA 3C18A 4YJWA 2V3CC 3KL4A 4J30B 5E3AA 3H65A 2CYDA 4BJTA 4U5DE 4DBQA 4CS8A 3UR3C 3S90A 4ER9A 2HMZA 3C63A 3ZIBA 4DXWA 4W8KA 3AQCA 1LI7A 1J8YF 1VLSA 1FMWA 3AGUA 1EQ1A 3DAGA 2L7AA 4LLCA 2WZGA 1M6TA 1CPQA 1V4AA 4XEVA 2A69F 3C8ZA 4UDVA 1WASA 1NLXA 1ZW2A 2FGYA 3E70C 1TFKB 1D0XA 2IBFA 4C7OB 2KSFA 1OR2A 4IRUA 4U9EA 5D92A 1RCPA 1U6HA 2HUJA 4U5BE 3H2UA 3FOOA 2WZLA 2IXNA 2NUPA 4JRZA 3U2LA 1RJ9A 3B71A 5A6BD 1Z5ZA 2YQYA 2XL6A 2TMVP 2KC3A 1QSPA 1WOLA 2G62A 2QNLA 2R7RA 4JTCB 3O39A 4JURI 4MVOA 5BUOA 4JKVA 4MTGA 2CW0F 3OWTA 3VM6A 4CJOA 2R7XA 2P1AA 1Y6DA 1JPNA 3C7JA 4K7BA 3UMHA 1MQVA 2R7WA 2MWQA 1CGOA 2NG1A 4DBRA 3QMKA 2YL7A 4KC9A 1RXQA 3C8GD 4AK9A 2Y39A 1SYQA 1ST6A 2CNWD 3EG9A 2CCYA 3B0UX 2L9JA 3S28A 1QLEC 3IQ6A 4O7GA 2XM4A 1ORYA 3JCUQ 4JZAA 1Q0GA 1BZ4A 3JYYA 3LNMB 4YT4A 4BEMJ 4P9TA 1TWAA 2XL8A 2ZD9A 4JTDB 1FFHA 3AG2C 3WHNA 3RIPA 2Y3DA 4BJ5C 3DM9B 1FTSA 3SEOA 5KYXB 5CI9A 3DMDA 4CX9A 5EGYA 1K40A 4JEAA 3LEVA 1RKCA 3DWWA 3ABMC 1SF8A 2QLAA 2O9XA 3FXHA 1KU2A 1RKEA 3A9CA 4B6IA 4HFKB 4JW1A 4F4BA 3US6A 2YEVA 4PFPA 2D4UA 1FFTC 3U8VA 2R7VA 5BQGA 2ZXPA 2P0NA 1QPUA 2D5RB 4IJJA 1OXKA 3W2WA 3C62A 1I4YA 1YAUO 3U9JA 2R02A 1M2VB 2NUTB 3O55A 2WZFA 5A6BA 4J7TA 2E87A 2YLDA 1T9KA 2A0UA 4YK5A 1YVIA 3DZAA 3KKBA 3NDBB 3MYFA 2GAQA 3IEEA 2NSGA 3FVYA 4PFOA 1LVKA 2YWAA 3A11A 1E85A 1F1MA 2AU5A 3AG4C 3N2ZB 3O6XA 4MS2A 4BG0A 4EUKB 1A41A 3QVZA 3O10A 4JCZA 5JP7A 4G7HF 3TK0A 1TWHA 3JRMO 3RW0A 3DKAA 3K6BA 5HSWA 2F22A 5KYYA 3TOLA 1HW1A 3EPVA 3K1IA 3C8GA 3LJBA 4P9FA 1QVXA 4E7ZA 2CNWA 4WJ0A 2OCCC 2M4EA 4LDRA 4RDAA 2R7OA 2OG2A 4JJGA 1T6QA 3IPMO 2DYSC 3POVA 5DQZA 2YVKA 2W4MA 2IYLD 1LI5A 2XLWA 2EIMC 3N24A 3RFYA 3PHF2 1NU7D 2H7VC 3MLGA 1ZHXA 3IHUA 4H54A 4JCHA 3ZG1A 3JZ0A 2J9BA 3JSEO 3TJ6A 3FMSA 1H9TA 2MYSA 3EHNA 3EH1A 2AWYA 3GEHA 1OCOC 3L0IA 3NYLA 1OXBA 2LIGA 3CEXA 3DM5A 2A6EF 4N6HA 3SXKA 3LS0A 1Q0KA 3AG1C 2GWWA 3QW0A 4MTOA 2R03A 2VB6A 4U5EE 4ULWA 1AEPA 3T4RA 2J7PD 3JTLO
chains in the Genus database with same CATH topology
4L6RA 2YLIA 1M6TA 1CPQA 3HNJA 3QW1A 256BA 1EKYA 1YYXA 3VRCA 3QVYA 4CIPA 5JUAA 4U9EA 1RCPA 4WGZA 5B3IA 3ZTMA 3HNIA 3IQ5A 5JSLA 3FOOA 4EIYA 1E84A 2XL6A 5JLIA 3ZWIA 4U9DA 4CDYA 2XM0A 4JKVA 4CJOA 1E86A 2YL1A 1YZCA 2XLHA 5JS5A 1MQVA 4N4WA 2YKZA 1CGOA 5JT4A 2YL7A 3HNKA 4NC3A 4D4XA 2CCYA 4JE9A 3IQ6A 2XM4A 5JRAA 3ZQVA 3NMKA 2XLDA 3NMIA 1NBBA 2XL8A 2XLEA 3NMJA 2BC5A 4CX9A 4CDAA 3DE8A 4JEAA 5AGFA 3U8PA 1APCA 3DE9A 2QLAA 1CGNA 1CPRA 4IAQA 4IB4A 1E83A 1QPUA 3C62A 4ULVA 4CJGA 4WGYA 1YZAA 2YLDA 3M4CA 3ZTZA 3M79A 3ZQYA 3HNLA 1E85A 1GQAA 3QVZA 5JP7A 4D4NA 1S05A 2XLMA 1QQ3A 3TOLA 2YLGA 2YL3A 1A7VA 2XLOA 2YL0A 5JVEA 3M15A 1JAFA 4JEBA 1BBHA 3M4BA 2XLWA 4CDVA 3TOMA 2XLVA 3FOPA 2J9BA 1LM3B 1YYJA 3L1MA 4N6HA 3QW0A 2J8WA 4IARA 4ER9A 3C63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L6R A;  2YLI A;  1M6T A;  1CPQ A;  3HNJ A;  3QW1 A;  256B A;  1EKY A;  1YYX A;  3VRC A;  3QVY A;  4CIP A;  5JUA A;  4U9E A;  1RCP A;  4WGZ A;  5B3I A;  3ZTM A;  3HNI A;  3IQ5 A;  5JSL A;  3FOO A;  4EIY A;  1E84 A;  2XL6 A;  5JLI A;  3ZWI A;  4U9D A;  4CDY A;  2XM0 A;  4JKV A;  4CJO A;  1E86 A;  2YL1 A;  1YZC A;  2XLH A;  5JS5 A;  1MQV A;  4N4W A;  2YKZ A;  1CGO A;  5JT4 A;  2YL7 A;  3HNK A;  4NC3 A;  4D4X A;  2CCY A;  4JE9 A;  3IQ6 A;  2XM4 A;  5JRA A;  3ZQV A;  3NMK A;  2XLD A;  3NMI A;  1NBB A;  2XL8 A;  2XLE A;  3NMJ A;  2BC5 A;  4CX9 A;  4CDA A;  3DE8 A;  4JEA A;  5AGF A;  3U8P A;  1APC A;  3DE9 A;  2QLA A;  1CGN A;  1CPR A;  4IAQ A;  4IB4 A;  1E83 A;  1QPU A;  3C62 A;  4ULV A;  4CJG A;  4WGY A;  1YZA A;  2YLD A;  3M4C A;  3ZTZ A;  3M79 A;  3ZQY A;  3HNL A;  1E85 A;  1GQA A;  3QVZ A;  5JP7 A;  4D4N A;  1S05 A;  2XLM A;  1QQ3 A;  3TOL A;  2YLG A;  2YL3 A;  1A7V A;  2XLO A;  2YL0 A;  5JVE A;  3M15 A;  1JAF A;  4JEB A;  1BBH A;  3M4B A;  2XLW A;  4CDV A;  3TOM A;  2XLV A;  3FOP A;  2J9B A;  1LM3 B;  1YYJ A;  3L1M A;  4N6H A;  3QW0 A;  2J8W A;  4IAR A;  4ER9 A;  3C63 A; 
#chains in the Genus database with same CATH topology
 2HKV A;  3ECS A;  2VCA A;  1Z6A A;  4DRI B;  4CS8 C;  4L6R A;  2YLI A;  1PV3 A;  1D1A A;  3I5P A;  1LKX A;  256B A;  2J0X A;  3EFO A;  3CAX A;  2YRF A;  5F28 E;  4FX5 A;  3VYW A;  5DQT A;  4EBJ A;  4KI2 A;  3ZDL A;  2WVO A;  5KYW B;  3UMK A;  5JUA A;  4XLP F;  4K0D A;  4PAC A;  1VB5 A;  1VMA A;  4U5G A;  3RKO F;  4JC7 A;  3HNI A;  1GGQ A;  3ZTM A;  1D0Y A;  4I1M A;  1OR3 A;  1TR2 A;  2R9R B;  1E84 A;  3ABK C;  2EPN A;  4AL1 A;  1N1C A;  1H7I A;  4U9D A;  2LCH A;  2LD6 A;  3PDM P;  2KYH A;  4XLN F;  2XS8 A;  2Q00 A;  3EZH A;  1YZC A;  2QUP A;  3W8H A;  4JVS A;  3S9O A;  5JS5 A;  3K1H A;  4N4W A;  2A0B A;  5TJ5 E;  1L3P A;  2YKZ A;  5JT4 A;  3SP1 A;  2RD9 A;  4YT2 A;  3EH2 A;  1I5N A;  5D91 A;  1HMO A;  4IWB A;  4QI0 A;  3TJ5 A;  3GAN A;  1ZHY A;  2HSQ A;  1MMN A;  2AVK A;  2VC9 A;  4XWJ A;  5E3C A;  5L0C A;  2KK1 A;  1OCR C;  4O6Y A;  1ZHW A;  2NSF A;  1R4T A;  2V26 A;  3LUT B;  4FES A;  4PJN A;  5F5F A;  2HFI A;  1XZQ A;  2J7P A;  2L81 A;  1WGW A;  2R05 A;  2XLD A;  4EWC A;  2IXO A;  1NBB A;  2CDQ A;  3NMJ A;  1YDI A;  5FZT A;  5FCL A;  2Q7R A;  4PR9 A;  2LQG A;  4MTF A;  3V7O A;  2W9Y A;  1XZP A;  3JRT A;  4JIO A;  4N6C A;  2G3V A;  5AGF A;  2OEV A;  3NG1 A;  1Q0F A;  2OEX A;  4MVR A;  1LS1 A;  3U2M A;  2OQM A;  4C3E A;  1CGN A;  1Z63 A;  2KQ9 A;  4G0H A;  4YT8 A;  2PX3 A;  2J9V A;  4J7Y A;  4IB4 A;  4PK4 A;  1E83 A;  2QE9 A;  4LDK A;  1QZX A;  3EGX A;  4DVZ A;  4NTF A;  3EGD B;  3HKK A;  1LS4 A;  1D1B A;  1I4Z A;  1G4U S;  4U5F E;  1SMY F;  2QTV A;  3TQO A;  2J46 A;  3M4C A;  1C17 M;  3SXM A;  2A6H F;  1V55 C;  2RSE B;  2WVQ A;  3PCV A;  4I3M A;  3RF3 A;  4E0I A;  3ASN C;  2R7U A;  3HJC A;  1GQA A;  1YLM A;  3VF0 A;  3AOU A;  1J8M F;  3GOD A;  3X2Q C;  1Z3I X;  1A7E A;  5EK0 A;  3ZC4 A;  3NKD A;  1PD1 A;  4XTK A;  5B1B C;  1NFN A;  2WL8 A;  1ZU5 A;  1TWC A;  4LAC B;  4BJ6 A;  3S84 A;  2YL3 A;  1OCC C;  3LLK A;  4C7O A;  4R32 A;  2R7S A;  1BR1 A;  1V54 C;  3N0T A;  5AC4 A;  4I44 A;  2YL0 A;  3K1I C;  1JOG A;  4MQ9 F;  4NTB A;  2EPL X;  2GFH A;  3I4U A;  3LAY A;  2VAS A;  3ASO C;  2PF4 E;  4MVS A;  1ORS C;  2H7B A;  3V5X A;  3M4B A;  1SR2 A;  3DJN B;  3FAP B;  1T6I A;  2HMQ A;  3T9O A;  4M63 A;  3S29 A;  2Q3T A;  3SZR A;  3B0P A;  2HV7 A;  1LM3 B;  3L1M A;  4G7Z F;  5F5H A;  1NZE A;  2EIN C;  4AE4 B;  3ABL C;  5KYU B;  2AP3 A;  5A69 A;  1BDJ B;  1MNE A;  1YAR O;  3M1C B;  3DJU B;  3LES A;  1DOW A;  1LIH A;  2XS1 A;  3AG3 C;  1HE1 A;  2ZXW C;  1OW6 A;  5KYN A;  2G3K A;  1H6G A;  2PBE A;  4HE8 D;  5COF A;  2OJQ A;  1VYK A;  1MMA A;  3H2V A;  2NPU A;  3FHD A;  2EIJ C;  2X51 A;  2OKU A;  2P6V A;  3AQB A;  3E9V A;  3NKE A;  3GEE A;  3B29 A;  4LLE A;  1WAT A;  4O79 A;  3F47 A;  4P6I C;  3HNJ A;  4ZLC A;  3QW1 A;  1EKY A;  1T5O A;  4LDQ A;  2KJG A;  4G7O F;  4DJ9 A;  3SNH A;  2W4B A;  2DI3 A;  1JPJ A;  2ASR A;  3G50 A;  1JR8 A;  4IGG A;  4OIN F;  5L3V A;  4CIP A;  4XEF A;  1QKR A;  1NFO A;  2B0J A;  2MHR A;  4CIH A;  5B3I A;  3LLI A;  2EIL C;  1OKK D;  3IQ5 A;  5B3S C;  1Z23 A;  2BL2 A;  4ANJ A;  1A7D A;  4EIY A;  4WAB A;  5L0G A;  1HMD A;  1RMV A;  2C03 A;  5DVW A;  2PP4 A;  1ZYR F;  2OU6 A;  2EPO A;  1VLT A;  1HE9 A;  4MVZ A;  3ITF A;  2XM0 A;  1TQG A;  4KNV A;  1MND A;  4JJF A;  1M2V A;  1T01 A;  2Y69 C;  2WVN A;  2NUT A;  2YL1 A;  5A6A A;  3KYI A;  3R7C A;  4CSA C;  4GQH A;  2Q9C A;  4FAP B;  2Q9A A;  5L0H A;  2HJM A;  3U0C A;  2PFD A;  5E33 A;  3VAY A;  3JSZ A;  2BE5 F;  4O6M A;  4J32 B;  3U3F A;  5CI8 A;  4Q5S F;  1ORJ A;  4NQF A;  1G4W R;  2QY9 A;  1TKN A;  2EIK C;  2FFH A;  2UUI A;  2VCC A;  3GOR A;  3KPH A;  4Q7C A;  4HFF B;  4MND A;  3SYN A;  4C3B A;  2LFF A;  4RBN A;  1G5Z A;  1PD0 A;  3NMI A;  3GWL A;  4OD4 A;  5CIV A;  3KYJ A;  5L0J A;  2XXA A;  4KBL A;  4G78 A;  1V74 B;  1WN0 A;  2BC5 A;  5L3Q A;  4OIO F;  1ZZP A;  3V5Z A;  3NYJ A;  1ZVZ A;  2J45 A;  4JTA B;  3DE8 A;  2LSE A;  3RVZ A;  4A4A A;  4DVY P;  4CSA A;  2P7V A;  3EJN A;  2NUP B;  3U8P A;  3K66 A;  1VK5 A;  5COG A;  1RJ9 B;  3EHM A;  1MMG A;  2J9W A;  2Y3H A;  1ZHZ A;  5BQH A;  1GS9 A;  1OKK A;  1Q0D A;  3KH2 A;  4YT5 A;  3ZVR A;  4KNW A;  5K0I A;  5A6J A;  3UMI A;  4O6N A;  2WB7 A;  3GWN A;  4ZLD A;  1WWP A;  2ZXO A;  1VTM P;  2P61 A;  2Q9B A;  4AL0 A;  1CGM E;  1D0Z A;  1KNY A;  3L8J A;  5L0I A;  5IY5 C;  3M79 A;  3GM1 A;  2C04 A;  3HNL A;  1ZW3 A;  3ZQY A;  1OW7 A;  1NSG B;  1O5H A;  2IXP A;  4CS9 A;  2L6G A;  4LER A;  1E2X A;  1WTY A;  2LFD A;  3EG9 B;  3OA1 A;  1YJG A;  2GA0 A;  2J9U A;  1S05 A;  1OQC A;  4D4N A;  3DXJ F;  2ZPA A;  3RQG A;  4A2N B;  1OW8 A;  2XLM A;  4BPM A;  2I8B A;  2HZ8 A;  1QQ3 A;  4E18 A;  3S27 A;  1EI7 A;  2CGE A;  2AWC A;  3HLZ A;  1Y4C A;  5KYW A;  1KTM A;  2FAP B;  3OEO A;  3GM3 A;  1Q0M A;  4NY3 A;  3T6J A;  3MFN A;  4U5C E;  5B1A C;  2VCB A;  4BJ6 C;  5A6K A;  2UUH A;  2R7Q A;  3DAF A;  4X0R A;  5L0F A;  3FDQ A;  4YN0 B;  5T3W A;  1JAF A;  1RKE B;  4PJL A;  4JEB A;  3Q7G A;  3ATP A;  3V5Y A;  1DOV A;  3X1O A;  5DLJ A;  4OIR F;  2PX0 A;  2XLV A;  3FOP A;  3G4X A;  2H8A A;  3Q6N A;  3TUL A;  2R7T A;  3G4Z A;  2X0C A;  2OJE D;  2XL4 A;  3GEI A;  5GPG B;  4MW3 A;  2A1D D;  2J8W A;  4IAR A;  5EHH A;  3RQF A;  2A68 F;  4EBK A;  2IOQ A;  4QDL A;  3RYL A;  3UGP A;  5DS5 A;  4MW8 A;  3RQE A;  1HW2 A;  3B9Q A;  2Q4F A;  2ZXR A;  1H9G A;  3LEO A;  5KYY B;  3K7D A;  3J06 A;  2HV6 A;  4E17 A;  3C8G B;  1K04 A;  1YYX A;  2W45 A;  3MBG A;  5T1D B;  2YZS A;  4IAO A;  3U3B A;  2Y3B A;  3VRC A;  3QVY A;  3R2P A;  1FMV A;  3L34 A;  4WGZ A;  1B68 A;  2XRH A;  3WAQ A;  2EPM X;  5BQI A;  5JSL A;  3AJM A;  2M64 A;  1MMD A;  3Q7L A;  3ZSU A;  3LS1 A;  1U0B B;  1VOM A;  2HJ3 A;  4QI2 A;  3LNR A;  3KMI A;  4HEA J;  3WOD F;  3L8I A;  2I15 A;  5JLI A;  1Z7Q c;  3ZWI A;  1UFB A;  3I5Q A;  4CDY A;  4RD9 A;  1BR4 A;  3W4Y A;  4OIP F;  3EQL F;  4MVM A;  1FAP B;  2HS5 A;  1E86 A;  1BR2 A;  3EGD A;  2XLH A;  5DS6 A;  5HV9 A;  4EBB A;  1IW7 F;  2JPU A;  5AC5 A;  4NCQ A;  4AX2 A;  3SXZ A;  1C02 A;  2EPK X;  1FNT c;  1C03 A;  2KW3 C;  4PJM A;  1G8X A;  4YL0 A;  5DS4 A;  3WG7 C;  1FR0 A;  4YWQ A;  1EA8 A;  2LK4 A;  1PCX A;  2ETS A;  2JD3 A;  3HNK A;  3QZC A;  4NC3 A;  3T6B A;  3W2V A;  1NG1 A;  3FAJ A;  1W2W A;  4D4X A;  1YA7 O;  4N06 A;  4BJ5 A;  3QTH A;  4JE9 A;  4BJ1 A;  3EFO B;  4Z9I A;  4DOZ A;  1ZU4 A;  5KYX A;  5JRA A;  3ZQV A;  3NMK A;  3JYH A;  4U5H A;  2OOC A;  3B0V C;  1A0B A;  1M2O A;  2DYR C;  1OCZ C;  2XLE A;  3IQT A;  3UNG C;  4NTA A;  1IZM A;  1LPE A;  2DB4 A;  2IM8 A;  2IXM A;  1U89 A;  4GYT A;  1NU9 C;  3AGT A;  3IQC A;  4OD5 A;  3RVY A;  4CDA A;  2XXA B;  3DI5 A;  1LE4 A;  1APC A;  2R25 A;  3DE9 A;  3JT1 A;  4DRH B;  2LP4 A;  1UG7 A;  1CPR A;  4Q4Z F;  4CBE A;  1SZI A;  4ONS A;  4IAQ A;  1TFO B;  3NYM A;  1O87 A;  1VYI A;  1M56 C;  4YL3 A;  1K05 A;  2L6F A;  4ULV A;  3TD7 A;  4CJG A;  4WGY A;  5L0D A;  2KGO A;  4AE4 A;  2XSE A;  3CSK A;  1AVO B;  1YZA A;  2DGJ A;  3MYI A;  1JRA A;  4MVU A;  5KYU A;  2H7O A;  4MVQ A;  2L6H A;  4XPX A;  2Y3G A;  3ZTZ A;  4XPY A;  4PJJ A;  1T6U A;  5E2Q A;  3EZI A;  3T6G B;  1ZHT A;  3SXY A;  4H4K C;  3U9M A;  4E7S A;  2PNO A;  1O3U A;  2ICW G;  4GEH A;  3NRH A;  4FWV A;  1HY5 A;  3PMR A;  1R5I D;  3BRJ A;  3RH3 A;  4EKW A;  4EHP A;  3GM2 A;  4YL1 A;  1JMW A;  4DRJ B;  4C3D A;  2Z15 A;  2J0W A;  4CS9 C;  3S0X A;  2YLG A;  3CZ6 A;  1A7V A;  1TWG A;  4I1O B;  3DD7 A;  1AUE A;  3F46 A;  1LE2 A;  2KNH A;  3CQZ A;  4XEK A;  2VH3 A;  3HTK C;  2GDC A;  4E0H A;  3MX3 A;  3K33 A;  2XLO A;  3Q6M A;  3W8I A;  4XPW A;  1GM5 A;  4Z9J A;  2HSB A;  5JVE A;  4K1O A;  3U5S A;  1L7C A;  3M15 A;  2YHS A;  4W8P A;  4CS7 A;  5COM A;  1BBH A;  4BEJ A;  5T3T A;  4OIQ F;  1YA9 A;  4CDV A;  3UGO A;  1XWJ A;  4Z9H A;  2JX0 A;  3TOM A;  1M57 C;  1YYJ A;  1S7Z A;  3BEH A;  3EGX B;  2B0H A;  4XQ1 A;  1D1C A;  3C18 A;  4YJW A;  2V3C C;  3KL4 A;  4J30 B;  5E3A A;  3H65 A;  2CYD A;  4BJT A;  4U5D E;  4DBQ A;  4CS8 A;  3UR3 C;  3S90 A;  4ER9 A;  2HMZ A;  3C63 A;  3ZIB A;  4DXW A;  4W8K A;  3AQC A;  1LI7 A;  1J8Y F;  1VLS A;  1FMW A;  3AGU A;  1EQ1 A;  3DAG A;  2L7A A;  4LLC A;  2WZG A;  1M6T A;  1CPQ A;  1V4A A;  4XEV A;  2A69 F;  3C8Z A;  4UDV A;  1WAS A;  1NLX A;  1ZW2 A;  2FGY A;  3E70 C;  1TFK B;  1D0X A;  2IBF A;  4C7O B;  2KSF A;  1OR2 A;  4IRU A;  4U9E A;  5D92 A;  1RCP A;  1U6H A;  2HUJ A;  4U5B E;  3H2U A;  3FOO A;  2WZL A;  2IXN A;  2NUP A;  4JRZ A;  3U2L A;  1RJ9 A;  3B71 A;  5A6B D;  1Z5Z A;  2YQY A;  2XL6 A;  2TMV P;  2KC3 A;  1QSP A;  1WOL A;  2G62 A;  2QNL A;  2R7R A;  4JTC B;  3O39 A;  4JUR I;  4MVO A;  5BUO A;  4JKV A;  4MTG A;  2CW0 F;  3OWT A;  3VM6 A;  4CJO A;  2R7X A;  2P1A A;  1Y6D A;  1JPN A;  3C7J A;  4K7B A;  3UMH A;  1MQV A;  2R7W A;  2MWQ A;  1CGO A;  2NG1 A;  4DBR A;  3QMK A;  2YL7 A;  4KC9 A;  1RXQ A;  3C8G D;  4AK9 A;  2Y39 A;  1SYQ A;  1ST6 A;  2CNW D;  3EG9 A;  2CCY A;  3B0U X;  2L9J A;  3S28 A;  1QLE C;  3IQ6 A;  4O7G A;  2XM4 A;  1ORY A;  3JCU Q;  4JZA A;  1Q0G A;  1BZ4 A;  3JYY A;  3LNM B;  4YT4 A;  4BEM J;  4P9T A;  1TWA A;  2XL8 A;  2ZD9 A;  4JTD B;  1FFH A;  3AG2 C;  3WHN A;  3RIP A;  2Y3D A;  4BJ5 C;  3DM9 B;  1FTS A;  3SEO A;  5KYX B;  5CI9 A;  3DMD A;  4CX9 A;  5EGY A;  1K40 A;  4JEA A;  3LEV A;  1RKC A;  3DWW A;  3ABM C;  1SF8 A;  2QLA A;  2O9X A;  3FXH A;  1KU2 A;  1RKE A;  3A9C A;  4B6I A;  4HFK B;  4JW1 A;  4F4B A;  3US6 A;  2YEV A;  4PFP A;  2D4U A;  1FFT C;  3U8V A;  2R7V A;  5BQG A;  2ZXP A;  2P0N A;  1QPU A;  2D5R B;  4IJJ A;  1OXK A;  3W2W A;  3C62 A;  1I4Y A;  1YAU O;  3U9J A;  2R02 A;  1M2V B;  2NUT B;  3O55 A;  2WZF A;  5A6B A;  4J7T A;  2E87 A;  2YLD A;  1T9K A;  2A0U A;  4YK5 A;  1YVI A;  3DZA A;  3KKB A;  3NDB B;  3MYF A;  2GAQ A;  3IEE A;  2NSG A;  3FVY A;  4PFO A;  1LVK A;  2YWA A;  3A11 A;  1E85 A;  1F1M A;  2AU5 A;  3AG4 C;  3N2Z B;  3O6X A;  4MS2 A;  4BG0 A;  4EUK B;  1A41 A;  3QVZ A;  3O10 A;  4JCZ A;  5JP7 A;  4G7H F;  3TK0 A;  1TWH A;  3JRM O;  3RW0 A;  3DKA A;  3K6B A;  5HSW A;  2F22 A;  5KYY A;  3TOL A;  1HW1 A;  3EPV A;  3K1I A;  3C8G A;  3LJB A;  4P9F A;  1QVX A;  4E7Z A;  2CNW A;  4WJ0 A;  2OCC C;  2M4E A;  4LDR A;  4RDA A;  2R7O A;  2OG2 A;  4JJG A;  1T6Q A;  3IPM O;  2DYS C;  3POV A;  5DQZ A;  2YVK A;  2W4M A;  2IYL D;  1LI5 A;  2XLW A;  2EIM C;  3N24 A;  3RFY A;  3PHF 2;  1NU7 D;  2H7V C;  3MLG A;  1ZHX A;  3IHU A;  4H54 A;  4JCH A;  3ZG1 A;  3JZ0 A;  2J9B A;  3JSE O;  3TJ6 A;  3FMS A;  1H9T A;  2MYS A;  3EHN A;  3EH1 A;  2AWY A;  3GEH A;  1OCO C;  3L0I A;  3NYL A;  1OXB A;  2LIG A;  3CEX A;  3DM5 A;  2A6E F;  4N6H A;  3SXK A;  3LS0 A;  1Q0K A;  3AG1 C;  2GWW A;  3QW0 A;  4MTO A;  2R03 A;  2VB6 A;  4U5E E;  4ULW A;  1AEP A;  3T4R A;  2J7P D;  3JTL O; 
#chains in the Genus database with same CATH homology
 4L6R A;  2YLI A;  1M6T A;  1CPQ A;  3HNJ A;  3QW1 A;  256B A;  1EKY A;  1YYX A;  3VRC A;  3QVY A;  4CIP A;  5JUA A;  4U9E A;  1RCP A;  4WGZ A;  5B3I A;  3ZTM A;  3HNI A;  3IQ5 A;  5JSL A;  3FOO A;  4EIY A;  1E84 A;  2XL6 A;  5JLI A;  3ZWI A;  4U9D A;  4CDY A;  2XM0 A;  4JKV A;  4CJO A;  1E86 A;  2YL1 A;  1YZC A;  2XLH A;  5JS5 A;  1MQV A;  4N4W A;  2YKZ A;  1CGO A;  5JT4 A;  2YL7 A;  3HNK A;  4NC3 A;  4D4X A;  2CCY A;  4JE9 A;  3IQ6 A;  2XM4 A;  5JRA A;  3ZQV A;  3NMK A;  2XLD A;  3NMI A;  1NBB A;  2XL8 A;  2XLE A;  3NMJ A;  2BC5 A;  4CX9 A;  4CDA A;  3DE8 A;  4JEA A;  5AGF A;  3U8P A;  1APC A;  3DE9 A;  2QLA A;  1CGN A;  1CPR A;  4IAQ A;  4IB4 A;  1E83 A;  1QPU A;  3C62 A;  4ULV A;  4CJG A;  4WGY A;  1YZA A;  2YLD A;  3M4C A;  3ZTZ A;  3M79 A;  3ZQY A;  3HNL A;  1E85 A;  1GQA A;  3QVZ A;  5JP7 A;  4D4N A;  1S05 A;  2XLM A;  1QQ3 A;  3TOL A;  2YLG A;  2YL3 A;  1A7V A;  2XLO A;  2YL0 A;  5JVE A;  3M15 A;  1JAF A;  4JEB A;  1BBH A;  3M4B A;  2XLW A;  4CDV A;  3TOM A;  2XLV A;  3FOP A;  2J9B A;  1LM3 B;  1YYJ A;  3L1M A;  4N6H A;  3QW0 A;  2J8W A;  4IAR A;  4ER9 A;  3C63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...