4WI0B

Crystal structure of coh3scab-xdoc_m2scaa complex: a c-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
156
structure length
156
Chain Sequence
b'GTTVSGYINPDFVTTSTTAPIVKAGFTVEIVGTTKSAVTDSNGYFEIKDVAAGTYTVKITKANYLTREIANVSVTADKELSTSASPILMWAGDMAIGGTQDGAINLEDILEICKAFNTSSTDAKYQVGLDLNRDGAISLEDVMIVAKHFGKVSSDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulosomal scaffoldin adaptor protein B
publication title Crystal structure of Coh3ScaB-XDoc_M1ScaA complex: A C-terminal interface mutant of type II Cohesin-X-Dockerin complex from Acetivibrio cellulolyticus
rcsb
source organism Acetivibrio cellulolyticus
molecule tags Structural protein
total genus 41
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1330.10 Mainly Alpha Orthogonal Bundle Type 1 dockerin domain Dockerin domain 4wi0B02
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 4wi0B01
1OHZB 1DAVA 3G3LA 2CCLB 1DAQA 5G5DB 3MN8A 4U3SB 4WI0B 1QMUA 3UL4B 5LXVB 3E8VA 2JNKA 4DH2B 4UYPB 4YOKA 5K39B 2B59B 2VN5B 4FXTA 4IU2B 2VN6B 1NKGA 2Y3NB 4WKZA 2OZNB 3HN5A 5AQ0A 2NSMA 2MTEA 4IU3B 4UYQB 4IYKA 1UWYA 3KCPA 4EIUA 4FL4C 4FL4A 1H8LA 3NJVA 2XHNA 3NJXA
chains in the Genus database with same CATH superfamily
3L45A 3CZJA 5DD3L 2VLKD 3KBEA 1OGAB 3RA7L 2G0KA 3UG3A 3S34H 3W0WD 1ZA3A 5KSBF 1UB5B 3ORJA 3MV7D 2GK0A 4P07A 1AHMA 2OX5B 2E6JA 3RX5A 5BQ7A 4PGCB 1U33A 4YVUA 3V0HA 1EAOA 4U05A 3DX3A 4QIRA 5K9KB 2Y3NB 4MLIA 4QRUB 4X5QA 1MVYA 5AQ0A 3QIBA 1L6PA 4GP4B 4LBEA 3APMA 1FNLA 2OMXB 4PJBF 1F18A 5JIQA 3LRSB 2VLKB 3G5WA 2XX1A 3W0WB 4KXBA 4U1HB 2GSIA 1WFOA 3MV7B 4Y4FC 2CSPA 5E5LA 1FQ9C 4K94H 2XPGA 1ORSA 3OPZH 1KLUB 2XJLA 1W6LA 3AY4A 4WFFE 3BI9X 3HN8A 5EBLA 2OSLA 4GRMB 2MCG1 1XGUB 2GSGB 1RSYA 3BP6B 4NPKA 3WIAA 1KXTA 2IWEA 2E9IA 3JWDL 4MMXC 2R56L 4L3EA 2BIOA 2BHYA 4D0BA 3DVFA 3HR5A 5DTFA 4CU8A 1NBYB 5TF0A 5E8NA 2RB8A 2PTVA 2H26A 3VXRB 5C6TH 1ODUA 2APBA 2X4UA 2WGNB 3GIZL 3OKEA 4ZW8A 2ZKXA 2AV7A 4Q0XH 1RZJC 3MV11 4KDTC 4Z7WE 3SDYL 2ATPB 1I3GL 3TH4T 1K4DA 3QZMA 4N6QA 3QNYB 5DJAB 2ICWA 3QUGA 1DFBL 3UO1H 1FZJA 3GDBA 3RX7A 1AI1H 4ZYKB 2YD0A 2OMUA 4WU5B 1S7WA 2VAJA 4IOIA 3H55A 3PPEA 2YUXA 2FX7H 3SKJL 3S8GB 2E75C 2VDMB 2DKUA 1WZ1H 3T6VA 3F5WA 5ELIA 3E2HB 5JUEH 3SQOL 2JQAA 1UM4H 1CI5A 4M5ZH 4F8PA 4X4XB 2AK4D 5DFAA 2G3XA 4YLBA 3W57A 3X1FA 1KBBA 4CNIB 5CCGE 1XQ4A 3EJJX 5IP4A 1DSFL 1ZHBB 4AE0A 1SHWA 1S78D 3WE6A 4NIYE 3QUHA 2CRMA 4LKXA 2ZXBA 4ESKA 1KIQA 1U8KB 3A5VA 2RTTA 4Y19E 4O2EA 4G43A 1CWVA 1SJEB 2R1XA 2WXHA 1KTDB 3ASOB 3LQZA 4NSKB 1CYXA 3KYOA 3MXWL 3OF6D 4MQ7B 4U1NB 5AG8A 5F70A 1USQA 2JKXA 4K07A 2E27H 2B2XL 3GBLA 2JJSC 4JPWH 1QPXA 4PREB 2NR6A 4H1LG 4UQAA 2WAQA 2XLLA 1FE8H 5I5IA 4I0KA 4YGAB 1EO7A 1P1VA 3VFUA 1JZ2A 2J6EL 4NT6B 1BBJB 1YVLA 1LD9A 4JUTA 3WO3B 4JFZL 2CKBL 4H88H 2Y4SA 3PREA 2GUOB 4JM2A 4OJFH 1EXUB 1ASOA 1QUNB 2EXWC 2OXGB 4J8RA 3SDCD 2E86A 1FYTE 3U48A 4TXVB 1OTSD 2PR4L 3KHOA 5DA0B 4X0NA 2Z0UA 5HYQB 3H9SA 3UOAB 1SMAA 4AL8H 1SYSB 3HB3C 4Z0BH 1F3JA 2OMYB 4KITB 3NBNA 4O2FB 1E6OH 4P04A 4RESB 2CQVA 2A73A 3BKYL 4E9WA 2X1QA 4LVHC 5A2LH 4LKCA 2R0ZH 2CIIB 3EOBA 3SDCB 2XVLA 1ZVSB 2FYVA 2VN6A 4N6RA 4PFEA 4XXWC 4AXWA 5DJ0A 3MNWB 4MNGE 1PKQB 4Z3TA 5JHDA 1CD9B 4Y9EA 3FRPB 4F91B 5D70H 2XIDA 5LAXA 5F88A 2UUDH 4O02H 3UDWA 4GMTH 1JRHH 3TEXA 5IQMA 4A37A 2F53E 4RWHA 3RGVC 2XTLA 2AMUA 5GS1B 4LL9A 3ILDA 3FU7A 4XVUD 4NN6B 4NNPH 1YJDL 4WHTB 2CPUA 1PGRB 4JHUA 3QR1A 3U82B 1DO6A 2YWYA 4L37B 3HZKB 4IHBA 3BW9A 4AUYA 4NJAL 1X7QA 5K9JL 3RFZA 2C1PB 3IVKB 2EDDA 1PCSA 4M48L 4IKLA 4Q4EA 4X9HA 3NDZE 1PMYA 2WLYA 3MNZB 5EU5B 1H3GA 4LCVA 1RUQL 1TZHB 5D72H 4M00A 5EOCL 3PP3H 4GAJL 1IGMH 3AS1A 3MV8A 3WIFB 5EZLB 5IVXF 2Z65C 2CO1A 3PIQB 5HYEA 4WFEE 1KCUL 1IM9B 3QP3A 4YHNB 3SOBH 4CVXA 4PJFA 2EEBA 4CVWA 5FEBA 5J1SC 3BO8A 4XVTL 3X1GA 4M6OL 4P05A 4QHKJ 1N6VA 1MLCA 5BOZG 2H8PA 3DSNB 4JB9H 3MBWA 3TL5A 3OG4B 2GEQA 1ZOXA 3UADA 1INQB 4JCMA 4V1DA 1MELA 3U4AA 4YC2C 4APQC 5IF0A 3QB7C 3WJMB 1ROCA 2E4FA 2DWYA 2XC8A 1E5AA 3MUHL 3FB8A 1SXAA 4UI2A 4KOBA 1P4BL 1Z9NA 4JG1H 5BRQA 3FBKA 5CEYB 5BVJB 2CDGA 2WN2A 1AD9B 4ZX6A 2WLLA 3E80A 2HFFA 1GYCA 2PUQT 1L6ZA 2YBGA 2VXQA 4MCMA 4MRBA 4YXHH 4OLZH 3AG2B 4UQ2B 2HCZX 1CVSC 2WYTA 5DMYA 4V2BA 1GOHA 2VLJE 1TCRA 2WOBA 4IHOA 1KIRA 4X80H 3ALPA 3BD5A 2APVA 2WQWA 4APQB 4GG6A 1AYRA 2FB4L 3C09B 3EJRA 2F74B 5EC1B 1WO2A 4NQDA 4XMTA 2UUDK 2XTJC 2YSTA 1UGKA 4YR6A 3O0LA 3TBBA 2FATL 4GIPD 2XN9E 1G7PA 2XWXA 1SM3H 4N3TA 2NUTA 2XQBL 1UQSB 2YD7A 4WI0A 5H4ZA 3UBFA 4LE8A 5FO7A 1U3HD 4KRMB 5DUML 2OW7A 4N90D 4XMKH 4XPTH 1KFAL 5SWSA 2AV1B 4JY6A 5TGBA 4E9QA 2WPGA 3L3OB 3HIZA 3ZVVA 1S9VA 1M9SA 4F3FB 1EJOL 2B1AL 1RY7B 1S8DA 2XTJB 1QAWA 2XACC 3IDGA 4NO2B 2MMXA 4ZMOA 1JVKA 5LBSA 1UZ6E 3NSCA 4TNFA 1U3HB 2ZSWA 1DBAL 4UV7L 3QWRD 4EDWH 4WLCA 1A3ZA 3Q5TA 2C3GA 3LXAA 4LT7A 1PNCA 5DGRA 3KPOA 1K8IB 5J6SA 3QISA 4ABVA 1NUFA 4IKIA 3VGAC 3EDEA 3AQXA 4NQSA 2ORBH 1S7RB 5KS9F 5L4FA 1E43A 4I3SL 4AENB 2VQ1B 5JLZA 5L4MA 1HFUA 3GSNA 2HXAA 1NFAA 3M1OA 3N1PC 3WAJA 2K7QA 1I1AA 1A1OA 3UZVB 4X9BA 3NZHL 12E8H 4M6MH 4JRYD 2GVYA 3DDFA 4U7MA 1FLTX 3U1SH 2KPNA 3WV0A 2YQ2A 4OD1L 5ILTH 2ZWYA 3MRQA 5HY9B 4U4IA 2OYMA 4NHCH 3QYMA 2Q0ZX 1D7DA 1GR7A 2X1WL 3GXFA 5TE6H 3KBFA 3QHZH 4MD5B 2BFVL 3QXUA 3ZE2B 5C0BD 4JRYB 4FA7B 4Y4FA 1BOGA 3LRHA 3QORA 3V5HA 1J5HA 5HVHC 1XX9C 4R9HA 5IB5B 2FD6H 4YAQA 2YS4A 2ZJSL 2NQCA 3AXLB 3F64A 5CLZA 3TO2B 4OM1L 3TZVA 3HUJB 4YHPA 2A6DA 3FF8A 3TURA 2VM4A 1HC1A 1H3XA 5FFOA 4HIEB 4S2SB 3MCLH 1FL3A 1NMBL 2CLVA 3MKKA 4I89A 4QHUA 3DGCR 4Y5VC 1FRGH 4MDIB 4AVIA 3HLKA 4NI6A 4BFIA 4K7PX 3NEOA 1VFOA 1ESOA 2IOIA 1OAKH 2FT8A 4B9PA 2L0DA 1SF3A 1VZHA 4DT2A 4AJ0A 4U3SA 4YSCA 3CC1A 3PWPE 1VCAA 2EYSA 5E1HB 3N43B 4I5BB 1IGFH 3NEEA 3TXAA 4GY4A 2DQEH 1BPVA 3V9EA 2CUIA 4KDTA 4XCCH 5DZLA 2Q7YB 1P4IL 2FNWA 4L5FL 4QXUH 1AVAA 2P8LA 3LPPA 4Z7WA 1BLIA 5DJYA 3QUYC 4XMZA 1OCRB 4Y5VB 1J88A 3Q8EA 2YIHA 3BWUC 4IIQB 4PJAE 2D3JA 4RRPG 1AGDB 5AW6B 3N2JA 3FO9B 3TVMA 2E7MA 1DANT 5CS7A 5GZOA 4HHGA 1JGEB 4MA8H 3QYNA 3VI4F 3FF7A 4M6AA 5BOPA 3UPCA 3GMMA 2AXFB 3KH4A 3NRFA 4XXDB 4PS4L 1GW6A 1CFVL 2R2EB 4GW4B 2LTQB 2R0KH 2VL5B 3RA7H 1J1PH 4FXGB 4X6CE 1Q1PA 3OMIB 1ZLVH 1EV2E 2ZAHA 4HHWA 3IWVA 4JDEB 1MQKL 4I2XB 1HHGA 1OV8A 3B2VH 1KJ2H 15C8L 2JF1A 3VXOB 4FA6A 3SY6A 1L5GA 3II2A 4A63A 1WV7T 4RMRA 2PPCA 4X7FC 1P7KA 1IM3A 4EKXA 3REVB 3CN0A 3G5XA 5CJXA 5JIIA 3EJCA 3FQNB 3BSHA 2JFCA 3BSGA 4BQ6A 2ZKHL 3D18A 2ZF8A 3HHRB 5F71A 2CGRH 4GBXA 4PTUA 3LKNA 2G9HB 3UABA 2DN7A 4J3WA 3BP4B 4G7VH 4Q6IC 2VDPH 4FKHA 4PJCB 4FL4C 3G5YA 3Q3GB 1F58H 5KYXA 5I74B 1FYTA 3T3ME 5T5FA 2IPTL 4AZ8B 1O6SB 4BEIA 5D9SB 4AWJC 3S4SG 3UH8A 3KVDD 5JW5A 5F7WC 1E5CA 2P45B 4DO4A 4R4BA 1ZLWH 5HBBA 4N8PA 3OKOA 1CICA 1MAKA 4PW3A 1C5DA 3OB0H 1ILSA 4JFPA 4QOKD 4K15A 2ZCKL 3SE4C 4EI0A 3OXSB 1AC6A 4PRIB 5GJTH 1NGZB 1MUJB 1OOWA 3CFJA 3KYMA 3NJIA 4MNGA 4TVPH 5HHVL 3SDYH 3X3GH 1I3GH 4CRPA 1I1FA 1XCTB 3RGVA 4AC2A 5DYFA 1OAQH 1JGDA 1RVFL 2F53A 1F0LA 1S7SB 2CLRA 3BFOA 3BGMB 3MTRA 1TTGA 1JGUL 4IS6B 1YYML 3T3PE 5FYKE 4QOKB 3E0GA 1NGXB 3IAPA 5KYNA 4W9KC 2DIJA 5J8OA 1L0XA 2J71A 3N50A 4MB3A 4U6YA 1BECA 4R7NB 1RZKC 1ZLVK 4JNXA 4QO1B 4I77L 2X2YA 4LCWB 4L4VE 2BSED 5DVOA 1OWRM 5AKSA 3O9WC 4JO2L 3UC0H 3CVHH 2AZUA 4S0SD 5EOTA 5AVVB 3GJFB 3W56A 3KLLA 3VNZA 1AKPA 5TJWK 4JRXE 4N0UE 1TVBB 4M3JA 2B2XH 2Z7UA 3BUYB 3GMRA 4FFTA 4P4RB 1AIZA 4ODUA 1U2HA 4ZW5A 1KGCD 1Y7VA 2JJTC 2K45A 4QPEA 4CBPA 3TIEA 2F5BH 4I9WD 5IJVA 1YNLL 4G3YL 1L4IA 4FG6C 1RULH 3VYPA 3ZL1A 5EEWA 1LEIB 5KTEH 1UWYA 5GGUB 3GSQB 2QEJA 4PJXB 4R97C 3IJHA 5B38B 4LVNC 4ORGB 3HZ3A 5EO9A 3ARFD 4I9XA 5DURD 3ZE0E 2N7BA 4Z3GA 4HJ0D 2A5UA 5JOEA 4J39A 2BY2A 3RL2A 4NQVA 1YUHA 1M53A 2QQNH 2P43B 3EBGA 3MROB 2NY4C 4HH8A 4LIQH 5I76A 1LO0L 4H20H 2X6AA 1MFAH 5I30H 1XH1A 1HHHB 4OM0H 4UOJA 1ZLWK 1DBML 1MCWM 5F7MC 3U9UB 3VCLB 2JXMA 2VLJA 2RQEA 1EMTH 3OB0K 5F7BA 5MERB 1TZIA 4FKKA 5AOIA 4NCC2 5DLMH 1UOKA 1HDMA 4PMEA 1FZKA 3VFSB 1X5ZA 5DRNA 1TIUA 1DJXA 5DK2A 4D0CA 2XN9A 4M8QA 3TBVB 1PAMA 3GF8A 3PQYD 1G9NL 3MLZH 1TQVA 1G0DA 4F7PB 5ICXB 3AU1A 3MX0A 2IPUK 1YJDH 2CUMA 3D48R 3MRPB 2VXTL 4S0HA 3BUQA 4MWFB 5I1LA 2GC7C 1SGKA 2Y1YA 1NAMH 3KWWA 4NJAH 4JVUA 5JMRA 2BSTA 1EHNA 2CBTA 2JSFA 4LLYA 3UJJH 2R23A 4NIKB 1A3RL 3V4PB 1CR9L 1CXEA 4QYOA 3CFBB 1EX0A 2Z34A 3PQYB 5E9DE 1Q90A 4A2LA 3ME0B 4LMQI 4DH2A 3LNEA 3PFQA 2HFEA 3GRWA 3K7UA 4BH7A 2WSDA 4N2DA 2J5LB 1BVOA 2CIKA 4G1MB 4NO0D 3VXSD 4Z8FL 3F6JA 1S3RA 1FHNA 1N0XL 3V0AC 3PGFL 5DJ2A 2PABA 3DUUA 2NY2C 4WW1A 7TAAA 3HA0A 4KXDA 4X7DC 4OJCA 2XETA 5JXED 3HHSA 3MACL 2Q3ZA 1E8XA 1S5HA 3D85A 4CBZA 1NGYA 2IWKA 1J8SA 3IT8D 4NO0B 3VXSB 2YAQA 1BQLH 3CHQA 3CMGA 3RUGB 1WWWX 4FEIA 3L3KA 3V6ZB 1BBDL 1HSAA 4HS6B 1W6WA 4YDLB 3DX0A 3DXAD 3JUZA 4JJHA 4CC0A 3GXMA 5F1IB 3WTUA 3CVIL 1HEZB 4XHJC 1AGFB 3PNRB 3QXTA 2UZYA 2P48B 3QJRB 4KK9C 2YPVL 4WEBL 1XF2B 3BH9B 3TYFB 3E3QE 3ZR5A 2H1PH 5CJOH 2DMKA 3W82A 4W4OA 1M71B 3MRMA 4P99A 4ACTA 5IW6B 2VXSH 3B3IA 1VEPA 3DXAB 4ZMNA 5D2NC 4NC2B 1B0GA 5FGSA 4JFQB 4OD3H 4PWJA 4FZEH 3SYOA 4ABQA 1N26A 2J73A 5FS5A 4UNVA 1N67A 3TU6A 5L9DL 1LE9B 1I7RA 3V0IA 4YBLB 3M1BA 1WFTA 1AQKH 2JCCB 1FFOB 3UJTH 3O6MH 2AABL 4P2QE 3TT3H 2WCSA 5IR1B 2WUBL 1ZSHA 3RVTD 3BDXA 2G4GA 2CBPA 5ID0B 1UXSA 5B22A 4M5YL 1X6LA 1JZJA 1DJSA 3U9PL 3U7WH 4F8TA 5KVDE 5BJTA 1J10A 4KMTL 1LO5B 4HXBH 4H44C 4UOW0 5ESQB 4JHVA 5CIPH 3PWPA 4J12A 1JI2A 4W9IC 2D7NA 4CVZA 1KMGA 3K5RA 3O0RH 4UV7H 5GZND 3QG6B 4XP1L 1R47A 4K55A 4JFFD 4X6DF 5DT1L 2ZXCA 2Q8AL 3QUYA 4M5TA 2RFXA 3FMGL 3PS6A 5CLTA 1WITA 4JLRB 1ITCA 5DK0A 3VQLA 4MDRA 3FQYA 4PRDB 5JOFA 3K91A 5J11C 3AREA 1ZHNB 2YD2A 2FZ3A 2HT2D 1NSNL 4PJAA 3GIVA 1OAZL 3T0BA 3STLB 5AVUB 5D2LE 5E4EB 3EYQD 4GSDH 5GQBA 4POYA 4G42B 2H32A 1FG2B 1TQSA 4JFFB 1PF3A 1A21A 1IGCH 2OMVA 5HHPA 4E9LA 2WXIA 3TO4C 5EORH 4RDQF 3EO9L 4X6CA 4W9DC 1RZ7L 1EHAA 2BRRL 3CZSA 4OJEH 1AS8A 5BRZD 3RIKA 1SXBA 4L1TA 5AYTA 2QLVB 1MOEA 3ABMB 1X44A 3T8MA 2AQQA 5BS0D 3VG0L 1UJTA 4ZO6A 4DJMA 2QHRH 3WENA 2VDNH 2IFFL 2X40A 2BFVH 4PU2A 2HG5A 5FOBB 1NCWH 2J8OA 4RDBA 4U1SB 4ZOBA 1QPKA 3G6DL 1ZIBA 1LQSR 5E5MA 3L81A 1TVHB 3GUTB 4PRHE 1B3IA 3S5LA 3TO4B 1X5XA 2QTEA 3VA6A 5BS0B 4OM1H 4HKBA 4AQOA 1PLGH 1H9DA 4JRLA 3JTSB 3MLRL 3PL6D 1K4CA 3UP1A 3KPRD 2DWDB 4O9HL 4MS8D 1BVLB 2Z8RA 1P53A 4MA3B 1JWSB 1N18A 4MXWL 4EIGB 4UQBA 3DJRA 3AB0B 1OPGL 2Y7NA 5I71B 2I07A 1NFDF 5DFVC 1ZSDA 4NAQA 1JZ7A 1MJ8L 2XQ0A 3PL6B 1KZQA 5ANME 1T22B 1MZZA 3KPRB 3LCYA 5E2VL 3MYJA 1TENA 2J4WL 3P73A 3D5OF 1FO0H 1R24A 1X9QA 1MREL 3SGDH 1BQSA 3A67L 2C7UA 2X6VA 1NWOA 4KJYB 2XXCB 4L5FH 5HI4D 4NN5B 3RE0A 3KS0H 1LE5A 3BQUA 5DQ9B 4ZSOE 4PWFA 4ZMWA 1N64H 3L9EA 5KG9B 4IU2A 1R34A 2AEOA 4B27A 1FI8C 1JJUA 2DQUL 5E9AA 4JCLA 5J9PA 3MMEA 2I25N 1QSEB 2Z35A 5DO2C 3SPVB 3O41B 5EIIG 1IBBA 5JW4Q 3MJ9A 1K8DB 3WIHL 1QQDB 2FNBA 5IMOB 2O5ZL 1IFGA 3O9WA 4LAJH 2H3NB 4L4VA 4YFDB 5GIRB 4G6KH 1Z66A 1PD6A 2G60L 5CZKA 1L9MA 3ULVE 2EIKB 3ZHKA 4FCAA 2A74C 3LEVH 4BA8A 1F13A 2CCWA 5G4MA 4YK4C 5FFGA 1FL5A 2B59B 1NBZA 2EDJA 3VFTB 4N0UA 1UJ3C 3DTDA 5E6YA 4P48A 3WD5H 4GAFB 4XC3H 2FX8L 3AT0A 4K9JA 3VFVB 4FF9A 2DQHL 4YE4L 4PB9L 3FN3A 1YEHH 5CJ5A 3I2CL 1F6FB 4NZTH 3QZOA 3TWCH 3VA2C 1X9UA 1S7TA 1T5WA 2LT9A 5AVZB 3LH8A 3TOPA 4I7ZC 1IO4C 1CVRA 5E0QA 1T21A 2X2UA 3PAUA 4BQ9A 2BIHA 3FOMA 1DQML 2A74B 1BGXH 5HJ3B 5KVFH 1CG9A 1LP9F 3K0YA 4GRWB 4BSWB 1NBCA 2YMXH 4X4MA 1EFXA 1KYUA 5ISZA 5IHUH 2VR6A 5EPMB 3HG1E 3MO1B 4HH9B 3VGDA 1FHGA 5GGTA 4MX7A 5E4IA 5EC2B 2X38A 1ETJA 5FW8A 5MENE 5IV2B 4KX7A 4OZHA 2FSEA 1GSMA 3MRNB 2EIDA 3ARPA 2XICA 2G5BB 4CGTA 4ONFL 3WI9A 4MB4A 1FFRA 3RAJH 3NFPB 5F2FA 3WMSA 2I5YL 2X9ZA 1CTOA 1F97A 3CFKB 3AROA 3QHFH 4GFXA 4Z7VB 4LAQL 1SMOA 4KROC 2CRYA 1RCYA 1UM5L 2X09A 5D1XC 1TTUA 2GHZA 3V8CA 5C0AE 5E8DL 5C7XL 5L6YL 3Q48A 1KENL 4U1MA 1YYMH 4XO5A 5GRJH 1IBGL 1ZHKA 5C3LD 2C3WA 2XBZA 4X8JB 2DQGL 1TQUA 1AHWB 4X5XB 4AYDC 5BOJA 4HHAB 3CLEL 4NYLB 4OFKA 3L3HA 2DLFL 4PWGA 5EIVA 2QVFB 5BUAA 2AAVA 1RUML 1KT2B 2V2WA 4R7LA 4UIMB 4A04A 5F93C 2YAFA 3V0EA 4DK5A 4KK6C 2GK0B 2V5YA 4BCYA 3FJTA 5E9DA 5GRWA 3LQAL 4JO2H 4KROB 5AVRB 5EIQA 1CFBA 2WXOA 1MW2A 1PL3A 3BSZH 3CZKA 4GKSA 5SWQA 4E2OA 2VC2H 5JXAL 2YQGA 4IU3A 2Y23A 2XKNB 2CO6B 3HG2A 4QNPF 3DHMA 3BH4A 2AMGA 5BMFH 3VXQA 4MJ5B 4HEMA 4APXA 2YKLL 4LEEA 3RPIB 2QSCL 5ALBL 4Q52A 4GQPH 5JHLA 1RP8A 1ORSB 3CFUA 1KOAA 3GM8A 5AAPA 4KAQL 2BW5A 3VQ2C 3QDHA 1M6OA 3DHPA 1OSPL 2IPUG 3QIWC 1R5VA 5IEHB 3KEDA 2Y5QA 1Y18A 4IM8A 1ZRUA 1Z32X 2DMHA 1Y1UA 2EE3A 2XSKA 1ZS2A 3K2KA 5F7DA 1HXKA 4R7DA 1FGVL 2FECI 1Q72H 1T7WA 1NCNA 3UTQB 5DTFB 5H37A 1MAJA 1KCBA 4G80A 2CCLA 1WBYB 2W0LA 3X1BA 2XWRA 1XFPA 2E6QA 4FFZL 4FNRA 3QNFA 4K23H 3SO5A 3S88L 3FT2B 4LCIH 4ZZFA 3U2IA 3SCMC 1VGKA 4LMQE 4UNUA 4GPVA 4KTGA 4WWPA 2P47B 3KGRA 4GXUM 1WA2X 3GSXB 2GC4C 1ADQA 2WXNA 2AQPA 3OMZA 2ICWB 4PRAB 4AQEA 2WBJC 4EN3C 2Y22A 3QQ4A 2OMUB 2WXRA 1EEQA 1DVXA 3MAWA 2HTLD 3RDTD 4MD0B 4R96B 4A2FA 1FSKC 4P2QA 3ZQWA 1JPGB 3QJZA 8FABA 3BKCH 4M8RA 5LBSL 5C2UB 2EIMB 3OC8A 5I18L 3VTTA 4BZYA 3FT3A 4IRSD 5K39A 5TQ2L 1ZT4B 3SCMB 2NR6D 3QEUA 1A3RH 1CR9H 2VABB 2ZD0A 4HCRA 4I1RA 3WE6B 1QBAA 1N6UA 4PJ7F 2X70A 4PG9A 2VO5A 1NCCL 3GK8L 1CB4A 3RDTB 4WNSA 2N7SA 2HVJB 4WK0B 5IBTL 1X9RA 4Z78B 2NY6D 3GSNL 3PFUA 3WSQL 4JM2D 1GGCH 3AMKA 2V6HA 2EXTA 4UV4H 2DV6A 4IRSB 5I15L 1C08A 1FSKB 3PHOB 4ZAKA 3P4MA 1NCUA 3IEAA 1WZLA 3SDAC 1ZWIB 2EDYA 2PXYB 4Z76A 3GMPB 5F8RC 1NIDA 3VFUB 5IQOA 4OBRA 3C5JB 3HZVA 4ODWB 3BP5A 5D2LA 2VISA 1E42A 1WF5A 2NY6B 4PB0H 4B95C 1E9OB 1SEQH 3L2NA 3NIFE 5BO1H 3ZQ9A 3KXFE 4JUSA 4XMUA 2A99A 2XWBA 3A6OA 1IJ9A 3CSBA 1CDUA 4NRZA 2VERA 4M5SA 2EKSA 2LU3A 3IU4L 4XCEA 3VW3L 2I9LB 4HIJB 4G8FA 4UTBL 4RQQA 3RNKA 4WZ9A 2B5IB 1XGQB 3OD3A 3VI3A 1IGJA 4YWGH 1HQ4B 4LKCB 3CVCA 2H1LM 5AVQB 3ZE1B 3VD5A 2D03L 4RVBA 2QZQA 4AXWB 3EH2A 1V3MA 3F65A 2FQFA 5DJ0B 5HGAA 1T1YA 3WO4C 1ZDQA 2XZAH 1QPPA 3L1OH 1MIML 5IQ9A 1BG1A 1SY6A 3VQ1C 1DN0A 2O5YH 3MLTA 4YXKL 4DAGL 2MNWA 5KVGH 4G9FE 4OLXL 3VJ6B 3DKHA 1C1EL 3BMWA 1SNRA 3L5XH 1TEYA 3FU7B 3MV8D 5HYSG 3AT9A 5IBUG 3RWJA 5A2IH 2VAAB 4P9HH 1BAFH 5I1JL 3DO7A 4OB5L 2WUBH 3NEXA 4U4BA 5I17A 1XF4B 4HIPA 2M2DA 1L9TA 4P46C 5EA0H 4M5YH 4NZRH 4CADB 4M02A 1UGNA 4X9GA 4DZBA 3WO4B 1U8QA 2EH7L 5F96H 3QUZC 2XZCH 4V1DD 2R51A 2E5EA 4MCZA 3BAEL 3VH8A 3FO1A 5F0MB 4BZ1A 4A39A 4YX2H 4JZNA 4PRPD 2Q8AH 5DT1H 5HHXH 1DL7L 4OZIB 3FMGH 4X5LA 1FPTL 4CVXB 3IN2A 4RDQG 5IOPA 2J3SA 5CINH 1CL7I 1BF2A 1NIBA 4ZSOA 1R3HA 1AP2A 2IGFL 2XNAB 3LKPA 4JFEE 3A23A 1EERB 5HYFA 5IF0B 5AB9A 3TPUB 1WWCA 3BAYA 5I1AA 1BMZA 4PRPB 4ZK8A 2HZHA 1HXYA 5MP6H 1JF6A 3EDKA 5A3IC 1KDJA 1DUZB 1H3WM 2YC1B 1BJ1J 4FQQA 1MLBA 3EO9H 2ITCA 3KEHA 4NQDD 2H7WA 3ROOA 3B2MA 3Q8AA 5H94A 3QXDA 4FYRA 1JNNH 1ANUA 4M7LT 3OKMA 2VN5A 1YAZA 3SKOB 1UJ3A 1A6TB 1BSIA 2VJXA 3KYKH 3A24A 1QRND 3NCYS 4XOEA 4WF7A 5SWSD 5I8EA 5EEZA 3WDJA 3GXIA 2AJSH 2OR9H 2DEYX 4CN6A 3VFNB 1E3FA 3SZKC 3HE6A 4YR6B 3NQIA 1ACYL 3VRLF 4YHLH 1ZXKA 1Z6JT 3D39E 1ORQB 1K5WA 4FQCL 5D7IA 4F15B 3GXTA 4I48A 3H6AA 5A1AA 2NUTB 5KYYA 2V3DA 3AQDA 2V2XA 4V2CB 1KLFB 3NCFB 4YHKH 1IE4A 4I0CC 1VACB 1U8OA 4FCHA 2X5PA 1ET7A 1QRNB 4WFGE 5HGDB 4E42A 3H7BA 1SMDA 1JUFA 1YSOA 1XT5A 4FI8A 5TGBB 5IGXH 3HG1A 3ILPB 5D93B 5DJDA 3ZLQC 1KTRL 1NZRA 1S9VB 1TQBC 1INDL 1F56A 1OPGH 2HFGL 2ICES 3IFNL 3ALWA 5MENA 2E4TA 4AEIH 4FOMA 2ADFH 4OF8A 4K8RH 3P30H 4KTEH 4J23A 1DQKA 3GI8H 3ZK0A 2PO6A 3PG2A 2GT9B 1IZKA 3L2LA 3BESR 4XXCA 5ACZB 1L6XA 2G2RB 1TO5A 2V37A 3HC3L 1CLYL 2MNUA 3PXJA 4N0YH 3EJUA 1XXFC 5EF1A 2ICEC 5K5YA 2J1WA 1QLEH 3SDXE 5D1XA 1YRKA 5IKCB 2PP8A 3DSFL 3FCUB 1HCYA 1UD2A 1SLXA 2WQRA 2A9AA 5AW9B 2YWZA 2RH0A 5C0AA 5EU3B 1MRDL 4JKLA 2XHNA 3WKNA 2JLPA 2YGQA 2I27N 4P2OC 3HI6L 4Z7UF 2X28A 5FCUL 3GLAA 1RJYA 2P8PA 4UTCA 3VRIA 3QORD 3L5WB 4P23C 4RZKA 4X0KA 2C7FA 4BH8B 4U1LA 3HG5A 1QTPA 3EJYC 4NAMA 4HGKC 4BXSV 4OZGF 3KMDA 3TZVD 2R83A 3LH2L 4GKLA 5AVXB 2QSTA 4MA1C 4UTAL 2LVEA 3GSVA 4JZOB 1PZBA 1N59A 1QTSA 1B0IA 3S2CA 1JHLL 4Y5XA 1NPUA 3L4CA 3T0EE 1BOGB 2WVSA 4JFXB 5DHMC 3QORB 4OV6F 2ADIB 4YE4H 5IT2H 4MFHA 4ZX3A 5ICUA 5JW4R 2EIJB 2V17L 4EBQL 4AJVA 3I6KA 3QNZA 3KNBB 3HAEB 4NP4H 2QADC 2ZXDA 1JHKL 1T7VA 4KRPD 4ZUTB 3TZVB 4JKPH 4YHPB 3OKDA 4X50A 5AG9A 2NXYD 1BVKA 5JZ7C 2Z9TA 3CTTA 1IU1A 3ZKSD 1S9YA 2X4PB 4F93B 4LGRB 4F57H 2Q7AA 3CXHK 2CLVB 2DLHA 1BZ8A 4Q89A 1S9XA 2NY0D 2WN3A 3N5AA 5EFIB 4DGYH 4U6XB 5DDHB 1HK6A 1B4JH 3IFPA 4ZD3H 4PBDA 2ENQA 5C97A 4OCXH 2W65A 3F6IA 4KJPD 4KRPB 1D5ZA 1HHKB 4QJ3B 4MCNA 5CJQL 5HI5D 3TVMD 1A6ZA 2EYSB 1K3ZA 3S3JA 3MLVH 1AR1C 1RJZA 2QADB 3BIKA 4HWBL 2V7NA 2I5YH 4N2BA 5C0GA 5GZOD 3ZSSA 4L3CB 2OZNB 5HD8D 5KVMC 5EUKA 1ES0B 4WQOA 3HC2A 1T5XB 2P8LB 2C9VA 4EN3A 2DPKA 4EUPA 4Z7WB 1BG9A 3MRRB 5CKGA 1EEUA 2J88L 3GTNA 1UM5H 4M1GL 2UWEB 4W81A 3W2DL 3JYCA 1AH1A 2PWEA 3CSGA 4PJ8A 2ARJB 4Y19D 3DX7B 2P7TA 3X12A 1RIUL 4OCRH 2DWEB 4PCKA 5EF3A 2IALB 3GMMB 2YA2A 1OXYA 2Z7ZA 1QI4A 3GMQB 3L3JA 3GRWL 4MD4A 1YN7B 1A7PL 3BPCA 4NBXB 3O3UN 4H25B 1WZKA 2VDKH 4YLQT 3MLYL 1TMQA 4HKXA 4JM2F 1DBJL 3E1ZA 1DEDA 1MHPH 1E27A 5LBVA 4HXAL 1QFWL 3NACH 5F0JB 4Y19B 5TPWL 1IUZA 2BVEA 2OMTA 3JWOC 1J0ZA 2GITA 4GBXD 5L88H 3EFDL 1TLMA 2VDOL 4JG9A 4LXFA 5JXAH 3A4EA 2V5TA 1JD7A 3SDAA 5J3HD 1P7KB 5FHBH 5I26A 5T3ZE 2DW5A 5EUOE 1FYTD 4POZD 4JFUA 5E8OB 1RU9H 4KI5F 3OZKA 4AV4A 1UT2A 3TJEH 4N8VA 1MW1A 3B1UA 4U0RC 1GGIL 2VXQH 2PCFB 2VDLL 1W91A 1QFWM 4GBXB 2ZUQC 3OAZH 1CICD 2FWUA 4NWUH 1JGVH 5HYIA 1CF1A 3JWNC 4ZFFB 1QR1B 3KXFA 3PWNB 3ELQA 1ND0B 2Q6WB 3WNJA 1FYTB 3MUY1 4Q14A 3S7GA 3IMWA 4PLNC 1OZUA 1RUAH 3UYPB 3HTLX 3NFNA 1DCEA 4XP6H 4UM9B 4HCGA 5C0CE 3VWKC 2F53D 3PHSA 5HHME 4EVNA 2HKHL 1IAOA 4DIXA 4WO4A 3SKMB 3NCYP 4MZ3A 1A6UH 4HW6A 4JQXA 4LSRL 1OTTC 1E4KC 2DF3A 1Z5LA 2ZUQB 1JRHI 2AP2A 1E5UI 3GQFA 2VLME 3N91A 4QRSA 4Z7NB 4HQQL 4GXFA 1I7ZA 4ZUVA 4QRBA 1HOEA 1JGDB 3MCKA 4Y7MA 2F53B 4G9FA 4PJFF 2LU4A 4GXVL 1ID2A 1S7UA 1XIWC 1THCA 4L9DA 4G83A 1D7BA 3H2QA 3PP4H 3VWJD 4Y0GA 3PWJA 3R0MA 5E6IA 3TBSB 1HE7A 4X7EC 5DGQA 4WFED 2ADGB 1YLBB 4PJEA 3TA3C 4BINA 4HOXA 4Z7OF 5TQ2H 4YPGB 4WI7A 3DARA 2W07A 2B0SL 2KYIA 1MFMA 2BS71 4X9YA 5JQHC 1S3KH 1RZ8B 1HIML 1NCCH 2ENSA 4LHUA 1CBVH 1PY0A 4MMYB 1TTFA 3VWJB 1U9KA 3MJ7B 1KWGA 1HINL 5FDWA 1NM4A 1OSZA 4XMPL 1XIWB 1F41A 3GMNB 4JO1L 4XNYH 3NA9L 3A21A 4HPYH 4DK3A 1ZANL 4BIKA 3TA3B 4GG6F 4UYQA 2WZPA 4MJ6A 3W39A 4H40A 1EAQA 4JFEA 4C4KT 1IGTB 4GW1A 3OAZK 1T20A 2VLRE 2VLJD 5DEJA 4JPKH 3TCLA 3VFPB 2VR4A 4IRJA 4LPCA 5KBPA 3FFDB 5EO9B 1UA3A 4LVEA 2QVTA 4UAOC 4O2CA 3RL2B 3SYAA 4BFRA 4HFWA 1D9KD 3MRFA 3T6XA 4GSQA 1JGLH 2X87A 2R29A 1FVDB 3T08A 4RGMC 1NMAL 1EEZB 2XN9D 2JXMB 3JTBA 4GQ9L 4DPAX 4XWGL 2EUVA 1RD6A 1I4FA 4HJSA 1XL4A 2IBZY 1BZOA 2C9XA 4YJZL 1O6TA 4Y88A 2E7CA 4ZMXA 2AI0H 1ROWA 1F3DH 3WFHA 3UTPE 1D9KB 5DUBB 1DZ0A 5EZOH 1MIMH 2YQ3A 5F7LB 2NY3D 2AJVL 1GH7A 2A1WH 2FBRA 2QL1A 3FQXA 1ASPA 5BV7L 4YXKH 3D39A 5DK2B 3OAUL 4D0CB 3C9NA 3Q0HA 1IARB 2UVEA 2RJMA 3ARDD 3CZFB 3Q1SL 5DZ9A 1HKFA 1PZSA 3SE9H 5B8CB 4AY0A 3V95A 3H4HA 4CJ0A 1S7XA 1J8HB 5F9JA 1T1WB 4OV5A 3KWWB 4PV1C 2BSTB 3PHQA 4GAYB 5F1NA 4NKMA 5JTWA 4KZEL 3WEXB 1RZJH 3FHAA 4LPXA 1N4XL 4CC4A 4QYOB 3C60C 4LF3A 4DF9A 2CDFA 3ARDB 1PSKH 4EF3A 4DH2B 1GZHA 2YSSA 2Z93B 3IS0X 4PGDA 4IBQA 5HDLA 1L3WA 3VX1A 3D85D 1MZYA 5MHSE 4J8QA 1SDDA 3DIFA 2ICEA 3BLBA 32C2A 1OAYL 3MKGA 1GZQB 4PV9B 3D4YA 5FYKL 5DJ2B 4HKZA 3SDXA 5E94A 1OANA 4WW1B 3DVIA 1A66A 4ZFGH 3RZCD 4D8OA 3UYRL 3AS2A 3CXFA 3MJ9L 2DQCH 2Y7OA 2DJMA 1NLBL 4NP9A 4JHWH 5E08H 3IDMB 1T3FA 4P2OA 3VSVA 4A2DA 3C60B 3OXRA 2ZZUT 2FWOB 3S96A 1CLCA 1EEYB 4RWYH 1BQHB 2EDMA 4UQCA 1NFKA 4P57B 4PJBE 4L23A 4FYQA 4FHJA 1BZQK 1MAML 4A7GA 1M7IB 1INEH 4P23A 2FYYB 1SN0A 2VDLB 3CFNA 5I75B 3RZCB 1PDKA 2DLTA 4NN7C 3P11L 2ETWA 1ZTXE 2E3VA 1CDIA 1UVQA 1PKOA 3EXJA 4A7QA 2K9UA 2QV2A 3WIIH 1N8ZA 3CLFH 5C86A 4B3EA 3MRMB 3LRLA 3PV6B 1GTNA 3T0EA 4H1LA 2YFOA 3E8UH 5I9QC 5L8KB 1DVQA 5DYOB 1UURA 3G04B 4AYFB 3CAFA 4FQLH 5ABDE 2WLNA 1J1OL 1P1ZA 5T5FH 1M57B 2R39A 4X4KA 5ICYB 3PJNA 3MRBA 3W1ZA 3PWPD 3EFOB 4DNLA 1DAVA 1U8HA 1UEYA 3HI5H 3IPFA 3QA3B 1VZGA 1NIEA 3ABZA 5DMKA 4H8VA 1JPFA 3QUYD 3O2DL 5T5NF 3TV8A 3MFFA 2BSSA 4JPSA 4ZXBA 3VFOB 3IFNH 3NQKA 5M94B 3ARED 2WOYA 5KOMC 2VT0A 1SXNA 4N2HA 3NZSA 3PWPB 2FO8A 3FCSB 3KLHC 2V33A 5E0FA 3ILQC 5D7JD 1FH2A 3UCQA 3VXME 1FAIL 5J6HA 2H2SC 1TJGL 2YLHA 3B56A 3F7VB 3QZWA 4DP6X 2Y69B 1YYLH 2X4TB 4KPHH 5ESAA 5DK0B 3BDBA 3V0WL 2QQKH 1BXXA 3VFRA 1YEEH 2YAHA 5FO8A 4ZW7A 4QKXB 5IW3A 4PJAB 4PH8A 2VN4A 3GIVB 2LQRA 2LVCA 2PWHA 1YCSA 2H0JA 4PGBA 5D7JB 4DO6A 5E4AA 5FUZL 2ZOKA 4ANUA 1DDTA 3MRKA 5I6XB 4FI7A 4RZCA 5AL0A 1J5OH 4XMVA 5DUPH 1QFHA 3LZOA 3H3KA 3L4WA 2OMVB 2YAMA 1U95B 3OZLA 2YR3A 4NLHA 1IAIH 4P5MA 3V0VB 3SYPA 3FB5A 3LZNA 5CN3A 1AXSB 3E6FB 3GLDA 2K4AA 5E2UL 4F1ZA 2F7PA 1YEDB 1YUKB 5EU7C 4D2NA 1S5IH 5E6UB 3F6LA 3PDOA 5I1DA 2B4CC 2E56A 5I24A 3WEMA 4BSJA 5JHLL 2Y7QA 4JQIA 1WTLA 4H8HA 4L1BA 1D5XA 4DN3H 5EUOA 3SE3C 1Q4NX 5C0EA 4ZS7L 2F1EA 3BZ4B 5CILH 1I1CA 5DJ8A 4TNVK 1KCSL 3P77A 1H6UA 2WAHA 2YPLA 3EYUL 2KERA 5BNXD 2XVKA 4PCTA 2OXHA 2XA8L 5MEOA 4OCMC 1I3RB 3OQ3B 2J44A 2F58L 3HNTH 4HKBB 4L3AA 1X5GA 2WTRA 1FBIL 1IVTA 2QKIB 4FNQA 2A0LC 2AJXH 1ZA6B 1FLRL 3CIAA 3L16A 5BV7B 4D9LL 2CPCA 3GMOA 4OZ4B 1QEXA 1SUJA 1DQDL 2YKKA 3T3MB 2JQZA 3S3CB 2ZP9A 4LSPL 4NKDA 3VWKA 3BQUD 3TT1H 1BXVA 2I07B 1DJYA 1E0OB 4JJ5A 5F89A 5C0CA 1ADQL 3AJ7A 2ZX7A 3HPLA 4C55A 5KUKA 1KYOJ 1JVLA 5FYKD 1QBLH 2OMWB 4FMVA 2IH8A 3QDJE 5AZ2H 2HN7B 3L17A 4Z3JA 2AQSA 5EO1A 5C9KA 3Q06A 2ERJB 1FZMB 5LO7A 3WY4A 4X6FA 3ECVA 4L4VD 3W2DH 2H9GA 2KZBA 4X98A 4WEUD 5GGQH 2RIKA 5IVXE 2VDQL 3LDBC 4HCRL 5KVDL 5GRUH 2W38A 1JDDA 2EDRA 1MPAL 4FS0A 1ZLEA 4JRXD 4XRCA 3S37L 3OC5A 1EJFA 3D4CA 5CCHE 3H9HA 2ZCLH 3P9MA 3VXPB 3GRWH 1RIVH 4ENED 2H45A 5HI3D 3T4YA 1HQRB 1JFQL 1X5IA 4IKNA 4PEEA 4RNRA 5TPWH 4F8OA 2HH0L 4X8CA 3WJJA 1T2XA 2Z4TA 3KGSA 4G6ML 5AWNL 4JRXB 5DD6A 3WUWG 2VDOH 4DP1X 3QUMA 3BDYH 2G5UA 2MQGA 1CF8L 2RQ8A 4UBDD 2NY4D 3TBTB 1B6UA 1BLNA 1DJIA 2VRAA 3S0PA 4PGEA 1FNGA 3T0VA 4DFIA 1A4CA 3AAZB 4J6RH 5IEKB 1OTUD 3K2MC 4R26H 4O58L 5IREA 4G7QB 4MJIA 4F58H 2R4SL 1GGIH 5BVPH 1S7TB 1BYOA 3B9EA 3U46B 5HDOA 1F5WA 3EBIA 1JD9A 2VLRA 5DS2A 1DEEA 4IBTA 4LOEA 5GRVK 1T21B 1UH4A 1PFOA 4IRZL 3A4AA 4WU7B 5T1DL 3FHEA 2DYPA 4TQ8A 4IDJL 5F44A 4N68A 1MF2L 3MRLA 4ZO9A 1R0AL 2RALA 3BE1L 4Y2DA 4M4PA 4M62L 4U2ZA 1KEMH 2UX7A 4DW2L 1MI5E 2E7DA 3FUIA 4P5KB 5D5MA 5ADOH 3H3PH 4Z3HA 1RIHL 4HUUA 4G6FB 3LKSB 2O61A 1XR9A 1QI5A 3GTTA 1BQRA 1CGYA 4BCXA 3P4NA 4LSUH 5LGHL 3WFDL 2ITFA 4DZ8A 4RA3A 3FU8A 3T2NH 1Q0XH 5I8OL 1G9EA 4WUKL 4HQQH 4NB7A 1LDPL 3PDGA 1U4EA 4ZW3A 1KN4L 4KKLD 1JGIA 4F1SA 5E9DD 4NQTA 1WEJL 3GBNL 4GXVH 2R69A 3SN6N 4B41A 4Q7DA 2ZUSA 1CGSL 2L7UA 1P9MC 1PY4A 4ZTPH 2Y3AA 3D0AA 1B4RA 6PCYA 2QT6A 2YAOA 4WI3A 4HBCH 4YIQA 1SBSL 2HVKA 3FTYA 5KS9E 4IGBA 4BZ1L 2XG4B 1HCVA 4TUOA 3BZEB 1SHMA 1MXGA 2UY7B 1PG7W 1U93B 4DP8X 4QAMB 4LEBA 4HK0A 3A0OA 43CAA 3SYQA 3V4UL 2VITB 3QYCA 5TE4L 5AUMA 1NLDL 2BXYA 5DD1H 4HAFA 3BWZA 4JHAL 5A6MA 4YHIB 3C6SA 5J1AB 3OZ9L 3QQ9C 3WXVL 3DUHA 5LGJA 5HHOE 3NH7H 2H32H 1LWRA 3O3EB 1KCVL 4APXB 3KWTA 3F00A 5KSAA 4FERA 5GJSH 1YO4A 3RVUC 3U2SA 4UDUB 3N06B 4RRPA 3C5XA 2IH3B 3LVEA 3H1ZA 2ZXQA 3N43F 5F97E 3ULVL 3ULUC 3C2AH 4M1CC 4NRXB 1R5VB 4L2LA 4P5TA 4AVKA 4BUQA 5I1KL 1N5AB 5F7DB 3O2WH 3F7QA 4R7DB 3UBXG 2GTZA 3HNSH 4OCLC 3INUL 3G9VA 5TK2A 3WE1A 2JV6A 4HGWA 3VDBA 2VSMB 1NMAH 4FHBD 3HCVA 4RAUA 4Q6YA 1UFGA 1MRFH 2C9QA 4K9EL 3GGWB 2GPZA 3VD9A 2BSBA 2MTAA 4M61A 4Y4KC 2MHAA 5IB3A 2D7TL 4P2QD 3EYFB 4LNRA 4WW2C 1MIEL 3T0WA 3QQ3B 4A2MA 4BWWA 4PGZA 3X11A 4M1DL 4LO9A 2VYRE 2Q2LA 4ETYA 4NUGL 4OCWL 4NENB 4BGDA 3K72B 3RWEB 3Q1SH 4XHQA 5LWYH 4QAWA 4HD5A 1GKOA 3BWUF 2VERN 3UTSE 3Q2CA 3DOHA 3V10A 3IGUA 4AIOA 1IC5L 1ZT7B 4P2QB 8FABB 3AWEA 3P4OA 2EVIA 5K39B 4KZEH 2BWQA 4WW2B 4ZAKD 2Q1EA 2VDQB 4EOWL 4DKFL 4K5MA 3S4SA 5SV3A 3FYIB 4YXLH 1JMZA 3QQXA 4QLWA 1ZIAA 1M1XA 1MWAL 2ZWSA 2KLTA 3U36A 1AE6H 3FTWA 3QNXB 1IEAA 4R4NC 3WKML 4HDIB 1H6FA 3QQDA 5DJCA 3RL1A 1IGIH 3VXMA 3T8XB 4B5EA 4X6CF 4GLRI 4HV8B 4EE2A 3D9AH 1ZS8A 5C6WH 4HPOH 5E7FA 5JW4M 4YEFA 5C2BL 5F9WC 1XGYL 3ZMNA 1J5IA 5E1IA 3TASA 1RZKH 3DJZA 2R8SL 3MJ9H 3Q6GH 1UA6L 3PPSA 3GBML 2EAEA 3OLIA 5A40E 3IBEA 1PG7H 5FLUA 5I16A 4GO6B 1E4XI 3SBQA 25C8H 3ML9A 1YEKL 4K7PY 3IJSA 4YSRA 1TEGA 2WVUA 2KZ1B 3PF2A 3BP7A 4RX4A 1RURL 4NRZB 1S46A 4PWEA 1U58A 2EKSB 2DTML 5FX3A 1F86A 3EYOB 1JK9B 1UG9A 1I31A 1V7NH 3D6GA 1TFHA 2CA3A 4G8FB 4PRHD 4R0LA 5I5JA 4F80A 2NSQA 1IC1A 1QASA 3WHE0 1YMME 4OF7A 2CR6A 2A6KA 2KLSA 3GSOB 1VA9A 2EE9A 4CILA 3Q44A 4TLUA 2YD8A 1HNFA 2EDBA 1LO2L 2XI9A 4QHNA 2BP0B 3MVSA 4F2FA 5T5NG 1KBWA 4FQHA 1KJ3H 2FGZA 2IAND 5CMAB 3F58L 3RKDD 3I6GA 1GTFA 4NKOA 3WOVA 1SOSA 1GC1L 2QGCA 3G5ZA 5I5MA 1PLBA 5JQ6L 4ZTOL 1DN0B 2DQJH 2QPEB 4PRHB 1OCZB 1DLFH 2KPWA 1VFMA 2BVYA 4YHYC 4ZG1A 2Z31D 5KVEH 5GGTH 4XMXA 1U3JA 5ADOL 3O3AA 3RWJB 2W81C 1PFCA 3B9DA 3DJ9A 4HSCX 4XT1C 3DO7B 4OGYH 4NQXB 3TFBA 1UT9A 3G08A 2IANB 3GEFA 3U4EA 4S1SH 1G7HA 1G6VK 1F4HA 1RHFA 3T3PF 2K4WA 2C9AA 1RERA 3AG4B 1U8QB 1TZ8A 4E9YA 3CV5A 1H3TA 1VFBB 2Z31B 4LLVB 2HX7A 1TZAA 3WKQA 1FFNB 3HRZB 4LP4A 5ANMB 3SGDI 3VH8B 1A9BA 35C8L 1RLWA 5BZDB 3QDJA 5DO2D 4ODVH 2NTFA 5DHVB 4AT6A 3L5HA 2HLFD 1F3RB 4UUJA 3FRPG 8PAZA 1O7DE 1JZDC 1HE8A 1LEKB 1JPEA 4N0CD 4PJ5E 5IW1A 5IM7A 4ZSOB 2F19L 4QHMB 1AG0A 3EGSB 5FM5O 3ULVD 3BVVA 5IVXA 2ED9A 4PJ9C 3SYCA 4Z7QB 3P02A 2WANA 1BD2E 3HE7D 5GPRA 3HNVL 1PD1A 3TWYA 3BUDA 3RTQD 4M7ZC 4AMKL 3QCUL 5HVWA 4HVBA 1ILUA 5I1GL 3SPJA 3PYCA 1BHGA 4HJ1A 3M1CA 4I1NB 2CH8A 3PU7A 4BYHA 3IMRA 4KH9A 4EPSA 3HE6D 4NRYA 2C1OB 5E2UH 4EQ3A 4PVBA 5AB2A 1DQQB 3QXDB 3Q8FA 3BRGC 1YNKL 2VIRA 1W8NA 1B0RA 5GRYA 1WD8A 3HE7B 3AVEA 4NM4H 5T1LD 3RTQB 2L7QA 5BUPA 2VW7A 1B2WH 3RY6C 4ZQTA 4Y4HD 4OZHF 3PCYA 1NGWA 3BHBB 4TVPE 1C5BH 5AYUL 3S6CA 3WNMA 4ERSL 3HG1D 2ZIDA 3RIAF 2CJTA 2BERA 5DHXB 1S6NA 5MEND 4I48B 1TPXC 4QXWA 4U3HA 4DVRL 4BQBA 4TQPA 5T1LB 5MEQB 3ZZQA 4P49A 4ELKA 1ZD6A 5CU9A 2PO6D 4LCCC 5H37H 1W8OA 3ULSA 3CFCH 4E42B 3H7BB 4Y4HB 1JUFB 3NZUA 2GJ6E 3RIAK 4NLAA 4QTIL 4IBWA 2HKFH 4I18B 1NEZG 2OCJA 4FQ2L 3JQOB 1ZPLA 2FWSA 4XCFH 4ZOAA 5LGYA 2HRGA 3M7OA 1CFTB 3QH3B 2MWCA 3VB8A 5MENB 3QJQB 1MI5A 4KGJA 5E2TH 3BPOC 3LTVA 2J7LA 3DBXA 2QPDB 2GFBA 3CUPB 5C0AD 2QKSA 3TJHD 2G75A 1U8IB 1PX3A 4AW7A 3H3BC 3P0YH 1OQXA 4TNEA 3RUGF 4WUUE 1E3XA 3RZWA 3X1NA 4LSTL 1MWAB 3KJ6L 4FC3E 3EOTL 3AUWB 5E51A 1RUKH 1XGZA 4XBPA 3TS8A 3NCWA 5TDOA 3ECUA 3RWCA 2LOEA 4EI6A 5GHWH 5AVYB 3ISYA 4P2RA 2C4FU 2CR0A 1JPTH 5C0AB 1D7FA 3RVVD 3D0VB 3O6LL 4L9LC 5FUCC 5KVDH 1QLFA 1BF8A 4JHZA 1P5UA 3FT1A 1CFQB 4QTFA 3Q5YA 1A0QL 2E0PA 1XGTA 2ESVA 4FQ1L 4N2FA 4ZMZA 2AQ1A 1A6AA 5JDJA 4L1DA 1CDHA 1RJYB 4LQFL 3WG7B 4NOBA 4LIQE 4GSRA 4TYUA 3JYBA 4KDVA 5D1QE 2OR7A 2X1OA 2Y06H 5I2IA 5FHAH 5J89A 4AQAB 4D8PA 3QEHA 3NA4A 1QBBA 2OL3A 3IFOB 4RAHA 3MGTA 1I9EA 3F12A 5KOVC 2CRZA 3VD3A 4OF6A 4HU8A 4HJIA 3Q43A 5F6HI 3WNOA 2ZG2A 3GSVB 1ZVYA 4UIKL 2WMPA 3ZHFA 3WEBA 1WFIA 3QEGL 5CSGA 3TEZA 1QSZA 4Y5XB 3BLKA 2DI8A 5HHOA 5EEXA 4AKQA 3MBED 2VLLB 3KYNA 1IFHL 1ETB1 3OKYA 2UZIH 5B3SB 4POUB 5L8JB 2K8MA 3RBSA 1NUGA 4Q9RL 5BZXA 1XAUA 5MEPA 2F6AA 2R29L 3O6KH 1BVKB 1A4KA 5CWSB 1A9VA 1XMEB 3OR7B 2YXVA 1KNOB 1TDQA 1UD5A 4RFOH 4IDJH 2CR3A 4L4JA 3TBYA 1YEFL 5FWQA 1S9XB 3DYOA 1EA9C 2IADB 1ITBB 3MBEB 2XWDA 5GISH 2YXMA 5SX4I 3EYSH 4O5LH 3VFWA 2CO2A 3KLKA 3BD4A 3OWRA 3HZYA 4LL1A 3LMJH 4AMWA 2WNGA 3FNKA 2NW2B 3N44B 2D7PA 2VZVA 1DVTA 1LYQA 1SY6H 1RIHH 4PJ8D 5HPMA 4Y4KA 3LSOB 1J5CA 1XSKA 4XP9H 1RJZB 1FGNL 2PKDA 2V7NB 5HDQL 4RBPH 1U8MB 5LGHH 1VDGA 4Z77A 3DTXB 4ICWA 5EUKB 4LOUD 5L2KE 2X3CA 4N2KA 4PWKA 5C07E 3BVUA 1EDHA 3GB7B 3O11A 2EADA 3GSRA 4N8CL 1KTLB 3BN9D 2JTDA 1KN4H 5A2FA 1A6WL 1SXCA 4B96A 4PJ8B 4C83A 1T0MA 2WIIB 2P7TB 3RVWD 4YQXH 2BWIA 2F15A 1OY3B 3UTSA 3VXNA 2ENYA 4NM8L 4X6DE 1UCBL 1G9MC 1MVUA 1X5MA 4HKJB 4MDJA 5IHLB 4JO4H 3SDAD 5K9OA 4DKAA 5D2LF 1SDAB 4BZ1H 4JANB 3ZO9A 3CDFA 3TBWB 1CCZA 4GI9A 3N85L 4XNXH 5DWUL 2WC7A 3ECBA 1G94A 4WGWB 1WCBA 3MA7A 4JVPA 3T2QA 2GTWA 5EOCJ 2GITB 5TE4H 2B9BA 1MNUH 4HAGA 1GAFL 4GIOA 4AGNA 4XVSH 5DMGD 2ISDA 2UXGA 1CZ8H 1THAA 4ZFZA 3FN0L 4R90L 3KXFD 3DETC 2W95A 3VI3F 5CD5D 2XV2A 1SJHB 1CDYA 5CZXC 4OI9A 1I8AA 4ELMB 2X05A 2ED6A 2DQDH 1U8NA 1WUNT 1N5YL 1MFBH 1MFDL 4KK8C 4P3CL 1GXEA 3U1PA 1UWXH 5A2AA 1NCAL 3WFBL 4KVCL 4WO4D 3ULVH 4UILH 3NIFB 3N6YA 3KXFB 5EIIA 4KTYA 1JXKA 5GSRA 3WHXB 3GWJA 4XCYA 2EYRA 2EH8H 2D4FA 3RI5F 4AEHL 3PNWB 1KDIA 1G6RL 1M3IA 3NFNB 4GSXA 4LDOB 3L4TA 5EO0B 4A6YA 1DCLA 1NCIA 4JZJA 4MZRA 2EVJA 4G9FD 1YMMA 4EVNB 3LZPA 5C09E 4RBPK 2DAVA 1HOCA 1JS4A 5AKRA 2ZOLB 4V33A 5TDNB 5E6ID 3D25A 4Z5RA 3GSWB 4PSRA 3RI5K 2YA0A 1ZKAA 4L3FA 2WXPA 5A2CA 2NY5L 1WH0A 1MFCL 1YMHB 1CXHA 4U0QB 2BC4A 4Y1TA 4KVNL 5B3NA 4M1DH 1NFDE 1KCRH 1I7ZB 4ZUVB 5AW4B 3VE0A 1C7SA 2JB6A 3QG7L 3WXWH 3H9YA 5L2JB 3CH1B 4G9FB 3HW7A 5DI8A 2J25A 3LQMA 4LHUD 1AZZC 1MCBA 3RWHB 3UIYA 4F27A 3T4AC 1S7UB 2Q7NA 2DEXX 4Y9CA 1IC5H 3PWJB 4KJWD 3U6RA 1OGTB 2YD4A 3DI3B 2BIPA 4HJJL 4ZDHA 4EJ1C 1P69B 1T0PB 4GG8A 2IQAA 3QAQA 1RAMA 1C12B 1WIPA 2CK2A 1T04B 4X9IA 2EDKA 4F9PC 2Q76B 3M17A 2CXKA 3EH3B 1KTCA 2WZPD 3CH8A 4LHUB 4JFED 4NNYB 2Q8BL 1OCOB 3UAJD 4OGAC 3D50A 2E59A 3NP4A 3N9GL 2F0CA 4JDVB 4R2GC 3S5LG 4LVOC 3IS1X 4IRJD 4MAUH 2Q3XA 3LV3B 1AGEA 4CDHA 3NCXA 5KYWB 4JFDE 3ULVF 4XNMB 1ZXQA 2FBJH 2UY6A 3O6FD 3DO4A 3BVDB 3NZ8A 2HJLB 4PJ5A 2MPAL 2GIYA 3N55A 3AWGA 4CW1A 1HI6A 3U4BL 3EUUA 4PJ9A 4MJ6B 4HT1L 4MYWB 3VGFA 2WWOA 5J0BA 2AZAA 1UA6H 3I84A 1UWXK 5FWRA 4GW1B 4G5ZH 5TDPB 4JY4B 4WJKB 2VMEA 2ATKB 1BD2A 1NA8A 3T0XA 4XBGB 4IRJB 3LEYL 1N6QL 2K0RA 5TFSH 1GHFH 5D7IF 1WYJA 4AG4H 4HGMA 1KPVB 4YHZL 3KDMA 3DOSA 3O6FB 2FECL 1FIGH 4HFWB 4LVOB 2APTA 5E9NA 3MQIA 5D8JH 4JQIL 2WTOA 3FPXA 5HVFB 2AJ3B 4E9TA 3C6LC 4FFYL 5T3ZL 3D39D 4MQTB 5AL8A 4JR9L 4QY8A 1J1XL 2A9BA 2AKRB 2HYMA 4IQHA 7FABH 1I4FB 3FU3A 3T09A 3ZDYF 3ZHLA 4WFGD 1OARH 2HJFA 3F58H 2O6DA 1UYWH 3V5DB 1A1NA 1FJ1B 1A7NH 3FT4B 2GQHA 1IEBB 3IGKA 3FQXB 1B90A 4WJ5B 1FVCB 3C9NB 1EHLH 4ES9A 2HJKA 2CO4A 2VUKA 1D5IL 4LCCA 3T5WA 4R6UA 3C6LB 5IROD 1XZWA 3SD2A 2ROXA 1CDGA 3WL9B 2ZYSA 1E6JL 1IBFA 4ZUUB 1JDAA 5F9JB 5I23A 3MLWL 4QXVA 4WTZA 1S2EA 3ARGC 4IBSA 5F1NB 1VAHA 1YG9A 3V52L 5KSUA 4ZRGA 5IOKA 1NOLA 4PJIB 3FQWB 3RDJA 4EUPH 1JPST 3RU8L 2Z4QA 2JIXA 3CVHA 4PGDB 3SBRA 4I4WA 4P9ML 4OF5A 3X14A 3MRHA 4XPAL 4S1QL 3SDXB 1DE4A 5E94B 3ZDZB 1EGJA 1AY1L 2YXWA 3KS0J 5I6NA 4NZUL 6FABH 4AH2B 5TF1L 2M1KA 4L9LA 5B7EA 4TUJA 2EZ0C 4LLQA 1W72A 1JK8A 1OCCB 3FTXA 1T3FB 3GI9H 4Z6AT 1KC5H 3LN5B 2VDRL 3OXRB 5E1AB 3HNVH 3D3VE 4UOQA 3K71B 3S8FB 1R4XA 2YLKA 4B0MB 4QNPE 4LOFA 1J9RA 3JV6A 1U8LB 4PY8I 5KVFE 4Q9QH 3DIDA 3H42L 2FO4A 3MA9H 3T0ED 3EJZC 3ISWA 3ZQXA 4KY1L 2HMID 2IIJA 1ADWA 3AQZA 3FH5A 1TG8A 1A14L 1D3CA 2X4QB 4KKAC 4F7MB 3VD7A 5I66A 4TUKL 4X9FA 1YEGL 1D5MB 1KELL 1G6RB 4PPTA 4E41A 2PP9A 4LPTA 1WK0A 4G7YL 3IMSA 4H1LB 4WK4B 1NC2A 3HLAA 3IKCB 1UENA 4ERSH 3GKWL 4ZXBD 3MUJA 3TYGL 5C8JB 2VH5H 2DS4A 4NWTL 2ITDA 2J20A 1UUSA 1P1ZB 1SVCP 4DEUA 1PZAA 4ES8A 5AOKA 3KPPB 4NJ9L 3VD2A 1QHOA 2WB7A 1C16A 3UG4A 1YNTA 1VPOL 1RV6X 1XWVA 3RHWF 1FORL 2VWEE 3ASWA 2CO3A 1U8HB 2BDNL 3BCFA 3S5ZA 2CJUL 5HYJE 4GUQA 2VWEC 2IBGA 1J8RA 1NAMA 1J5DA 4HUXB 1JPFB 4IBLT 2BSSB 2GJZB 1M4KA 3UJIL 4RA0C 5J6GB 2P24A 4ODSL 2WXLA 3QPQD 3RHWK 1NBQA 1MCSA 5FO9A 2VJ8A 5IMLA 2P5EE 1CLZL 5CEZH 1M9WA 5J6HB 1WP6A 3RWFA 1GYUA 3AW5A 1CL7L 2AJYL 2BS9A 2R69L 4TVUA 3NRPA 3VFGH 5HGHA 1EJ8A 4LEXL 3EO0A 5C07A 4KGLA 5EZIH 4MQXC 5GGVL 5IQNA 1TU2A 4PJ7E 4W6XB 3L3GB 5ECJE 4EIZC 5ITBL 1QWHA 3ZZSA 1JN6B 3GHEL 3IJYB 5HYSA 4Q2ZA 1T4KA 3WLWD 2DM3A 3RY5A 4X6DA 4FQ1H 4XCNA 3JVGC 3F01A 1J0IA 4F2EA 4LQFH 5T3ZD 1WIUA 1PYWA 3CFDA 1Q9WB 4MMZA 3REWB 2PCYA 3THML 1XCQB 3QEQE 4OTXH 3BAWA 3LKRB 4BSVA 4DKEH 4MNQE 1YPZB 3E1F1 4MASA 2P5WB 4KI1A 1KPUA 3GM0A 5F6IC 4BBWA 1O5DT 4XZUA 5LXVB 3QDME 2DKSA 4JDZA 3Q2WA 3QEGH 1MCNA 5FA3B 1D5XB 1FNSH 5EUOB 1HL8A 1P84K 4ZFQA 5JORA 1G7JA 1L7IL 5DJ8B 1UB6B 5G2NA 1KJMB 1YDPA 2OXHB 5MEOB 4X42A 3D4ZA 4XI5C 1KXVC 2ILLA 1I75A 3ZPDA 5C0CD 4PJDF 2R29H 5L4JA 5HHMD 4PTTB 1WCQA 1CURA 3D30A 4OCSH 1ZTXL 1FC1A 1WPCA 5ES4B 1FV1A 1EAPA 1MW3A 3GMOB 5E00B 1XF3B 1RK1A 3FO0L 1NCTA 5ITFA 3QJFA 2VLMD 1ZEAL 4JY5L 5C08E 4KHTL 1ED3B 2DBLL 3GZKA 4TV3A 1UATA 4JJ5B 1MNNA 1QFPA 5C0CB 3ZTDC 4PJEF 5HHMB 1HH9B 4J4PC 5CIPA 5C09A 4UQDA 3QULB 1OM3L 4Z95L 4BFNA 3WN5A 1JF5A 3GSUA 2JTYA 4NGHL 4YNYA 4BV1A 1ECYA 1SZNA 4Q58C 5HDQH 4UAHA 1O9VA 1UACL 4HSAC 3ZOAA 3OGOE 4ONHA 4JO3L 4WI5A 1H6EA 3N42F 3RNQA 1NFDA 2HX8A 4X6FB 3O45B 1TKWA 2W0FA 3W37A 1N7ML 4X98B 4XWOC 4JG0H 3VGEA 2CGYA 3S34L 3WTXA 4NNXB 4GUPA 1C8QA 3COOA 1HX0A 3UBXI 5F3BA 1CGUA 1DBBH 1OM9A 2J55A 3ETBJ 1NPJA 3IWUA 5IQLA 1NMCC 1OHZA 1KIUA 3P9MB 2AF2A 3HBPA 1O7VA 2J56A 4WDIA 3ZKMC 4JPIB 2VDRB 4HISA 1H5BB 3B2PA 2OTUA 3ARBC 1UD3A 4JO5A 4RNRB 5C0IB 4PJHE 1TSHA 3S36X 3C5ZC 4PG2C 2Y7MA 2VLRD 1AZNA 2J72A 1GAFH 3B9KC 2R1YA 1VKXA 1NDGB 3QIUA 4K94L 3KE0A 2XY1A 2L8AA 1BDYA 3QUKA 1VADB 4JFDA 1M56B 2DYPD 1M05B 2RBLA 2YAEA 2N1KA 2O5NA 4ZMAT 1A4JB 2CNYA 5I8CB 4JN1L 4PGEB 3CZEA 5KZCD 4Y2DD 1YQ2A 4OD2B 4ZFOA 5E1QA 1L3NA 4J3SA 3G3LA 3K6NA 4PR5A 5KVGE 5KN5A 4FQXC 2VLRB 1DEEB 3LHPH 4G9DB 1U3ZA 3HJEA 2X9WA 4K71B 3RVXC 4L0PB 1I53A 3N3EA 5EG6C 3CX5K 2BVTA 2DYPB 2XFGB 5AAWC 3PRZA 4AYMC 2IXQA 4H8WC 3UTPD 4H0LC 3VRLE 4GMSL 5KZCB 2R2HB 2NXZB 3AM8C 2ZXWB 2MJWA 2J8UA 3BRFA 3ARWA 2KT6A 3KCPA 1XDTT 3TCTA 2JWYA 2CBQA 4Q0XL 4X6EB 2ZF9A 5BW7A 2WW8A 2D7QA 2BHFA 5I5RA 2EE2A 2F5AL 5HVGB 1UD4A 3DROA 4HUUB 4P4KC 1XR9B 3UO1L 3AFLA 5AW5B 2ZUWA 3MOAH 1AI1L 2JVUA 3P4NB 4HJGB 2PLTA 2FX7L 1WZ1L 3BEVA 1R75A 2ED7A 4KMLB 5MI0B 2SODB 4IGBD 5BZWA 3LY6A 1BW8A 3V6FA 1LHZA 4JS7A 5HDRA 1RH8A 2HUEA 5BQDA 1FFTB 4TULH 3SKUD 2DYSB 2OK0H 5CLYA 1NAKH 1E9QB 5BXFA 5MHSD 2A6JA 3ARGA 1CE1H 2YMTA 3K0WA 4HZLA 1XF5B 2HVKB 2NZIA 4IGBB 3EIFA 1GYWA 3Q1EA 4TUOB 5IJKC 2E27L 3D33A 2VE6B 5KSAD 1U30A 2ZQKA 2D73A 2HKAA 5CN1A 2Z8WC 4A7GF 2YRBA 1JHTA 1KJVB 3OHMB 2BCMA 2RGSA 4K73A 4E0RB 1FE8L 4EI5A 2VSDA 3UPRA 4Z7UE 1AQHA 4NXSA 4M93B 5AW0B 4M4RA 3FONA 5I73C 1R5IA 3SZ6A 4H88L 5KSBB 5HHQB 1NKRA 4P5TD 2J1YA 3FFCB 2DB8A 3PY9A 4OJFL 4G8IA 2EJ1A 1F2XK 2WGXA 5T3XH 3O4OC 1ZMYA 3U4BH 3D2UA 5KSAB 3E7JA 3U2SB 1OOAA 5AOMA 4CMMA 4J3OC 5IVOA 4OZGE 2WWMC 3O8XA 1L9NA 1CXIA 1WBZA 4L3EE 4WWOA 4AL8L 4FE9A 4Z0BL 3DVNA 3D3VA 3JWOH 5ENWA 4CKQA 1S7VA 4QTHB 4NPYA 1R6VA 4PJBB 2WZAA 5C9JA 1E6OL 5HGBA 4NKQB 3UZEC 1OALA 1RK0A 2NY1C 4L8DB 5F9OH 2CHZA 4P5TB 4B7IA 3EH5B 1JP5A 2R0ZL 3UYOD 4JQIH 2VMJA 2D2CC 4PRBB 5T1MA 4UINL 1GCYA 4HGWB 2YGVA 3JVFC 1CK0H 1D2PA 2NY7H 2FEDC 1AGCA 5D70L 5TH2A 1JYWA 3O4OB 2EEDA 1G1OA 4G8GB 3CSTA 2W9DH 4B9JA 1JRHL 5ACLA 1IKFH 1JOIA 1U2CA 2DQ6A 3NK3A 4J3BA 5J13C 3I9IA 2JI3A 4Y8AA 2XYBA 1R3JA 2AHIA 6TAAA 3JWNH 3PUUA 3ZDXF 1FFPB 5CLXA 5FB8A 4NNPL 3EJQA 5HDBF 2BNQE 5EBWA 2EDTA 2AEPH 2V3FA 3L6FA 3QJOA 3QVAA 5CXPA 5B4MC 4AYEC 3PUCA 2BY3A 1PVHA 5LXVA 3OM3B 4ZPTA 4ZS6C 1U8JB 4GRLA 2JJUA 2X9XA 4XN2A 4JFHE 3VXMD 5D72L 4RIRA 2L3BA 3LD8B 5HYJA 1QFOA 3FRUA 3C12A 3GMLA 4B5ZA 2NYYD 1BOYA 3W11D 3WFCH 2X44D 1OP3H 1VGEL 2FLMA 1E4WH 2J2ZB 5AZEH 1FVEA 2IQ9H 2XYCA 3V52H 3BZFA 2BCKA 1JZ3A 1VJSA 1GZPB 2FJHB 3B2UC 1K6QH 1SLWA 3SOBL 4FTVB 4LQ1A 2Y1AA 3RU8H 2P5EA 4XPFH 3SY0B 5IHHA 1IEAB 3FC8A 2VW4A 4JB9L 5DJCB 2ICWJ 2Y6SD 2VQ4A 3JTTB 1CTNA 1KYFA 1KGUA 1TQWA 3DPBB 4LHQB 3G9AB 4KK5D 1BVNP 2R27A 1KXHA 3IGFA 4L8SC 1XR8B 3QHTC 1QO3A 3EG9A 4UYPA 4HPHA 5IWLA 4JG1L 4PJ7A 4M9PA 2DZEA 5DZOA 3VRJA 4GKZA 5DVMA 2CZNA 4AKPA 4XB7A 4Y16D 5FKAA 4HCFA 5IBLD 3H9SE 2FUQA 3ABGA 4UOW1 2FGWL 2X2JA 5EB9A 4YXHL 1TZGH 3BEWB 4OLZL 1ULVA 2DEWX 1QSFE 1NL0H 4H7VA 4KXZH 4MAYC 1RXLA 5KBNC 5IB1A 1MRCH 4JEGB 2IDSA 3TN0D 3UBHA 3V6BR 1WVZA 2ZXEB 1DVFA 1WZAA 4KI5E 2DQTL 4X80L 4ANVA 2K8QA 4MNHA 1U58B 3QUMH 5DJXB 3BAXA 4JE0A 2DH2A 3NRQA 2IAMA 2A38A 3D12B 3QEQA 4R0LB 3DMMC 4M29A 4Y16B 5JHDE 3UZQA 3PJLA 5AB0A 1HXMB 4PYGA 2OJ1A 4K7PH 4EUPG 3HG4A 3RGHA 2EACA 3QDMA 1BJ8A 5B3JF 4D0DB 2X42A 5I1CL 3PGDB 3QO0B 1QEWA 1MG2C 3TN0B 3W5MA 1LO4L 4AE1A 2BP8B 4UU9A 4G7YH 3IDXH 2BVQA 4MAYB 1EZLA 1JG9A 1CE6A 4XMKL 3GKWH 4XPTL 2DDQH 5AD0A 3IPBA 5DEGB 3TYGH 1KXVA 1CFNA 1NDTA 1ZLDA 2I7SA 2KDGA 1V3JA 2WJ5A 4JM4H 4NJ9H 5J12B 4GFTB 2WWKT 5KW9H 2FL5B 3FUJA 4YDKH 2ID5A 1CD1B 4FNUA 3KGUA 4KFZC 1Q9LA 1JYNA 2QGEA 3QFDA 4F2MB 3QDJD 3CPLB 2CJUH 3H0TB 3V2AR 3G08B 4X5RA 4Z7IA 3HPJB 4D7BA 4K2UL 3VUAA 4EDWL 3UJIH 5C08A 1DLHA 3O4LA 4X7TB 1KCLA 3QJVB 3VXUA 1NDMA 4I3RH 1AXTH 1BIIB 2IBZX 3LH9A 3LYRA 1XHHA 5IB4B 3MRDB 4QMEA 5AENA 1A9BB 2ORBL 2I60L 4N8VG 2AQRA 2PETA 3ES6B 5JDSA 3FN9A 4GP5B 2V5SA 2P80A 3HBQA 2AS5M 2NTFB 1NFIB 2PCXA 2WVVA 3GJEA 1GYVA 3CIQA 1MCQA 3BN3B 1Q94B 5H35B 4NHUB 3NGBC 12E8L 4M6ML 4PP1C 4QCIA 3W9EB 3HS0C 4LLAA 4PP2A 3W81A 2D31B 3U1SL 3GHEH 3LKOB 1OT1A 1I7TA 4NHCL 1I9JH 2CALA 1OVZA 3HC4H 3MLXH 4HIHA 3P9LB 3QI9C 2WO4A 4QRTB 3KLDA 5DJ6B 2HP4A 2YPKA 4G11A 2NLJB 3C2SA 3ARBA 5TE6L 4XGZA 3QHZL 4NO5A 3VGBA 3LAFA 4Y89A 1WBXA 2GI7A 1EK3A 1R1CA 3C5ZA 1JF1A 4NX0A 1MSPA 1HAWA 4PG2A 1A6VH 2VIRB 4U1JA 1HL4A 2IEPA 4PJHA 4YBHA 3B9KA 5GGRA 1XBRA 1B0RB 1N0LB 2IMMA 3NGBB 4IEFB 2FD6L 1I9IH 4P3DA 4L4TB 5CP7A 1RI8A 1V7MH 2EIBA 2D2OA 1RHHB 4YDIH 1FFQA 3DGGA 4TVSa 4XVJH 3OKNA 4OVVA 5AB1A 5D5MF 1NGWB 5INDA 2X3AA 4WO0A 1L7IH 5GS0C 1HSBB 2WQXA 4JKWA 4RGNC 2P4AB 1PS3A 5DC9B 1SQ2N 4O02B 4QWWD 5H2BA 3MCLL 3EADA 4H8QA 2BO0A 1FRGL 1IZJA 1MI5D 1EAJA 1TZOA 2J1XA 2F1AA 3MJ8B 2O6FA 1BAGA 4UQIM 4TSBH 3Q01A 4BK4A 4G8EB 2WY3B 3KPSB 4A6YL 1OAKL 1ZTXH 2E74C 2QELA 1H9VA 4Z9KB 3QUXC 5JIPA 1N10A 3IETB 5FUOL 2FK9A 2WK2A 1IGFL 2QPUA 3QGVA 5CUSH 5D7LB 5KAQF 3ZTCC 3SGKA 4CL7A 2DQEL 4XCCL 3UP6A 4DKDC 1MI5B 1UWGH 3FUHA 3MGOA 4P4KA 4QXUL 1U21A 2CO7A 4PV8A 4RGNB 2C3VB 2ZG3A 2QPFA 1OM3H 2HB0A 5CNHA 3ZZLA 3V4VA 2W60A 3BGFB 2PTTA 4CSTA 3QRGH 4MA8L 4F7CA 1A9EA 3QO1B 2AXGB 5EMYA 3ZHDA 4PI2A 1YEIH 1N7MH 1QW9A 4RFEB 3SO3B 2R0KL 5EEUA 1J1PL 1QNZH 4ALAC 4ZMVA 1XGTB 3M6DA 5IQ7H 1A6AB 5TD4A 4MJ2A 1G7MA 5D7HA 3QCTH 1BZ7A 3B2VL 5HHOD 1KJ2L 2GCYB 2F1BA 2JK5A 4CVUA 5KS9B 1WGVA 2BVOA 2YQBA 3IM1A 4RMUA 1ET8A 4WV1B 4N25A 3QEHB 2QQLL 3UFIA 4OBSA 1WJ3A 3MGTB 1QVOA 3VXRE 1Y6MR 1BZEA 4JQVA 2R7EB 5D1ZD 1K5NB 3DDGA 4M1CD 4Z7UA 3ZYZA 4PWHA 3GXDA 4X7SL 2WMPB 2XIIA 4KQ4H 3RKPA 2MQ3A 3QR0A 1H3UA 2CGRL 3BC9A 1T66D 1PD0A 1I8LA 4JN1H 2W9EH 4G7VL 3KYNB 2VDPL 3QJHA 4XMLH 4PAZA 3QWOA 1JYXA 1NICA 1A64A 1F58L 3C6EA 3DX8B 3RWIB 4OZGA 1TT6A 3EH1A 1M3JA 3QZBA 5MEPB 3L8QA 3DX9B 2MEJB 5IK3B 2N01B 5D1ZB 3WLBA 3UZEA 1QUPA 1A4KB 5SX5H 1XB8A 3E2HC 2B4CH 4M7LH 1MHCB 3Q2LA 2W80C 4YDJA 2DWXA 2WINB 4GMSH 2OTWA 3CQQA 3FOLB 3KBHE 3BUTA 1RZGA 5DHYA 5GJTL 1K2DA 4TVPL 2AK1H 3HOGA 3FQRA 3X3GL 2F5AH 5IB2B 2FT6A 4JO8A 2BMKB 1CIDA 1OAQL 2V7HA 4QHLB 3CFQA 3OTTA 3UTSD 4AQ8C 2Y0SA 3WYRA 2G0LA 4FLRA 4WI6A 5I8KH 2EXSA 1E50A 4LLWB 5KYUB 1LNUB 2BNQA 3O11B 5FW6A 2VXUH 2EVHA 2UZXA 1X6NA 5JO5A 1G1KA 1JTOA 1T2JA 3SB3A 5CD3A 1IMHC 2A4EA 2W5PA 3EBHA 1DTUA 4JN2A 4YVNA 3U30C 3U4KA 2X10A 4OCYH 2EDNA 3VXNB 3C08H 5HTSA 1CYWA 1MVUB 1S7QB 5DZJA 3UC0L 4F7EB 3CVHL 1J8KA 4HJUA 4ZMPA 4TSAH 2RA1A 4PYHA 5K9OB 3B37A 2ODIA 2MOVA 1X4XA 1Z9SA 3NVQA 2WTPA 2AK4B 2XWJA 5K33A 5DVPA 2PPFA 1WCBB 3MA7B 5BPPA 5JPMA 3OLDA 5FIEA 3VI4B 3UTZB 3BVXA 2F5BL 2X4OA 3E6HA 4L8SA 3MRGA 1IKNC 1RULL 1W72L 3U30B 5FK9A 5KTEL 3SDCC 4EMZA 4HOWA 1OHQA 3NG5A 2V2TA 2XV6B 1OTSC 3L48A 5DJZB 5F3HA 5GGRY 2MCAA 1PW3A 2ZWZA 5LB1A 1NGPH 4AEEA 3K6SB 2E7BA 1ZVHA 5DS1A 1OP9A 2QQNL 3ZTNH 4LIQL 1SEBA 5SX5K 4H20L 5GS1C 2Y5EA 1MFAL 1YMMD 2DTSA 3EZ8A 4WK2B 4WSJA 5I30L 2NZ9D 3MOBH 4NXKA 4OM0L 4AM0B 3ZGHA 5AFAA 1QSFA 3I3BA 1NCDL 4NN6C 3RX8A 2X7LB 2WKOF 1I1YA 1EMTL 3M7FB 5GSRB 4R84A 5CCJA 1URLA 2OQJB 3O81A 1D5BA 3T2LA 1QZNA 3DMMA 1X5AA 3QZWG 5DLML 4UINH 4FKEA 2FQEA 4K3HA 2XN2A 1AIFA 4JZJB 3HRPA 2P8MB 2WZ0A 3DNKA 4H2CA 1YMMB 2XKUA 3RPKA 5ICZA 1CU4H 2XBTA 3WUWA 4XVUC 5IJDC 3IKKA 3EBAA 2PCPA 1B3JA 5IG7A 1T6WA 3KR3H 1V55B 2WNKA 4Z5RB 3MLZL 3WJLC 2BOCB 4MVBD 3UC2A 1E9PB 4R4FL 1IGYA 2WIMA 1SVBA 2HLAA 1ZT1B 1NAML 2FE0A 3UJJL 5LG1A 2XUWA 4ODXA 3PJSB 4HUWB 1HTYA 4FYTA 4ELDA 2NNXA 3WDHA 2YJLA 1XL6A 1ZHLB 3U6RB 1MCEA 1N3NA 2CHWA 4DERA 4ZDHB 1FA4A 1M7XA 2IQAB 2CM6A 2I26N 3HI1A 1VGEH 4LRIA 3VD1A 3MV01 2E46A 3DRQB 3CSYA 4PJ5D 2HT4D 3M17B 4AGOA 5FGBC 2LAGB 3R1GH 3X1EA 4HMEA 4YAQB 1BD2D 4FXTA 3VNYA 1KJ2B 3AITA 2Z91B 3K4DA 4O51B 1AGEB 1UOVA 3MUGA 2CHDA 2CDEA 3JWDC 1F6AA 3C09C 2NUPA 3PABB 4W9CC 3SDDA 3NESA 3U0PA 3LXCA 2UY6B 3JWNG 1AKJD 1RFDH 1WDAA 3LEXA 3F3HA 3OSKA 4PJ5B 1NBVH 1BQLL 1NCGA 1YN6A 4NERA 5JHBA 1ZAGA 4KKBD 2V8MA 4LEOB 4TSCH 5IIEB 1UD6A 4L8BB 3EDDA 5D7SH 2YAPA 3RGBA 2FGWH 4WJG3 1BD2B 3L3IA 1T03H 5GGSB 2OSYA 2VOTA 2VDPB 4A7TA 1Y0LA 2OL3H 2VSKB 3NFSH 1I7UB 3MNVA 5LXGH 4OZFA 3DOSB 1AKJB 3J07A 4AYID 3KPQA 2DQTH 4EDXB 4TVPD 1QRKA 2H1PL 5CJOL 2YOCA 1IC7L 3V5KA 5IMKB 3L3OC 2AANA 4XH2A 4ISVA 2YK1H 2XTJE 3JT2A 1MCOH 2VXSL 1BV8A 4HUNB 5K1NA 3DYMA 3ZRCC 1BJMA 4RAVB 3GLZA 1QI3A 5CGYD 3MR9B 4N1EA 4OD3L 3OKLA 3ZU8A 2ZWLT 3F83A 1R3KA 4FZEL 4DGVH 1U3HC 2EIZA 1U8CB 2IPKB 3MRIA 5I1CH 2YN3A 4JL2A 2VTFA 3DYPA 3DUSB 3R06B 1LO4H 5AALA 3ULUH 2V5MA 2SEBA 2GJ6D 3SGEI 2EO1A 3CCHB 1JWUA 2X4SA 2YD6A 3MXVH 1AQKL 3NN8A 3UJTL 3O6ML 1C5CL 3TT3L 3DLQR 1FZOB 1ETZB 3STBA 2HWZH 1W0VA 3G6AB 2AERT 1T1XB 3B2DC 4W9LC 3QRBA 1MCPH 1Y07A 2JIXD 3U7WL 4AQ1C 1MJJA 4U6VH 3RWGB 3PP3K 3Q8CA 2NW3B 4HXBL 1IT9H 2GJ6B 2PMZA 1BZ9B 2OFQA 4WUUD 1OGAA 1M2OA