4WI0B

Crystal structure of coh3scab-xdoc_m2scaa complex: a c-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
156
structure length
156
Chain Sequence
GTTVSGYINPDFVTTSTTAPIVKAGFTVEIVGTTKSAVTDSNGYFEIKDVAAGTYTVKITKANYLTREIANVSVTADKELSTSASPILMWAGDMAIGGTQDGAINLEDILEICKAFNTSSTDAKYQVGLDLNRDGAISLEDVMIVAKHFGKVSSDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Coh3ScaB-XDoc_M1ScaA complex: A C-terminal interface mutant of type II Cohesin-X-Dockerin complex from Acetivibrio cellulolyticus
rcsb
source organism Acetivibrio cellulolyticus
molecule tags Structural protein
molecule keywords Cellulosomal scaffoldin adaptor protein B
total genus 41
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1330.10 Mainly Alpha Orthogonal Bundle Type 1 dockerin domain Dockerin domain 4wi0B02
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 4wi0B01
4YOKA 4U3SB 4WKZA 3NJVA 2VN6B 2XHNA 4UYQB 2VN5B 4IU3B 3UL4B 5G5DB 5LXVB 3MN8A 3E8VA 3G3LA 1NKGA 4FL4C 4EIUA 2B59B 2JNKA 2Y3NB 4UYPB 4DH2B 1DAQA 4IYKA 1H8LA 3HN5A 4WI0B 2OZNB 1QMUA 3NJXA 4FXTA 4IU2B 1DAVA 2NSMA 2MTEA 5K39B 3KCPA 1OHZB 4FL4A 5AQ0A 2CCLB 1UWYA
chains in the Genus database with same CATH superfamily
1WD8A 2IADA 4PRPE 5I73C 2CLZB 2CO1A 2D3LA 5F9AC 3G7TA 3VM5A 4FLHA 1IC4L 3IAGC 5IB1A 5DS8B 2WVUA 3GSNH 5KVEL 2V9RA 4G59C 5SWZB 2YGOA 3BWAB 3G5XA 1TJGH 4KK5C 3BGAA 4Z7VB 3S37L 3OHXC 1S5HB 5CIPH 1A8ZA 1KXHA 4DK3A 3ABGA 1MFEL 4HD5A 3S5LG 2EKSA 2H0EA 4WWPA 4X7TB 2BVQA 4LSVL 3PHOA 4LGRB 2P5EB 1IKOP 3EOTH 3RTLA 3WKMH 1KG0B 3LH8A 3IFOA 1K8IA 4QRTA 4WI3A 4ODTH 4AUUA 1GGUA 5KBKA 4ILDA 5C09A 4QKTA 4DJMA 1IGJA 3IDJA 1CVSC 4FDWA 3FB6B 4WO4A 3FN9A 2PWHA 5EOQH 3W39A 1SEQH 1KCVL 4HJ0C 5TFSH 2HFFB 4RMRA 4TLKA 3SBRA 1A14L 4R7VA 3TX4A 5IIEA 5AZEH 4AYID 4UYPB 4L48A 2HJFB 1AQMA 4OD1H 4YBLB 5J9PB 1FVEA 1FH5H 2MQ3A 4QRRD 5AD0B 2H8PA 3FYIB 1J8RA 1RUAL 3II3A 5DVMA 3CJJA 4YX2H 5EZIL 2I07B 2NNRA 4KMTH 4OLWL 1JGLH 5IB5B 2W60B 4ZXBD 5CIPB 3WJJA 2Q7NA 2B8OT 2CCWA 4DP8X 2DMBA 1RZJH 4NNXB 1ASOA 1H0DB 1I7UB 2EVFA 4ZOEA 4MDIB 5D7LB 4PJ7A 3MV7B 4RQQA 4JMNA 1E8XA 2E6PA 4ONOA 5F1SA 1CURA 1I1CA 5LDUA 3D69A 1ZVYA 4L37A 4E9QA 3E38A 5DMGD 3EYSL 1UFGA 3ATBA 3DHUA 3KYNA 3T8VA 4F9LC 1ITBB 4CDHA 3HE6D 5FUCC 1AKJA 3GB7B 5CMAB 2D4FA 5C8JA 5I23A 1DCLA 5F96L 4H25B 4QXGL 2KT6A 3Q6GL 3S34H 1YPZA 3LY6A 3GSUB 1X7TA 2BS71 2WHVA 4ODTL 3S9DB 2HFTA 1BOGB 2VDRH 5GQBA 1MRDL 3ARSA 4PJ5B 4PYHA 4B0MM 2KLTA 2RJMA 4YHKH 1MIEL 1B2YA 3W38A 5IMMB 3ABMB 3TFBA 3U4EB 3PJSA 5L4IA 2IOOA 3FU7A 1NPJA 2P80A 4UILH 5I1GL 3F2LA 3KLKA 4UT7L 4Y89A 5JHDD 4PJBB 5GJSH 4QRPB 5E00A 2J7LA 4HIJA 5I9QC 3MA7B 3A6BL 3RX9A 3C60C 2QR0B 1XAKA 3WD5L 4J8QA 4AVIA 4OV5A 4TUKL 3ILQC 4BE6A 3GMQA 2G30A 3BZ4B 4QRUB 3F7YA 3R18A 4KKLD 4EIBA 1MW1A 1KEGL 2RGSA 3N91A 3DUSA 1SY6H 2ZOLA 5JW4M 3NGBC 2XI9A 3Q3GA 4ZTEA 3F5WA 3O4OB 3CLWA 4JKMA 4Y4HA 4NDMA 4X5WA 5JNYB 1SMAA 1A66A 4KXZH 5CJQL 5FK9B 2YAFA 5E2TH 5SX5H 1DO5A 1XF2B 2LE9A 1ZY9A 3OWEA 1E6OH 4N28A 1N12A 1UWXH 2YEZB 2Y69B 3WFBH 3X1GA 2ITCB 2YAMA 3ZZSA 1LGVA 1ZA6B 3U2JA 5HHMB 3SGJC 4M43H 3UGXA 3G9AB 1R6VA 3QRLA 5E6IA 3C5XA 1LLAA 2BNQB 5FLUA 2CUIA 4N1EA 5A2LH 3LRSA 3KPNA 2BDNL 5G4MA 2XZCH 1JZ5A 4UDUB 5GRVL 2V9UA 1F4YL 1AS8A 4OF8A 3VI4B 2CBQA 5K9JH 3MBEC 1AXTH 4UZGA 4AH2B 4ZMOA 3TPKA 5KVFE 3RWJA 3VFNB 1RZFH 4HJGA 4CILA 3DYPA 4ELKA 5C0AE 2X4UA 1IGYA 3FSZA 2ZG3A 4M02A 1LJMA 2B7DT 3DGDA 3L3KB 3OKLB 3PABA 3QJQB 1M9WA 4LIQL 4OF5A 1ZDSA 3VFWB 4EBQH 5M94B 3BHBA 3CHSA 2WIIA 3MGOA 3EYQC 4Q8BA 2ZXQA 1ZLWK 2VSDA 1DAQA 2MNUA 5FHBH 5D7KE 4M62H 4PJDF 3MYJA 5FX3A 3OGOE 5TQ0L 2PTUA 4KI5C 2NT1A 1YY8B 4URKA 4QYOA 1HOCA 4G82A 3T3PB 4GSDH 5DEFB 1MH5B 5MEOA 1CE1H 4JJOA 2P5EA 3TEXA 1JGEA 3TWCH 4OCYH 2LV4A 1CLOH 3BVXA 2Z64C 1G1OA 2I5YH 5DJYA 2GBVA 5AB0A 1NAMH 1RZKC 3G08B 1GZPB 4ODHL 3OAWA 5C2BL 5ANHA 4HJ1A 3V0VA 3AFLA 2XTSA 1JXDA 4XN4A 4UM8A 5E51A 5JHDE 2R69L 5AVTB 4CADA 3IJSA 4NPJA 3VXTA 5CWSA 3PWUB 5SV4A 3QULA 4MJ6B 4MZRA 2YEQA 4GXVH 4OF6A 2D7PA 4A2EA 2CA3A 2DJ4A 2OYMA 4C56D 1ZVSB 1NMCB 1JHLH 4OCYL 4TLSA 1QKZL 1WFNA 5GS0L 3LSOB 4J39A 3L4CA 3HG1B 1JNLL 4ZW3A 1HXYB 3WHXA 1NMBH 4LGPB 4YQXH 1S7WA 4KY1H 4YHYB 2APVA 1Z1WA 4HWBH 4Y5XB 3SDDB 1WZ1L 2IJ0C 3P9MA 3VFSB 2LABA 2OM5A 4PJGF 4ZS6C 4DKFH 2BSSB 5IVZB 3ARBC 3GRGA 4PCKA 2QQNH 1BAGA 4HPHA 1G7MB 4P59L 4PMFA 2XQYK 1IAOA 4LQFH 4PRID 3TO4D 3RWCA 5HHVL 4GRLA 1BF5A 2AJZB 5EO1A 4RX4D 3B6SA 1DUYB 3DO4A 4JVPA 1LM8V 3Q9PA 5EWIH 5F9JA 4I5BA 1FO0A 5SWZA 3OKNA 2B08A 3PF2A 4M3HA 3V0AC 2SODB 3HC2A 2XY2A 4HBCL 4KJYA 3ESOA 3B7UX 3QIBB 5I1LA 2P8MB 3ZTCC 2NDFA 2EXWD 2KZWA 4YC2C 3RVTC 5IESL 4JANB 3EFFA 3MA9L 1L6ZA 2DV6A 2QKIB 2AS5M 2K45A 1NCBH 5CJQH 1F8TL 3Q48A 2WINA 3CCHA 1IBGL 4GKNB 1LP9F 1V10A 3AU1A 5K39B 3NOIA 3V5DA 1GGBL 3V8CA 2V5YA 1ZHKB 4M03A 4B5EA 3GSVA 4JNXA 2ZG2A 5F7HA 35C8L 1PDKB 5IROA 2A74B 2AJSH 4YR6A 4NQQA 3FH5A 2CCVA 2IALA 5DEGB 4YSSA 1LP9E 2NY4B 4TQHA 2D73A 4NB7A 3SDDC 4X6DA 4W1TA 1WBYA 2VCOA 2WXQA 4JVUA 5C0EB 4ABVA 2PCPB 3I6GB 1LYQA 4IGBD 3HHSA 3ZIYA 5GJSL 1DLFH 2WMPA 4LLYA 2IF7A 4JRXD 1A6ZB 5CJ5A 1EUUA 2VLRB 3NIFF 4RAHA 4PS7A 2HPOA 4ONHA 3CU1A 1MW2A 1KPUB 5B3NA 4TUKH 3N41F 4BUGA 3A6CH 5EPMA 3ELAT 2AJSL 2BNRE 3HC3H 3PWNA 4R0LC 1OAUL 1CTOA 3I9AA 3J7HA 2AXGB 4AXWA 5J89A 3EJZC 3TO2A 2EH8L 4Z77A 5IHLB 3SGKC 2F18A 5IY5B 2FJGB 4H1LB 5JIPA 2N0MA 3QQXA 4HEME 2CJUL 4GKZA 3WEAA 4G7QB 4UILL 1A1MB 1MVUB 4BK8A 1VERA 1G7QA 5E2WL 4N2CA 4FXKC 1EZVY 2JXMB 1JK9B 1QTSA 3EZJB 5F3FA 3U36B 4YPGB 3MKGA 4D8OA 4N0FA 3SZ6A 3K81A 2MKLC 4WDIA 3THMH 1PMYA 3NRPA 2N56A 1V27A 4MD0A 3ECVA 4GKOA 3KL3A 5FC9A 4ZMLA 4JY4B 1N5AA 1N68A 3CZNA 1B90A 3L4TA 4ZQKB 5C0RL 4KJWC 1R34A 4G8GD 3IRPX 5D7JB 4ELKB 1IEAA 1CXLA 3D18B 3CSTA 5AG8A 3D4ZA 3R1GH 1TOXA 1AHWC 3CFKA 4N0YL 4XMXA 5F71A 4MJJA 1BLIA 3OL2A 1MFDL 2GBAA 3TBYA 3C8DA 4JFDA 2A9DA 5B3JE 1IBFA 1TJXA 2XTJD 4D0DA 2O5NA 4ZYKB 3EJSA 4PSPA 3OR7B 5FW7A 1C1EH 15C8L 4L4VA 1CZ8L 3NCBB 1MIEH 1MJJA 2H3NB 2ZZUT 4G6JH 5ETUB 3IXTB 5JLZB 1JZEA 3IYLW 4NQSB 2Q5BA 2DEYX 1VPOL 4QHLB 1A9BA 2MCAA 3MV01 3ARGA 4L8SC 3RWEB 2V7NB 1NA8A 1WLHA 2UXTA 3V52L 4MA7H 4YIQA 1QX1A 1CT8A 3LRMA 1JWUB 3TEZA 3E2HB 4IRZL 2OMNA 2VZUA 1BFTA 3KVDD 3O6FD 4PRBB 3DXAD 2UXVA 1L3WA 4EVNB 4M7JL 1SFHA 3ZGIA 5B1AB 2ZIDA 4R5XA 5E2UH 4FNTA 3R1GL 1DQIA 5ILTH 3GSNL 5KVEH 1KBGL 3GK8H 1DVFB 3GTNA 3QUZD 2NMSA 3JV5A 4CUCA 1RERA 3WEBA 3X11A 2IG2H 1T5KA 3FB5A 2X4PB 3M8OH 4XNMB 1PFCA 4I9XA 3TBWA 3NIDE 4J3XA 2Z31A 3HZMB 3BC9A 3MNMA 2IPTL 1E6JH 2KLSA 2VISB 4FA8A 3MCYA 1ND0B 2EYTB 2HFGH 1W0YT 3MRFB 1TZIB 4GRMA 1ES0A 4OVVA 2FLRT 1PZDA 2AQ3A 3CFUA 3K80A 1L4IA 4KQ4L 4XNXH 5I16A 1LWHA 2FWLB 1TITA 4P4KB 5D2NC 5A2BA 4X80H 4BM7A 1DSWA 4G9DA 1G7HA 1HEHC 4G5AA 5FAAA 2E56A 3VD1A 5L8JB 4BWWA 3PAZA 2Z7UA 4MJID 5IG7A 3O0RH 3Q5OA 1MI5B 1KPVB 2CBPA 3NCWA 5IQ7H 3V4PA 3RZWA 3ECWA 4EDXB 1FSKB 2E3VA 2YD6A 4XCCH 1UJ3C 1OCRB 1WBZA 1SUJA 2WZ0A 3NCEB 4P2OA 3WO4B 4P57A 3QUMA 4U7KA 4P9HH 3UEZA 3ZE1E 3MFGB 1NWOA 4FABH 5DMIH 5AG9A 4GUQA 3WTSA 4NHUA 4OKVB 1H9DA 5I5MA 1T0PB 2H6PA 4BV1A 2YUWA 1X4ZA 4Y16C 4O5LL 5C07E 4Y2DB 4XMUA 4L2LA 3IU4L 4BBWA 1XGTB 3VWJA 3RVUD 1U91B 1M1XA 1C16A 1ZOXA 2R69A 3H6AA 3UYPA 5I1AA 5I66A 5DQ9B 1LE9A 3M7OA 2ZX9A 1UC6A 4BHUA 2PCPA 1PX3A 1F3RB 3FT0A 1INDH 4NJAL 2Q2LA 4ODBD 4PJEE 1CS6A 5DJAA 1HSAB 2BVPA 2VLKB 1K4DA 5J5EA 2WCPA 2FIKB 4YFDB 1IKFH 1QVOB 5CLXA 2WZAA 4RFEA 1NKGA 1C12B 3ILQD 3Q1SL 2ZTBA 1JPFB 3EOBA 2B1HL 4G6AC 3I9PA 1JERA 5IVXB 3SPVA 4QF1B 3RI5K 4OGAC 4RGNB 3BSHA 5F7NC 5D72L 3B7YA 3NIFB 3BQUD 4Y2OA 2QFRA 1BEYH 1AQKH 1ETB1 4YUEL 4Q97A 1K6QH 4YDVA 1IBGH 3DIFA 5K93A 3DNKA 2DI7A 1HYSD 5JOFA 2WBWB 1QWHA 4FFZA 3QNXB 1NCBL 3ZR5A 3L1GA 2XETA 2ZKHL 3QYCA 2ISDA 4O2FB 3EZ8A 1JK8B 3VWKD 4AEIH 4JQIH 1YAZA 1MG3C 3LNIA 2X4UB 1NAKL 4GMTL 5I0ZA 1A9VA 3P0VL 3HS0A 3CDGB 2XXMB 3S34L 3BLKA 3ZR6A 4OJDH 2CR6A 3OZ9H 3SCMD 3BESR 2J8UF 2BW5A 2J1WA 3HI1B 5EU4A 4UQBA 1S7VB 1T1XB 2R0KL 3BN3B 4LB8A 3VA2C 1B9ZA 1MELA 1MY7A 1PBYA 1Q1PA 3HNSH 4NO5B 5GGRB 4F7CB 1DTUA 4GW4A 3CFJB 3II1A 3MRDA 4GW1A 4NFBA 4HALA 3MRKB 3VFOA 3KPMB 2VW4A 3FU5A 4JFFA 4Y2DD 1QFUL 4GAGL 1KN2H 3ARQA 4IJ3C 3DSNB 1L9SA 2AANA 1MFMA 4GAJH 2FBRA 3K8KA 1FL6A 2K6YA 4HJEA 4RA0C 1KCUH 3CZKA 3HRPA 4RETB 2BFGA 4XBMA 3VW3H 1RZKH 1VEMA 4Y19A 4LAQH 1NMBL 4XX5A 2UWEB 2OJEB 5EIVA 8CGTA 4FLSA 2QDVA 2YBGA 3AWGA 3BZDA 4LCWB 5DEJA 2E8ZA 4N87A 4N0YH 2OMYB 2ICEC 2UYLA 5ETUA 4WWKD 2R23A 1KF9B 1NUNB 2K4WA 3QI9D 3FSOA 1X5JA 4P4KD 1KBBA 3KYNB 3QIWB 2FJUB 3OJDB 4L29B 5F89B 4FP8H 2LQRA 3VFSA 3DVIA 1N26A 4QNPE 2DQGL 4MCMA 4AVJA 3VX0A 1F6LL 2YXMA 4I0PA 4L0ZA 5IV2A 4M56A 5HJGA 1G4MA 1JWUA 4FD0A 1OE1A 4XB3A 1UT2A 3LX9A 4HS3B 3QEGH 4Z3IA 1YPZB 4AMKL 2K7PA 2DQ6A 1J9CT 1NFIB 2WWMD 2APTA 4QRRA 4H44C 1Y1DA 1JXJA 3RTQD 5FW8A 1DVTA 3VGAB 3B6SB 5C0DA 5AUMB 1VFMA 2IXQB 4FG6C 1R24A 1TJGL 3BISA 4Z78A 4H1LG 3CH1B 5LXVB 1WIUA 1NINA 2AI0H 4R83A 1DE4B 4AW4A 4PVMA 2O6EA 4G43B 2VQ1A 4K94H 3TNMA 1R3KB 4Z3JA 4JDVB 4PY7A 3N1GC 4QRRE 4YDKL 3C2AL 3F83A 4HFWA 2XZCL 4PQXA 5I6KA 4KI5F 1MWOA 1PSKL 2VDLB 4PJ7F 3LHPH 5KJ7E 4E2OA 2CJSA 2A9NH 3T3PF 1E5CA 1HZHH 4PJBE 5F9OL 5K9JL 3QUXC 4IOSD 3DUSB 4AZUA 4BSWB 4OFDA 2NZ1A 4X5WB 3O2VL 3RA7H 2A9ML 4NQXB 1OP5H 5T1MB 4R8WL 2IQ9H 2CRIA 1JWSA 2FBJH 3A24A 4F7MA 4DH2B 3CN4A 4ZTPL 4C47A 2ZXCA 4NOFA 3BUQA 3D25A 1V8HA 1LNUB 4U1NA 3L3JA 5A2CA 4YSTA 5I74B 4MZIA 5BJTB 4G3YL 5D2NA 1GSKA 2YPVA 5IT2L 3DUUA 3L1OH 3GRWA 5CHNA 5EC2A 3HS9A 4BKSC 2HVBA 3V0HA 4HZ1A 25C8L 5F7MC 4M4RB 1FNAA 3N5AA 2XPZA 4HGWA 4LU5L 1ZCRA 3MV7E 3N04A 3EJJX 1GXEA 1GIGL 1DVXA 3WLWD 3Q1EA 1BREA 2UZXB 1B4RA 1KIRA 4BWTA 3GS0A 5IVNA 4PBVC 1T2XA 5E24E 4UIKH 3RWJB 1R3JA 4U1JA 5KYXB 5F6HJ 3OGCB 1F97A 2YS4A 2XN1A 3GSNA 3H9SD 3FUFA 2BP8B 2C3HA 1INQA 4GI8A 2AJVL 5C86A 5HGHB 3IN2A 1OWWA 2XWZA 4Y1AD 2CRZA 2VISA 5F6IC 4AQ8A 1HHJA 1OTSC 2XG5A 1PW3A 3PNWB 5F96H 4K3JL 1BQ5A 4GG6A 4JFXB 1DQQB 1QMUA 4IRJB 6TAAA 3OLGA 3RVVC 2KI6A 2A73A 2NQCA 1Z3GH 1OSPL 3HI6H 1RJCA 3ARDB 3D4GA 4C57C 2X9XA 3P2BA 2IWFA 4MDRA 1HHKB 4MJ5B 5D4JA 2R69H 2E27L 1K8DA 4DW2H 4AGNA 2WYTA 4X6EA 1NCWL 1A3LL 3KPRE 2EDOA 5E8NA 2AJXL 2EACA 2N7SA 4I0PD 4JFFB 2C7UA 3ZTEA 4P46A 1KJVB 1MQKH 5DRXB 4R4FL 3P9LA 1CE1L 2HVJB 2RAMA 4Q9RH 3PFQA 2LHAA 3BIKB 3QHZL 3MI6A 4IBUA 4AJVA 5D70L 3JTTB 1T3FA 2J6EA 5HGGS 4OZGB 5HY9A 4HWZB 1R5IB 1DQDL 4NO2A 2XWCA 4OD1L 1ROCA 1C12A 2Y7OA 1ZANL 5F89A 2ATAA 4HS6B 4DKTA 2XWRA 3AXHA 3EBAA 2DQCH 1LEGB 4NKOB 4R0LA 1PJWA 4PJIE 3NVQA 1TU2B 3BYYA 2IDFA 3DHJA 3GNML 2CPCA 3KPOB 4MCNA 4NQDE 3P0VH 2L04A 1NGXB 3CPUA 3L48A 1JL8A 2VQUA 5E7BA 3RJQB 1FIGH 5D6CB 3QORA 4MAYD 1AHKA 1II4E 4MB5A 2DYPA 1BBDH 2E4FA 5L0QB 3BJLA 2OJZL 4WFFD 1FZKB 3HEIB 3FU6A 2IQAA 1PZSA 3CPLA 3FT2A 3K6SA 3EJQA 5FGBA 5AAWC 4X4XB 1F6FB 4CDGC 4C56E 5D1XA 1XQ4A 3BPCB 4GW4B 4LRIA 1FFQA 4NKMA 2HRHA 5GRYA 3HG2A 4DF9A 3N40P 3GXFA 3PHOB 1XCTB 4BFKA 2Z93B 2UVFA 1A1OB 1YQVH 4HEPA 5B38G 2EIMB 4FG2A 3EYUH 3EO9H 5C08E 4O2EB 1Y6NR 2G3MA 3MN8A 2PXYA 4KK6D 1QFHA 1TR7A 1NAMB 3TU6A 3G9VA 4GKSA 1JCKA 3CSGA 3TBBA 4NUGH 2OX5A 2WNXA 3C6LD 4TVPE 5E99H 4PJ5D 4KZDL 2FX7H 1ANUA 4HX1A 3T0EB 2CWRA 4XMKH 1S7TB 1I53A 1D7FA 4S11A 1KB5B 3BJ91 4ALAC 2GTWB 1OGTB 4PJ8A 2X70B 2ICEA 4Y5YA 2NYKA 4M6ML 2YMOA 5L2JB 3TCXA 3Q6FA 2YQGA 1QEWB 3FL7A 4OF3A 2XZQH 4EDWH 4JFOB 2AHIA 3GZKA 4M4RA 4MDIA 1PAMA 2AAAA 4IBLT 4FABL 3Q6GH 4A2HA 5J8OA 4ZMXA 1OEZW 1C7TA 2AI0L 3S3DB 1QUNB 4HETA 2BFVH 5B39B 1BGXL 3RX5A 5CCKH 2EAEA 5CSGA 1TTBA 4G72B 2XG4B 4ODSH 4TNFA 5JHLH 3NZ8B 4MQTB 3CX5J 3QDJE 1S46A 1Y1UA 5I1HH 1EUTA 1HFUA 1TFHA 3LB6D 3KH3A 4GSUA 1KJ2L 5E08L 5E4EB 1NPNA 3FNKA 1QLEL 3MBEA 3R4RA 4U1GB 5J6HA 3UTSA 3ULUD 4GNKB 3PIQB 3U9UA 2NNCA 3QDMB 4N3UA 1MCPH 2YAHA 4DUWA 4ZMQA 2PCFB 3MRBA 4XPBL 4MMZC 1WT5C 4LNRA 2V9QA 2P8LA 5FO8A 1XGRA 5ECJE 5IB4A 4U3CA 4BZ2H 2EDBA 1WQVT 3U30C 2BO0A 4P2OC 3T77B 1H6TA 2XIIA 4XE0A 2X4RB 3HI5L 3HMXA 4Y88A 3U79A 3UH8A 5TFSL 4ZMTA 3X3FH 1NUGA 3MRIA 3VXPB 3VDCA 3SDDD 1DJZA 1YYLL 2AQRA 4OI8A 4KI1A 2VXQA 3FTYA 1A7BA 2DQGH 3D34A 1F4WL 3DVGA 1XTLA 1S7QA 2BSBA 3QXWA 3RPKA 2Z3FA 4AGMA 3S0PA 3ABLB 3GSOA 4WHTB 3O11B 3VVVA 1FRGH 3EDDA 4MZ2A 1S9WA 4HJIA 4JY5L 4IHOB 3MZGB 1W2KT 4MYWB 1JVOA 5F44A 4L4TD 3ZE0F 1W8NA 5C6WH 3VWJC 4G6JL 4OZGA 3RRQA 2AXFA 1F0LA 2K3HA 1ICTA 4AT6A 1K3IA 1JHTB 1FZOB 2D2OA 4DO4A 4TL5A 1L0PA 4AG4H 1G0YR 2WKOA 3HZVA 1HNGA 4IRZA 2KLRA 1A3ZA 3SDAC 2LW3A 2Z91B 4ABUA 5HYJE 3LIZH 4JPWH 3ETBF 4M9PA 3OZ9L 1T83A 3SDCA 5HDLA 1QNIA 3IXAB 1RZPA 5EA0H 4GP4B 1I1YA 4OUOA 3SYPA 2IBZX 2M83A 2X6VA 2Y3NB 1BG9A 1U2CA 1O5DT 3QI9C 1R5VA 1DR9A 4OU3A 5H37G 1NBCA 4PWKA 5DLLA 1D3CA 4PY7B 1GHFL 1OP9A 2N1TE 4M8RA 2WLMA 1J8HA 1XCXA 2CGZA 2QELA 4X4XA 1BEXA 5BO1H 4G83A 3WL9A 3MRJA 2YRZA 2VR6A 4D9QD 4DAGH 3LVEA 4AGOA 2I9TB 3DURB 1NBQA 4IHBA 4EBQL 1XH0A 4XXWC 4JM2C 5E8EB 1RHHB 2ZP0T 2EEXA 3B5HA 4YBLC 4GRWH 4ATTA 1CL7L 2APWA 3UC2A 5IGXH 1BFSA 4PJ9C 2I69A 5A3IC 5HVGB 3D3VE 4OJFH 4M3JA 2HA1A 3SCMB 4RH4A 4XCFH 1NBVL 3BMWA 1ID5I 1YEHH 3G6JE 3K72A 4BSJA 3UGEA 4Z7NF 1PX8A 4I9WE 4LHUB 5C08A 2CKBH 2DQIH 4IMKC 1NBYA 1V54B 1UM4L 1GZQB 5I1CL 1HAUA 3WFCL 5KS9E 4HGWB 4DKEH 1RLWA 4NUJB 2VITA 1EANA 3IFPB 5FCUL 3WHXB 1I75A 1JBJA 4JJ5B 4NERA 2LU7A 3EHBD 5T3ZL 1F86A 3O41B 5F3HA 2AVGA 4CVZA 3VNZA 3HNVH 1ZSHA 2CR0A 3FTZA 3BXNB 4JFYA 2P46B 3NCJL 3P0YH 1SJVA 5F7FA 4J3VA 1N0XH 2CJ3A 2ZWLT 4RA3A 1XXDC 4YBHA 1CD1A 2QQKH 1G9MH 4X5PA 5H37H 5B1CA 4WCYL 3ZE2E 3GMRA 4X80L 5DQDH 2C5DC 2B3IA 5CD3A 4L3AA 2X7LB 4OGYL 3MUY1 4JPVH 3U7YH 1JGDB 1USQA 4DQOL 1KBGH 2RD0A 1EJOL 4UV4L 1KXTA 1VFUA 2BNRB 4F7EA 4IM8A 1YQVL 2HSIA 5GGRA 2WLZA 5C07D 4K07A 1A1NB 2GYSA 3T0WA 1WUNT 3A67H 3ZJAA 1RPUA 1T7YA 4PLNC 4DK5A 4KVCL 1HKLH 4FQXA 4RLDA 2CGRH 4Q0XH 1A64A 3TBTA 3QCVL 1RD6A 2Y36H 2VQTA 3PPSA 3IJ9A 4JHWH 3UIYA 2MKWA 5AWNH 3MNWB 1J9QA 1VFAA 2CKBB 5KBLA 2VN5B 1CYWA 2JSFA 2CO7A 4HUUA 5I30L 2JI3A 2HKAA 4WO4B 4H2CA 1Q72H 3KLSA 1SPDA 1EEYB 2X4RA 2DKSA 1N6UA 4AI7A 1NLDH 1VCAA 5K59E 5AW2B 4LSPH 2YD3A 2X2HA 5I8OL 2EDWA 1KYFA 5AOZA 2F68X 4Y4KC 5LWYH 4OZIF 2WXNA 5IBUB 2HLEB 4DTGH 1T66D 2CDFB 1ZT4B 5FFLA 2XPGA 1AZBA 3QPQD 4HAFA 2R0ZL 1ZLSL 1ZV9A 4WFGE 1G7IB 4JN1H 1U8IA 1R5IA 3RIFF 5I74C 3TCTA 3KPNB 5CF3A 3NABH 2E7HA 5DURD 4RMUA 4G6ML 1JPTH 3QEUA 1VGEL 2YAPA 3WUZA 5JW3L 2ZICA 3HZKA 4PJAE 1URLA 4W6XB 4JJHA 1I7TB 3MUGB 2DIBA 2LTQC 1J0JA 1WA0X 1JF1A 3HJEA 1JHTA 4XVTH 1BQSA 3IGAA 3D7PA 4YL9A 1CGTA 3ZN6A 1RZ8A 5C70A 4BZ2L 3PXHA 4Y16B 1HH9A 4APQA 2PP7A 3DARA 3MSPA 4XBGA 3ILEA 2Q87A 1P4UA 2FL5B 4QT5A 2EIZB 5F8QC 5IOPA 1EAQA 1QBLH 2VDOL 5C9KA 1AFVL 1CGVA 4GQRA 2WXIA 1J7VR 2F19L 2X4QB 2Y07H 5ESAA 4OZGF 1Q94A 3QG7H 4YXKL 4FNQA 2O6CA 2G9HB 1MCBA 1UZ6E 3O45A 3WJLC 4OV5B 2IAND 3Q01A 2Y5QA 3WKML 5HYJA 4LARL 4ZZKA 4M1CC 3H0TA 3JWOL 5T1MA 1KOAA 3CDYA 2A6DB 5JHDB 1GKOA 4U0QB 4WJ5B 1AR1C 4K71B 4MMYB 3VQ2C 4CGTA 3X1NA 5L7XL 2E46A 3V7AG 1QNZL 5ISZB 4XN5A 3KH4A 4O02A 4EOWH 3P2TA 3Q8CA 3ZDZF 2PNDA 5BRZA 3FUKA 3QJOA 3MRCA 3WLWC 3MBXL 3GSRB 3OAZH 3ENEA 5FPIA 1I3UA 4WU7B 1KJ2B 1QHOA 4MNGA 4JKWA 1VENA 3SDXA 4GRLD 4K7PX 1OAZL 3NK3A 4FL4B 4GQQA 1AGDA 2V2XA 2QDWA 4IRJD 5DC9B 2IDUA 1CIDA 3QIWC 3HIZA 1EA9C 1PTZA 3SE6A 4IKKA 3CHRA 3TA3D 1P9MA 2B59A 2GVYA 3U9WA 2GY5A 3V0WL 4KTGA 4OIIH 2DB8A 3VD9A 2VAAB 32C2B 1QP1A 3ZUNC 3C6EA 3MLPA 2DLFL 4KMLB 5JUEH 1BZOA 2V7NA 2BNQA 3PXLA 1NLBL 3QQDA 4XB7A 5EORL 2O1AA 5DS2A 1X44A 5C1MB 4N0RA 5B39A 3FRUA 1B2WH 1IZJA 1D5ZB 5DWUL 5K9QG 3HS8A 1Q9LA 1WZKA 1CDGA 3ARBA 2XIBA 3D85A 3GEFA 2ZUWA 4LGSB 5F3HB 1XGUA 3CZUB 4L3EB 1UOWA 3ZBMA 1Y6KR 1D5IL 4YPJA 4M8QA 3IJYA 4N85A 2CDEB 1BXAA 3GIVB 1OP3H 4B9CA 4PRHA 1MFNA 4OUUB 5J6HB 3SYCA 1TPXB 3IJEA 3EADA 4N9OB 3JUZA 5EBLB 2BNQE 2XN9B 2Y0SA 5GGUA 1WEJH 3SEPA 4NCDA 1P6WA 5DEZA 4M1CD 2YN3A 1IBZA 2N4IA 1GW0A 1EDYA 1IGJB 4HUMB 2WPGA 4UM9A 5GXBB 4Z3FA 1XBDA 1X4XA 1NL0H 3FB8B 1J1OL 5K39A 2A0LC 1JHKH 4BZ1A 2EIDA 1OE2A 4QYOB 1UA6L 1SXNA 3S6CA 2OTUA 4X7DC 2YXWA 2HRLA 3EF4A 3QXVA 1A6TB 2C8NA 2DDQH 1IC1A 4RAUA 3DURA 2DQEL 3QDGA 1DHKA 3CVHB 1IAII 3E80A 3WNMA 2DQTH 4OB5H 4ZYKA 3QR1A 2CKBA 5D70H 1S3KH 1MUJA 3QIWD 4TSAH 4GJTB 3ZQWA 1F2XK 2J2ZB 4NNPH 4WW2F 1YNTF 1CO1A 1TLMA 1HEZA 2FEDC 3STLB 5TF1L 1OSYA 1QKZH 5GS0H 4HS8L 3O8XB 1CF8L 1EXUA 4OLZH 3U9PH 3WKNA 3D9AH 2VWEE 3MCG1 1JIBA 1C8PA 3MV9B 3QIBD 5HGBB 1E9PA 4K94C 1VACA 3B4NA 4WO4D 4KK6C 1N6VA 5F3BA 3BPNC 4K9EC 3H7BB 2XVGA 3QFJA 3ETBJ 1KIQA 4P2RD 4TSCL 3KWWB 5G55A 2OMXB 4GSQA 4JHBA 1G9NC 5FYKL 2FIKA 4TUUA 3MJ7A 3HZVB 1ZKAA 2I7OA 3BWUF 1KXVC 3C6LB 3DIVA 1CI3M 1SVBA 2F61A 2P5WE 2PF6A 5LAXA 1DBMH 2MCPL 4NZFA 1KJMA 4D8PB 2ENQA 2JTDA 4JHWL 4QDGA 1OSPH 1CFVL 2PP9A 1OAUH 1I8KB 3HI6L 2GEEA 2AEQH 5IEHB 3WNOA 5FYJU 1JGDA 3JT2A 4KDTC 4QLWA 1A8JH 2DDQL 3IXAA 5BRPA 3K4ZA 2P52A 2X4NB 5D7LE 3TGXA 4NKMB 3LQAL 3QIUB 3HPLB 2VDQL 3W9EA 1AO7D 5ALBH 1IC7H 5B3SB 3W9DA 1AHMA 4D0BB 1IFHL 2AJ3B 3WHE1 4QPEA 3K3QA 3FFCA 3GJFH 3FO0L 4AZ8B 1Q94B 4FEMA 3MLRL 5H35A 4KKAD 4GAYB 2DICA 1EERB 2FJFB 5I0XA 3OXSA 3RP1A 1S8DA 3W0WA 4EXKA 1IE4A 4XPFH 1PZ5A 2DWEA 3THML 2AK4B 1ZPUA 5GJTL 5FGBC 5IMOA 3OR7A 3P2DA 1N0XL 2X28A 3DOSA 4V33A 1FH2A 1ZLEA 4YSAA 1R9FA 2ZCHH 2A6DA 3QC5X 2R2CA 3KPMA 2NUTA 3V7AE 3WFDH 5BZZA 4PRAA 3WJLA 3CFDA 4KX9A 5CILL 4ZX4A 3OJVC 4HT1H 1K85A 3C9NB 4QGYA 1F8TH 2NR6C 3DI3B 4RESB 3MRCB 3WFCH 1BM3L 3L3HB 1DANT 4XX1G 1XVSA 1N2RA 5E9DE 1ZHLA 3HOGA 3W81A 5L8LB 5JXAL 3ESMA 2MIZA 4WEUD 2QEJA 4XR8C 1DVFC 3COOA 3FUDA 4K23H 2CM6A 4JB9H 3RNQA 5DHYA 4JPIA 4C83B 1E90A 2B4CL 4PLKD 5HDWA 2O30A 4R7NB 3GBNL 4G1EA 3U82B 1P5VA 3QRFM 4UQDA 1N59A 1M3JA 2YPLE 1NJ9A 4OGXH 2VR3A 5ADPH 3QUYB 1YMMD 5JW4Q 3BH8B 3MRNB 2QLVB 3MLRH 4PR5A 2WO3B 1ZS8A 3SBQA 5KSBA 4QT5B 5CS7A 3PIQA 4QXTA 1U8KB 3L6FA 2Q10A 4EEEA 2HT3D 4AEEA 4BUQA 4FI7A 4OD2A 2YAOA 4X5LA 2YGPA 2ZXWB 5FIEA 5KJ4A 5CFHA 4JAMB 2V2WA 3KDMA 1BXUA 2VUKA 5CLWA 1AHWB 1MH5A 1XFPA 3JWOH 4YDMA 5MEOB 1PS3A 3LPOA 3INOA 5D9SB 5AAMA 1Z5LB 2IMNA 1DJWA 5DS1A 1VIWA 1AS6A 1HQRA 2JB5L 4FQPA 4GP8B 1S78D 3ZE0E 3AQDA 3ZDXF 2FEJA 3MRLA 1J87A 2IFGA 3FQ4A 1CVRA 4X8JA 4I18B 3MOAH 2EO7A 3LV3A 1NGQL 2D7OA 3CXDL 4MD4A 5I5JA 3P73A 1KEML 3ZTNL 4NXSA 3CX2A 1OCOB 5HDBE 2NY0C 3T0DA 2ZG1A 2XN9E 3K0YA 4BSVB 2OCCB 5JDSB 3ZTJG 3ARRA 2ITEA 1KCSH 4HC1L 4YHPA 4R2GD 1J1XL 4D9LH 4HUUB 3O3AA 4JL2A 5CEZH 5DUBA 3TF7C 5EU3B 1A6TA 3GHBL 4Y1SA 5IWLA 4WHDA 2OCJA 4TSCH 4NBXB 1PZ3A 2HG5A 5HGAB 3SDXB 9PCYA 2WUCH 5KSAC 1RZ7L 3B43A 5DQ9A 5TQ0H 2V2XB 1HL5A 2AQSA 2O6PA 2WN2A 1CFQA 2GJ6A 3O4OC 3LPWA 4IRSC 4K5MA 1ZIBA 5FUOL 1M7DA 1T89A 2X6BA 1P7QA 1G1CA 1I85C 4DWHA 1Q8MA 1KGCE 4OLXL 4LVNC 3FAXA 3V0DA 3I3DA 4F8TA 4MKMA 1DVQA 3RWIB 1QABA 1FGNL 3RY6A 5I76A 3FTXA 1EO8L 3VI3E 2GJPA 2VDLH 2WTRB 2XFXA 3L5JA 5JR1H 4P5KA 3D39B 2WLYA 1D5ZA 4IKLA 2X6UA 4GQZA 1F13A 3ZYZA 5E5UB 2UX7A 1I7TA 3DX4A 3FF8A 3JWNC 4QXUH 3SGEH 3Q8EA 1D6EB 1NEZA 2LGNA 4F7TA 3N50A 2V2TA 1PG7H 3KGUA 4MQXD 1KTJA 1B0RA 3MOBL 2YKKA 3ZKMC 3FRPA 5TPWH 1T4KB 1A7OH 5JXED 2X4OA 3P4LA 5DZNA 5DD5H 4F2MA 2BWQA 4DEPC 4TQPA 4MNQE 4XMVA 3ZO0A 4G1MA 2X89D 1OT2A 4V1DA 4ZFZA 3WE6A 1ZGLM 1YEIL 4WWKA 2DLHA 5EU6B 2H9GB 1K6QL 4NLHA 4W9LC 3TXAA 1BEYL 4YUEH 3UPAA 1JDCA 5B7EA 1S9VB 3BFWA 4W9FC 5TDOA 3MTRA 5TJWK 5J1SC 4LPXA 1HIML 1IGCL 1FI8C 1YEKL 3QDGB 4JR9L 1WS7A 4U1HA 4YHLL 4XXCC 3O2WH 2WXLA 1MFCH 4ZS7L 2Q76A 1CFTA 3X14A 2B4CC 4TLTA 3BFQG 5I75B 2AF2A 2VLRA 1V3LA 1KLGB 1HEZB 2QVMA 1MN4A 3FJTA 3GSRA 4X2UA 4FI8A 3MRGA 2NNXA 2NR6D 1M71B 1KDJA 3TZVC 3OKDB 1FFPA 1WITA 3P3YA 3M7FB 1UTDA 1E5ZA 4HJJH 2GITA 2HYMA 3IBOA 1A02N 3QZPA 3QFJB 4N20A 4MFHA 5JHAA 5I19H 2QMKA 3VGAC 2F53A 4U6XA 2XBTA 5DWUH 5EZLA 1XF5A 1OGAE 5BZWA 4JFUA 1FNGA 1IC5H 4HDIA 4KUZH 1FP5A 1U8JB 4FQQA 3WTUA 2JJTA 4MQXC 1NFKA 3FYEB 2L3BA 4HKJB 3RFZC 1OPGH 2ZAIA 5BV7L 4O51A 5IQOA 1QAWA 1SY6L 1G6RA 1OCZB 2XZAL 2EDTA 5LGHL 4XH2B 4GG6F 3STZA 4JS7A 1IB5A 4IIZA 3GMOA 3ZDYE 3BAKA 4N2BA 1KACB 3QUZC 5DYOA 2YA0A 3VE0A 4B9ZA 3FHAA 4EI0A 4X5XB 5T5FA 1O6VA 1I7ZB 5CZVL 4IOIA 2CDEA 3GIVA 1DE4A 3NFNB 4JCLA 1ZS8B 4PREA 5KSBB 4QD2E 4HQQH 2C34A 4FXGB 3FQXB 4X5RA 4S0HA 1FNLA 3KMDA 5INCA 4KMTL 4OLWH 3I02A 5DGQA 2AJ3A 3L2MA 1E3ZA 1WPCA 3RPIB 3HI1A 5EU4B 1ESOA 2VLLA 3BDXA 1A6VL 4KNSA 4QRPA 1WISA 3DJSA 3KPSE 5J12B 1PG7L 2CHNA 3EFOB 4I9WD 4XT1C 1EFXA 5L2KE 3ZRSA 4YDJA 5D8JL 3G08A 3ZO9A 3QUKA 5F72S 4DTGL 1IGTA 4G8GA 5HHOD 3BKCH 1A1OA 1EFQA 4HF5H 5MENE 3TJHD 2OXHA 3MCKA 1D6VL 5DA4A 1RUML 2WBJB 2N1KA 1OF0A 1AFVH 3VXUB 1WHPA 4H8UA 2VMFA 5SWSB 3EBGA 4BZ1L 2CHZA 3HVNA 5DDHA 4FQ2L 2EE6A 4NZJA 3CGTA 2YRBA 1D5RA 3O3EB 2J8UE 5FK9A 4J5VA 5DVPA 2CDGA 1VPOH 1UA3A 1EBPA 5KS9B 3SIKA 1QZ1A 5DGRA 3KLHC 1ZANH 4UTBH 4HWZA 2IWKA 3BSZA 1OGTA 1XGQB 4LLDA 2VLME 4HPOH 3MVSA 1Y18A 2WKGA 1P2CB 3X3GH 3FB5B 5FO9B 1AJ7L 1SOKA 3G5YB 2EDKA 4V1DD 4YDIL 3KXFB 2B9BA 3CLFH 4IQHA 4F33A 2G5RA 1A14H 1D5BA 2J8UA 3QJHA 3RDTD 3VDAA 4DQOH 4P5TA 4LP5A 5K69A 5BOPA 3G5VB 43C9A 1N70A 1JRHL 4NUQA 4MNHA 1O9WA 3CFMA 3VD7A 3CXDH 5F9WB 3II2A 3MO1B 1P4LB 1LE5A 1SDDA 5LAXB 3V4UL 2Q3AA 1JV5A 1XZ0B 1V7NL 5ADOL 4Z3HA 2F2HA 1QACA 5I17B 4NKIL 1UWGL 2YSSA 3GJFK 1KPRB 3HCVA 4MD5B 4KHXH 5JQHC 1J1PL 1YY9D 2HWZL 3ROLB 4HXAL 3QISA 4NBYB 2QHRH 3UMTA 2FX9L 3C6SB 4MZ3A 2CA4A 3QDMA 4ZODA 3VFRA 3GI9L 2HTLD 2X2JA 4MQ7B 3HC4L 4OCWL 3WN5A 4OR1A 2ZWNA 2KZ1B 4YLQT 2YD7A 5HDQH 1RK0B 2AGJH 4NWTL 1QG3A 2Y7QB 4CVXB 4MWFA 1DJSA 4PI0A 1TNNA 3I6SA 1IQDB 1OT4A 1YEFL 1OTUC 1T20B 5D5MB 4WUUA 4Z18A 2WUBL 3NJXA 3ZZLA 4O4YH 1U8QA 1QR1B 1B4LA 2OQJB 4P46C 3L3GB 4FFVC 3QUHA 3O3BB 3FOMA 4I4WB 1K2DB 5C0BD 3KBFA 1RIVH 2W9DL 3QULB 4MJ6A 3GF8A 5C71A 1TJIL 3MGTB 1OAQH 2B9AA 1DLFL 1E8ZA 1LMIA 4PJ7E 1JZ6A 1MWAB 4FQIH 4YHZL 5EPMB 4KFMA 1SLXA 3BZFB 4BD4A 3O9WD 2OPCA 1S9WB 5GRVK 4ESKA 2JJWA 4WNQB 1SLWA 5JQ6L 3BQUB 3EGDB 1A4KB 5HI5C 2BP0B 4LKXA 1A7PL 4AV5A 4HKBA 3LH2L 1YMMB 3L9EA 4Y5VA 5GZOC 1ZEAL 3FTSA 1RFDH 3VDBA 4XPGH 2MH4A 1HDMB 3HN8A 4G3YH 4FFWC 2JELH 4NCC1 1YC7A 4PM1A 4XN2A 4ES8A 4OVUA 4PJDE 2K9FB 3U46A 4F9PA 5I73B 3MJ9A 2JCCF 1T1YB 4ZD3H 3QYMA 3QC6X 1KT2B 5D71L 4FQ1H 1JZGA 4TRPL 5HHPA 3CDGA 2AP2A 3LZQA 4N8PA 4DUVA 5I6MA 3S88H 3G5ZA 2NW2A 4MRCA 3U7WL 4MA8H 4TUOA 3NCFB 3UACA 5T3ZE 1UXSB 3LEYH 5C7XH 4M48H 1DBBH 1UYWL 3GI8H 5ERWA 4E41D 3OKYA 1ZVNA 1ZHNB 4KTYA 1VB9A 1TYRA 3UYRH 1I1AB 1PNDA 4WK0B 5GJTH 4BKLA 1AOHA 1WE5A 2GSGB 1KN4L 3WE6B 2XQBH 3W5NA 3HE7D 2EVIA 4JZJB 1DVFD 3QUZB 4B9JA 1KG0A 1J18A 3P4OA 1HZKA 4DAGL 1HL4A 4UIMB 4XVSL 1PSKH 4DO5A 1MLBB 1UKTA 1C5DA 4NT6A 4OI7A 1AR1D 2WQ8A 3IAPA 4PRHD 1H6UA 1T2QH 3LQAH 3O81A 5C0FA 2AQTA 2XKSA 2C9PA 4PJDB 4S0SD 3RY4A 5CN2A 4CMMA 5IHZB 2PR4H 1EFXB 3I9GH 2P49B 4JDEA 4UTBL 1QPXA 4WI4A 4XTRC 3WIIL 3VFMA 3DX7A 4ZW7A 2PO6B 4U1MB 2B16A 3ALXA 2Z34A 4FF9A 4WWNA 3NJGA 3BIKA 4PJAF 5J6SA 3V9CA 1ROWA 3BEWA 4AYDC 5AAWA 5ALCL 4Q9CA 2R8SH 4FFYL 4FNLH 1GR7A 4LPUA 3H4HA 4PSRA 3TEYA 3FH8A 2JKRM 2YWZA 4HIXH 4HC1A 5A2KH 4PJ7B 3HFML 2J56A 3WS6C 1SJMA 3ILPA 4OLYH 4TNVK 2DL2A 2EEDA 4K9JA 1BZDA 4NPYB 4WNSA 1DJHA 5JORB 4FRWA 4WW1A 2VIRA 5C0CE 4LPTA 3QAQA 1TYEB 1XH3B 1DFBH 1OM3H 3VFVA 1RAMA 5C2BH 2JIXD 3GRWH 2R29L 4AQEB 4A6YL 4XNDA 3AMKA 8FABB 3LTVA 4R0LB 4AYGA 3QDMD 2ZXDA 2FQFA 4JJ5A 1V3KA 1MCWW 5B38A 4HSAC 1KJ2H 2IAMB 3PWJA 2N3JA 4PY8I 5E08H 3NGBB 1G6RL 2DD8H 5I8EB 4PWIA 3WELA 4ENED 1QBBA 4NKDA 4UV7L 1JHKL 4KY2A 4F7PA 3GKZA 3AACA 1QSEE 1ILUA 2OA9A 1IBBA 3LEXB 1R3LA 1X5YA 2GCYB 3D1MC 3O4LB 4WWKB 4C56A 3T5WA 1EPFA 2R7EB 3T4AB 5LB1A 2QR0A 3AB0B 1NCCL 1QSFB 3QUYD 4LEOA 3P3TA 4LHUG 3S5ZA 3X12B 3D30A 4F80A 1N6QL 2VYRE 2C1PB 5CGYD 3L3DA 5MEPB 2BVOA 2GTZA 3HI5H 2FO4B 4RFNB 1SRDA 3ULVD 5BV7H 3IE9A 3BZ5A 1COBA 3F64A 4PB0L 1QHPA 5E6SB 2ZP8A 3RL2B 1AQKL 4UU9A 2XTLA 4O2EA 3LKQA 3DMMD 1BZ9B 1ORQB 3U4AA 4AGPA 1P7HL 3IGLA 3MBWA 3S3JA 3L3OA 4NYLB 5SWSA 1FN4A 2UZIL 1KLGA 3CHXA 3CSYB 3K4DA 2GHWB 2WXHA 4HX1B 3S8GB 1JNHB 3IXTA 3L9BA 4HKXA 1MEXL 3GT6A 3SDCD 3FC8A 1S7WB 3RKDD 1TEFA 1BYPA 1OXYA 1THCA 1ZTXH 4QOKB 2R0LL 4I8DA 4P2AA 1JPGA 1L5GB 1L7TL 3P11L 2BMKB 2PYFA 4FQHA 2ZT9C 3ES6B 1EEZA 1RUQH 4YHLH 2BJML 5SWSE 4LDLB 3TN0D 1MWAL 3OJMB 3VXUE 3QPKA 4CC1A 2NY1C 5HI5D 4BK5A 3ULVH 1DBKL 3LKRA 2XX0A 3TJEH 3WGUB 4ZFOL 1OM9A 2WCGA 3O9WB 1PZ2A 5EO9A 1IM9A 1MF2H 1NDGB 5DI8B 3NFNA 1TQVA 4HFUL 1DDHB 4DPBX 3FTGA 2X9WA 1QLFA 4LSUH 1BVNT 1HHIA 2PWEA 5AVRB 4KJQC 5DYOB 1FL5A 5HYSA 2NYYD 3KLLA 4JHAH 4CBZA 1TSRA 4L4VD 4FG0A 5DC0A 1EH9A 4YNYA 3KPRB 4S2SA 4UT7H 1XEDA 1YUHA 4OF7A 3MUJA 4AITA 1WFMA 3GPEA 2X1WL 4JQXC 4OFIA 3FSAA 1PGRB 3D39D 4BCXA 4F15C 3FN0L 1JVKA 4PCYA 4TN9A 4AYFA 1IV8A 2WXKA 2Y3AA 3MRBB 4LARH 4E9XA 2C9RA 2VM3A 1MFAL 3ELQA 5DK0B 1A1NA 1KGXA 5DRNB 5KVGE 1I1AA 4Y4FC 2HLFD 5IQMA 3Q2NA 1BG1A 2Z1KA 4IBYA 5FCSH 3O6FB 4R96B 1ADQA 1DYZA 5FDYA 2OL3L 4JO2H 5JOEA 1GOFA 2H1LM 1FO0H 1M6UA 3LPPA 2WB7A 3EYFA 3LKNA 1M2VB 2F5AL 2KKQA 4L0PB 5KANG 2VN5A 1Q1JL 4QRFA 5BS0D 3WLBB 1EX0A 2MCG1 1VKXB 3BI9X 3L3GA 4OLXH 5IFJB 2YPLD 4UOW1 4CU8A 2X6AA 2JQMA 1CLYL 5DHVB 5FOBA 3QS3A 5EUOE 4K8RH 1ZVSA 3APCA 5DO2D 3D09A 4LCWA 1P5UB 1S5IH 3P30L 4JN1L 1WCBA 1WZLA 4PBDA 3A22A 1LO2L 3TN0C 3ET9F 2FYYB 1HXYA 1CCZA 1B4TA 1VGEH 3AW5A 2OMVA 1WGVA 4HEMA 4Q6IA 1HSAA 3OG4B 4IGBC 5CIPA 2VZTA 4QAWA 4X7FC 3K8LA 4Y2LA 3MLVH 4S1RL 1FQ9C 3D0VB 1R4XA 4TNVF 4A7QA 5IEKA 2MQCA 5J11B 2PR4L 1R0AL 3MFFA 3QJVB 5GISL 1IAOB 4LCUA 1PKOA 5KBNC 3IVKB 3WUWB 3SPVB 4K55A 1MZZA 4LAQL 4FAAB 2YD0A 4I77H 4HGKC 1HU8A 2C4XA 2OTWB 3OKEA 1DBJH 3EUDA 2APFA 4XVSH 2NW2B 3MREA 3JUYA 4B9YA 4AQ1B 1E28A 1ETZB 2PKDA 4KPHL 4Y16A 5E5LA 1R17A 4XVUD 3NDZE 3PAUA 1JV2B 4CU7A 3IMTA 5LXVA 1MFDH 4A67A 1RQ5A 5TQ2H 3DUHA 4MA1B 2PW1A 5BW7C 2W9EH 3ULSA 1XBRA 5SWSD 1GOHA 2JJTC 1PX4A 2P7TB 3IJHB 4FJYA 3N44B 1N3NA 4S1QL 1AE6H 4Z7NB 4MNQB 4NWUL 4EQ3A 1R5VB 2AABH 2QL1A 3T6WA 2Y36L 2VZ3A 3B9KC 3O0LA 1RJZA 4OTXH 5IFAH 2RCSH 2FDBP 3OAYK 1G9ML 4N8VB 2B20A 2JELL 2XA8L 4PAZA 2FO4A 4MB1A 4YR6B 5BQ7A 3T2PA 3VQ1C 4J3OG 4NN7B 5JHDA 3U7YL 3PRZA 3QJXA 4MNGE 2YXVA 4AUJA 5FOBB 1E7VA 2EDRA 2TSAA 1NGQH 3D39E 4F24A 2OMZB 4PRDB 3BIAX 3FMGL 3LZRA 2W5PA 3VRJB 1PPIA 1U36A 1M6OB 2DWDA 3DVFA 3MBWB 4DVBA 4Y4HC 5FWQA 1IQWL 3BUYA 4ZMVA 3BQVA 2E7BA 5HHNB 4A2MA 3U4BH 5M7QA 1FUNA 1FZJB 2BX5A 1BVNP 2P8PB 4AK1A 4WI9A 1A7PH 1NKRA 2X2IA 3B2UD 1ONQA 1WSST 2VJ8A 3HS0C 5FGCE 5F70A 1A7NH 1CFSA 3I75B 3ZGHA 4YHYC 5ADPL 3R8BB 3FTVA 2A9NL 3QE5A 4E36A 4DZBB 1I1FB 5HGBA 2HFEB 4GQ9H 5FA4A 5BS0E 1F90L 5AVQB 1BQRA 4G9FD 1RUPH 1CL7H 1IAKB 2X5PA 2PP8A 3ASOB 1A4KA 1NEPA 2G75B 4OGAD 4F8LA 2PYEA 4LO9A 3QW9A 3VACA 1MHEB 4ABQA 1IRAY 4PJFB 1ED3B 4AX3A 3RLSA 1P7KA 3T9WA 3LNEA 4BQ9A 1SZNA 5ANME 4YDKH 2E9JA 3IJYB 1JI2A 4ZFOB 3G5XB 4Z7VA 3SKOB 4Z3EA 4XCNB 3ZUCA 5BS0A 5K59F 2GSMB 1SHXA 3VSQA 3ZE0B 1B0IA 4NENB 2J73A 2BW4A 4PJAA 5KS9F 1DDTA 2IPKB 3F7PC 4KRPB 2J88H 4UQ2B 3VRLF 1U3HD 4YSQA 3O2VH 3RA7L 4PGDB 1R3KA 3HPLA 2XWDA 2XTJE 4L8CA 1WAEA 3GHEL 5C0FB 3D08A 1PG7X 2BK8A 1MAJA 1MHPL 4H20L 4TPRL 5DU7A 3QFDA 5IR1B 4NI3A 3RFZB 1A7RH 3BH9B 4XXCA 4AEHL 4DP0X 5J6GB 4HCRH 4X6DE 3LIUA 3DO3A 3UO1H 3DVNA 5FS5A 1A21A 3A3YB 4GT0A 5FYJL 1JGUL 5K1VA 1QI4A 5I1KL 1IGML 2VN7A 5TH2B 3PWPE 4OTXL 3L95B 3D85D 1FGNH 1XSIA 1SJHB 3F65A 4IS6A 2OYPA 4F8QA 3QXDB 3W56A 3KPLB 3IJSB 1TZGH 1AJ7H 2AITA 3ZZQA 3FCTA 4IU3B 2CIKA 3P77B 1FRGL 3E8VA 2CHWA 3V4PH 12E8L 4IKNA 3RAJH 2VN6A 3MNVB 4K2UL 3QNFA 1VACB 3SSGA 4Z7OB 1U2HA 1INEL 4PP1D 3PHSA 1ZDQA 2VLKE 3KEHA 4F33B 2WLIA 4F7KA 3TBCA 1H3VA 1UQSA 1GMIA 3REVB 3QQ9D 1KLUA 4JFQB 4MJ4A 4DCQA 2JH2A 1XH3A 1SOQA 3FQTA 3RG1C 3OSKA 3EXJA 2Y1ZA 4GG8A 1KGWA 3VFGH 3U1SL 1H3XA 4RFNC 4ZPTB 3KPSD 1HNYA 4GW5A 1WWWX 4GFXA 2NY4D 1CLZL 5DR5H 1F1DA 4NN6B 3VVWA 1MHPH 2WNWA 3VTAA 3D8MA 4N26A 1XDTT 4PEEA 1NM4A 4PJCE 2DOCA 3VXQA 4YSUA 5IUCA 1VADA 1BJ1J 5IB1B 1CBVH 2EDYA 4XOBA 3V4LA 3NIGE 5T1KD 1M42A 1RL1A 3KS0H 1I3VA 5EOTA 3NH7L 4J3OH 4P3DA 3FFCE 5DK0A 2JKNA 1EWHA 1DEDA 4X4ME 3QFGA 2L4OA 2HJLA 4I3RL 2P7TA 5DHEA 5J1AA 5HVWA 2CUMA 3LJ3A 1QRKA 4B5ZA 3ZU8A 5C3TA 3ULUH 4ALAL 3QRGH 3QFJD 5AZ2H 4B0MB 2E7LC 3FO1B 1HVXA 1LDSA 1MNUL 3GBMH 3TL5A 2X1PA 4NNYA 1ZA3B 2WLLA 2XJLA 3NJHA 2VLMD 1FA4A 1SYVB 1Z0MA 3HN5A 1K2DA 4Y19E 1XR8B 5HYIA 1ZGLP 5TK4A 2CG9X 1ZT1A 2X42A 5KYUB 2GBTA 1GKEA 1ZRUA 4QTIH 2VXUH 5T1DL 4F57H 3IDUA 2ZNXA 1C16B 3P9LB 4Q9QH 1NL0L 1DSFL 2Z65C 4WI8A 3FN0H 1BIIA 5A6MA 4HIIB 4UQ3A 4FFWD 1G0XA 2FWSA 4BIKA 5CNHA 4IEFA 2NUPA 3NYKA 3WFBL 1BQHA 3NRQA 4ODVL 5KBPA 4GP5B 1CDYA 5D7SL 1P7QB 3NA4A 4PU2A 3RWDA 3ZSSA 4B7LA 2OMUB 3IPEA 4JO4H 1HT6A 5IREA 5L88H 4UTAH 3OQRA 2BXZA 3EIFA 4JVWA 1LWJA 1DSFH 2W8CA 1FDLH 1GYAA 3IN0A 2ZJSH 3FQWA 1E4XI 1RP9A 1TZOA 3B37A 4ZUTA 3KNBB 3MJ9L 3NJIA 4YGVB 3WE1A 3PQYE 4DGIL 5HD8C 1FL5B 1I8KA 2AEPL 3IEAA 5IEHA 1E28B 1ETZA 5ES4B 2YRPA 3OX8B 1S5HA 2V33A 4M7KH 4P46D 4F91B 1MNUH 2YD4A 3IETB 4D7PA 1ZTXL 3T04D 4QHUB 1KEGH 1GPOL 1AGEB 4ZOAA 1T5WA 3FW6A 3UJTL 4NO0A 1IFHH 1IGIL 1B6UA 4R3SA 5DZ9A 4F3FA 3EDJA 3ZYJA 1CIUA 2PYEE 3WNIA 4JRXE 4UM9B 5D9SA 1BVLA 1OT1A 4NRZA 1MCCA 1DQJA 1TSHA 4NENA 4ANUA 4KXAA 3R7RA 3BDYH 2VNCA 5MI0B 2O72A 4IRZH 3TBVA 1ZLDA 2RMNA 2R56L 3WSQH 4BFGA 1GGCL 4HSQA 1DBML 2MCPH 4NQEA 4MD4B 3FUHA 3L4UA 3R4DA 4KZEH 1GY1A 2ATPB 1ACXA 2ADGA 4HUWB 3F6LA 4BA0A 5C07A 1A4AA 3HG1D 3WN5C 3U83A 5DHVA 2TRHA 3EXLA 2NZIA 2UWEA 5IMKA 2ZOUA 2P43B 3Q8FA 3HKZA 4P59H 2K0RA 2G2RA 2WGXA 4K3GA 4QXGH 4WGVB 2HVKA 5C6TH 3HE6C 1TENA 3BWZA 3QEUB 1F3DJ 2D8KA 2OMVB 2ZKMX 4WWID 1EO8H 2EC8A 5T3ZD 2HT3C 4FEIA 5F3BB 1DO6A 4RAVA 3WFEH 1LL1A 4EE2A 1P84K 2F54B 1LK3H 4Y5YB 4E41E 3C5SB 1J5OL 3AY4A 2OSYA 5IBLC 3WENA 2KQNA 2VLRE 4L3CB 1U8MB 1TT6A 3H3PL 1JYWA 4H8WC 3QCTH 2VO5A 3OGCA 4N8VG 3BEVA 4L8DB 3RVWD 3T8XB 2K8QA 4JPKH 4N5ED 4RBPK 2QVTA 3TONA 3FZUC 1F58H 4JM2F 2J25A 2VABA 1Q0YH 2AV1A 2AEIT 3MXWH 4U0RC 1F45A 3VFNA 2C9XA 2KH2B 4ODHH 3S96A 5ITFB 2AQNA 3QO1A 4WFHE 4MNQA 3I6KA 4H20H 3MRMB 2XT1B 4GI6A 1BWMA 2DMHA 3EJYC 4N2IA 2CD0A 2BLFA 4K0OA 2P45B 1X6LA 4U6TA 4N24A 3MOAL 3FSVA 4ZMWA 1ZGLB 4X98A 4ZO6A 3C5ZA 4HGMA 4JN2A 1B4JL 3NAAH 2GAZB 1TZIA 5E5MA 3E3QE 4M6OL 5CZKA 2VXTL 3B2DC 3FBQA 2R0WH 5CEZE 3RGHA 5CR1A 3QCVH 2CXKA 3HNVL 3PJNA 3C5JA 2FRGP 2XYCA 2EE2A 3ETSA 2C7UB 3T0AA 4AL8H 5C92A 3B7TA 4WI5A 2GSIA 5C0CD 2EDQA 4G42B 2O5ZL 3T4YB 2P47B 5ACLA 2MQGA 1GGIL 4PY8J 1KTKE 3EYVA 4E42B 2DWDB 1JGVL 4K7PY 4YZWA 1KFAL 4KDVA 1OK0A 4IMLA 2EVJA 2EO1A 1YNTB 1JNJA 2MFNA 2XWXA 4MASA 2EYSB 1F42A 4K8RD 3IDIA 5CN3A 1I7RB 3QQDB 1G5GA 1SLVA 4XP9H 5EIQA 3U48A 4JFVA 1M2OA 5CSBA 2VDOB 2YPKA 4XWOD 3HBPA 4NRXA 3HMWH 3POHA 5BUAA 4EF3A 4IYKA 4BUHA 5EOCL 1BIHA 3HG1E 1BVKA 5IM7A 4NC1E 4DP1X 1OZUA 2WQVA 2PN5A 4DCQB 1CE6B 3L5HA 2WJ7A 2O93L 3MRHB 1URIA 4DGVH 1AZUA 1CC3A 1BM3H 3IMVA 3O6MH 3PDDA 5IW3A 5TDNB 5L4JA 1FC1A 2MOGA 1I8IA 2X38A 3BKML 5EZJA 2YFOA 5AVWB 3VB9A 1DUZB 3WY1A 3V4VA 2CK2A 3H9ZA 2B1OA 3GMRB 5GZOD 4OCXH 3C5ZC 4OT1H 5EO0A 2A4EA 1LO4L 4H8HA 3VI3A 5A40E 1KTLB 1NCCH 3ECQA 3UYOD 4KRPD 3GQFA 2R27A 2VZVA 2JKIS 2YN5A 3H6JA 2UY6B 3IWVA 5CUSH 2HAZA 1PYWB 1JCVA 2YKLH 3EFFB 4KH2A 2WWKO 5F93C 3HZ3A 5SV3A 5T1DH 3A6BH 3LKNB 1U95B 4LFHG 1WIPA 3VH8B 4N86A 3APMA 4AIZB 4Y9GA 3FK3A 3GSVB 2JI2A 1OKEA 1VZHA 4LSSL 4XRCB 4B41A 1FLTX 1SUHA 4EQ2A 1KTDA 5JZ7D 1MNNA 2H26B 4EZMA 5MP6L 2VDRL 4U49A 3T0EA 2J12B 3LMJH 5KYUA 4RMQA 4TNWF 5HGAA 5FWRA 5I8KH 2G4GA 3SYOA 1Q0XH 4K7PL 5IROC 1NANI 2AZAA 5H4ZA 3E8UL 3AZUA 3FT9A 4Z7UA 5E8OA 5IB3A 4JPKL 1FAIH 3TTYA 2XJKA 3D9AL 4DK6A 3AABA 3N0AA 4X4ZA 5FFGA 2XV2A 2PETA 1AZZC 1X5XA 2E9GA 1KPUA 1Q0YL 3CBJB 5D1ZI 2FNWA 2DM7A 3UBXA 5HHME 4LCUB 4R6UA 5ID1A 3SQBA 3VTMA 3G6AB 3QJZA 4EUPH 3RWCB 4HWBL 4KOBA 3D12B 2Y25A 3KYAA 5IQLA 2P28B 4ZAKD 1NLDL 3C5ZD 1JZ8A 1E4HA 2D4DA 3X1FA 6CGTA 5IW6B 3RWGB 4DGUA 3N42B 3FQRA 4I3SL 3JWDH 4M5SA 4NCC2 3GMPB 1UT1A 3ARZA 5IROD 1YEEL 2QZQA 2EDEA 4PW3A 4Z0XA 1M7UA 2XNAA 4M5YL 1MCPL 2DYPB 2P42B 4LFHD 3APNA 1FFTB 4I88A 4L4TB 1GJIA 1T1YA 5DZJA 2VC2B 3AXLA 12E8H 1SOSA 4P3DB 4R3SB 4F3FB 1U8LB 2Y6TE 1HOCB 1KCKA 4M6NL 5HHXH 2M26A 3HUJE 5F0MB 3WJJC 4EIGB 1KBVA 3ABKB 4XNUL 2XBDA 2WBJD 1Z2KA 3ZTDC 2ZCKH 4I2XE 1IZKA 5KYYB 5GSVB 2VB5A 4IMKA 4KO7A 5CJOH 4G43A 4UT6L 1EMTH 1G9HA 3FO1A 2JKTM 2ZPKH 1LK2B 1BFOA 2NW3B 1S9VA 4WI6A 3H0TB 4EI6A 4MB4A 3EH5B 4GSDL 3JV4B 2G3NA 4CW1B 1TMQA 4NC0B 1A7QL 2YUXA 1PKQB 2J88L 3PPEA 3QP3A 3S2CA 4XCEA 3L3HA 4PJ5E 1DAVA 3FO9B 3DGGA 2ZUXA 2WZ5A 4ZOCA 1NCHA 5E5RB 3U0WL 3GUTB 3D2UB 5FKPB 1UM4H 2FR4A 1I8LC 4FHKA 1UXLA 4L5FH 4YHZH 5JO5A 4Z8FL 3GINA 1MCFA 4H13C 4OM1H 2BRQA 2AEOA 2RFXB 4JFPB 2AXGA 4M6AA 4W4NA 1Z5YD 4NNXA 1ADQL 1Z3RA 1A9EA 1WVZA 5KANI 2UUDK 5I8CB 4W9DC 3CN1A 1IKFL 4BFIA 2BIPA 1KELH 2R15A 3Q7JA 4PWEA 2CIIA 1GRWA 1WRFA 4LCYA 3FCSA 3KJ4C 2MSPA 5BMFL 1BYNA 4G71B 4HV8A 1L0QA 2DJMA 3AQYA 4NHCL 1LEKA 1BVKB 2Y23A 4WW1B 3RGVB 1UADC 2Q8BL 2B1AL 5AB2A 2GEQA 1CFMA 1WWAX 1BD2D 2CPUA 2JJVA 2QQQA 4QAMB 2DQHH 2VH5H 2WQSA 2CLRA 3CLEL 4NZUL 1KT2A 4QKXB 3UL4A 4MHHG 3LQZB 4Z7WB 1N18A 4U1SB 4P9HL 4CBPA 1E42A 3TS8A 5HVHB 1JPSL 1D2PA 2NY2B 4KKPA 5GS3A 3C8HA 3LRHA 4F37K 4FG4A 4X4YA 4MS8C 4OZFB 4K7FA 5EU7C 4YHKL 1S7VA 1T1XA 5HDBF 2WWNA 1T1ZB 4G7VL 1YEJH 3SPHA 2CAKA 3ARGD 1DSYA 4W9GC 4J3OD 3BPLB 5EF3A 2QSCH 4GG6B 1FG2B 2VXQH 4CC4A 4Y1AA 4LLVA 4MWFB 4WWOA 4AMXA 4KGLA 4Z5RA 2EZ0D 4NRYB 2XCMC 5IFHH 2KHAA 4A39A 4BH7B 1NIBA 1C5DB 3MLWH 4NT6B 4L1BA 3F58H 5PCYA 2HZHA 3IFNH 3QPXL 2W07A 2FQDA 3O9WC 2HT2D 3CFEB 5TDPB 4G8EB 5HBBA 1JZ3A 2CBMA 2NRDA 1CFQB 1NGWB 5C0IA 5DMYA 3SJVB 3O3BA 5TPWL 1MJ8L 2VERA 3WY2A 4U1LB 5INDB 4XMTA 1LK3L 4DP7X 3HB3D 3FFDB 4EMZA 2EDMA 5EMYA 1KCVH 4TNWK 5C7ZA 2JTYA 3DX8B 4Y1AE 3BUBA 4UF7C 3DK0A 1W0VA 2YOAA 4UZSA 3DX3A 4X50A 4XE5B 1O7SA 5KS9A 3VJ6A 4G6AD 4ZSOE 3IFLL 4G80A 1AKJD 1A6UL 3WNPA 3ZT5A 2OR9L 2D31B 3T0EE 1DVZA 1RULH 3VRIB 3LZLA 2GABA 4OZHA 5I6OA 4PJHB 1RUMH 3U36A 1LILA 4AVKA 3P4NB 5C0JB 4M6NH 5HHXL 2E27H 3CH8A 3E0GA 2YZ8A 2WLHA 4JKLA 4Z7UE 1JD7A 4NJ9H 1EJ8A 1GCYA 3RWFB 2JF1A 3IDYB 4FNPA 4HS6A 3CK0H 3RNKA 2X7LA 4K71C 4TUOB 1AGCA 3MLVL 4S1RH 3SKJL 4ODUA 1QQDB 1I8AA 4GXUM 3BP7B 4WO0A 1QPPA 3S4SA 1LE5B 1HKLL 3GMPA 4PJCF 5K9KA 2YD5A 3T6QC 1N0LB 4D3CL 4XNQA 3BVNB 4FJZA 4PGBA 3MLTB 2GHZA 4NX0A 4YNYB 4U7SA 1E5YA 2IFFH 2XWBB 3QR0A 3O4LA 4AIOA 4JY6A 2Z8SA 2BSRB 1KB3A 4JO2L 1AXIB 2CO7B 5FGCB 4EN3B 3KL0A 3LNGA 5B8CB 4LEXL 3ARUA 1N7ML 3W0WB 5TE7L 4B9FA 1Q1JH 1U93A 1F5WA 4KBPA 1S7UA 1R19A 1ZSDB 3T8MA 1D9KB 3ZX1A 4NQDB 3SKNB 1U33A 4Q89A 2YBRB 1E5UI 1XCTA 4DHLA 3OC5A 5T5NF 1RZGB 4N4YB 3IBEA 4X9FA 1CN4A 4R2GC 2B39A 3Q5YA 1TEYA 5D2LA 3WEOA 4FA7B 4K3DL 2ZOLB 2GG1A 3AWFA 5GS1C 1FNGB 5AVSB 1JP5A 3BGFC 4F1ZA 4PCTA 2EH7L 3ILPB 3FQ2A 3RZCB 1DVUA 3RVXD 4OZGE 5BW7A 5HYQA 1J0HA 1DQTA 4Y9CA 1FJ1B 5B7FA 5I1CH 4ZO7A 1RUPL 4NZUH 1AACA 3UZVA 3MLYH 2GJZA 3K2KA 4ACTA 4QTIL 5LGJA 4PS4H 1KB5A 1MWAH 3MRHA 1QW9A 5KVFH 1TIUA 4O2CB 5KUKA 3NTCL 1USZA 1BQLL 2BP0A 2DH3A 1QFWI 2ICES 4LKXB 3QPQC 2NOYA 1R3JB 4PJHF 4LOVA 1L7IL 3RKDC 3U4KA 1LO4H 2EE0A 2ARJB 3LHPL 1V05A 5EFIB 4Q52A 1MHHB 2DQDL 4JRYA 5KVDE 3IETA 5TK2A 5DC2A 3ECBA 4UYQA 4N6RB 1JK8A 4ZDHB 3ZDXB 3U0WH 2TSBA 4PH8A 5E6YA 4XN9A 1HN1A 4OJYA 3IMUA 1UD6A 4OFKA 1L6XA 4MAUL 3EO0B 1FAKT 4LLQA 2VLLB 1E43A 4AENB 4Y19D 5I28A 1NC4A 1U6AH 5JXAH 3SD2A 2B2XL 4WI2A 4DIXA 4HCGA 4OZIA 3MZTA 3N1FC 4FHJA 1XD1A 3LH2H 3KBHE 4ZOBA 1HQRB 2FLMA 4L5FE 5FA3B 3VFTB 2EKSB 2C7FA 2FO8A 1PIGA 2O26U 7FABH 3LS4H 3QUKB 4X8GA 1FNEA 5HJ3A 4ZT1A 1D7CA 1RZIB 3TJPA 5CJBA 4L2YA 4EI6B 3EDKA 1Q9OB 3SOBL 1OOAA 5ESQB 5I71B 3W39B 3KM1A 2RIKA 3V5KA 3ALPA 2XY1A 5E94A 2CCLA 1ZD6A 2WWOA 3P69A 2DPKA 5EUOB 1KYOK 3IDJB 4BSWA 1ET5A 5IB4B 5LNDA 3Q2CA 3GM8A 5JMOC 3BVDB 3FT3A 4I48A 3ZY7A 3DX7B 3MYZA 3GM0A 4QRPD 2ENSA 3L3OC 4UM8B 1OP5K 3V4PL 2VN4A 3PQYD 1XGQA 4JY5H 4LLDB 4OBRA 1ZT7B 1MJUL 2W1NA 4CSZA 4QTHA 2J8HA 1QLEB 4HUCA 1U8IB 2OI9C 1TZHB 2R0WL 2ZF9A 1X9QA 4RNRA 3MROA 3WMQA 3M1BA 1YQ2A 1OM3L 3NUKA 4AIXA 4LEBA 2ZSVB 5T3XE 5E23A 4FJ6A 3T08A 4Y2OB 3NG5A 2GTQA 1P0SE 3GHBH 3QDAA 3ZQXA 3HNSL 2VDQB 2XNAB 1XAUA 3ISWA 3P30H 3W0WD 2I5YL 3A4AA 2RHEA 4FNLL 4L4TA 4ZUUA 2ED9A 3CH1A 1TQWA 1WYJA 4DW2L 1OF2A 1QTPA 4JPQA 1HJBC 1P69B 2LLGA 1BZ7B 2DL9A 2WAQA 3M1CA 4FS0A 4GUOA 3UTTD 3MV9D 4KNUA 5CXPA 4MYPA 4NP9A 5DUPL 2XV6B 2WNGA 4KXDA 4AEIL 1KCUL 3TZVD 2W0KA 4QHMA 4FX5A 4Y8DC 5LN4A 1SN2A 1UG9A 4G1MB 3VXRD 4QYAA 2Z4QB 4JFXA 1JRHI 3K1KC 1KY7A 3QEHA 3WEXB 4JREC 1V3JA 4L4TE 2HP4A 1ZLUK 3S3SA 4CW1A 4NRYA 5B1KA 2HMIC 3KPPB 4K8RC 5TDOB 4B97A 3OKMA 2F15A 4EIUA 3L3IB 2JKSA 3DA0A 2EXWC 4NUMA 4L8CB 3UTPD 2ZUVA 3O2DH 4RZKA 5A16A 4G2AA 2WNKA 3BSGA 5LQBL 2H5UA 4N5EC 5C0IB 5C0BB 3VD3A 1P4BH 1OB1B 4PJXA 4AQAA 1LNUA 1T6WA 2CU9A 2WZPD 1YPZE 5EIIB 3POCA 2ICWJ 5F7AA 2J1ZA 4PGEA 1CXFA 1D9KD 2E86A 3MUUA 2DTMH 5FUZL 5H2BB 1CF1A 1DJXA 4LCCC 1A2YB 2E74C 1HQ4B 5JW5A 5HDOA 4ZNCD 1X5GA 2R51A 4HHGA 2IGLA 3KE0A 3MLXH 4O5LH 5L2JA 2VRAA 2QGEA 3SGDI 2KC0A 1QA9A 2W0FA 1RUQL 5BZDB 2RBLA 3D06A 5F2FA 2D03H 5ID0A 3DRTB 2YQ2A 3NN8A 3MLUH 1J88A 2DM2A 2VE6A 3LXAA 4GRWE 4LDEB 4DT2A 5BV7B 3K8MA 4Y9BA 3TJEL 5I18L 4D9RD 1CG9B 5FHAL 4PYGA 3US0A 1NCGA 3LNHA 3VG0H 1BF2A 4E5XG 4NFDA 2WQXA 3FONA 3TEUA 1A1MA 1MVUA 3GKWH 4PGCA 1OAQL 3MNZB 1UZ6F 2UY7A 1QLFB 4MKTA 3VGBA 2BXYA 2PPAA 5EH1A 1V3MA 4Y4FB 3RX8A 2V2TB 5E1HB 1XGPA 1W72L 3BZEA 1DN0B 1IU1A 4TL4A 3QQ3A 5GGSB 4RX4A 2VJ0A 2VKWA 5J3HD 3DJRA 1IC5L 1JWMB 3NCYP 3OKOB 4KUZL 3KLHD 2F7OA 3KBEA 3L9RB 4NQUA 2BNRA 5BRQA 4F7EB 5DD0L 1XIWA 1XTMA 4JHZA 1RI8A 3GSQA 3EHBC 7PCYA 3GI9H 5MI0C 3P3UA 4NJ9L 4LLVB 4MHHI 3V0VB 2R1YB 3OVUB 4QRQA 3ZT7A 3UTTE 1FCGA 4JFHE 4EDXA 3BKJL 3NIFE 3CHOA 2FSEB 4H8WL 2H8PB 4Z7QF 1WFOA 2YZ1A 3IDMA 4XP5L 3O0RL 2OR9H 4UV7H 4M6OH 1EDHA 5JYLA 2NY1D 2NY0B 3L13A 1SJEA 1ET7A 3BFOA 2BCMA 2R9HC 4KAQL 3UTTB 3NZHH 3CVHH 1IMHC 1C5BH 3CDZA 4KQ4H 4AL8C 4S1SH 5HPOA 4GB9A 1HZLA 1FFPB 3TVMD 2H3KA 4PJEB 2X05A 2FT8A 3FKUS 4EUPG 2BVPB 1CGSL 3SDCC 4JDTH 3QR2A 2YGVA 1H9VA 3H2QA 3QUXA 1RJLA 3HE7B 3ARGB 3UADA 5JW3H 4KTDH 1ZT4A 4JFED 4MDJB 1J9SA 3G5WA 1N19A 4QUOA 1OSEA 4CN4A 2FCBA 3MJ7B 1I3RB 2DLTA 4OCSL 4TVUA 1A65A 4G5ZH 3WJMB 1J9RA 1H3WM 2YUVA 4KKCD 4LSRH 1R3HB 4PP2B 5F1IB 1LD9A 4BFNA 4LLMA 2NY6B 4KJPC 1ECZA 5D96C 4RIRA 1RK1B 4NZ8A 1E0OB 4LESA 2E47A 2WYHA 5F7KC 4IW4C 2BC4A 2BSEA 2A6JB 3BT2L 4LASH 3QI9B 1HCYA 3NZ8A 3TIDB 2ZWYA 1UKSA 3L5IA 3KNBA 4YGVA 4JZNA 2K3TA 2X4PA 1UUSA 2EICA 2R2HB 3SJVD 2EXSA 1YA5A 2ZOTA 3BKJH 3U0TB 3RBGA 1QWNA 2YSSB 3B3IB 4DEPB 1TDQA 2WKLA 3MYJB 5DSCB 1TTFA 4JANA 5E56A 3NSJA 3ETTA 3QWRA 4JQIL 1Z3GL 2X4QA 4MMXC 2ADIB 2ILLA 5HI4D 3WN6A 4MCYA 5KYNA 3DJZA 3S36H 1PZ5B 2DWEB 4EPSA 4ENEC 4N8VA 1MJUH 3NQKA 5DEGA 3QUMH 1UXMA 3KVQA 1A6WL 2BIOA 2H41A 3JWNE 5HHMD 4RSYA 5EN3A 3M6DA 1KPVA 5FUOH 5KSUB 4U6VL 5F88A 3NCMA 2Y06H 1ILSA 2XACC 2W0LA 3OMNB 3GLEA 3UPRB 5DJCB 2OMZA 4PRDA 1ADQH 5CWSB 3K6OA 1R1CA 1AQ8A 1OCWL 5AKRA 1FFRA 3ARXA 1GC1C 3CFCH 3TA4D 1HINH 1DANU 1U4FA 4EKXA 1X5MA 4EZKA 3P0YL 2HUEA 3V0WH 1YEJL 3VO0A 3HAEG 2P80D 5CINH 5HYSG 5GHWL 1MIMH 4BFBD 4HG4J 5D5MF 1C5CL 1QEWA 1BIIB 2V5SA 3L54A 4A7UA 4AXWB 2Y7NA 2X12A 4X99A 3DX6B 4ZUWB 5BVPH 3DRQB 3AROA 3BKMH 3PGDB 2FX8L 2JJUA 2J1YA 5IB5A 3FQTB 2R2BB 1G7QB 4CAGA 3L1OL 2DQHL 2DRUA 3CLEH 3I2CL 5FYJD 2JXMA 3V0EA 4P5TC 4NZRL 1L9TA 4QRSB 3HC3L 4ZRGA 1GGBH 1B88A 3F00A 4PTTA 3HLKA 5L7XH 2AJUH 5HYEA 1SEBA 1NQBA 3L3KA 3PABB 3FQWB 4UUJB 4Z3GA 3FONB 3VD4A 1YHPA 2QZ5A 1FO0B 2RQEA 1CDCA 2H2SC 4XNUH 3FT1A 4YZFF 1T21A 1NICA 1MJ7L 3F7VB 2WVVA 1WC7B 1F3DH 3VNYA 1TPXC 3AU0A 4YXKH 1ZLVK 2AGJL 3CXHJ 1P7BA 3FO0H 5ITFA 5CP7A 4W9CC 5BVJB 5CJXA 5EBLA 5D7IB 3SN6N 2NLJB 4U4BA 1BCIA 3G6DL 3QRGL 4FZ8L 5AZ2L 2BWIA 1BX2B 2W07B 3BN9D 3C2AH 3OAUH 4K23L 3FU7B 4FADA 4AL8L 5GS2H 1VFAB 4M7LH 5D4HA 3QFDB 4C55A 1Z9SA 4YE4H 2QTEA 4MQ7A 4H4NA 4N2DA 5EDSA 1EXHA 3EH1A 5JPNB 4Z7UF 4D0DB 4JFEA 2FEEL 1QSFD 1UXWB 2RACA 1W0WA 4OZ4A 3B2VL 4FLRA 4P9ML 4Q2ZA 5C0NC 4AQAB 2FJHA 3OKKA 4OKDA 1AGBA 1JFQL 1LTXA 5AW9B 1J0KA 4JZJC 3V6BR 3ULVC 5JLZA 4GT7A 5MENB 4HWEL 4GY4A 4XAKD 4XP1L 4OLYL 1A5FL 4U6HA 1YEDA 4Z76B 1HH6B 1MUJB 2Y6SD 2R9HD 2DIJA 4HH8A 1LDPH 4K5OA 4X8CA 1O7VA 3MV8A 3PNRB 5TF0A 4LHJB 3KPLA 2R8SL 3ERXA 2HVKB 2P5PA 4YDIH 3UG3A 3P54A 4BCZA 2ZSWA 3U6XA 2RCSL 1U21A 4ELMF 3GLDA 4UOJA 2VDRB 1L0XA 5A6IA 2BVUA 5B22A 1CK0H 2BHUA 2YEZA 1NZRA 2XDHA 3BAXA 3REWA 1KIRB 1PD0A 1KCBA 4QXUL 2LU3A 5GPRA 3AREB 3RQ3A 4ODUB 4AGQA 3FAWA 1VGKA 5KSBE 3HUJF 3MMEA 4R26H 1QFUH 4GAGH 1MCSA 4GBXD 1FPTH 2DBLL 1B6DA 1E9OA 3RWHB 2A38A 5AVXB 5AWNL 3LN4A 2QT6A 1FC2D 1CFVH 3LVTA 3OAZK 5ITBH 1JTPA 5F7BA 4K2UH 4KY1L 4NIYE 3RAJL 1HHGA 1CXEA 3VRLE 4BGDA 4ZFQA 5IJVB 1L9NA 3A67L 3QO0A 1A4JA 3CCHB 3KLAA 3QZMA 3T65A 4NQCD 3NESA 5ERWB 3TLRA 4HMCA 1BOYA 1G9NL 2FB4H 1OGAB 3GXUB 2PTTA 1A5FH 3TFKC 1XIWB 2V9TA 3S8FB 5C08D 3MRQA 4KKQA 2R83A 3L3IA 2WQUA 4NQEB 2Q7YB 2CZNA 4G7RB 4OQ1A 1GJUA 3F04A 4MJ5A 2ZAGA 2COVD 2F58L 1MLBA 4WAFA 3DPDA 2MTAA 1JPST 2BDNH 3FB6A 3VQLA 4WI0B 1A7RL 1U8OA 4TVPD 3UOAB 4WF7A 4E5XB 1YY8A 4ICXA 4UTBA 1HYRC 2AMGA 3D87B 3IDMB 2EABA 3L8QA 2OK0L 5LG1A 1XR8A 2K6WA 3KM2A 3VU1A 5IJCC 3BD3A 1KJ2A 1WBXB 1ZT1B 2HX7A 2W95A 1WAAA 5J9PA 3DROA 4UWQB 5D1QA 1EIBA 3MDJA 1JZJA 1FJ1A 3QPXH 1IUZA 3L4XA 4HCRA 3W37A 4UB0H 1ODAA 2DAVA 3TO2B 4Z77B 3A4FA 3IDIB 2CDFA 1GC1L 4M3KB 1G9MC 4HP5A 2A83B 4FTVB 3IE4A 3VGGA 5ABZA 5DJAB 1CI5A 1Q9KB 4OIIL 4B9GA 5CHNB 5EC2B 3BO8A 3UG4A 1CXKA 5DF0A 4PG9B 4QF1A 3SKMB 4IOFD 4NJAH 2G2NA 4XGZA 1EHLH 3H9SA 1NFDA 1JPFA 1NOAA 3EOBB 2DJSA 1WWCA 4J2QA 3WY3A 2CNYA 1XF3A 3V2AR 2H32H 5IQ7L 1H6EA 1ZVHA 4HHAB 5I5IA 4Z0BH 2VZOA 2AQ1A 4MD0B 1JV5B 2FH6A 3KBPA 3BOVA 3BVUA 2BOBB 5DJ6B 1I7ZA 4P2QB 3QJTB 4G6FD 3TBWB 4HFU