4WI0B

Crystal structure of coh3scab-xdoc_m2scaa complex: a c-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
156
structure length
156
Chain Sequence
GTTVSGYINPDFVTTSTTAPIVKAGFTVEIVGTTKSAVTDSNGYFEIKDVAAGTYTVKITKANYLTREIANVSVTADKELSTSASPILMWAGDMAIGGTQDGAINLEDILEICKAFNTSSTDAKYQVGLDLNRDGAISLEDVMIVAKHFGKVSSDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Coh3ScaB-XDoc_M1ScaA complex: A C-terminal interface mutant of type II Cohesin-X-Dockerin complex from Acetivibrio cellulolyticus
rcsb
source organism Acetivibrio cellulolyticus
molecule tags Structural protein
molecule keywords Cellulosomal scaffoldin adaptor protein B
total genus 41
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1330.10 Mainly Alpha Orthogonal Bundle Type 1 dockerin domain Dockerin domain 4wi0B02
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 4wi0B01
2NSMA 4FL4C 4IU2B 3MN8A 2VN5B 4FXTA 3HN5A 3NJXA 4U3SB 1DAQA 1OHZB 4YOKA 2CCLB 1UWYA 3KCPA 3NJVA 1QMUA 1DAVA 5LXVB 2JNKA 4DH2B 3E8VA 2Y3NB 4WI0B 4FL4A 1NKGA 1H8LA 2MTEA 2XHNA 4UYPB 3G3LA 4EIUA 5K39B 3UL4B 4WKZA 5G5DB 4IYKA 5AQ0A 2OZNB 2VN6B 2B59B 4IU3B 4UYQB
chains in the Genus database with same CATH superfamily
5IWLA 1F1DA 1N8ZA 4M5YL 1HTYA 3N6YA 2BRRL 1NLDH 1CGTA 1O5DT 1TZHA 1MRFH 3RGVB 4Q6YA 4HJ1A 5TDNB 4LHQB 4J3WA 2HJKB 2IQAA 3LZQA 3SD2A 4K5LA 3A47A 3FSZA 3M7FB 1LDPL 1X9RA 1WHPA 2X4RB 4MAYA 3GRWL 5EBGA 3KWUA 4A04A 3R0MA 1WZMA 5KS9F 2BP8A 1XTLA 3C08H 3V9FA 1W0VB 4HKZB 4Y5YC 3WJLA 1Q9LA 1E4KC 4YVUA 3K2IA 5E6SB 3T0EA 4IBTA 5FV1L 4KKRA 1EMTL 4D7BA 2IWFA 4GI6A 3U0PB 4H26B 3LRGA 3KM1A 5IKCA 4AQ1B 1T0OA 5F7YC 2CRYA 1D6EB 4BFFA 1MZZA 4DP7X 1ONQA 1U6AH 4HUXB 4XZ4A 2J1YA 3IDNA 4JFYB 2PPDA 1I8AA 5L4JA 2BY0A 3RIAK 1DFBH 1LTXA 4I3SL 5B4MD 1NBVL 2CZNA 4QXVA 1MRCL 3GS0A 1AE6L 4GSUA 3EKCA 4J23A 2NXYB 2B3IA 3LV3A 5A40E 3T4AB 3GK8L 2B1AL 1KTJA 4ZSOB 5H37H 3ULAB 5CD3B 2UWEA 2K8QA 3L4YA 1KUMA 4R83A 5KAQG 1C5DB 2Y24A 1N8ZB 2X40A 5B39B 1QVOA 4OB5L 2Z93B 4HUUB 3RY5A 3DDFA 3QCVL 2CLVB 2YA1A 3ASWA 2CHNA 4FFWC 4LXFA 4RMQA 3SDXF 1I7ZA 2ZWLT 2IFFL 3FCSA 1DDHB 1JZ7A 4X5XA 4OGQC 1RVFL 1ZHNA 1ZVNA 1JGEA 2DLIA 1U8PB 4JFDB 1RJYA 3FQWB 1J9SA 1N8OE 1ND0A 5T1LB 3CVDA 2BC4B 4NZRL 2BY3A 3ENEA 4UT7L 5DJ0B 2WYTA 4GUOA 4WU7A 5ICXB 1CF1A 3EO0B 1SHWA 4Y4KC 4OJYA 5FOBB 1W6LA 3TX4A 2EXYC 2WLIB 5HDLA 1JGUL 4NC0B 5DA0B 4MQTB 4R26L 3AQDA 3CH8A 4J4PC 4E9VA 3FFCA 4I5BA 4RISL 5GS0D 2J4WL 3GZOA 2X9ZA 4PN6A 4QRQA 4OUUB 2R69H 1EJ8A 3SE6A 5DK0B 3O6FD 5I1EH 4Z0XB 5FO8B 1OZTG 1UTDA 1YJDL 1T5XB 1GKOA 2CBTA 1GW6A 4UIMA 5MEPB 3OKKA 1SDDB 3N41B 5LXVB 1T2JA 5DJ6A 4KDVA 4AYDC 2LVCA 3I6SA 3KL5A 4Y5VC 5GGTA 3P77A 3ZIMA 2ADYA 5D1QC 3QYCA 3U1SL 2CBMA 4G83A 2E7CA 3UO1L 3NRFA 4YK4B 1THCA 4Y5XC 3I02A 4LBAA 4NHUB 1A9EB 4GG6E 4KNQA 2VM3A 1VJSA 2DQGH 1U93A 4IBQA 4PJ9D 2IJ0C 2JI1A 2QHRL 3F7PC 3TBSB 3FRUB 5LHDA 2Q8BH 5E1HB 4PTUA 4GKSA 4PGDA 4F7MB 1RPQA 1XGTA 1CI3M 1CXIA 5ICUA 4DF9A 1T3FA 4UV4L 4FMVA 5CS7A 1NCUA 3BUYA 3S36X 2B4CH 2P5ED 1U2CA 2VDLB 1RMFH 2XQYG 3KWXA 3UYRL 4E9RA 1PBYA 3D9AH 1RIVH 3MRCA 3BUIA 4TSBL 4FNQA 1E8YA 3IRZA 1R3LA 1WP6A 3OHXC 1CU4L 2GSMB 3SGJC 4ZPTA 1G4MA 1L9TA 4ZTPL 3AABA 5DD6A 4CSZA 4EKJA 5IR1B 2FUTA 1QABA 4E5XB 4Q4IA 3MGTB 5J1SC 3PL6C 4P2OB 4IKLA 1OAXH 4XPFH 1AG6A 1HAWA 3UFIA 3AQZA 4JDEB 5C0GB 2AF2A 2FWUA 2MSPA 3EG9B 5DJCA 1JD9A 2CJTA 4RGNE 3QAQA 5EZPA 5KWYC 1VKXB 1Y0LA 2A38A 3GKWL 1A5FL 3JTSA 5E6IA 4BH8B 4HWBH 4OF5A 5BVPL 1JXJA 3NZ8A 2WOBA 3RTQB 1EGJA 1G6RB 1KCRL 1UXLA 3ARDD 5FF6B 4UT9A 3W0WE 4CJ1A 2K45A 2EINB 3FU9A 4NZUH 4R97C 3NQKA 1R5VB 1DVQA 2X6MA 3PUCA 4XC3H 3IDJA 5DJXB 4MZIA 3W2DL 3VWJA 4UMSA 5HHQB 4LP8A 3F12B 3HAEB 3DO4A 5J6SA 1AZZC 4LEOA 3RIFF 2XN9A 1BW8A 3FT4B 4Y9EA 1QO3B 4ZTOL 1VFOA 3W39B 4F93B 1TO4A 3CLFH 1WAPA 4R96B 3PIQA 3GNML 3FQUA 4GY4A 4X4MA 4AMKL 3S5LG 3WUWG 3GXTA 4M5TA 5DU7A 3VFRA 5SV3A 3AS2A 1NGXB 3MODH 2HCZX 3SBWA 2DYPB 3H0TB 1BQ5A 4XTRD 3BIKA 4IQHA 3QNXA 5TE6L 4FG6D 5AFAA 1I7UA 4LLVA 4Y5XA 1Z9PA 4KK9D 1Q0EA 3FOMA 1I3VA 1TVDA 4HAKA 4K7FB 2G3MA 5C0AE 3VXMD 3A67L 1LNUA 2FECI 1OGTA 1QBAA 1TLKA 2V2WA 4FHKA 3ZDXE 1EJOL 4EDXA 1CFNA 2E27H 2ZP0T 2AXGA 2NDFA 3GRWH 1QFHA 4H0HB 2BY2A 3F65A 2OTUB 1EHXA 4FNTA 1OD7A 5CCHE 2V2XA 1MUJA 4N2FA 3PWJB 1DQDH 4EI5C 4PGBA 5DUJA 3RWCA 1E6JL 2VIRB 4AVKA 3CDZB 5JTWA 4B9ZA 3KPNA 4PJIF 5I30H 3UEZA 1MHHB 2JJUA 3VRLE 3DLQR 4O5LL 2C7FA 2FQDA 5J9PB 1DBKL 1NFDB 3LZLA 4H25A 2V9QA 4GKNA 4QJ4B 5JHDA 1EBAA 1UT2A 4BFBD 4NC2B 5FECB 5IEKB 1R9FA 1JPGB 5IP4A 5EFIB 5E4IA 4CU6A 4OGYL 4BZ1A 2ADIB 4NFCA 2XVLA 3LV3B 1QEXA 5E51A 4F57L 1PD1A 3L3HB 5FHAL 2N56A 3EYSH 1IARB 1PD0A 4MD0A 1A1NB 5G4OA 5C0IA 5KBPA 2WZAA 1R3LB 1WFUA 2AJ3A 4X80L 3CHXA 2BRRH 4MQ7A 3FUFA 5EZIH 3UDWA 1M57B 1CXLA 3HZMA 2XVGA 3T2PA 5F2FA 5ITFA 3QT2A 1U8NA 3IE9A 1KYFA 1RK0B 2QPSA 1SPDA 4M3JA 4Z95L 4LHUG 5C6TH 3T8VA 5D1XA 1KPVA 4ECNA 5KSAA 2O6PA 3WNLA 4JB9H 1NFDF 3LKOB 1Y18A 4PVLA 1OPOA 1P1ZA 1RIUL 5LG6A 4P2OC 4YBQC 5I1JL 4DNLA 1XF4B 4RFOH 1EHKB 1UJ3A 2QGCA 4C59B 4MZRA 2OR8A 3SSGA 3SY0B 3WNOA 1JPFA 3EYQD 5JPMB 4KK5C 4ISVB 1E5ZA 2O5ZH 3GXUB 2PO6A 3LB6D 1MPAL 1SHMA 1NINA 4ABWA 3AY2A 2B08A 2GUOA 5F9AC 4N0RA 3UL4A 1RZFL 4LVNC 2OX5B 5HDWA 3UCRA 1FE8H 4JE4B 4NQDE 3VXMA 2C1PA 5E56A 1S4IA 3WEBA 5IHWA 2ZKYA 1X9UA 1VFBA 4H1LA 1MWAA 5B1BB 5JZ7D 4JMXA 1MCRA 2P5EB 3CLFL 4HZ1A 4M8QB 2ICES 3ZDYF 1XGRA 1CK0L 4K5NA 1OKEA 2MCG1 4YDNA 2X0UA 4ZMLA 1A7NL 2EC8A 4JHWH 4X50A 1L5GB 1A9VA 3ZTDC 4E36A 1FHGA 1FO0A 3OMNB 1D9KD 3FFDB 4CVWA 3VRLF 1YEIL 3NZ8B 3VGDA 3BKMH 2F18A 2VDMH 1NGQH 1Z9LA 2C9RA 3NFSL 3VGAB 4N0CD 4HULB 2VITA 4QRTB 1SJXA 2FK9A 4OLVL 5DHXB 4BFGA 2NY2C 5BQ7A 1IB5A 2O93L 5DO2C 2FBJH 5L88L 1C08A 5JW5A 1AO7A 1KTDB 3AY4A 3K7UA 1MCSA 2EVGA 1GZPA 1TYEB 2PW2B 3M8OL 4U1KB 3SOBL 1F00I 3O41B 3TVMC 2D3VA 3FBQA 4OSUL 1WBYA 3S96A 1IM3A 4LCUB 2Z31A 1EO5A 2TSBA 4DGVH 3C60B 4NNYA 4WUUD 5ID0B 7FABL 1UB5B 4YE0A 5DQDH 1KJ2A 1VFBB 2XXGA 2CLVA 3GO1H 4W9GC 3V0EA 1IGCH 1R3IH 3NJIA 2VITB 3HAEG 5HGBA 2ESVA 3MR9A 3S5LA 3FC8A 3WUWA 3K81A 4QRRA 2KZ1B 2DWDA 5FFLA 5EN2B 4FJZA 4FERA 4QF1B 2C9QA 1KN2L 4NM8L 4S1SH 4RMWA 3RKDC 2Z35B 3MXVL 2FEEL 3ULUE 4AT6A 5I74C 4LLUA 2AJZB 5EORL 3ZYOA 4JK0D 4KHTL 1XF2B 1PZAA 2C3VB 4O2FA 1GS8A 4KI5D 5SV4A 4NQEB 3QH3A 1ZLWK 2VC2L 5D9SB 1FFRA 3D34A 4N4YB 1RK0A 4N0YL 1NLBH 1X3DA 5C7XH 4DEPB 5IT2H 1PY9A 5F93C 1WJ3A 4MKMA 3DMMC 3HMWH 3WEXA 4GRWE 5T3ZL 1JVKA 3NCMA 2ENJA 4HT1H 3U9UB 4YAQB 1MI5A 4UQDA 4LL1A 3T4AC 3IWUA 1TJHH 1I1RA 5E2VH 4F2EA 2Q10A 3VD0A 4HIHA 1BD2A 2VLMD 3AM8C 2MHAB 1CG9B 5GJTH 5GS0L 1TZ8A 4KJYA 2CBOA 3BPCB 2XRAL 3TO4B 3P4NB 4V33A 1E65A 2HFEB 2Q76B 3M46A 1MCPL 1LO5B 4DVRL 2WWKO 3ARGA 3FB7A 4IEFB 4KH9A 1KJ2B 4NUMA 2NT0A 5ITFB 3HR6A 4FL4A 4WF7A 3CFTA 3UC0H 2BDNH 3GMMA 3HVDA 3WNIA 3ULVF 4PJBE 5ICZA 3Q8FA 2AFNA 2NXZD 3HA0A 3QJHB 5IOPA 3DXAA 4DCQB 1EQWA 4GQ9L 1CFTB 1NAMA 4PJCE 1XT5A 3MJ7A 3KWTA 4OLYH 1ROWA 3R06A 3O41A 4BZ2H 1EAPA 1XGRB 1ODUA 2X3CA 5LBGA 1FI8C 1RLWA 3G5ZA 4IOFD 4OY9A 2LW3A 1JK8A 4IBVA 4HUVA 4G9DB 2QMJA 3BIAX 4Y88A 1K5NB 3PLYA 2FR4B 4B7IA 3FSAA 3QDJE 2BO0A 3WMSA 2AJSL 1VGKB 4LLYB 5F6HI 3S88H 2EDEA 2VH5H 4PFEA 3G6DL 3MRDA 1JZGA 4HWNA 3DPBA 1AD0A 1KFGA 4EIBA 2DWEB 4Z7NE 5I17A 4PB0L 3GXMA 2UXTA 4ZO7A 3ASNB 3N06B 5KG9A 2V9RA 4PLKC 1UWFA 3K3QA 3MCG1 1SBBA 5FDWA 5I8OL 1G9MH 2A2QT 2FATH 4J4PA 3KYKH 1PNDA 3NZUA 5SWSB 1DJGA 4AEHH 4NNXB 4AMXA 3KE0A 4OZFA 4H44C 3MYZA 5DZLA 2D7TL 5ILTL 3TWCL 2IQ9H 4EIGB 3OZKA 5DJXA 2VB5A 1J8SA 4OFIA 1D6EA 4PGJA 1ZS8B 4NRYB 5CD5D 1XH3A 2UX7A 4E41B 5HY9A 2AJ3B 4XNMA 1ETZB 5EOQL 2WOYA 4PRBA 1A6VL 1INEL 3BSGA 2B0SL 1JHTA 5IW3A 2DWSA 4W6XB 3CGTA 2J72A 3VFTB 1DVUA 5JORB 1DQTA 4M8UA 4GRWB 5BW7A 1NA8A 3L8QA 4JDTH 2IWEA 5DVOA 1G7MA 4FQIH 1MIEH 1TEYA 3K6NA 4LEOB 3HLKA 4JFPB 3U0TB 2EDLA 1ET7A 4OD3L 4DGYL 1DQQA 1E9QB 4Y19A 4ZW5A 2YPLA 1TVBB 1RZJC 4HJGB 2NR6A 4P49A 1MFBH 3HR5B 5EC2B 2WIIA 5JIKA 3SDXE 2QADB 3EFOA 3HW7A 4Z7VA 2DJUA 1N67A 1FFOB 3R7RA 1E6JH 1YVLA 4UM9D 4WTZG 3TZVD 1BAFH 2WJ7A 3ARFB 2VZSA 2YEQA 5H2BB 1P0SE 3CDGB 4YR6A 1FH5L 1NAMH 3BAJA 1OAZL 1KG0A 1ACYH 2ARWA 3IDIB 4TYUA 1TIUA 3HI5L 5DVLA 5J1AA 4XN1A 3ZZ1A 4N9GB 5D7IB 3P2BA 1CGXA 3Q2VA 1KF9B 1KELH 4KKBC 4K23L 4UT9L 4ZMOA 5DDHA 3QDMA 3VXSA 4N25A 2VWEC 2XWTB 1YNTB 4K4KA 4EN3D 3CQFA 4AIOA 2C1OB 2O5XL 1KTLB 3UJJL 5C3IA 2LLLA 2X4SA 5DSCA 5FLUA 3QUMB 3SCMA 1IAIL 2EE2A 2R0KL 2J21A 2Q8AL 4TUJB 2MJWA 2Q20A 1PSKL 3KVPA 1NJ9A 1BIIA 3BDYH 3HG1E 1FP5A 3T3PB 4I3GA 5BUGA 4G6FD 3U6RB 2W60B 5IUCA 4QUOA 1IGJA 1EO7A 1LWJA 4PM1A 3SN6N 3KBPA 4I85A 4PJDA 5D5MB 1SQ2N 3VWJB 4JQIA 1BZDA 4XN8A 2X3BA 2H47C 4X98A 2UUDK 5IJVB 1IILE 2P8PA 2VLKE 3PWUB 4JS7A 4K3DH 43C9B 4IJ3C 5AZEL 4NSKA 3FZUD 3DPBB 3L7EA 1W72A 2GFBA 3H2PA 3QUXD 3IF1B 1F4XL 2G0KA 1A4KA 1MCKA 1PDKA 2BNQB 2EO9A 3ET9F 3LSOA 4QD2E 5ISZA 2V0AA 4JO1H 3TBWA 4AL8H 1YN7A 4F3FA 3HS0C 3V6FA 4GXVH 1QI5A 1D7BA 2GIXA 3BWUC 1RURH 4KROB 4AXWA 1AS7A 4LK4A 1NEPA 5JDJA 4MRCA 1CZ8H 4QXTA 5DRNB 3TONA 3V4VH 3MLZL 3WHXA 1HHKA 3VG9B 4ENZA 3TT1L 3C6LB 5J3HC 4NOFA 4MJID 4XNXL 2APXA 4OLYL 1QBML 4FFZL 3QUKA 1TJGL 4OQ1A 4BH8A 3P3RA 1CD8A 4CSSA 3TPUA 4FHJA 4ZW3A 1H3VA 3DRQB 4UQ2A 4DK6A 5F1IB 3BUDA 4RGNC 2Q7NA 3FRPA 3LPWA 1P7HL 2XBZA 4P2OA 2HRPL 4TNGA 3OR7A 5DFWH 2HX8A 1RJZB 4ODWA 4ODTH 5TE7H 2BMKB 15C8L 4PB0H 1HNGA 3OKEA 5IMKA 1PU0A 3HMWL 4Q9QL 4FNRA 4LL4A 4XH2A 5F89A 5IEHA 5HI3D 5JHLA 2H2PD 2VDNB 3MRCB 1MFUA 1UWGH 1P9MC 4YXLH 1FV1B 4WZ9A 2L04A 1ZAGA 3MV8A 1AS6A 3ZE1B 2FZ3A 1T3FB 2K9UA 5CZRA 3DMMD 5DYFA 1BOGA 2WVSA 3VW3H 4HHGA 3GI8L 4EOWL 1UXWB 3RBGA 1GGIL 2A74A 4QRQB 1F3DH 4DPBX 3O8XC 4AUYA 2VJXA 4OI9A 2E7LC 3I6KA 2DM7A 5EN2A 3UTTD 1TZIB 1DFBL 4DQOL 9PCYA 4LSQL 3WTSA 2O6EA 3LKQB 4R2GD 3KL0A 2YKLL 2WK2A 3LCYA 3KLQA 4BZ2L 3ZQXA 3RZCB 1I7TB 2VERA 5CZXD 2EE6A 1N59B 2Q1EA 2B1AH 4FHBD 5FOBA 1PX4A 3GYRA 2N01B 4NO5B 1S6NA 5D2LE 1M9WA 4LARH 2BSBA 4NGHL 3JVFC 3WIHA 2F6AA 5GGVY 3MRGB 3MRBB 1GZHA 4LARL 2W0FB 1HE7A 1HZHL 4PJDE 5C0CB 2AERT 4TULL 1WIUA 3PQYA 2BHYA 4WDIA 1ASPA 1RJYB 3SOBH 3DGGA 1QOKA 2F54D 3QHZH 4MAUL 2WP3O 2WTRB 1JZDC 4R3SA 3ULVC 5TQ2L 5JYMA 1UGKA 4ZZFA 2AK1L 4CC4A 5MENB 5HHVL 2WHVA 3E1F1 5AD0B 1QI3A 2PPAA 3UBXG 1ASQA 1M05A 2NNRA 3HE7D 3KWWB 2VABA 1QLEL 4JKMA 4IJ3B 4HC1A 2IH3A 3FB6B 5GSRB 3D2UB 1AZNA 2VMFA 5DUBB 1TU2B 2ZOLB 1H3TA 3PJNA 4G7YH 5DJ0A 1NC4B 1FBIL 4K3EL 4M6AA 5E8OA 5IB2B 1RUAL 4MLSA 4HLEA 1CICB 4N0CC 1KYOJ 2RGSA 5DURD 5EC1B 1TF4A 1U8PA 1ZLDA 5DRWA 3TO2B 1KFAH 4PJ7F 1BG9A 4P4KB 5DEGA 5ABAA 4Y9FA 3TT3L 4YE4H 4P46D 5MENA 3F3HA 4QRFA 5AL8A 3DMMA 3F83A 1TMQA 5IB4A 4PD4J 2CALA 4U6YA 3PAZA 4MKTA 2J88L 3L5XL 5CJXC 4DN3L 2IXQA 4BUHA 2EUWA 3MDJA 1JYNA 5ADPH 5FKAA 2D0GA 2WIMA 1WCQA 1JFQH 4KKCD 3BE1L 4ZFZA 4NO0D 1LVEA 1A3LH 3N43F 4NQED 5JORA 1NZRA 2FJHB 2G75A 2D0FA 1VZHA 2OMTA 1MJUH 4G1EB 2A74B 3VX0A 4J39A 2IC2A 4GH7B 1MN4A 1PCSA 2VW4A 4F37K 1XB6A 4WVRA 3MV9B 3RIFK 1A7RH 5D5MF 2K6YA 3GMRB 4E9YA 1MVYA 3LQAL 3REWA 4NDMA 2WO2B 5JIPA 4OIAA 2G0LA 4KPHH 4URTB 2B39A 3EYOB 4L8DA 5CXPA 3JVGC 4DO4A 5IIEB 1SF3A 2PKDA 3QH3B 1TVHB 3HI6L 5GS2H 3I9GL 3M1BB 4NNXA 4OH2A 4K15A 3V4VL 3TCLB 3ZTJG 2EDXA 4AGMA 3FQYA 4YHYC 3KPOA 2QGEA 3MV8B 4HETA 4QOKA 3LPFA 3ARBD 2ZNXA 1M2VB 3T2NL 4JN1H 1IQWH 5L0QC 4AV5A 4F91B 1IC5H 4NHCL 2EH8L 3BH8B 2ITFA 3QR0A 5E9DA 3WNNA 4M7ZB 4OCWH 3VRIA 1KJMB 5FB8A 3GLAA 1P5UC 5MI0B 5IHZB 2YXWA 2I5YL 2R7EA 3PGCB 3MFFB 1OTTC 3QS2A 4QRPA 3WTWA 2BSSA 4OZ4A 2YAMA 5D2LA 1UOLA 1FO0H 4M93B 1X7QB 2Y7LA 2FX9L 2Q2EB 1QWUA 3DGGB 3DX9B 3EJCA 5IESL 4Y89A 3Q13A 2DKSA 1DJXA 3VI4B 4YQXH 4X7FC 4BK5A 1YMHB 2FBOJ 4C47A 2AEPL 3OAZH 3WJLC 3VQLA 2NX5B 1C08B 4P5SA 1MFAH 1HHKB 4PUBH 3SDYH 1T03H 1GL4B 4X2UA 1WFNA 4X6DE 3CHOA 3Q06A 3WAKA 4H8HA 1LO4H 2CR3A 2HTLD 1XO8A 4E9LA 3QAZC 5EEZA 4JPKL 1LM8V 2AQ3A 1KLGB 1XSKA 3FF7A 5T5FH 5DA4A 3SBPA 3WKYA 5MEQA 5EZLA 2HTKD 3DDGA 4YE4L 1XR9B 3GNMH 3M86A 2R2HB 3HC0B 1CBJA 2YBRA 4UB0H 1KBBA 3BVWA 2DLTA 3BESR 4MA8L 5GHWH 3H42L 3HHRB 3ULUF 3UJIL 2R2EB 2PPCA 3JWOL 4WSJA 4E9TA 3OLDA 4H1LB 3FTZA 2P8PB 4JM2A 1L6XA 2X4TA 5DT1L 4AWJC 1W16A 4MB4A 5CILH 5BO1L 3ZSSA 2PCPB 1A21A 3KCPB 4Z8FL 1G6RA 1NCNA 4TRPH 3RB7A 1KTLA 1E5YA 4OIFA 4YC2C 4CGTA 2R0ZH 4LLUB 2VN7A 4ZUSB 3WFCL 1MW3A 4TUJA 4XXWC 4MMYA 4TQ8A 3MZGB 4PJHF 3KPQA 1OSEA 3V6OA 2F7QA 2HVKB 3FRPB 3P9LA 1MW2A 4KVNL 1HHHA 3W9DA 4D8PA 3NACL 1BMWA 3IRCA 1AQMA 4OZHB 4PJFE 4L8SA 5IQ9A 2A3TA 3BISA 4FJYA 4JLRB 5DMIL 3ZDZE 2D7TH 4RDQG 5KVMC 4ZFOA 5CINH 2BSRA 2NY1D 3RDJA 4ZUVB 4QLWA 2DF3A 2GQHA 3GTVA 5EU3A 3TL5A 3L7FA 5KYYA 4UZSA 2NY4C 3WHXB 4PJ8B 2J1KA 3ZYJA 2CGRL 2YAEA 3DHJA 1FGNH 3IKCA 4UTAL 1JF6A 5CLTA 2BP5M 3LXBA 4L9LA 5D72H 4ELME 4P4RA 5F96L 4YHPB 3W1ZA 2HLEB 2KHAA 4YSOA 1X5KA 5IEKA 3HG4A 4UUJA 4QHKJ 3X12A 5FK9A 3CFMA 1VACB 4LLWA 4AQEB 5IQ9B 1HH6B 4QRPE 1L9RA 3MKGA 4UQCA 1JNNL 3FQXA 1OHQA 1BVNP 3U1SH 2RA1A 5E8DH 4CVZA 2E59A 2KT6A 4E41A 1ZWIB 3SPIA 4HIIA 2CLZB 3B2DC 4NZUL 3OKKB 2N1KA 1FWXA 5GIRB 3QJZA 4FQHB 1AGDB 3IXTB 2ZWZA 5HP5A 5I82A 3U6RA 3SQBA 3G08A 3WXWL 2AKRB 2B3RA 1WS8A 5CUSL 2M26A 4JREC 2H2PC 5CKGA 2V5RA 1I85A 2PWHA 2X4TB 2DQIH 3B7TA 4KFMA 3GMPA 2G4EA 3AFLA 2DQIL 1BJ1J 1S7RB 3UGUA 2PO6B 2GCYA 2DZEA 3UPAA 3UYPB 4AEIL 3QJVB 4I0PB 4X9GA 4AEIH 1JBJA 3QAZB 4H5SB 3QDMB 4KI1A 5B7MA 4E0RA 5F7MC 1FNAA 3KL3A 3FT3B 4WUKL 2CAKA 4CJ0A 2ZKXA 3BN9C 1FLRL 1CU4H 3B3IB 2HT4D 1T6BX 3TBTA 3ZMNA 4PRHD 2QTVA 2PR4H 4G7RB 4J4PD 3HE6B 3S3SA 1XR8A 3MVSA 4BHUI 4Q52A 1T0NA 2I9TA 2PWFA 3FBKA 4LSSH 4J2QA 4OLVH 3EUUA 2IG2H 4KMTH 4PJHB 1ZS2A 1J1PH 3FO1A 5IT2L 1EAOA 1J8HD 2Y07L 4GSDH 3UBXB 3MOBL 4HDIB 1JHKH 4OGZA 4PQXA 2FQEA 3T08A 2DPKA 1KIUB 1AYOA 2X4OA 1YNKH 5ALBL 4XNUL 1WFIA 5JUEH 5B22A 1F8TH 4ABQA 4WGKA 3FCGA 4ZDHB 1RZ8A 1W91A 4RA3A 4KRPB 4ZXBD 2NX5E 3EH1A 4OLUL 3QJOA 5BV7B 1QFUL 1AZCA 3ULVH 1OP3H 3VGGA 1JZ3A 1L9NA 2Y5TA 4NT6B 2YGOA 2ZUTA 3VI3F 3N1MC 2XZCH 2CD0A 5E99L 4XPGH 3IM1A 2JKXA 3Q5TA 4Y2NA 1CYXA 3KGTA 2UXFA 5JXEC 1OTSC 3D8MA 2QPUA 5HVFB 2Y6TE 1CO1A 2WXQA 2KDGA 2PN5A 3D4ZA 3VVWA 5FGBC 3RWGB 1OT2A 2X41A 4B97A 4KWUA 3P4OB 4JHAH 5CF3A 4H8WH 5DC0A 5IJKA 3IMRA 1URIA 3JUYA 4WFFE 1YNTF 4ES8A 1GC1C 1WRFA 4EIZC 1AC0A 4OR1A 1VLXA 4POZD 3O6MH 4DH2B 3VXRB 3X1BA 4KKLD 2APSA 2YN3A 4ELDA 2WAHA 1J1XL 1OCZB 5DJ8A 1QQDB 3EYVB 4GIPD 1RERA 1RUML 3VTAA 2ADGA 2ODIA 2X70A 4LOUC 1DEDA 3ATBA 3EJZD 2YRPA 1FZOA 3GSQA 4JRXD 1TJXA 3APFA 4LCVA 1BLNB 2FCBA 2JKIS 4MYPA 4HAGA 5E6UB 3TTYA 3GBEA 3BMVA 2DQTH 25C8H 2FE0A 2L7QA 1FNGB 3CHSA 2Y5TB 4J3VA 4OFVA 3WCYA 1BXAA 1GRWA 1ZHLA 2VLJA 1OSYA 1V7NL 3EFFA 4B0MM 4P2RD 3UMTA 1LD9B 3BSHA 3IETB 3Q6FB 5E4EC 5HJ3B 5BXFA 4MMZA 5EUKB 2JIXD 5GZNA 5JW4N 1DCLA 1HSBB 4GFXA 4JFED 1YC7A 3ARUA 3GSRB 5DURB 4JN1L 2BNUB 2EDBA 1WDAA 4HEMA 1C5CH 5KYXB 1IAIH 4MNQA 2CE6A 3GK8H 2NYZA 3MBWB 2A6DB 2VYRE 4LSRL 1GSKA 3EG9A 4LFHG 5DJCB 5F6IB 4F7PA 2C5DC 3UADA 3VXUA 4QDGA 2BJML 1OK0A 5HVHB 4LU5H 2CBPA 3O9WD 4JQIL 4JFQB 4UQIM 1GYWA 5EDXA 3TBTB 2C9PA 4JQIH 1MI5B 1SLUA 3ZQ9A 3LS5H 4AW7A 4LKXB 4G59C 4EUPG 3HI1A 5JW4Q 5TQ0H 1MJUL 5A2KH 1UHVA 2Q86A 5C08B 3BGMB 1IAMA 4RZCB 5FDYA 4BSWB 3OBAA 2WBXA 4PP1D 4UM9B 4GS7C 4M1DL 3GM8A 1MKFA 3CVHH 3U48A 2H41A 1L3WA 4CC0A 2FJGA 1X4ZA 1C5BL 1CPUA 1TETL 4MMZB 3KDPB 1ACYL 2H0FA 1IKNA 3WNPA 1QR4A 2G60H 4OV5B 2ZCHH 1MG3C 2YPVA 1FSKC 3H3PL 4GKSB 4I1NB 4B9GA 4B6ZA 2Y1VA 1HJBC 4LIQH 1HC1A 4UIKH 3DURA 4PY8J 4EJ1C 1Q1JL 3FU3A 3X1EA 1G7QB 2Z31C 3QJFB 4HJEA 3QJUB 4XCFH 4JRXA 4FXGA 1H3PL 3QPQC 3KJ6H 4JKLA 1ZHBB 1BFOB 4Y1SA 1HILB 3C87A 1HWGB 2LLNA 4NZ8A 5EU7C 5F3HA 1QNZL 4MBOA 3AT0A 4HUKB 5GISL 4AQEA 4DGUA 3EH5B 5D1QE 1JGVH 1PJ9A 3KDMA 5L8LB 4NEHB 3BUBA 3H7LA 2P5WB 4QCIA 2WVVB 3EF7A 2MFNA 1KCUL 3VFMA 1RZ8B 4EBQL 2NW2A 4KZDH 1LO2L 1MG2C 5HJGA 2CDEB 2IXQB 1H8LA 5TDPB 3ABZA 1QSFD 3DJ9A 3MC0A 4NQXA 3QCTH 1WC7A 4OZHE 4PJFB 4WNSA 2WLZA 3MLSH 3APMA 1A7OH 3KYKL 5DD3L 2P4AB 2XFXB 2DQFB 3QEGL 1KIQB 1VFAA 3QUYA 5DGQA 2MRYA 4CGUB 3X11B 1C1EL 4WHTA 4MDRA 4TMPA 5C09E 4FD0A 3DJSA 3TCXA 1KIPA 2BLFA 1M1SA 5BRZE 1KBVA 2VSDA 1KCKA 4Z7IA 2I9LB 4MMXA 1R3JA 1SFHA 3IAPA 3O3BA 3QO1A 2AXGB 2J8OA 2PYFB 1U8LA 3P3UA 3O0RH 3N5AA 4MMYB 4KJWD 1YY9C 5HHPB 3WKQA 1EZSA 2QLYA 4NYLA 3V4UL 4JDVB 32C2B 2OBGA 4KROC 3S37X 3AREC 1SEBA 2XTJE 3O2WL 1DQLL 4PJHA 1NGPH 4WO4A 4XMPH 3ILEA 1JD7A 1T21A 2MQCA 4DWHA 1T1ZB 4XGZB 1MDTA 2ZD0A 3BC9A 4R5VA 1QR1A 4GW1B 1SYVA 1QA9B 5D6CA 1IRAY 3ARBA 2HUEA 4H8WC 4F1ZA 2NYYD 4QTIL 5IUSA 1A14L 4P4KC 4RAUA 4CN4A 3RJQB 4IRSB 3TA3C 1AKPA 1NMBH 2O72A 4ABVA 3EO9L 4UYQA 1UZGA 1OZUA 3GPEA 2ZWKA 3FQXB 2HJFA 3TIDA 1TJHL 1ZGLM 1ZT7A 3GMNA 4JRYD 3IMWA 2C9XA 4WFFD 2FL5A 2MIZA 3QEQE 3P0VH 5DD1L 3HZVA 1S5IH 1H19A 4OCYL 4UT7H 1X9QA 2FQFA 1YQ2A 2GHZA 3C60D 4NUPA 3D4GA 2KQMA 2L7JA 1GVIA 4QY8B 1QTYT 4XPGL 5BZWA 1YA5A 4U1HA 4YDIL 3S5YA 4QTHB 1VKXA 3ISYA 3NCBB 2FWSA 1HQRA 4JHWL 4ZO9A 5SWQB 4JFEB 3BKML 5FO9A 2EE3A 4AOFA 3X1FA 5GHWL 2CO7A 1CDYA 4PJEE 4MMXC 5DEFA 1FFTB 3NCFB 4YLQT 1NC4D 4OJDH 4NRZA 1X7TA 4XMZA 4XNYH 4BCZA 2MPAH 1HQ4B 1PZUB 1U8KB 1PLBA 4HS6A 3V52H 4F9PC 4KO5A 5BZDB 2ERJC 1A7OL 1DP0A 2HSIA 3T6ZA 4YXHH 5D7JC 5FKPB 1CMOA 4BEIA 4Z1PA 1P4LA 2MNWA 2D4DA 3QP3A 1WG3A 4RGMC 4XWGL 4IOIA 2SEBA 5G4NA 1DVFC 3JTTB 5KSAD 1K4CB 3BRFA 3WXWH 4QXTB 1FZMA 1KDJA 4LGSB 2HX7A 2WKLA 1GGBH 5EBWB 5BOPA 1RPUA 1X9LA 2HJLB 3B7SA 4GP5B 2L7UA 2Z6FA 5DMIH 1QSED 3GXDA 1JF5A 4NHUA 1NDGB 2L8AA 3GXFA 1JWUB 1QBMH 4N8CL 1XIWA 2GT9B 3GBMH 3P77B 3FH7A 1T2QH 2JKLA 5TDOB 2VR8A 4P3CH 1DQLH 2KYIA 1QKZH 1UG9A 4V2CB 4XMLL 2PXYC 5DJDA 2G3NA 3UH8A 3HNTH 5E4OA 2J8UA 4XMPL 5FYJL 5I5JA 1GJIA 3FTVA 1X5XA 4W6WB 1KXTB 1YY8A 1MRFL 2WINB 4I0PD 5DHVH 2R0LH 3O4OB 5FYKH 1OAJA 4FXKC 2BSED 4KQ4L 1ZTXH 3IJSB 4S1DD 3NJNA 4OZFB 1ZVHA 2YPVH 4P5MB 3STLA 43CAB 3EYFA 4IHOA 4XP4L 3PG2A 2OMVB 4WKZB 1G6RL 3BN3B 5DZJA 1U8CA 3VG9C 3X1NA 2YWZA 2NY1C 3B83A 3QFGA 4GIAA 4KBPA 1ZA3A 4UV7L 1UKQA 3S3JA 3SZKC 4ZMYA 5JPNB 5K9JL 3HTLX 3MRRA 3ZKMC 5AW0B 1O0VA 3S9DB 4UM8A 4ZNEE 1IKFH 4ZAKD 1V3KA 2HJLA 5FM5M 2YPKA 1MFDL 1BZ9A 3SE8L 2CCWA 3IDUA 1R0AL 3VG0H 1CLCA 3OLEA 3KWWA 2YS4A 4YDMA 1I9JL 4WHCA 3B2VL 2Q7AA 3W3BA 3I2CL 1I9JH 2F54E 4Q4EA 2IH1A 4LSUL 1XGZA 4JJHA 2B0SH 2FX7H 4B5EA 1B4JH 3PPSA 3SDCC 3U4BL 2WSDA 4RDQF 1EXUA 2VNCA 1U58B 3TM6A 1G7IA 1A6TA 2OSWA 5E8EB 1BEYL 1XD1A 2FWOA 1UZ8A 2Y1ZA 3FW6A 4X6CF 1XF3B 3ZYZA 1YEKL 3LRSB 4M5ZL 1ZDQA 4GB9A 4OJAA 5CJBA 3ZZLA 5AVRB 4G3YH 1N4XH 3MRBA 2X88A 4QMEA 2DTML 5E6RB 2ICWB 5FCUH 5DT1H 2VXSH 5IGXL 1RULH 1PQZB 1NKOA 2WLKA 1FRGH 3T0AA 1E4HA 3QPQD 1HXKA 4JPQA 5JPNC 5JDSB 2R0ZL 4L4TB 2XXMB 5ID1B 1HL9A 1V10A 3BH8A 3FB8B 4RSVA 5E9DB 5K1JA 1T4WA 4KZEH 5GGTH 2VN6B 4OZIE 3CPUA 2YN5A 4FFZA 5JQ6H 1OSPL 4WK2B 4YSTA 2VLJE 4Y2DB 4Q97A 3INOA 3O3EA 5TK2A 5DK2B 2WBWB 1HXYB 1FL6A 1Z2KA 2R27A 3F5WA 3LQAH 2HPTA 3VFMB 3K71A 3MCLH 4LCCB 2P5WE 1NPUA 2HT4C 3O45B 1CE6B 4PLJD 4HUNB 1ZLEA 1B9ZA 4R4NC 4BFIB 5C2BL 3HC3H 2NNXA 4Y2DD 3H85A 3WS3B 4X83A 3U1QA 3PU7A 4GBXA 1RV6X 4N8CH 4P0DA 1R5IA 3GHBH 5EHFA 4X9YA 2Z65C 5EU6D 1T6WA 4JEGB 4D8OA 5T3XD 1LP9E 4YZFE 2JQMA 2EYTA 2AQQA 1ZLUK 2WZPD 2MCMA 2FYYB 2BC4A 3G6JE 2A83B 3FTSA 4WY7H 2F8IA 5C7XL 3CJJA 3UZEA 3V0WL 35C8H 5DMJB 1AHWA 2BFVL 2FR4A 2A6KA 1Q72H 4O9HH 1DSYA 2DV6A 4N6RB 3KJ4B 2AJYL 5I71B 4AYGA 3MJ9A 5HYQB 3IS1X 1A4JA 2Q3AA 4PCKA 1GYCA 1WPCA 3BP4B 4WI7A 2BNUA 3BHBB 3D25B 1DQVA 2NY2B 1I8UA 4XC3L 1Y7VA 1N6QH 2J57A 5I2IA 4A1RA 1Q90A 2CCLA 4MMXB 3AXLB 25C8L 2V5MA 3BFOA 1LE9B 5LDUA 4GO8A 1F41A 1T4KB 4UM8B 2QSTA 4NCDA 4N2EA 3B3IA 5D7SH 2J7LA 3F58L 2WNGA 3NFPA 4OGAD 1KLFA 1HH9A 1EXGA 3PP3K 3O2DH 4A2DA 5F7HA 1XBDA 4CBPA 3V6ZA 1FUNA 2GSGB 3I50L 4LMQI 2HG5B 4PJBB 1L4IA 1IT9H 1CFQA 4Q9BA 2RBLA 4PJ8D 1SY6H 4PWGA 2Z4TA 4FQXA 1USQA 3TXAA 2XQ0A 4F27A 4LPTA 3DOIA 3ZQWA 3CX5K 5C0EA 4YHMH 1UD8A 4G71B 4M8QA 2YAPA 1IC4L 3IGAB 3CK0H 2VDOB 5HJDA 1QHQA 1AIFA 3OTTA 3RRQA 3QFJE 3QHTC 3MV8D 2ZG1A 3AADB 2J44A 3C5SA 3UBHA 5J0BA 2AV1B 1VENA 3B9KC 1YYMH 3ZL2A 4OU3A 4OZFG 3SCMB 1GPOL 4TNVF 1ZEAH 4QRUA 3SZ6A 4JFFD 3BZFA 1CB4A 5DRXB 1WE5A 4JFOA 4LAQL 1KCWA 2NY5L 4AVJA 5AOLA 1EEYB 12E8H 4JO1L 5E9NA 3VRJA 5J8OA 1MFEH 2OS7A 3OR7B 1FG2A 2NXZC 1KXVC 3GRWA 5CUSH 1DUZA 2G2NA 3LKOA 1FL5B 1X5AA 2UVFA 3FTUA 4HZLB 1E6OL 4H8QA 3QZWB 4EOWH 4ZMPA 2EVIA 1TZGL 4K2UL 3COOA 4FEIA 4HJUA 4WU5B 6FABL 2GTWA 4DK3A 1CDCA 5DHYB 3G04B 5CGYD 2IDQA 5A6MA 2AEWA 4JM4H 1G5GA 2WM0A 3E80A 4FE9A 1HK6A 4YJZL 3GBML 4KUCD 3X3GL 5I0ZA 1I3GL 2MEJB 3E7JA 2V5TA 1LK3H 3F00A 3IU3B 4GIOA 4KRLB 5DMKA 3WN5A 3TBYB 1UXMA 2I26N 3LZFH 4KHXH 1YJDH 4JUTA 5I8CA 1FFPB 3BAIA 5JHLL 3RU8L 3V4PA 5I1DA 1H5BC 4LEBA 2GK2A 2PYEA 2E0PA 3O2VL 4Y1TA 1DVSA 2CXKA 1ORQA 2HLFD 3OLGA 3QHZL 5F3BB 4QTHA 1BQLH 3HE6C 1RY7B 4XNZB 4O02B 5PCYA 1CXKA 4FQCH 5GRUH 1XGPB 4HWZA 3LPGA 2ID5A 4L3FA 4RMVA 4DN4L 4EVNB 4Z7OB 4A7SA 1EHLL 1S9WA 2XJLA 4YGVB 4IGBA 4A6YA 1QEWB 1D3CA 2EIBA 5F1NB 1WVZA 4O58L 4KRPD 4ZXBB 2ALAA 2OSLA 3RFZB 3V0HA 5D96C 5MEND 3FT9A 5HHNA 1H8NA 3GDCA 1NCDH 2EDFA 5EEUA 3ELAT 1ZSHA 4RFNC 4U6XB 5E03A 2L0DA 2WQ8A 2IF7A 5A43C 4X4YA 4K94L 1KY7A 1CIDA 4JRYB 4OD1H 1FDLL 1SXAA 3DX2A 3WBDA 5DJAA 5I75C 2VUOA 4KTEH 1G1YA 1Z0NA 4F33A 3FULA 3GMQB 2NSXA 1MLBA 3T2OA 1FAIL 2DYPA 3D4YA 4IRSA 2H2SC 1TQBC 2YD2A 3QYNA 1I9RH 2ARJQ 3LZPA 1D6VH 4UB0L 4Z3TA 3CLEL 3K72A 4OCRH 1FCGA 3ULUL 2F8XC 3RVVC 5DUML 3WEMA 2I7SA 3RWFA 2F1EA 3HAEA 1O9WA 2FSEA 1NCIA 1F56A 3U30B 5KVFH 5D7LE 3HG1B 5GSVB 4GAYA 3RWGA 3P9WB 5T3XH 4A6YB 3FHAA 3AAZB 1AD9B 1U8OA 1D5XA 1TTGA 2NUPA 2YQGA 4NQVA 1TDQA 4DGVL 2WO3B 2D4FA 2VZVA 3LX9A 5AOJA 3EXLA 2VCOA 2NY4B 3MFFA 4NO0B 3JWNE 4QRPB 5IB5B 4B27A 1M7UA 2HFEA 2Q76A 4WEBL 4YHKH 4LVNB 2R2CA 3P3YA 4TQEH 3F6LA 3L3KB 3NIGF 3II1A 1V7NH 5SX4H 3QJXA 4X9HA 1Q1JH 1VADA 1MY7A 4N1EA 5HBBA 3UG4A 1PKQB 3KZ8A 3I3BA 3I6GA 2DQMA 5DZVA 4IRSC 3WL9A 3HCVA 1IO4C 3CSYB 2CDEA 3MLVH 1N64H 3U4EB 2Y3NB 1SJHB 5KEZA 1AGBB 3K8MA 4JZOB 3QBTB 5CZVL 5IIEA 1F2XK 4L4VE 3ARGC 4CNIB 1RZJL 3KNBB 2F15A 3L81A 1FRGL 2X1PA 1HI6B 2GEEA 4OD3H 4DGYH 1R3HB 3MJ9L 3KYAA 4XHQA 1K9TA 4ZPVA 2Y7QA 1L7IL 3DGCR 4FQCL 2NLJB 1E3FA 3TBSA 3R1GL 5IB1B 4JO4H 3WD5L 4AYEC 5AQ0A 3ABMB 2NY3D 1HEJC 3IMVA 4JREB 4EN2A 4HPYL 1MOEA 1T7XA 2VGLM 3DI3B 3O6KH 2W9EH 4P48A 4PRBB 4WW2B 4M7JL 1SM3H 1T1ZA 5EEXA 4AEHL 1MELA 2QSCL 3OJDA 3QJSB 2P48B 1TCRA 2ITDB 4ACTA 1W0YT 3N42F 4RWYH 1EDYA 3KMDA 4PRDA 2ZQKA 5GRVL 1AOZA 1QPPA 4MHHI 4UV4H 2PUQT 5T33L 4GG6B 1S7QA 5IFHH 3BZEA 1AXTH 1S9XB 1YMHA 2NXZB 2R29L 1UUSA 3T65B 1VF5C 3FT0A 2ISDA 4HIEA 2YK1L 4H2AA 1KFAL 1KC5L 3NIGE 1G9NC 3CDYA 1OT1A 2ZUQB 5AW5B 1HOEA 1I7RB 3HNVH 5AKSA 4NKIL 2IADA 3VTMA 1UFUA 3VFVB 1TTCA 4MCYB 4P2QE 3QISA 1QW8A 3T2QA 1KB9J 2Q3XA 2K3TA 4I9WE 3JZYA 4MNGA 3KXFD 3ZRCC 3MRIB 3CC5B 1JL8A 3PYCA 3CU7A 1XV8A 4RGOH 5DJYB 1LMKA 2J8HA 2BINA 5A2BA 2H2SD 4RIRB 4XRCA 5I1GL 5KYNA 3UTPD 4KTDL 2LHAA 5ETUB 3IKCB 4OZIA 3EFDL 4FABL 5I6XC 2W38A 1CE1L 4HWBL 5BVPH 1KACB 4XOAA 4M7ZC 5C0CA 3C5ZB 1T1WB 1EEZA 3RL1B 2J71A 4YPGA 3HOGA 2QDWA 3EFFB 1WYJA 2P5WA 4QCIB 2Z34A 4TSCL 5HI4D 3BVNA 3CDCA 2BSSB 5HI5D 3U30C 4JLRA 1I1CA 5K9KA 4I89A 1I7TA 3R8BB 4BZ1L 1CFVL 2WN3A 3H9HB 1NC2B 4YHLH 1JRHL 3WU1A 2D9CA 5ERWB 5C9JA 1JV5B 2OX5A 2VW6A 5JHDE 4I0PC 3UABA 4JR9L 3B2VH 1S5HB 2PO6C 3VFNB 5I0WA 1MCOH 2XWXA 1E2WA 2R1WA 2X6CA 5SWZE 3TNNA 4LSQH 3F7LA 1U93B 3MJ6A 3ZSTA 4ALAC 4P5TC 2UWEE 5F8QC 1EZVX 2OMZA 4MAZA 2RCSH 1CT8A 3NFSH 3SDDA 1KB9K 2G5BA 2PWGA 4K3GA 1D2OA 3KJ4C 4OCRL 1PFCA 1RZGB 2F61A 2VDPL 1CWVA 2X4NA 3FUDA 4UOW0 5I75B 3T0ED 1JV2B 1GYUA 3EH3B 4LCWD 1YUHA 4QOKD 4CKVX 2VMDA 1W0WB 1GW0A 2QL1A 3FUHA 2QVTA 4I77L 4J5VA 5E8DL 4DZ8A 4NO2B 2YQBA 3G6DH 3DVNB 2Q9OA 3MV9A 1QFWL 2YBRB 3BN9D 3OQRA 1DBMH 2EICA 1PFOA 2IFFH 1X5FA 4M03A 4RMRA 5DVKA 3LNFA 1PKQA 2BS71 4JFTA 1GZPB 2F7IA 1UYWH 3D69A 4CW1B 4LVHB 3BKJL 5D1QD 2QQNH 1RZFH 1N3NB 5EO9B 1JZJA 4ZDHA 3NSFA 1XH0A 5LNGA 1VCAA 2CM6A 3RI5F 2ZOUA 1D5ZA 5BQDA 4MQSB 2CXGA 4P46C 3VXME 1M05B 2XN1A 3VJ6B 2ED8A 2FHCA 4TF4A 3N44F 2FD6H 1YJDC 5ICXA 4FA6A 4TNVK 2VDRL 2V2XB 5E0QA 1K8IA 1NBVH 5IHLB 3QWNA 4HWUA 5EZOH 1WSST 5I6OA 3FO1B 2AVGA 4H13C 5JOFA 2KQNA 3CHRA 4MNHA 1GAFL 5IHBA 2W9LA 4XPHL 4APQD 4YFEA 4JGUA 4H20H 5C6WH 1CICA 5C70A 4XBMA 2ZWYA 1MI5D 3I75B 2HPOA 2GIMA 4NKDA 2IAMB 5M94B 4N0YH 4XVTL 4MB5A 3LOWA 2A4ZA 3ESVF 3VNZA 5C0FA 3DROA 1BZ9B 1PZBA 4LRNL 3NA4A 1UXSB 4LOFA 3NZSA 3ZUNC 1RVFH 3KBHE 4M7LT 3I6LD 3D69B 4CW1A 3HHSA 1ED3B 2VE6B 3MACL 5GGRB 2AEQH 2NY5H 2YUWA 3VFUB 2Y1YA 4XI5C 1AGEB 4YXLL 2X7LB 1OGAD 1TQBB 2AKRA 2XIBA 3OL2A 5ITBH 5C0CE 3ALXA 4D0CB 5T1KD 2NRDA 2HWZH 1W72H 4HFUH 1RD6A 4OJFL 4OF0A 3WV0A 3IJSA 4NCC2 1LO4L 2WCGA 5F1KC 1NIFA 3MLXL 4R4BB 1J9RA 4JX0A 3RNKB 5DHVB 4JZOA 3ZGHA 5IEHB 2J8UB 2A9BA 4QTFA 4RFEB 3B2XA 4ZFFB 1IAKB 2GI7A 4RETB 5J13C 1BF2A 3HC2A 2R2BB 2CKBA 3WIAA 2FIKB 3QIWC 1A3RH 1H3GA 2ZAIA 2VSKB 3GJFK 5EWIL 5AW6B 2HP4A 4MXWH 1AP2B 1NEZA 1VESA 3P3SA 1X44A 4JDEA 4XNZC 3T5WA 3VMPA 3DRTA 4I2XA 4C8XA 4JB9L 1BXVA 1QRND 3RKDD 5KW9H 3OZ9H 3DV4B 4TOYH 2LFEA 4XX5A 1JZ4A 4NLHA 2V3DA 3TEWA 3B3BA 3MJ9H 5EF0A 1AGBA 1PY4A 1XH2A 2PTVA 1RXLA 4FQXD 1JGDB 4K7PX 4NQQA 4Y5VB 3PNRB 4M6NL 3K4ZA 1DE4B 2H9GA 3JXAA 5GSVA 2IPUG 4I18C 1E9OA 1MFNA 1T0NB 6TAAA 1VADB 5I71C 4XVJH 2G5UA 4FLOA 1C5BH 3FCTA 5DUBA 3LD8C 4O5LH 3VNYA 2XWEA 3L2NA 4GP4B 1YHPA 4KKNA 4EMZA 4NPYB 5BRQA 5T5FL 5FLVA 4S1RL 3KPSD 1K2DB 3KR3L 4RRPM 3HS0B 1OY3B 1A47A 4QRSB 3BKYH 3PDOA 1DHKA 4IRJA 4K9EL 5IG7A 5LQBH 2X0WA 4AIXA 1B4JL 4NSKB 2XG4A 3IJ9A 2N1TE 4K7PY 4UWQB 5DJZA 4CVXA 2QQKH 4LHUB 1HVXA 4YVNA 1ZIAA 2QVFB 5KS9E 2CUIA 1U91B 4DW2L 1MIML 1QSFB 2BJMH 2HKAA 2GY5A 1LEGA 4DW2H 5E70A 4MJ5B 4QYOA 5GIRA 3VD7A 5SWSA 2VAJA 3QRLA 2XKNB 3CSTA 1FZJA 3ZMRA 2VDRB 4R7LA 5J11C 1ZANH 2VLME 3RFZA 3CVIL 1A22B 4S11A 2BSDA 3V4PH 4UBDC 3QDJA 4KK8C 4EEEA 4TTDC 1RIUH 3DOSB 2ENSA 4YXHL 4V2BA 4ZS6D 3JQOB 1F2QA 2CLRA 2WBJB 2J56A 1HH6A 3QZLA 4XXWA 1QFOA 1H0DB 1HU8A 4R96A 2GSGA 1Q9OB 4U1IB 3EUDA 4CSPA 3V79C 1KYUA 4JE0A 1YC8A 2HTKC 5E5MB 2Q8BL 4HSCX 1YNKL 5ALBH 2ZWNA 3B6SB 3UG3A 5I66A 2EDNA 3OMAB 3QDGB 3SE9H 4X6CE 3WYRA 1MQ8A 1K3IA 1NDMB 3DV6A 3I84A 3MNZA 1RUAH 3CDGA 4O00A 3OAUH 1DZBA 1FDLH 2QPEB 2CR0A 2WN2A 3NRQA 3NTCH 2VDPB 4AK1A 1TPXB 2NY2D 5IQNA 5BW7C 1MW0A 4ZD3H 2FT6A 1Z9SA 3QXDB 5C6PB 5IG7B 4ICXA 3WKNA 5GS3A 1A6UH 5J5EA 2Z93A 3IMTA 2VWEE 3C5XA 1NBQA 4NQDB 4S2SB 4D9LL 3D06A 4OLZL 3H2QA 3QO1B 5F7UA 2DTMH 3CQQA 3RA7L 1CQYA 2ZCLH 4IKIA 3L4TA 1MCDA 2ZYRA 3B5HA 3MLTB 4HBCH 3U36B 3CVIH 4KX7A 4OFPA 4GO6B 4NN5B 3D48R 3BEWB 3N40F 5DRXA 3WFHB 3EO9H 1OM3H 2DOCA 2YJQA 4FEMA 3GSOB 5A7BA 3E0GA 2OXGB 4FMKA 5DWPA 2DH3A 5D9SA 2QHRH 4HS8L 1U3ZA 4KU1A 2ADJA 1M7XA 1DR9A 4HLZH 3NFNB 5DK2A 5F7NC 2P52A 3UACA 4AVIA 4JQVC 3TFBA 1FBIH 3L9RB 4K3EH 3F7YA 4FQ2L 3AWEA 1DN2A 2VN6A 3Q8BA 4YSRA 3B9KB 3NOIA 3VXSE 1U36A 4L1LA 4ZMZA 2OMWA 1NM4A 3PGDA 4NN7B 4GKZB 4PYGA 1IGFL 4F2ME 3ZLQC 3MV7A 4NUJA 3BPOB 3MO1A 1YMMA 3RX8A 5K39A 1QFWI 1KB5A 3CFJB 1S7SA 3BLKA 2C4FU 2FGZA 3MRJB 4H1LG 2PO6D 2XZQH 2YQ3A 3HZ3A 4P06A 5GZND 5C3TA 1UB5A 5E4AA 5AUMB 5HDOA 1SF5A 2UZIL 3MUUA 4O4YH 1G0YR 1TJMA 4Z0XA 3L3JA 3T0VA 2NTFA 4OZHF 1S3KH 3DSNA 5F9JA 5IOKA 3LKRA 4GPVA 1A7QL 4WTQA 2AQPA 4F8PA 1L3NA 5JOFB 4BUQA 2CO4A 2X05A 4B60A 1NCJA 2JCCB 4M7KH 1DSFL 3EDJA 5I6PA 3B8YA 1BWMA 4N6RA 1UA3A 3KG5A 5C0AB 3GGWB 3LRKA 4HS3B 5E08L 4RZCA 4Z0BH 1YCSA 4NJ9L 3SDCB 4B41A 4KQ3L 3QEHB 2DB8A 2ESVE 3B5TA 4EPSA 3QQXA 1YAIA 2JI3A 4U1JB 2BRQA 4M6OL 2QSQA 3D39A 2ARJA 1D9KC 4PJXA 2NXYD 1I3UA 2H6OA 3LNIA 3QIBC 4RCAA 3D9AL 4PR5B 4L1TA 4XMUA 2UUDH 4MSWB 4N8VA 3D1MC 4R9HA 1HZKA 2H1PH 1RZKL 2E7HA 4PWEA 2QR0B 1VFUA 1Z1WA 3K1DA 3UYOD 3T8XB 4IHOB 5CP3A 1K8IB 2XDHA 3PFQA 4XNBA 2ZOKB 3P4MB 4U05A 4OZGB 2YHGA 3O2WH 2DS4A 3S34L 1F4WL 4YX2H 3JV4A 1S78D 5IF0A 3WIIL 4WWKB 1A9BA 5HYFA 35C8L 3U0PA 3ARSA 4I9XA 3RUGB 3OD3A 1CLVA 1CL7H 2P80D 3HN8A 3LRLA 2ATKA 1O75A 1FYTB 3LPPA 3N41F 3OKDB 4KMTL 2H32A 2XA8H 5HHOA 3ML8A 4AY0A 3RP1A 2IFGA 1GKEA 1RZQA 1OF2B 3QCTL 2FJFB 1FH2A 4IIQC 4AMWA 4ZBJA 5T3XE 5T5FA 3NIDB 5F44A 3P2DA 1U8QB 2OM5A 1DQMH 4J1UB 1KB5L 1B6UA 1J5IA 2QVKA 1IC7H 1S5IL 3DURB 4KXCA 4G8GB 4LNRA 4X7EC 4XN9A 4NNPL 3GPSA 3WE1A 3HKZA 1H8SA 5J12B 3HMXA 3EDKA 3L3IB 3HJEA 3IJHA 3OPZH 1ADQL 1UH3A 4ZOBA 1IL1A 3ZDXB 1C5CL 1XCTB 2DQHH 2KKQA 4U31A 4ZD3L 5FHAH 4G8IA 5IB2A 4L2LA 4BUGA 2BP3A 3FB8A 1PYWB 2E7LA 2X4RA 4MAYB 5JHMA 4L8CB 4GG6F 4U0RC 4OFDA 5JQIB 3EW3B 4KTGA 3OG4B 2J2ZB 2VDML 3FNKA 5AKTA 1IIIA 2W92A 5F7AA 2C3WA 4DTGL 2PCXA 5KUKA 5L7XL 1S9KC 3CZEA 2R69A 1XGQA 2M1KA 1NC2D 4GOSA 1RHHB 4NZTH 2W07A 1F18A 5DUPH 3ARFD 4PPTA 4X42A 3VXUB 5K69A 4FAAB 1K85A 5E8EA 3VGAC 3BWZA 3KPLB 1BAWA 4M1GL 5DZOA 2P43B 4BQ9A 3LQZB 4PWKA 3TEYA 4G8GD 1VEPA 3T71A 1KIUA 1QZ1A 2CGZA 2X4OB 1BBJB 1S9XA 3H3KA 2ZYSA 3UZEC 4HS8H 4EN3C 1SHXA 2E8ZA 5CJ8A 3B9AA 3SYPA 2X09A 4ZQTA 1MEXH 4WEBH 4YHKL 3W9EB 4ELKB 5E8PA 1MEXL 5F3FA 1LE5A 3W0WB 3AVEA 4MCYA 3QFJD 4L18A 1VPOH 2A83A 5D4JA 3FJTA 2F7RA 3KYNB 5EOQH 3VI4E 2Q6WA 1DLHA 5IV2B 4MQXD 2J55A 4Y9BA 1QNIA 1G7PA 3V0VA 1OE3A 2EE0A 2XKNA 3CZLA 3ZU8A 2X70B 4NPKA 4A2HA 1HI6A 4AITA 3C8DA 4BE6A 1UVQB 1SYVB 3N3EA 5EBWA 2XV2A 1KOAA 4XPAL 3CZGA 4DP8X 5D55A 2P3YA 2PXYB 2ROXA 2ENQA 4EF3A 2BM3A 2DIAA 1URZA 4QHLB 5I74B 5B3JE 5FYKL 3OB0H 3D0AA 3KYMB 1WT5C 4NZTL 3F62A 5DGRA 2FNWA 3E3QC 4LE8A 1M53A 1BJMA 3T9WA 1CICD 1ADQA 1A2YA 3H3BC 4PWJA 4WI6A 3SBQA 2VLLB 3T0BA 1XF4A 1WZ1H 2HUHA 2XZZA 2CA3A 1A0QH 2FQGA 3G5XA 5DFAA 4DP5X 4J8RB 4Z76A 2HRGA 4P07A 5J3HD 1J0YA 1ML0A 2B14A 1T0PB 2W9DH 1YQVH 3FOLA 3ARFA 3S5ZA 3DHUA 2JKJA 4G43B 4AYID 2WO4A 5FK9B 4XWOC 5HVHC 2Y23A 4UI2A 3UGXA 1JF1A 3B1UA 3G3LA 1OSZB 4NQVB 1ZLVH 2F8VA 1CD1A 3HG0A 3HR5A 4PJIB 3HN3A 5HD8D 4BZ2A 2PF6A 4RMSA 1IV8A 5TF1H 3I6GB 1P6FA 3ETSA 4LO9A 2ENPA 4IBSA 4IBUA 1PG7W 4V11A 3L7FB 1S8DA 2O61A 5HJBA 3TZVA 3VD2A 1Q9KB 5AW2B 5PAZA 4JFFB 1BQRA 4KY2A 4XXCC 1L9PA 4XNYL 4MS8C 4IDLA 5I73C 4QKXB 5DUPL 3NK3A 2G9HA 4PREA 4Z7UA 1INQB 1IGTB 1R24B 2E9GA 4GRLD 1N18A 2AXWA 5A3ID 2Z92A 3J8F7 3NEOA 5DHVA 1PD6A 2HG0A 2NQ3A 4IDJH 3ZMEA 3C6SB 2IOOA 2VO5A 1SOQA 4E42B 2OCJA 2HKHL 3BI9X 4HPOL 1UWGL 3WNKA 4FC3E 1NAKL 3LDBB 2D2CC 3PRZA 1HKLL 3K5SA 4ODUA 4HFWB 1HL5A 3M88A 4XP6H 4AZ8B 2CO1A 1QRNA 1SEQH 2FDBP 2X4QA 3ARFC 3R0NA 4G7YL 3C6EA 3QPXH 4HD9A 1XGUA 3FQRA 3OX8B 4LBEB 4WO4B 2VXQL 3EZJB 4HOWA 3J2PA 3QNXB 1IEBB 4P2AA 4JM2B 4LFHD 2KBGA 3IXTA 4QHNA 4X6FA 2DWTA 2XWCA 3IN0A 2FB4L 2WCPA 3ULSB 4HGWB 4ONFL 4JGNA 3PIQB 1KYDA 4UYQB 4WWID 5IVXB 5JIDA 2UZXB 3VO0A 4AGNA 1LP9F 4GLRI 4JFFA 1MCBA 5DLML 2X89D 1ZA6B 5IJKC 4H8WL 3BP6B 5JO5A 1JUFA 5FGCE 3BCDA 3LYRA 2QSVA 4BKLA 2G9HB 4PREB 5B39G 3BKCL 3F6IA 2OSLB 2NYKA 3FL7A 4NGHH 4PJAA 2BIIA 1U8HB 4NM4H 5CAYB 3G9VA 1U3YA 1SJMA 2XXFA 5CJ5A 1L6ZA 1U3JA 2XA8L 1K4DA 1DN0B 3MRMA 1QLEB 3R4RA 1OTTD 5FYLD 3V4VA 1BV8A 1IGYB 2XNAA 1N6QL 3SQRA 4MJIA 3H9SA 1N2RB 1AR1C 4PJIA 1DL7H 1W72L 1NBYB 4FOMA 3BFQG 4HK0A 1D5BA 4AM0B 4F9LC 4P5KA 1HKLH 1X7QA 4X8XA 5D4IA 3VVVA 3G5XB 2V37A 4PRHA 2AZUA 1HFUA 4ZMWA 1OTUD 3KPNB 5I76B 3KH3A 3H8NA 4N0FA 3MREB 2DMBA 1OP3K 3U7WL 1ZSDB 1KIQA 1T1XA 4A2MA 1SOXA 2NW3B 1ES0B 1LEIB 3CVHA 4GAYB 4YDJA 3BDYL 4P5TA 5E94B 3QWQB 3ARWA 3MLUL 4F24A 1QWHA 2F54B 1R6VA 3WELA 3VXPA 4IGBD 1UWYA 4OW6A 1IC4H 2GJJA 2MNUA 1CT8B 2HB0A 2ZG3A 3BQUB 2PCPA 4YFDB 1FVEB 3TCLA 3BWAB 3FO9B 3VFOB 1MCWM 2WGNB 4U3SA 1NIEA 1O6VA 1BQSA 2IPKB 2XTJD 3CTTA 4HBCL 2VZUA 4IJTA 3P3TA 4B50A 4X9BA 4ZX3A 1OWRM 3ESUF 4L4VD 5C0JA 1AQ8A 4A2FA 4QF1A 3PUUA 4N2CA 3WFCH 1Z66A 4UINH 4XP5H 2UV3A 3O3DB 3WIHL 1T20A 5JQ6L 4BE5A 2RJMA 3H9HA 3GSWA 1HDMB 4AQAB 1QO3A 1ZTXE 4G8FA 4BCXA 3UTZA 3LIZL 3MRPB 3SDCD 1AIFB 4EQ3A 2QQNL 3II2A 1KLGA 4PRPD 1P2CB 4KX8A 1TZOA 3PAYA 3PV7A 3POCA 6FABH 4KJPD 2MQ0A 2X6AA 2ZCHL 3IJYB 3V55A 2VR6A 4K2UH 4D9RD 1OGSA 4YUEH 5D7KE 4BA0A 5BOJA 4PRPB 2UY6A 4GRWF 1BF5A 4AG4H 1A6PA 3SPCA 1MCLA 2BVEA 3CN3A 4KO7A 2OK0L 3Q05A 2Q86B 2ZUVA 2OMXA 2OXHA 1YPZA 2X4UA 3HN5A 4DKTA 4PLNC 3E6FB 1E67A 3NJXA 3Q6GL 5D72L 3TH3T 1DBJL 3FB5A 1S7XA 2Z4QB 4N3UA 4J3SA 4Z7VF 5K1NA 1G1KA 4KV5F 4BKLB 5LGKA 1P4IH 1X6LA 3FFDA 1BZEA 3KPSB 4M62H 1LE9A 2BFVH 3OHXB 4M48H 2EYTB 3TU6A 1ZA6A 3RZCD 3GC3A 3D2UA 3MYJB 2AK4A 4ZOAA 5EN3A 4XODA 1CGYA 2H8PA 4XTRC 5AAMC 2W91A 4QHMB 3STZB 3CWGA 3IEAA 5D7JA 2P5EA 5JR1H 5CJQH 3IGUA 4N2GA 5HGHB 1UENA 1YYLL 2HTLC 2YRLA 1X5IA 3ATAA 5LXGL 1ZGLA 3RVVD 4HHAA 5IROD 1LEKA 5IB3B 3RY6A 2R59A 3NG5A 4R3SB 4CMHB 1DAQA 4TSCH 4R2GC 1ZPUA 2IALB 2MKLC 3LRHA 3BH9A 2AJXL 3BWUF 4L29A 1CTOA 3BFWA 4WJ5B 3IVKA 2CNZA 1U92B 4QOKE 3SY6A 2WP3T 4N2KA 2EO7A 3V0DA 3FTYA 4S1RH 3N42B 1Q9LB 2CLZA 1EJ6A 1PAMA 3QUYD 5E9DE 2QQQA 5D7HA 5AW3B 5CR8A 5FUCC 2J1ZA 5IMOA 3VD1A 3QWOA 5H4ZA 4QRRB 4WHYH 5EULV 2ADGB 2BVQA 5CZVH 1DANU 3PGDB 2ZXQA 2OK0H 5KSAB 4CSTA 4OCWL 4J3UA 1H3XA 4Q9RL 4TS6A 2HJKA 2BIQA 5EBMB 3NJVA 4R0LA 2ICWA 3T77A 1ILUA 2AQ1A 1NBYA 2X38A 1O7DE 2FLMA 4K3DL 3LMJH 3CSYA 3IDXL 1F6FB 4HXAL 4KX9A 3FMGH 2P26A 3WKMH 5IB3A 4XOCA 2UYLA 2AV7B 3GTNA 1FFNB 4X0KA 2GPZA 2HVBA 1OARL 2HG5A 4LCWE 1UFGA 4P9ML 2EDMA 3MRIA 5B38B 3VFWA 1I1AB 4YXKH 2X2YA 3Q2LA 4WAFA 2BMKA 3FO0H 3B2PA 4MA1C 1NIDA 5JOPD 5T1DL 5CR1A 1JWSB 4PG2C 3UAFA 1AD9A 1U8OB 2NUPB 2UZXA 3AAZA 5ALCL 1OM9A 3B37A 1KJ2L 1A2YB 3K2KA 3FH5A 4AH2A 4G9FB 4KNUA 3K0YA 1WD8A 2A0LC 3KYOA 2EDOA 2UWEF 5T3ZE 1T7ZA 5JHBA 4JGJA 4MNQE 4WW1A 4IMLA 4WJKB 3OX8A 5E2TL 4CN1A 3CG8A 1KIRA 3RTQD 1E5UI 3L1OH 1JRHI 4R5XA 4QHPA 4P23A 1FJ1B 1LQSR 3MROB 3AG4B 4Z7OF 5EH1A 2NPLX 2OMWB 2Y07H 2R0WL 5F0LB 1E7VA 4LCYA 5CGBA 4DKDC 5EEVA 2H3NA 2OMNA 1FGVL 2DQUL 1PZDA 5K39B 1P1ZB 2AQSA 3DSFL 4N90E 7PCYA 1BQHB 3HUJE 1U3NA 1R5IB 2XC8A 2Y06L 4DESA 4F58L 3IDNB 1JMXA 5DWUH 3C6LC 2PCFB 4XB8A 3F7YB 1V27A 4ZI8A 3PQYD 5DJ8B 3N91A 3PHQA 4DVRH 2XX0A 4GSRA 4UOQA 4MAYC 4N2LA 4L9DA 2OJEB 4XP9L 4GMTL 3I2CH 4OGXL 4Y5YB 4JPIB 4PJDB 3REVB 1KBKA 3V6OC 5F7KC 4AKPA 2WNWA 2DICA 2VZOA 3T0DA 1XXFC 3TLRA 2VDRH 2EXSA 2EIZB 4W81A 4JRXE 3BAWA 4FXGC 4BDVB 4U1GC 3SDAA 4XZUB 2ZOOA 3IPBA 3MN8A 4ATTA 2X4PB 3N85L 4JJOA 2C1OA 1JNLL 4OAWA 1F45A 3IE4A 4HJIA 3LEVH 4FLQA 3WIIH 2YA0A 4E5XA 1LO3H 4JAMB 4AYFB 2J88H 5I76A 4R4FH 2AJVL 3VWJC 4R4FL 1D5XB 1GHFL 3LJ3A 3X2QB 1A6AB 1DBML 1GHFH 2RHEA 4HKJA 3MUGA 3IMSA 2WXOA 4Y2DC 4JBSA 4APXB 4TUOA 3EH2A 7CGTA 4N2IA 3HMXL 5BZWB 5IW6B 3QRGL 5FUZH 4M6ML 1ESOA 3D85B 1MWAH 3GJEB 2VN5B 1BFSA 1DN0A 1M71B 3GHPA 4WRLA 2NY6C 4WLCA 3MPCA 4WV1B 4OCYH 3VM5A 1BQKA 1BVNT 1U95B 4DP0X 3HG1D 3T8MA 3SBRA 1OTSD 4IW4C 2EACA 5LDSA 4R8WH 1T80A 3AGVA 1OXYA 3RG1C 1XGYL 2C3HA 3U79A 2NY3C 3WJMA 4KH2A 4M6OH 2FL5B 2XT1B 4JR9H 3W9DB 3IMBA 4LLDB 5KYUA 3VI3A 2WNXA 3FO2A 1IJNA 5EZOL 3SDAB 3UJJH 4I18A 3LN4A 4Y7OC 3WTVA 4PBVC 3BO8B 3PP4L 4RISH 4Y16C 3CFKA 4J3BA 5ESAA 1J12A 2BP0A 5C0RL 1W72B 1P7KB 2GFBB 3NPZB 4NXKA 3LHAA 2GCYB 3UYPA 3RUGA 4DO5A 2Z31D 1OAYL 2H1LM 2VDKH 3T6XA 1EV2E 3DIFA 1ZRUA 5HYSB 4U6HB 3MJWA 1HWWA 3WE6B 3RVUD 3CU1A 4PS8A 2BW5A 3DJTA 2R9HC 3MBEA 4IMLB 4KKQA 4LBEA 5CILL 4YFLI 4GEJA 2YC1B 2BNRA 1MCIA 3QCVH 4Z7QB 5C86A 4TRPL 5E9DD 1CXFA 2R1XB 1B4RA 1T0MB 4IS6A 2X7LA 2BZDA 1JN6B 1JWUA 4I88A 5F0JB 5HHME 2VDQH 4P05A 2YMOA 2I9LA 1IBFA 5KBMA 2GJ6A 2NYYC 4EAEA 4PJ7A 3RGBA 2DY2A 4FULA 5DMKB 3QEQA 2WQWA 2OYKA 3VXRE 2VM9A 4UAOB 1AQDA 1H5BB 1NOAA 3OR6A 1KJ2H 4LCCC 4UTBA 4X5XB 1ITCA 4L8CA 4GLRH 3NJFA 2XFXA 3U2SA 3K2UH 4U7MA 1E9OB 1HNYA 1WTLA 4NKOA 4PJDF 4M93C 5IFJA 1IFGA 1MJ7L 3MUGB 4HS6B 2R4RL 3DYOA 1DBAH 5ENWA 1NEUA 4HZLA 4W9HC 2NW2B 3DRTB 2OYLA 3NGBB 5JXEA 5T1MB 4HKBB 2X2JA 1IM9B 1D5IL 3VJ6A 2PABA 3NDZE 4EUPB 4PJEA 4JAMA 2FTAA 1JHLH 5FM8A 3DVGB 5E24E 1I1YB 2ZICA 4FI6A 1E27B 5AENA 5I1GH 9CGTA 4N2DA 4DP9X 4XVOA 1LO0L 1G6RH 2O5NA 4WGWB 5SWQA 3IDXH 4KZ0A 1MCCA 2LU3A 1BMZA 4PRIE 2ITEA 5D71L 5DZPA 1OTUC 2QQLH 3QUGA 3TOPA 5EZJA 3F7KA 3K6IA 2ERJB 2CDFB 1T5XA 2EXWD 3BP5B 3JT0A 3Q1EA 4UIMB 4ESKA 5I0YA 4RAVB 1A9BB 2C3GA 1WV7T 5FIEA 3EOBA 4UBDD 3SE9L 3OXRB 3VMOA 1F3RB 5I19H 4KQ0A 1WA1X 4YLBA 3L13A 3TN0C 3E9TA 5GXBB 1GGYA 3CLWA 3QG7L 1SHSA 5I6LA 1WAEA 1E43A 5TGBB 2HJFB 3TIDB 1QLFA 1HYSD 3D30A 1JS4A 4MA7H 5AAWC 3T4YB 2G75B 4XX1G 1JP5A 1MHEA 2NY3B 2XPGA 3DJRA 4OBSA 3DTXB 2F74B 2ADFH 3QI9C 3S3CB 3QEQD 5D1XE 2VJ8A 2DMHA 3ECQA 1Q38A 4ZUUB 4UAHA 1P4IL 3NPSC 3MUZ1 4K71B 3HBPA 4UTBL 1EAJA 1SUHA 2FWOB 2VABB 5D2NC 4DJMA 1QUNA 1JGLL 2OQJA 3LMJL 3V5HB 1JFHA 3QQ9D 4U6YB 4EN3A 4XB7A 2BZ7A 3N1GC 1CFSA 1S7TB 2X2UA 3APDA 4AIZB 1CYWA 1E28B 3UTQA 4FYQA 3CQPA 2WUCH 1V7MH 5CP7B 1V55B 2YRZA 4DAGL 3VGHA 3CBKB 1YEDA 5EC1A 4XNUH 1TQWA 1IM3B 5CD5C 5I1AA 2GK0A 1HXMA 3LQZA 3VI4F 1S7UB 2QADC 5ITBL 1JWSA 1WWCA 1NDMA 1P9MA 4TLTA 4M5SA 1RHHA 4N2MA 1YYCA 2EDDA 4JHUA 5D1ZC 4XXDB 2XA3A 2Y7SA 4QRTA 4P3WA 5F7FA 3QDGD 1H0DA 3LEXB 4QXGH 5MEOA 4NM8H 4OD2B 3JV6B 3T2NH 2BNRB 2XTJC 5GGVL 1N9PA 5KJRL 4PRPA 3KLDA 3FU5A 3U9UA 4KVCL 1CGUA 1I4FA 1QKZL 4MJ6A 2LV4A 4XMLH 3GSVB 5FYJU 1NTDA 2VDKL 3NFNA 3V7AG 3LEYH 4AKQA 3O6ML 1JHLL 1AO7E 1X5YA 4PRNA 1BZ7A 2EDRA 2W60A 1J1XH 4HH9A 3ZKQD 3AWFA 2O6FA 4M48L 4FZEL 4K07A 4GMSH 3EF4A 3CVHB 1MF2H 1RZIB 3LKQA 3CVBA 3LKSA 1XF2A 5EIIA 3OKLA 3W11C 3VCLA 2HFTA 5F7EH 1JZ2A 3SPVB 1Q0XL 4XBPA 1G9ML 4ODSH 1XXDC 4M6MH 2D73A 2FJHA 1MDAA 2ZCKH 1UXWA 4XNQB 1NCBL 5IVOA 2KH2B 4BSVB 4EZMA 3U7YH 1TR7A 2AK4D 4JO2H 3NN8B 4QRAA 5CO1A 4J3OC 4HYTB 1DJSA 3TZVC 1G7IB 1D7FA 4TUOB 1KCVH 3T0EC 2KLTA 3A6BL 5EBLB 3SYOA 1GGIH 3WFEL 4ALAL 3CXHJ 2WPGA 3QORB 2CKNA 3HZMB 1XF5B 4M3HA 1SLWA 4P3CL 2H1PL 1B4TA 4RIRA 2BNQD 2ATPB 4JG1H 4PJHE 3N85H 3BD5A 2LTQB 4XR8C 4PJAB 3AS0A 4ODWB 2GBUA 2P1YA 3O8XD 4NT6A 1ZHKB 4XVTH 1OHZA 5DJYA 5DZNA 2X42A 1GCFA 2C3XA 2NY0C 3FUJA 1JN6A 3EADA 5ESQB 1T7VA 2DYPD 5B3NA 3ILPA 4HIEB 2OMYB 3DNKA 3OKOA 3IKKA 2EIZA 4WNJA 1N5YH 1ZEAL 3RWIA 4M8RA 4XCCL 2FX8L 5BVJA 5CJXA 3QC5X 3CDZA 4OFQA 4ADIA 3FSWA 1KNOA 2GJZB 4RNRA 5IFAL 2WWNA 5FYKU 2VL5B 2A9AA 2NSMA 1S78C 4P8QA 4AIZA 3WHE1 4HEPA 1ACZA 1QD0A 2JE8A 2X28A 2Y2WA 4XMVA 1IEBA 4A66A 4UQ9A 4YN3A 4HOZA 1Z7JA 4V1DE 5FOJA 3SGKC 1GCYA 1AKJD 1G1OA 2RAMA 2XJKA 3DSNB 3MA7B 4CRPA 3TJHC 1AC6A 1ZT7B 3GMNB 1E8ZA 5D7SL 1J0KA 3O4OC 4MJHA 3CAFA 2CR6A 4L1BA 4N28A 3T3PE 4OLXH 3UERA 1XB8A 5FHBH 5HYJE 2M2DA 4WFHD 4PI0A 4X8JB 4CL7A 3RZCA 5L6YH 4JKPH 1WFOA 4PRID 3VI3B 5KYUB 2Q3ZA 1EAQA 3SKJL 1ZD6A 2DEYX 3PDOB 1XZWA 2P7TB 4LLAA 4U1SA 3BW9A 3OKYA 2IEPA 5GS2D 5FFGA 3SO3B 4KHTH 2VDLH 1T1YB 1YEEH 3O4LD 1WBXB 5EDSA 2LAGB 1KTCA 3WLBB 1Y18B 4LVHC 3L17A 1DAVA 5DC2A 3DO7A 3CCHA 3G5VA 1KG0B 3IDIA 1OALA 1J1PL 3LS4L 1NGYB 3F12A 3EJTA 4G6ML 5FFOA 3FTWA 4TVUA 5IW1B 4QEGA 2GSIB 5HDBB 2XG5A 4PRAA 4F7CB 2VAAA 1ETJA 2EEXA 2VQ1B 1I75A 3C60C 5ACZB 5IHHA 1NMAL 1CDIA 1WBZA 4M7JH 5IQOA 4JG5A 3NCJH 3S37H 1D5ZB 1I1AA 3PS6A 2IDFA 2PP7A 4OFYA 3B9KD 4X6CB 3ZE0B 3DTDA 2XKSA 4HK0B 3NIDE 1ACXA 1PEZA 3B2UC 4OKVA 3UPRA 2GY7B 3F7VB 1LJMA 2CUMA 3IK2A 5K59E 2NZ9D 2E9BA 3HZYB 1DQKA 3PAUA 2DMKA 3VFSA 5F88A 4KAQH 2QQKL 3V4UH 3PHOA 1XZ0B 4RRPG 4FYTA 2VLKD 1I1FB 4OI7A 5EZIL 3OMIB 4DVBB 2XV0A 2WMPB 3K8KA 1NGPL 3CZKA 4GP8B 4CN6A 4DOHB 4KJQC 3NBNA 3BUYB 2Z8WC 1JNHA 5DFTA 3OWEA 5I1KL 5LN8A 2PETA 3CFUA 4AJVA 4ENED 3WLBA 5H37A 2J20A 1H6EA 3HE7C 3QDGE 4RSYA 2R2HA 1XTMA 3VRJB 5GGRA 4L3EE 4QRRD 2FEEI 2VR5A 3CUPB 4LZKA 1DFXA 1S7RA 3K5RA 1F4HA 2AQ2A 3MRFB 4RMBA 5LXGH 4PP2B 3O3UN 4NRYA 3K1KC 5LGHH 5HGBB 3VQMA 5M7QA 1TSHA 4MVBD 4G42B 3C5SB 2FJGB 3QDME 2MNJB 1R0AH 2VDMB 1NSNL 2J5LC 4MWFA 2KMWA 1EAPB 3JSSA 3K2UL 2IMNA 1AFVH 2JB6A 4BH7B 4TSBH 1QFWM 4RX4D 3GSVA 5AKVA 1LL1A 1V05A 3GHBL 5SX5H 2RALA 1SVZA 3ILPB 1A3RL 4ZFQA 5ICZB 1R24A 2OR9H 3FO2B 5I1DB 3QG6B 2PP9A 3E9UA 4Q6IB 5JNYA 4YEEA 1UACL 3NH7L 2K9FB 4OZ4B 2QPFA 5I8CB 4LLYA 3ZL1A 3K46A 1BD2D 1BA9A 5F3BA 1MAJA 2JI2A 4QRSA 2F7PA 5AEAA 2X4UB 1G7HB 4PSRA 4YX2L 1KPUB 1CTMA 3QNZA 4KUCF 4KXAA 4R7DA 2MOVA 4DQAA 4F2MB 1TZAA 5HGAA 4HK3N 3FCTB 4HW6A 1F58L 1PX8A 2VDNH 5AVUB 3TYFB 5C1MB 4YR6B 1F90L 1WTGT 1S7UA 1NH6A 4XC1L 4DOHE 3PREA 4BM7A 5D7LA 4QI3A 5IJBC 4IBYA 1YLBB 1MVFA 2EXYD 3MGAA 1OSZA 1Q8MA 4H8VA 1IFRA 3IYLW 2J12B 5F7WC 3AC0A 3ARGB 1K6QL 3FB7B 3MBED 1J8HE 3QIUD 4IEFA 5AWNH 4AIEA 2J5LB 3JVGA 4O51A 5G4MA 2YPLB 3AJ7A 1JSYA 3JZ7A 2GJRA 3WS6A 2OL3A 2NUTA 3OKNB 4GAJL 4RGND 1XGTB 3W11D 2WXHA 2H6PA 3OKLB 3QZMA 4TNEA 1QBLL 3ESPA 4FKKA 2FD6L 4KRPC 3OPZL 5E9AA 3VXOA 1J5OH 1TT6A 1R1CA 5IY5B 1O9ZA 4EQ2A 2ZX8A 1HHJB 1ZE3H 1MNUH 3MKKA 5B8CA 4HHWA 3CH1A 4KK6D 3UTOA 4PRNB 3DBSA 2FO4B 1MXGA 4ZTPH 2IPTH 1BXXA 1YEWA 5I16A 4ELKA 4RWHA 3ZT7A 2ZX9A 4X4XA 1I4FB 1ZS8A 4R0LC 1H6FA 1CL7L 5DQJA 2FJUB 2YPVL 5IKCB 1PG7H 2G2PA 1ZTXL 4D9RE 5DR5L 1CDGA 2RB8A 3FONA 5CMAA 4W9DC 3WY2A 2XWDA 2K6WA 2N7SA 4ZX4A 4KI5C 1FC1A 5I73B 4N8VB 4KK9C 5LVEA 3MQIA 4L3EA 3IFOB 2NXYC 2BP8B 4A68A 4B0MB 4OIIL 5DFVD 4H88L 4XO8A 5KVGH 1D7DA 4JCLA 1IQDA 4PEEA 1PIGA 3MROA 3ZYIA 3VW3L 3W2DH 2JTYA 5GSRA 1KULA 4PU2A 5C0AD 3PFUA 2I24N 4HKBA 3I9GH 4MD5A 4RRPA 1MCOL 4HDIA 4NC1C 2A6JA 3VE0A 1WLHA 2AAVA 4OF7A 4K5OA 1EFXB 2C9VA 1EUUA 3SYQA 1SXZA 2BNRD 1U8JA 3RAJH 1AI1H 4J6IA 2B9BA 3KPLA 1CGVA 1WIPA 1V8HA 4X4ME 4WUKH 3ZUCA 4G7VL 5IOPB 3U0WH 4WFED 5KVDE 3TP4A 1GXEA 2HVJA 5CGYC 3H9SD 1DVYA 1AQKH 4ONOA 4ONHB 5DS2A 5BQ7B 2Q0ZX 3KPPB 4JN2B 5IZ7A 4P2QA 3L1FA 2EXWC 4ZJ9A 2X2HA 1EZUA 1HZHH 3WY3A 3ETTA 1DJIA 1XIWD 4BIKA 4UT6A 5FUOH 1UB6A 2TAAA 2JKNA 1I8LC 4PD4K 4YL9A 5H4YA 4J27A 2XVBA 3BZ4A 1E2VA 5C2UB 3CFBB 2DQGL 3JV0A 4XO3A 4CKQA 5DK3A 5EA0L 3BQUA 2BVUA 3VYOA 5I6XB 1OPGH 5L4MA 2YAOA 2XN9B 1B4LA 3L3JB 1IBYA 1RUPL 2EIJB 3MLRH 3QI9D 5CIPH 3EYOA 1FVCB 2HH0L 1CFBA 1J8HA 1LP9B 1MH5A 3ILQD 2HH0H 5MERB 3GI8H 2ICWI 3VU1A 2FSDA 4IOSD 3V2AR 1CK0H 4ALAH 1S2EA 1XZ0A 4BHU