4WI0B

Crystal structure of coh3scab-xdoc_m2scaa complex: a c-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
156
structure length
156
Chain Sequence
GTTVSGYINPDFVTTSTTAPIVKAGFTVEIVGTTKSAVTDSNGYFEIKDVAAGTYTVKITKANYLTREIANVSVTADKELSTSASPILMWAGDMAIGGTQDGAINLEDILEICKAFNTSSTDAKYQVGLDLNRDGAISLEDVMIVAKHFGKVSSDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulosomal scaffoldin adaptor protein B
publication title Crystal structure of Coh3ScaB-XDoc_M1ScaA complex: A C-terminal interface mutant of type II Cohesin-X-Dockerin complex from Acetivibrio cellulolyticus
rcsb
source organism Acetivibrio cellulolyticus
molecule tags Structural protein
total genus 41
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1330.10 Mainly Alpha Orthogonal Bundle Type 1 dockerin domain Dockerin domain 4wi0B02
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 4wi0B01
4UYQB 1DAQA 5LXVB 1QMUA 2NSMA 1OHZB 4FL4C 5G5DB 4UYPB 3NJXA 2CCLB 5AQ0A 2B59B 1UWYA 4FXTA 4FL4A 3G3LA 4YOKA 3E8VA 1DAVA 3NJVA 4IYKA 2VN6B 2JNKA 2VN5B 4IU3B 4WKZA 1NKGA 4EIUA 2OZNB 2XHNA 3HN5A 2MTEA 4DH2B 5K39B 4WI0B 1H8LA 3MN8A 3UL4B 4U3SB 2Y3NB 4IU2B 3KCPA
chains in the Genus database with same CATH superfamily
2W0FB 4U6HB 2Z0UA 5ACMA 2D0HA 3B43A 2Y36L 4NX0A 3GMNA 4ZX5A 1WWBX 2BSRB 3H7LA 1MF2L 1TZOA 3CDGA 4JFOB 2JIXA 2WJ5A 2BY3A 3SGEI 3UXFA 2ZIDA 4QAMB 1F90L 2GT9A 4JLRB 4YDMA 4JM4L 1XXDC 2J8UA 5SV4A 3TWCH 1NDGA 4BQ8A 5E8DH 1A7RH 3AQXA 1HXYB 3NTCL 1JWSA 4FQXA 3AGWA 1T1XA 2W1NA 5IEHA 4X7DC 3VXRD 1N18A 3C5JB 2XFXB 1PD6A 4P5KA 3VWJB 3ZYIA 2NXYB 3PAYA 4N2LA 5IBTL 4IKJA 2Z92A 5F3FA 5EOTA 3N44F 4YDZA 4ZMLA 2B9BA 1GVIA 1OB0A 5HY9B 4R90L 2F54D 3VFMA 3P11H 2GUOB 1MI5D 4G7YL 3SYOA 4HU8A 3CFCL 3GTVA 1WAPA 5DD3L 4M4PA 5I1CL 3ZE2F 3EJTA 2HLEB 2DMGA 4LKCA 1SGKA 4KKPA 5J1AA 3VI4F 1IVTA 4LDLB 3P30H 1E8ZA 1KJ2B 5FM5M 5D2NA 1KYUA 3N50A 1IGTA 2DYPA 2PR4H 2QVFB 4M7KH 3TBWB 4LCYA 4AEIL 1JDAA 1CICA 2PPDA 3EKCA 1GIGL 4M6AA 1NLBL 2GAZB 3P3RA 2ZKYA 2NZ9D 3H85A 4MGXA 3WI9A 3AG4B 5H94A 1U93A 1M7IA 4X4MA 4AMXA 2BS8A 5CXPA 4I48B 4J27A 1BD2A 1D5ZA 2I60H 2KBGA 3MNZB 1RHHB 5IQ7L 1ERNA 2K3TA 3UFIA 4ADGA 4UT9A 5FCUL 5TF1L 2NY6D 4BCZA 2AK1L 3PRZA 2VL5A 2X0VA 1QRNA 5C8JB 1MFBH 2IFFH 2ZT9C 4FQQB 4XPBL 3TYGH 1SDAB 1Z9NA 4ZFZB 4I9XA 1U8MA 3V0VA 1BVNT 2Z31C 5T5NF 3HS9A 4XCFH 3NCXA 4MA8L 3VFTB 3WJJA 4KK9C 4X6DA 3BHBA 3IKCA 1O5PA 3UOAB 1MEXL 4HK3J 5AOMA 5LGJA 3EJZD 3EJSA 5BO1H 4S1RL 4JM2B 3SPIA 1WBZB 2OXGB 4AG4H 2VN6A 4GXUM 4N3UA 4LOFA 1K6QL 3ME0B 1AZBA 4ODSL 4ZUWA 3HKFA 3ARGA 4IU2B 3RUGA 1E27B 3KR3H 4GJTB 4ZOEA 3BRGC 4N8CH 2M8XA 3MA7B 4CJ1A 3F5WA 1L5GB 4MD0A 5JR1L 1WUNT 1K5NA 4PWEA 3T8MA 3WFZA 2CLRA 4PCYA 3UPRB 4CMMB 1NGXB 4KRNA 4GSUA 4XCCL 1KENH 5IW6B 3NJKA 5DEFB 4M6OH 2FUQA 2GG1A 4PVNA 5E6SB 5KBNC 3PWUA 1EEQA 1MZZA 2MRYA 5DYOA 4PTTB 4E42A 4L4VE 1ADQH 3EYOB 1SY6L 3SOBH 2QT6A 5E1GA 3FTWA 4WUUE 2LTQB 1FLRL 4G9FB 1XF3B 3FU7B 4XVUC 3B5TA 5K9OB 3WNLA 3VMNA 2W94A 3IFOA 5K59F 5ETUB 2WUBL 1S7WB 4KKAC 4L3FA 4LHQB 2WP3O 5KVFE 4M61B 3OKDA 4WSKA 4YFDB 1HIMH 4LCCB 1B4JH 5J9PA 1I4FA 3V8CA 3ZMEA 2A9ML 3QR1A 3QUXD 2LLLA 4NZUL 3STLA 4HWEL 5PCYA 2EYRB 1VZIA 5E56A 5JXAH 2CR0A 4UTBH 4YDIL 3KPQB 2V2XA 1ZGLB 4X4ZA 1RK1B 5DK2B 4XBGA 3F01A 1FVDA 4H88L 2FR4B 5DZAA 2BWDA 3ZHDA 3VGAC 1WT5A 2D3NA 4A7GA 2OMVB 3SZKC 4F7PA 3Q8BA 5DR5H 4WW1B 3SO5A 1I7UB 4D9LH 1JXFA 5DQDL 2H7WA 3K6SB 2GBUA 2P8LB 4QY8A 4N2BA 2AXHA 4WSJA 4U6TA 2P5EB 4YR6B 1I3RA 4FHBD 1OCWL 1GS8A 3GMMA 2YAHA 3QUMB 4NCC2 4K73A 3H42H 3WFHA 1TTBA 2GYSA 1TZAA 1ZHLB 4FFYH 2C3VB 1Z9MA 1PZUB 3BWUC 1PEWA 4JFPA 2I9LA 1TDQA 2W65A 4MCMA 5IT2H 5HGDA 4PR5B 1NSNH 3EDEA 4U7MA 1H8NA 3EGSA 5FKAB 1GJUA 2A4ZA 1UCTA 4OI9A 3OKOB 5KG9A 3HW7A 1VEPA 2M1KA 1Q4NX 2BP5M 4XB7A 4ZYKA 4PJCE 3HG1A 4PBDA 1Q0XH 1D6VH 4AL8C 2CHZA 3S36H 1MPAH 4Q97A 4I5BA 1ID2A 2PETA 3K8KA 1IBBA 5HDWA 1UUNA 3TONA 3LH9A 4YLCA 2XQBL 1VFMA 4PJIF 3G5VB 4QHPA 4W4NA 3T8XA 2F53A 4I88A 3QUHA 3DROB 4X7FC 1CLOH 3OF6D 3MRPA 4BWWA 5B3SB 4BRJA 1GR7A 1RJYB 3SKOA 2GSIB 3TCXA 2L7QA 1SLWA 3ZPDA 5IB5A 2DQJH 5TDOA 4NUJB 3O6LH 4ZMQA 1YNTA 1H15A 4OD3H 4MJID 3SGKC 4X8JB 3SQOL 2DQ6A 2B1HL 3HRPA 2OKMA 5I8KL 3ARQA 1G9NL 1PZ5A 4K8RL 2UY6B 4LASL 4QOKE 4LLMB 4OI7A 4WK4B 4MA3A 3O4LB 4V11A 1BQKA 1WE5A 2X2JA 1MFDL 1KJ2L 1F6AA 2BCKA 5BZWB 2F61A 4Y19D 2W91A 1E4WH 3QUGA 1BZ9A 3W9EB 3VD4A 4KHTH 2QTEA 4GO6B 2KHAA 4QYOB 5ID1B 3TFBA 3KXFB 4YHYC 1V10A 1PG7H 1R47A 4BQ9A 4E9RA 5C0FA 3L4VA 3NAAL 3BZ4A 5C0ND 5IV2B 2YLKA 3KE0A 3IDXL 4PHXA 3HHMA 3V55A 2BINA 1XZ0B 1HH9B 3OKNB 3MODL 3WUWB 2GJ6E 2WZPD 2VERN 1G6VK 4YC2C 4J3SA 2AF2A 5H37H 2EXTA 4OQTA 5FW7A 1KNOA 4XAKD 1EAQA 3PL6B 5KANI 4CILA 4YHOL 4HH9A 5AYQA 5BRZB 2VDKH 5LG1A 1I7ZA 3GUTB 4HCGA 2D03H 4HGMA 3OG4B 4OM1H 4JKKA 3QA3B 2YRLA 3EO0B 4KQ4H 3ATEA 4S2SB 1MJUL 1VGEL 1E9QB 4EXKA 3FRUA 3NPSB 1XB8A 3U2JA 2CJSA 1J1OH 2BIHA 1OAQH 4PJ5D 4I0CC 2W9EH 3U7WL 4L8DA 1KTLA 5L4MA 1R9FA 3V5HB 3X17A 2ZAHA 2R39A 5ITFA 2Z1KA 4XCYA 3VD2A 1RU9L 3KAAA 2G2NA 4JKLA 1OT4A 3ULVL 4YPGB 2CO7A 3EBHA 4OFVA 4FEIA 3LZQA 3TIEA 4F9LC 4L4VB 2X9ZA 3E80A 4XVOA 3X13A 1TCRA 2VUOA 3QO0B 1QFWI 5AKTA 4FTDA 2F0CA 1J8SA 2WIIB 2MNJB 5C0BD 3RL2B 5C0CA 3HC3L 5GGSY 3HMWH 4OF5A 1NOFA 4H0LC 3UBXI 3GSUA 1XB6A 4WI0A 4N0CD 2G3XA 5AZEL 2E9GA 3X3FH 1TJHL 1FJ1A 2BP0A 1JK8B 3DTXA 4P2OD 2OMTA 1R5VB 1YEEH 4GSDH 4Y2DA 3GSVA 2G2PA 2IPTL 4KO5A 3AC0A 3BSGA 3ZZSA 1LILA 4KUZL 5CJOH 1MNNA 4HPHA 1WA2X 3NJHA 4H4NA 4JFTA 1C8PA 4BRVA 2C4FT 4B27A 3BPLC 2VMCA 1ZT1B 5I8EB 1HOCB 1WZAA 1LO4H 1YEDB 1EWHA 4X6BB 3T6ZA 3M7FB 5JOPD 1QZ1A 3CDGB 5MEQA 3U4EB 3NEXA 4CNIA 5HYJD 2JCCE 3K71A 3QARA 4JREC 1MHPH 5DFTA 1IBZA 2GT9B 2NW2B 5EC1A 3DLQR 4PMFA 1FNFA 4B0MB 2BP8A 5IK3A 1RZ8B 3WXWL 4PGJA 2IQAA 5FO7B 4X7SL 1OTTC 3GYRA 4MXWL 2WQAA 5D1XD 4DZBA 2CJUL 5JXEA 4ZS6C 4HWNA 4ZUVB 1AKJA 1YC8A 2XZCH 2COQA 1SDYA 1V7ML 3CCHB 4UM8B 3BW9A 3MLYL 4PJCB 2QLYA 3BKCH 3PYCA 5FKPB 3NZHL 5A7EA 4ANVA 4GW1A 1RIVH 1KPUB 1KJVA 1KTRL 1Q1JH 4FFVD 4HUUA 4YX2L 2Z31B 4GKZB 1PZ2A 5C0GB 3LZPA 4L5FL 5I6PA 3APFA 5KAQG 2CLVB 3FT2B 5L8JB 4XPGL 4RAVB 4UM9D 4JO4L 8CGTA 2VC2B 3DTUB 2OMWB 3BPCB 3FB8A 5DO8A 2YFNA 4IMKC 1YECH 4FG0A 4N1HB 2ARJB 3IE4A 5E9NA 4G71B 1D5XB 3REWA 2O72A 2AQPA 5ERWB 3VO0A 4LSRH 3ZMNA 1OCZB 4Y1AA 4NDMB 2J7LA 3SE4A 5IF0A 1GRWA 3DRTB 3TPUB 3WL9B 1QNZH 4M1DH 1X9RA 4LCWD 1RIUL 1HWWA 1UXLA 2YQBA 3QUZB 3G3LA 3QPQC 2ESVE 4NCC1 4BFNA 1MFAH 4JFHE 4Y1TA 1C08A 3TOPA 3FXIC 4ZQKA 5JYMA 5IWLA 2MCG1 3NRFA 2FIRT 3IJYA 2H47C 1M3IA 1U8MB 3FTXA 4PI2A 3MGOA 4WU7B 2R2EB 1Z32X 3CIQA 1NDMA 3CSPA 3Q6FA 1I7TA 5LWYH 4CSPA 1VLXA 1BFVH 3NT0A 3P2TA 1CCZA 4JG9A 2GJ6B 1T22A 5GGSA 3ZDWA 2V2TA 2FEEL 5F9DC 2NY7H 2H2PD 2EDMA 4DGIH 4IIQA 3NCFB 2V7HA 3NACL 3ZE0F 4CSSA 3U2SB 2OTUB 4NKMB 1OE1A 3CPLB 2OX5A 3SY0B 4H7VA 4PLJC 4WTWA 2CCWA 3MLXH 2CBMA 1USZA 2EDQA 3JTTA 3OXSB 3QJQB 2WNKA 3GZPA 3VGAB 1G9MH 4YEFA 2FO8A 4FNQA 3VD0A 4Q9QH 2JVUA 5ALBL 3EOYG 5I73C 1QSZA 1BYOA 2XV3A 5IVZA 1SYSA 4MCZB 3HUJE 4NXKA 3CZNA 4JJ5B 4PVMA 2NSQA 3MJ6A 3OKEA 5JORB 1W2KT 5D7IF 2V17H 4FFZA 4HHAA 3VB9A 4GLRH 2DB8A 2HSIA 2X3BA 3PHQB 2Y06L 2ZYHA 3H9SD 3W2DL 3DETD 2JKTM 4PB0H 3CK0L 2DM7A 5E99L 5BQ7A 3SSGA 1JHLL 3KPNA 3Q2NA 3F6LA 4BHUA 1R3IH 2FGWL 2PR9A 1DSFL 3DO3A 4PJFB 1KFGA 2WXJA 3S97C 3P4MB 5F7EL 4WEMB 4GQQA 1JFQH 3FBKA 1N19A 5CEZE 1I4FB 4NPJA 1A3RL 1P5UA 1HHIA 2BJML 1AO7A 4JN2A 4KFMA 3W39B 1ZLWK 2QPDB 3C2AL 1ET8A 1BMZA 1SBSL 4ZXBB 5ICZB 3FFOA 3MRFB 3PWVB 2ALWA 3FU5A 1KXTB 4YBQC 4ENEC 2VKXA 4HHWA 5DUMH 4CC4C 4GBXA 4AMKH 1AXSB 3AY2A 1TTCA 3D3VE 4W9JC 3K1DA 1G5GA 3MLVH 1S9KC 1YYLH 2OJZL 2BZ7A 2G3NA 2W59A 1FZOA 2RR3A 3I3DA 4HEPA 4CVZA 5I76A 3ILEA 1R24B 4PJAE 1FGVH 5KVFL 1E5AA 3L3OC 4X99B 1JUFB 1UZGA 5HJ3B 2X6UA 3K8LA 4DN4H 1LP9F 4QY8B 1OAKH 1TYRA 3EBAA 1PZDA 1IGYB 2HJLA 5GJTL 2C34A 2YD3A 1UKTA 5D5MA 2R2HA 1XGRB 4N2EA 2V33A 4JY5H 5LN8A 4NQSB 2GQHA 3KYKH 4GAJL 4HCRA 1X6LA 4FNLH 4BWUA 3FO1B 2B15A 4M7ZC 4D0DA 2ADFH 3BX7C 3UJTH 4QTHA 4WFFD 3JV4A 2NY0D 2JJTC 1MJJA 1FG9C 2O6EA 5I6NA 4N1EA 1J05A 2RBLA 4X6EB 1S9WB 5B1KA 4WK2B 2ZCLL 2P1YA 4YHYB 4X80H 4R3SB 2VMJA 4I5BB 4Y9EA 1FL3B 5FW6A 1H3PH 4DKFL 5D1ZD 4UU9A 4LAJH 4NQVA 3BZFA 4ZO8A 2ZXBA 1I1YA 4OKDA 1FCGA 2EC9T 1RKRA 5DHYA 5DWUH 1DAQA 4YC2B 4PY8I 5EO9A 1QASA 1PJWA 3SKOB 2EIZB 3TT3L 1LVEA 1ROWA 5LNDA 1O7DC 1FP5A 3MV7A 5IQOA 5E4AA 2CCLB 4JB9H 2AQTA 1HHJB 3GB7B 1JRHI 1MRCL 4OZGE 4PQXA 3QAZC 2AXFA 3ASOB 5IIEA 1EEYA 1TTGA 4PGEB 1LO0L 4XPAL 2DLFH 4TTDD 1PZ5B 1XR9A 2EUVA 3WS6A 3O2DA 1K5WA 4YGAB 3DOHA 4YO0A 5DSCA 1M1XA 1QHOA 4HGKC 5E0FA 1GCFA 3TO2B 5F97E 2DQDL 2ESVB 3BAJA 1A6TB 3L8QA 3CN2A 3PDOA 1BZ9B 2JKLA 3SE8L 2Q3ZA 2HUHA 1BIIA 1FAKT 2RCSL 4KJQD 3RDTA 3VH8G 1PLAA 2ETWA 1WVZA 3MUUA 5C0IA 4CN1A 1DQLH 5EBLA 3FUEA 4K5LA 3T2NL 4FL4A 5I66B 2YPLA 4KTYA 3WELA 3D39D 4ICWA 3D85D 3G9VA 1OAUH 2Y5QA 4XX1G 3UDWC 1PMYA 5D4QA 2ZUUA 1R46A 1IC4H 2ITFA 1AS7A 3GLEA 5CP3H 1F8TH 4A7TA 2X3CA 4UT9L 4PRAB 3ML9A 2WYHA 5FK9B 4F58H 3L3DB 4N90E 4W9CC 4ZW6A 7FABH 5DVKA 2Q6WB 4FI7A 5IY5B 4PJ9D 1J1XH 4L48A 3GINA 2VTFA 3VXOB 1MREH 2Y7NA 3QORD 4OIAA 2YRZA 2P5WA 3IRZA 3P77B 2WZAA 3VU2A 5FYLL 1I1FA 3T04D 3PAUA 2WYIA 4FJ6A 4F1SA 3QHFH 4NO2A 3ABKB 1OK8A 3DUUA 3OWRA 4HZAA 5KUMA 1CS6A 4TUJB 1CFMA 4EN3D 4OCWH 3ZL1A 1DQDH 3L5XL 4MA7H 1MQKH 2JK5B 2EXYC 3QEQD 3Q6GL 3D06A 4DK3A 4YH6A 4YSCA 1A64A 1KTLB 4L8DB 5FA4A 1DEEA 3BPLB 3HUJB 2YGNA 5CM1A 3MRCA 2WUCH 4OLWH 1H6UA 4YDJA 4FP8L 4DEPC 1SF3A 2HFFA 4OFIA 3RY6C 2AEWA 2HKFH 4X5WA 4DT2A 3EOAA 4JQIA 7PAZA 3S98A 2PPAA 1X9UA 4OGZA 4N8PA 4XC1H 3GSWA 3R19A 1DCEA 2FECI 4OGYH 2MOQA 1HHGA 5GRJL 2G9HB 1AQKL 2VM3A 2EDJA 1MCEA 1NFDA 4HUWB 5C2BH 1O9ZA 2F1BA 1MFCH 1CD8A 3FZUC 4JDZA 1HL5A 4RGOH 4XMPL 5F71A 4AQ8C 2OMXA 1DVQA 4ODVL 3I6KA 1F3DH 3S36X 4URKA 2DBLH 4TULL 3GXPA 3INUH 5J3HD 2VXQA 2C9XA 1I7RB 3FOMA 3FSOA 2BP0B 1JJUA 1E4HA 4MB5A 5IROD 2R0LH 2VXSH 2XJKA 4Z7WE 3DV4A 3J7HA 4UQ3B 3MNVA 2P80A 3DXAA 4XE5B 3TP4A 2YMXH 2R0KH 2B0SH 5L2JA 3D3VB 1G43A 3LPOA 1IGCH 1UWEL 3O6KL 1T5XA 3ASWA 4NO0A 4PJAB 4X4KA 5L2KA 3JT0A 4GUPA 4HBCL 2RGSA 1O7DE 1U8CA 4PCSA 1G9MC 1OB1A 1L3WA 1N5AA 1J5CA 4LPTA 1R3HA 5KANG 3DV6A 1ZA3B 3MJ9A 1E7VA 4OT1H 1WFOA 3WS3B 4MAZA 3OLGA 2X89A 1RV6X 3K71B 4DK5A 1Q9KA 4LRIC 5D2LE 5SX5H 3WE1A 1KXHA 1RUMH 4B9KC 4RCAA 1Z0NA 2EEDA 1W16A 3A67L 3JV6A 3QIUA 5KAQF 5KSUB 2IG2H 3P9LA 3LS4H 3BGMA 4Z7UE 2PXYC 3B8YA 4PJGF 1P84K 2PWEA 3NSCA 4Z0BL 4PP2A 3TIDA 4YLQT 3S88L 4FDWA 5I8CB 5IR1A 1ED3A 1L0YA 4PRHB 1PG7X 3AT9A 4F33B 4GKNB 5DMIH 1AKJB 1C5BL 5KVEH 4NQUA 1LXMA 5C09E 4MNQA 1TFHA 4N9GB 2BP3A 2IMNA 4AX3A 5CIPH 1CZ8H 2E9BA 1LK3H 1IM9B 1NBZA 1G6RH 4KZDH 4U6VH 5B22A 2NNFA 4D7PA 5JOFA 2FO1A 2D2CC 3SDYH 4X9HA 1QBMH 2R4RH 3CLEL 3U7YL 2ZD0A 2KC0A 1YY8B 3B5HA 4YZWA 5IFHH 1JNLL 2VM9A 4C4BA 4JX0A 4UB0H 4LPWA 5C86A 3WXVL 3MLUH 1T7ZA 5EO1B 1IAIM 4NWTL 2FQFA 4TOYL 4CSTA 1OD7A 3MCKB 1QR1B 2AQNA 2UYLA 2OK0L 4HPOH 4OZHA 1HZKA 3UBXG 1UFUA 5ICUA 3H3BC 4JANA 25C8L 1X5AA 1B3JA 1GAFH 5FM8A 1ET5A 4YE0A 5ESAB 5DRNA 4Y2OB 1VKXA 3ZE2E 5IUSA 5DFWH 5JLZB 4NNPH 4POZD 2KDGA 2PCXA 3VI4E 2FWOB 4Y16D 5I73B 2VDQH 3RPKA 4R0LC 3DBXB 3GK8L 2GJPA 3C08L 4JO8A 2Q8BH 3PWPD 4BA8A 1GGBL 1EEUA 3SKMA 4ORGA 3A24A 3N55A 4ODWA 1I8UA 2X1QA 3E2HC 5DUJA 2QPUA 3IF1B 2CGZA 2YA2A 3VFSB 3WLWD 4XXWA 2VJ0A 1R5IB 4FQIL 1UACL 4UYQB 4LPUA 4XP9H 5EZLA 2UX7A 2FEDD 1RVFL 1BOGB 1IQDB 5D6CB 3SQRA 4NPKA 32C2A 4PB9L 3BAYA 4Y4KC 1UCBH 1UWXH 4YIQB 5EZJB 5D6DC 3S48A 5SWZA 1SXAA 1PDKA 2HH0H 1WIPA 3QDAA 3QRLA 4KJYA 4N5ED 3V0IA 3KYOB 1O6SA 5AW9B 3ABGA 4L2LA 1CE1L 1KJ3H 3DYMA 3IDMB 4F7EA 2V4LA 5JHAA 4D9QE 4XZ4A 3L3JB 1TTAA 5EWIL 1M6OA 3E8UL 1FO0B 3RVVD 3KJ6H 4DN3L 4JHWL 1CG9A 1OGPA 4OQTL 1RIHH 2UZXB 4HALA 4NBZB 2ZQKA 5AL8A 3ELQA 1P9MC 1NGZA 1PX8A 2GI0A 1S3RA 2BVEA 4XX5A 3QUYC 3RWCA 3Q06A 4WKZA 4HIIA 3CUPB 2HPOA 2X41A 4EOWH 2CR3A 1J0KA 1C16A 3TBSB 5DT1L 5BQ7B 1ACCA 3LZFL 3TEZA 2P46B 2J20A 4HWZA 4NUMA 2IAAC 2DMBA 4UQ2B 4BUHA 3AU1A 4L18A 1FE8H 1XH1A 4M7ZB 3TVMA 3LEXB 5BVPH 1QUNB 1JV2B 1FL5A 2UXGA 4GIAA 4JKPL 4BH7B 4UINH 1T0OA 3ARBC 3CSGA 3N85L 5T1LB 4JN2B 1IGFH 2DS4A 4RISH 1PZCA 3VFGL 4Q9RL 1MLBB 1RJLB 3OX8A 4HFUH 5I8OH 2E4TA 5JZ7C 1NEZB 3OJDA 4HUCA 3MV8E 4YZFF 4TPRL 1QLRA 2OMBA 1CDUA 3I9PA 4N2NA 4UUJA 4P23A 4W9ZA 3UTPD 5KVGL 2WBKA 2EXWC 4L29B 5K59E 1YNLL 2CDEA 1NH6A 4ELKA 1R19A 2ZUQC 3C8DA 4GB9A 5K1NA 5CEZL 3QXAB 1UEYA 4WCYH 3MJ8A 4HPYL 2VXVL 3CWGA 3A6OA 4AENA 1BEYH 3KLHD 2VW7A 1QBLH 3F58L 1RPUA 3LNDA 3QWRD 4KXCA 3T1FB 4GYBA 5E94B 2AAAA 4OD1H 2C9AA 3A21A 3TC9A 3QAZB 4IRSD 3RFZC 3O9WA 1KT2B 5D2LB 5JHMA 2LGNA 3IAQA 5C0JB 3LSOB 3H3PL 4B3EA 1G7HB 4Z7UB 5LQBL 2W81C 4J4PD 1HWHB 1JDCA 1AZRA 4BFIB 1IGJA 1MAMH 5FV1L 3L9RB 5E2TL 3RWFB 1KPVA 5F0PB 1GXEA 2N56A 2ZX5A 2AERT 3NSJA 3PABB 1QFOA 3TN0D 3FF7A 5AVTB 1QTYT 3A6BL 3S8GB 1TUPA 1GZPA 2IGFL 2JB6B 1KCRL 1AQ8A 1MCWW 4XGZB 5BW7A 3FN9A 3UBFA 4DETA 3BUPA 1AHWC 2A6KB 2EYSA 5IJCC 3FUIA 4IRZA 2DTMH 3NGBC 3P4NB 1B3IA 1JOIA 5CP7B 3FPYA 4A2LA 2CK0L 1I1YB 4LLWA 4LSQH 5DS8A 3L4XA 4XP1H 1V27A 4HKBA 3SJVA 1OF2B 2A9NL 5E8PA 2Q2EB 1AOZA 4L4TE 1JAEA 4Z0XB 3KBEA 4Z76B 1OGAA 3UAJD 4YXKH 1DN0A 3SGDI 3N44B 5EEVA 1E3FA 3ZYJA 1OAYL 3L3IA 2BFVL 3IJSA 4M7LL 4IOIB 5H4ZA 1TLMA 3EYSL 4KXAA 4PJIE 5IVXF 4PRNA 5JPNA 3T08A 4WI2A 1M1XB 3M1OA 3VI4B 1CXIA 3S35H 3A3YB 1UZ8B 4FMKA 3S34H 3UZQB 1P7QA 5LBSH 4ODTH 2VLLA 3KPRB 1EGJH 1B6DA 4L0YA 3HR5A 3CFEA 4U1MA 5D70H 3LIZA 5C0IB 2DEYX 1A6PA 2GTQA 5DHVH 2XZQL 2QHRH 3L2NA 1WAEA 1N68A 2WBJC 3BYTA 5A2IH 1EHNA 2EILB 4U1HA 1F97A 1TCMA 4N25A 2Z7WA 4UF7C 3VFNA 2ICEC 3GIVA 3C8KB 4F3FB 5J6HB 1XH3A 4OQ1A 4Y4HD 2AJZA 3UL4B 5B8CA 1ZVSA 1BF5A 1DBML 2D4FA 3ZBMA 5HHXH 1WK0A 4JFXB 1TJIH 2QVMA 4YBLC 4ZNEA 1NUFA 1PY4A 1RZKH 4JRLA 1ZVNA 3B7UX 4K2UH 5JIKA 3WNOA 4G5AA 5EU6E 4DGYH 2J6WA 3MOAH 1SJEB 2H6OA 3H9ZA 1HTYA 3NIDF 4HUMB 1JZ5A 5GS2D 1ND0A 4WFHD 4AVHA 4FABL 1U41A 1XFPA 5B7EA 3KPLB 4OCLC 4ETQA 3DYOA 5I6XC 1R4XA 4M93C 3O81A 3KNBB 4NNXA 1VEOA 3W5NA 4NZTH 3V0WL 4BFFA 1UXWA 4UV7H 4LBEA 4JQVA 3EOAB 4APXA 1MJ7L 3UTTE 5BCAA 1LE9B 2JKWA 1EZVX 3VUAA 1D7DA 1FO0L 3PS6A 2R8SH 1BF8A 4JVUA 2NLJA 1OSYA 4F7KA 2PXYB 1R3JB 4QI3A 3GPEA 1N8ZB 3EYVB 2JJUA 2MMXA 3I74A 5AZ2H 2IALA 3IDIA 3V0AC 1TVHB 5I1JH 1U58A 1T03L 1U8JA 2V9UA 2FQGA 4FFZL 3QG6B 4HK0A 2DMKA 4NNYA 3IB4A 1HCVA 5FHAL 1NFIA 2NZ9C 3FO9B 4KGLA 2AP2A 3GRWH 5CHNA 4L1BA 5I16A 2PO6C 1QLFA 4PRPA 1W15A 4TVUA 5A2LH 3NQKA 4AZUA 5F7FA 3FH7A 2X6MA 3MV8B 3LV3A 4XMZA 2VDMH 4FKKA 2ZUSA 4XCNB 4AQ1C 2BY2A 3MBED 1QYGH 4HUXB 1XHHA 1YEWA 4I18C 3QJFA 3NH7H 5GGRB 4TVPH 1M53A 2HB0A 4GRLD 1NGQH 2BSEA 3KYNA 2R9HD 1M71A 1A4JB 2WLKA 2XBTA 4MWFB 2J8HA 3HTLX 2VSMB 4F57L 1I1AD 3MA9H 2ZP8A 5GS1C 3FN0L 4DUXA 2EDDA 2XXFA 4TL5A 2BOCA 3VA2C 5DJ2A 1MHEB 4BELD 1G84A 3Q5YA 1S7SA 3RZCD 3V5KA 2DEXX 4HIHB 1UD4A 1AH1A 1T3FA 2WJ7A 4HBQA 4BKSC 4C57C 1FDLL 5AVWB 4IKKA 3U46B 1GGCL 4U7SA 1EFXD 4I1RA 4R5XA 4LL9A 1ZV9A 3U9PL 3WFBH 3IXTB 4R0LB 1U91A 2HG5A 1D5MA 3W3BA 4FLQA 4S1QL 1VFOA 4MNQB 1FGNL 1T20A 2D2OA 2QHLA 4JFZH 4I2XE 4NQCD 5E7BA 1G7LA 3S6CA 4DO6A 5BNXD 1HHKB 3A5VA 4OD2A 5SWQB 5HDBF 3WE6B 3K4AA 3E2HB 2ALAA 2DQEH 2F1EA 4PM1A 3V9FA 4TLSA 4HCRL 5E51A 4EDWL 3QEGL 1AIZA 1ZANL 2H26A 4ABUA 3E7JA 3TV8A 1YLBB 3QDGA 4X9GA 1BXXA 1IAOA 3UG4A 1XCQA 2J71A 2Y7QB 3JQOB 3LPPA 2WHVA 4ZOCA 4NLHA 2OR9L 3QCTL 3QPXL 3QQ9D 4HJGA 3RGBA 3GI9H 1BBJA 3UZEC 1IVLA 2XWXA 2K78A 2UYLB 5IMOB 3KG5A 4XRCA 1GOHA 4WUUA 4HIJB 4NKDB 2L7UA 1KIRB 1YNKL 4L4TB 4JANB 3E9UA 2CKBH 2LAAA 3MLRH 4QLWA 1LLAA 4KH9A 1A4BA 5JW4M 1I85C 1JYNA 5I1LB 1G1YA 1PLGH 1NCTA 1MDTA 4H44C 3KGSA 3HNVH 2ZX9A 4JDVB 4W9KC 4AQEA 2O1AA 4A7QA 3Q8AA 5HGGS 4L8SC 2L04A 3QUXC 1NWOA 1JPFA 1ACYH 4JKMA 5KW9L 2EDLA 4PAZA 3TEYA 1UB5B 3ILPA 3GJFB 4OFQA 4TQ8A 4NEHB 1MLCB 2F54E 4LDCA 1MI5E 3IDJA 2YEZA 2OJEB 1OGTB 3BP5B 1DR9A 3HEIB 5ESVA 2OCCB 4HQQH 2V5RA 1MJ8L 4XVSL 5L88L 4LARH 1WHPA 1ZIBA 5KSVA 4EE2A 4YJZL 3D69A 1NAMA 3DX9B 1VSCA 1LDSA 1BQSA 3LS5H 3BT2H 2UVEA 1MFUA 1JZ7A 2K4WA 3S5LB 2DQCH 4IK7A 1B2WL 1OCOB 1ZLDA 1KB9J 1AQDB 3ARBB 1NCWH 2OULB 3STZB 2ZCKL 3GQFA 1JWMB 1INDH 2X4RB 2YKLL 4NM8H 5DRWA 1KFAL 1C5CH 4CMHC 4MCYA 3PV6B 4RFEA 5EU6B 3WMSA 1JNJA 1IT9H 1S7QA 4DIXA 4F7EB 3SYQA 2ZX6A 4LFHD 3KPPA 1BZOA 2VJXA 3LKSA 2LAGB 4BH8B 2HPTA 5GZOD 4M1GL 4XXCC 2YPVL 1CG9B 3MRQB 4ZPVB 4V1DE 4N22A 1KELL 5E6IC 4CBZA 3T65B 2CG9X 2DW5A 5JIHA 1UYWL 2YQ3A 3CVDA 4Z78B 4H8WC 4HIIB 2VN5B 2RFXA 1NJ9B 1NLDH 1FNLA 3I9GH 3IMBA 4JG1H 4BQCA 1AYOA 3UABA 5A40E 3RFZB 3B4NA 1P6AB 1FH5H 1H8LA 4MJ5B 2N0KA 2WZPA 3LPWA 1S7XA 3I9IA 1JI1A 2XSKA 4FZEL 5B38A 1BM3H 3WTUA 4Z7AA 1J8HD 1TENA 2ZCHL 3RA7H 2V9QA 2QZQA 3TVMB 5GISL 3VXSB 4G11A 4NSKB 3F6JA 3QFJE 4H1LB 2CBQA 4BSJA 2A74A 2VL4A 2C9SA 5EORL 4KVPA 3VRIA 4QOKA 3T4AA 3OLDA 1W72B 4P57A 3KPMB 1DVSA 2DLGA 4DW2H 3BQUC 3O6ML 2IBBA 3OJDB 4U1KB 1K8DA 4PP1C 3TBVB 5D7SH 3I50L 4APQD 5CN1A 2FX9L 2HXAA 1C12A 4WW2F 1XMEB 5AYUH 4OLVH 1TO5A 1AHWB 3DVNB 4KH2A 4D3CL 3NGBB 4MAYA 2OL3B 2WWNA 1LEGA 1B0GA 2EE9A 4R7DA 3V4UH 5E2VL 1NBQA 2PW2B 2VXQL 5AW5B 3HPJA 4ZSOA 4YHLH 3ZTJH 1ZTXL 3AXIA 2HTKD 3BSZA 2D8KA 5DJXB 4GIPD 2EIKB 5C0NC 1PFCA 3E9TA 5CUSL 4W6YB 1OZUA 2VN4A 1KV7A 2WK2A 4JQXC 1H5BA 3SBWC 3WEBA 3SB3A 2CLZB 1GS6X 2AC0A 3VCLB 3QNZA 4KTDH 1RLWA 5AAMA 3O3DA 2EE0A 4LAQH 4QHLA 2AKRB 4M5ZL 3WIFA 3ASNB 4GKLA 4IEFB 3BDXA 4E9WA 2GCYB 2N4IA 2VO8A 1V3KA 4AYSA 1K3IA 1OP5H 1IGJB 3I3BA 4ONFH 1GGUA 1LP9E 2XZZA 1KB9K 1PTZA 4K7PH 3MJ9L 3IU4L 2IAMC 2AJ3A 4N6RA 5J1TC 4I2XB 1G7MB 2C9QA 4E9TA 4ODXB 1XGUA 4TYUA 1Z3RA 2WBJB 2W60A 2NZ1A 4WI4A 4CADB 4H0HB 1DQKA 3GBML 4FNTA 4XPTL 1MCDA 3WV0A 1IQWH 4O2FA 2ICEB 2P8PA 5T1KB 3VSTA 2RACA 4QTFA 4HWBL 2VQ1B 3BEVB 3S37H 4GH7B 1KY7A 1QP1A 3CIAA 2VDRL 1AD9A 4HOWA 3QAQA 4FEMA 4RAHA 4HX1A 4NKIH 3T0AA 1MW2A 5FO8B 4OVUA 3K8MA 1AZUA 3GXFA 4P5TD 1QFWM 3IJSB 4WSGA 2FYYA 4WVRA 3VXRB 4LSPH 5TH2A 4A63A 4UILH 1NKRA 5IOPA 3POCA 3R8QA 3CDYA 2BRRL 5CD5D 3TZVC 1Z2KA 4AITA 5FW8A 3VTMA 1T0NB 4M93B 4BA0A 3DO7B 4R8WH 3CXHK 2F54B 4QRFA 1MI5B 2IDSA 4EUPA 3WSQH 1J8RA 1TXKA 4N2KA 5DO2C 2W0LA 5JO5B 4P3CH 5IM7B 1ZK9A 1OSPH 4PS4H 1HKLH 1F13A 5D7LE 4CVWA 2XDHA 1SFHA 2YD2A 2PTTB 3HZMA 3SGKA 2D31B 1QX1A 3V4PH 3EO9L 3R4RA 3C60D 4MJIE 2HX9A 1BVLA 1QKZL 2EO7A 3AS2A 5LN4A 1A7OL 3KJ4C 3LNIA 3W5MA 4NRYA 4LDEB 4WUKL 3EDFA 2W9LA 4XVTH 3HNSL 4X4YB 1NM4A 1SEBB 4LCWA 1DJHA 4Y19E 2WYTA 3AADB 5D1XC 3U1QA 5B1CA 4HDIA 4YSEA 5KYYA 3GS4A 3QC6X 4XO9A 4AQ1B 3MKGA 4QRSB 4Z8FL 4PJHF 2OZNB 1D9KA 3F7YA 4IBZA 1T6VN 3U30B 2EDEA 4I18B 4BE6A 5BZDB 5L4FA 2ZSVB 4GINA 4M7JL 1KEGL 3L48A 3FTSA 1S5IH 2HLAB 3MRGB 3L5JA 5GS1B 3LY6A 2VERA 5IJBC 5LBGA 3PUCA 5KSBA 1NC4D 4FG6D 4K3EH 2A6DA 3B2DC 1UM4L 1JS4A 2NLJB 3HZ3A 1U8OB 2VZTA 5C7XH 1OP9A 2IWGA 3UERA 1CYGA 4XAKE 1Q8MA 2ILLA 3WMPA 4OV6F 1NIFA 2ZWLT 3PAVA 1WJ3A 4PJEB 1II4E 4E9YA 2VRKA 3WNMA 4PJ8C 5HGHA 8FABB 3G08A 2VZ1A 4NNYB 3EG9A 1JPTL 3L3GB 2ZOTA 1G1OA 3ARTA 2SODB 5F44A 1UD8A 2NCEA 5F9OL 4LGPB 1E3XA 3UTSD 5KS9A 4PJ5E 2WXFA 1XF5B 1SEQL 4ES8A 5IKCA 4MA1B 3SIKA 3SCMD 1MCKA 3LNGA 2HTLC 2R1WA 1ZSDB 4OUUB 1OXYA 1P4LA 3D0LB 1EJFA 2QSCL 3B2VH 3QJFB 5DD6B 3C09C 1UB6A 1AACA 2G5RA 2QPSA 4IU3A 4PRBA 5L4IA 4J3WA 2R2BB 1YEKL 2K0RA 2J2ZB 1FVEA 3H9SA 3KYNB 3QJHB 3CDCA 4I13B 3GSOB 3LPGA 4NN5C 4GG6A 3D4ZA 4IDJH 3NYKA 4GIOA 2FH6A 3LNEA 3GRGA 5DJDB 3L54A 4TVPE 4HAFA 2H1LM 3CSYA 3S35X 1RUKH 5HDQH 2VR5A 4C56D 5C0BE 2WLIB 4R5VA 4XMTA 4N2OA 2J55A 2OL3L 1A5FH 2O5XH 1FN4B 3OZ9H 1LEIB 3PE9A 2QPFA 1JNHB 3ZDZF 4L8SB 3QUXB 2H2PC 2EVIA 1ZHNA 4BGLA 4ANWA 2Y07H 1FFPA 1QFWH 4R96B 4ZTPH 2R29H 1SDDB 1XF2A 1Y0LB 5CJBA 3ESNA 4HJEA 5H35A 4RIRB 1G7LB 4AC2A 1IJ9A 5TE6H 4TS6A 1W6WA 2UV3A 1AE6H 4HOMA 1RUPH 1ETA1 1XTMA 1MQ8A 1BLNA 4AVJA 4FKHA 4KNSA 4DZ8A 4ZG1A 1WIOA 3DX1A 4IJ3C 3DIFA 3GMOB 4K4KA 4PJGE 1RMFL 3AFLA 2H3NB 4DP0X 1U3HD 4GQPH 1EEZA 4UQIM 4Y88A 1NAKH 1PS3A 1OANA 1UURA 5DCCA 4A2MA 1EJOH 4I0PC 4NAJA 5D9SA 1IEAA 3PREA 5E9DD 4Z7OF 5HYJE 2Z34A 5K1JA 4UTAH 2P24A 1OTUD 4M02A 4BSVA 3AUVA 3A6CH 3BPOC 3NSXA 3RB5A 5BXFB 1NCAH 3LRHA 3Q05A 3G6AB 1DZ0A 2CIKA 3LQAL 2VQTA 4D0BA 1ADQA 1WCBA 4NZDA 5SX4I 5I71C 4Z7NF 5EU4A 4UIKL 3IPFA 5D1XE 3T2QA 4UMSA 1KIUA 1DVFC 2ENQA 4PGBA 3O0LA 3KPSE 4R97C 3Q0HA 3R8BB 4EVNB 3TO4D 5DVMA 4DKEH 3U36A 1G7QB 3VYOA 3IDUA 2F7PA 1F3JB 1D6EA 1FVCB 2W0PA 4O5LH 4PRID 5DZ9A 2BNUB 2FSEA 1YAIA 5FYJH 1ZXQA 2X7LA 5FO9A 1H6TA 3RI5F 3RIKA 2XN9D 4Y5YC 3B1TA 3IFNL 5AVSB 3WN6A 4N1CA 1MCNA 3V95A 3GSXB 2FEEI 2A0LD 1ODUA 4GAGL 1GH7A 5CKGA 3UROR 1UWYA 1IFHH 3JVGA 1V54B 2E59A 4MJIB 3VGGA 4BKLB 2ROXA 3LIZL 5EEYA 3Q8EA 4A1RA 4BXSV 4HUNB 1A21A 1MHHA 1E4XH 3D07A 3WEXA 4F2MA 3QZPA 4FFYA 4JO2H 5FECB 4B5ZA 2FCBA 3VE0B 3VDBA 4FFWC 3K80A 4Y19B 5CBEA 4B7LA 1JVKA 5JMOC 2NY0C 1B4RA 2DQTL 3ARZA 3FU8A 1HXMA 4FXKC 2O5YH 5DEJA 2YD9A 4ODHL 4E41D 1MFEL 1U8NB 2Z4QA 3HFML 4YHNB 3MLZH 5LO7A 4XP6L 4AYFA 4C55A 3GSQA 3BKJH 4HUVA 4YSAA 3EJYC 1A1OB 2XQ0A 4WDIA 3FQNA 3IPEA 1PQZA 1WWCA 2E5EA 5D1ZC 5IB4A 3THMH 5I74C 1YEFH 2R15A 2GIXA 4KC3B 4ZOBA 5IHHA 3D4GA 1SXBA 5I19H 1OSEA 3L9BA 1JGVL 5FYKH 4OR1A 3CC5A 5MEOB 2YC1B 3U9WA 1NUGA 4LIQE 1CFVH 3ZUCA 1TKWB 2X0WA 3B6SA 5AUMB 1QPPA 4DQAA 1I9IL 4OZIA 2IAMB 3DMMD 2VDNH 1J1PL 5I0WA 2UVFA 3CSTA 1INEL 4TTDC 3LTVA 2LU3A 1BM7A 4H20H 1EX0A 4MMXC 2MQ3A 4LU5L 3QEQA 4PJ5B 4U3HA 4KKBD 4DQOL 1VJSA 3OAUH 3LXAA 1S7RA 4ATWA 4ZMZA 2VOTA 1SJXA 4KJQC 4WHTB 1VB9A 3BN9C 2OXHB 5EB9A 3U4BH 2C1OA 3ESPA 4NPYA 4KBPA 4NIKB 2QKIC 4N0YL 3OG6B 1E4KA 3UYRH 1KLGB 3F64A 4NUPA 4DAGH 1WZKA 4LSDA 3IMRA 1IBGH 5HI4D 4ONHB 4I89A 3PIQB 4YZFE 3CH1A 3VDCA 3BKYH 3QNZB 2CDGA 2JKIS 1G0XA 4G6MH 5C0BB 2K4AA 4HJUA 1OSZB 2WXIA 5IQ9B 2KLTA 2LQRA 4OCRH 2WTRB 3RTLA 1CGUA 1NMBH 3INOA 1UM6H 4GPVA 4DNLA 5BS0A 4KKQA 2ITCB 3PGFH 3CE1A 3MAWA 5LJYH 5H37A 5K5YA 3QORC 2GSGA 4DUVA 4EI5D 4KK6D 4P2OB 2UZIL 4EN3C 3QWOB 3UP1A 2BK8A 2D0GA 3GTTA 3MO1B 1BFTA 1JP5A 3VFUA 5GRYA 4M29A 1RD6A 2W60B 4MJ6A 4QXGH 1HYRC 2YQ2A 4WFED 5IGXL 2E6PA 4M43H 4PJGB 2ODHA 3CQPA 4AEHL 2RA1A 4PLKC 3C5SA 1IFGA 1H9VA 3R0NA 2XKNA 4BEIA 4BFBD 4B9IA 3SKJH 4EAEA 4KQ3H 1BAFH 4XC3H 2GTZB 1BAWA 5TD4A 1MH5A 4MD4A 5HYJB 4IGBD 3KJ4B 3P9MB 4K9EL 4LQFH 1CN4A 1E6OH 4D8PA 4PW3A 2CZNA 1QO3A 5F96L 3PV7A 2EC8A 4M8VA 3CMGA 1QFUH 4O02H 1D3CA 3UCQA 2JJTA 5D1XB 2XG5B 2H9GB 2XWTB 1UM5H 4ELMA 5G4MA 3T0BA 5J3HC 3D1MC 4QHMA 4NP9A 4ZPTA 1FHGA 1OEZW 1B0IA 4Z7WA 3B9EA 2LLNA 2MPVA 3KPSB 4QXVA 3ARDC 3BWSA 5F7UA 1DFXA 4OJFL 4OM0L 2GITA 1AR1D 2AV1B 3SDDD 3EFFB 3WJLC 2EKSA 4LMQI 2LABA 4BKTC 4AW4A 5IHZA 4EUPB 2MWCA 4XX1E 3ZY7A 4TQHA 4I3SH 2XIBA 1XVSA 3G6JF 2FO4A 1EMTH 3E1ZA 5DHMC 1TZGH 2VLMD 5DJ6B 2A7BA 5IVXE 3HG2A 4YDKL 4UM9B 4LSTH 3VXQA 2YHGA 4UNTA 2CO4A 5C0AD 4BZ1A 2NNAB 4NZFA 3QEUB 2C3WA 4LCUB 1M7DB 3V4LA 2VZOA 5JIMA 1DVZA 1SJVA 3RWHB 3D33A 4G83A 3OHXA 1QLEL 4H8WL 1CFNB 1FYTE 2FD6L 1AMYA 5FFLA 3UJJL 1T21B 2V7NA 3RX7A 1TQBC 2K6WA 4JFDE 1FG2A 3B9DA 3SDXB 2XVLA 4OLXH 2Z4TA 5FM4A 4XTRD 4PGZA 1JRHH 3C6LD 1E3ZA 4TSBH 4LCWB 4NUQA 4W9HC 4Y16A 4Z9KB 4B53A 5C09A 2OSYA 3GC3A 3NEOA 4JFEE 4CU7A 2VE6A 1NAML 4LVEA 5LXGL 1DJIA 2ZOOA 4JO3H 5H2BA 3TYFB 1OGSA 5EBMB 4AZ8A 1JWUB 2O61B 1QI4A 2APXA 5T3XH 2IDTA 1WBYA 3ZKSD 5IB1B 4LVNC 5LDUA 1QQDA 3L45A 4NN5B 2FRGP 1N2RA 3OLEA 3HBQA 1RLBA 1U8IA 4S1SH 5GGRY 1GHFH 1NIEA 2APWA 2VXUL 2ZXWB 3NIDE 5F3HA 4J3OD 2HMIC 1MVUA 4K7PX 1T1WA 2FBOJ 2XA8H 3C2SA 2ATKA 4MLIA 2WQ8A 3FQTA 2B2XL 4YE4H 4IRJA 2VITB 4NRZA 5K9QG 2IWFA 4JDTH 1KY6A 4HT1L 5HGHB 4JY4A 1LQBC 4LRNH 4DVBA 5KN5A 2P26A 9PCYA 2W88A 1FC1A 2K1MA 2RAMA 1UATA 2J1XA 5MERA 3RPIA 3CFDB 3ES6B 4RDQF 5A2AA 5IEKA 3S37X 4NLAA 5BUGA 3LYRA 2EE3A 1K4DB 4LF3A 3FB7A 4IJ3B 3FCSB 2YPKB 4WHYG 1Q1PA 4OBRA 4YEEA 2A1WL 1P4BL 1EZVY 1FRGH 3VI3A 5B21A 5DEGA 3H9SB 4AE1A 1Q38A 2X5PA 3WLWC 4YUEH 5I1EH 2B77A 5KBPA 3BPOB 1ONQA 1HZHL 3P2DA 3D34A 4PWKA 3CSYB 1DFBH 4NN7C 2AW2A 3OTTA 3IU3A 4J3OG 5I71B 1ZLVH 4QO1A 4W9IC 2J4WH 1PPIA 2OPCA 3ZTDC 1DVFB 1Z3GL 5TF0A 4P5MB 4JFWA 4N5EC 4J5VA 5LNGA 4R97B 5DMGD 1BQUA 3ULAB 2CKNA 5BV7H 3GSRB 1ZT4A 2Q5BA 4I9WE 4DP8X 3CHPA 4EF3A 3HHRB 1OARL 3HPLA 2ZXAA 1IRAY 3RVVC 4MNGE 3QO1B 3CVHA 4S1DD 3EAKA 1XSOA 2CHXA 2OMNA 5E8NA 4JL1A 3ATBA 4MDIA 1KEML 2JLLA 4Y5YB 4HH8A 4NZ8A 1LM8V 4TSCH 1DUZA 1E90A 1M4KA 3MR9A 3QWRA 1K85A 2BOBA 4HHGA 2OCFD 5JNYA 4M6ML 4X98B 3TT1H 3RG1C 1XGPA 3CH8A 5BZXA 3VW3L 2R1XB 5HDBE 5AB1A 1J5IA 2PYFB 3DX7A 2OSLA 3I9AA 5BPPA 5I17A 4D0BB 1U30A 2X4UA 4JFFD 3M86A 3ALXA 4WW2C 3SGJA 4J4PA 5L0QC 2FATL 3K1KC 3AXLA 4PJBA 3ABLB 3JT2A 3MRRA 3G5WA 2NY1D 2NY0B 2FT8A 3G04A 4U6YB 1VADB 4FXKB 3TXAA 1SQ2N 4M5TA 1A3QA 1BVOA 1A2YA 3H56A 3VH8B 4C58B 1DLFH 2F6AA 4K23H 4A7UA 5E08L 1COBA 4OF6A 3TA3D 1KGCD 3L3HB 2VIRB 4OGQC 5DLMH 3ZYZA 5TK2A 1D6EB 4LCIH 5AZUA 3ZL2A 1G7IB 3MUHL 4GQ9H 5D1ZB 2ISDA 1L7IH 1DJXA 1KCKA 4FCHA 4FCAA 1BG1A 5I74B 2PMZA 2WGNB 43C9B 4HA1A 1GOGA 4OLYL 5BJTA 4HKZA 2JELL 4KROD 3FFCE 1OM9A 1OALA 4YHIB 5C08A 4Z5RB 3HE7D 1HILA 3WDHA 5HHPB 4Z3EA 5CEXB 3SQBB 5DC4B 4I3RH 1FYTB 2GTWB 2WOBA 1MCOH 4X5LA 4JFDB 4MMXB 4U1NA 3WIHH 1JPSL 4M03A 1BFOA 5FB8B 2X12A 5ICYA 3GNMH 3HS0C 3PWPE 5HYSA 1MRDH 4L1SA 4NQEA 2NUTB 5E5UB 2FX7H 2ZKHH 3ULUH 3WCYA 1U2CA 1SRDA 2IFGA 3QFDA 4JR9L 1DBAL 4BDVB 4HULB 3TN0C 4YXHH 2BZCA 4HLEA 4YSSA 2XG4B 3WOVA 1KWGA 1HEZA 3MLWH 5E6RB 4FGMA 4TSAH 2QKIB 3EOTL 3HN3A 3TEWA 4G59C 3L1EA 3NCCB 4OZFA 3D39B 5GS0D 4MYPA 3D85B 3L6FA 3L16A 3IN0A 3QIBD 4U7KA 5F6IC 3TBYA 3NIDB 2MSPA 3OKMB 4FN0A 3TWCL 4F9PA 4KVCH 1A7RL 5E8DL 5FLUA 3DHMA 4Y4HA 3BZEB 4PJ9B 1JV5B 1MNUH 3AGVA 2E9JA 1D5IL 1IL1A 3KS0J 3UAJC 1FL6A 3QORB 2MIZA 2YJLA 4FLHA 4P2QD 4PJIA 2C7UB 2A5UA 1JNNH 5F6HJ 3RGVD 4EN3B 3P11L 3P40A 4TL4A 3QEQB 2Z8SA 4RNRA 3U48A 1K3ZA 3MDJA 4X8GA 5FA3A 5IQNA 5F7DA 4DEWA 3LKQA 1I1CA 3QUYA 3WTSA 3IDGB 4FQ2H 4WNQA 5IHUH 3EDKA 1XQ4A 3MXWH 3BZDA 3P30L 2EH8L 1S7RB 3WY3A 5F7MC 5LCVA 5I5IA 2G5BB 5KYNA 4AUYA 2PR4L 1NTDA 2EP6A 5L6YH 5GGUB 3RNQA 4L9LA 4JRYD 1A3LL 3RGHA 1W91A 5I1AA 1KXQA 1NEPA 3S3SA 1YMMD 3U0WH 1TF4A 5AVUB 2YD4A 1JZHA 3CFMA 4X0NA 5K33A 3ZUNC 3EFDH 3IJHB 3KBFA 5CBAB 2IQ9L 3FB5A 2CMRH 4NENA 5DJAA 1J0JA 3CDFA 2VLJD 1CDIA 2VR9A 2VLRD 1X5FA 1IKNC 2XTJD 3DVIA 4JR9H 4N2GA 5IB2A 3HBGA 5CP3A 2Y3NB 2DWSA 3S5YA 1F4HA 1AANA 1R33A 4RRPG 5GGVH 3U9UA 1WD8A 3FFDA 2ORBH 4N0RA 5AVVB 1KB5B 2AJXL 2WN2A 2IDQA 4LNRB 3FCTB 3DK0A 2F5AH 3FB6B 2BNQD 4YK4C 4LESA 2LVEA 35C8L 2AJVL 4XCFL 4QT5A 1MCWM 4Q14A 4MNGB 1MCRA 3L5WB 4O4YL 1YDPB 3W9DB 3SD5A 2CO1A 4LCVA 4GW5A 3UBXB 2DWDA 3KGUA 3NP3A 1AS6A 3H0TB 2P8MA 2GY5A 2YK1H 1CXHA 4HAGA 4KMTL 2JIXD 3UTTA 4M4RA 4AG4L 3WTWA 4NZRH 1INQA 4LLDA 4K5PA 2Q76A 3VFRB 4OVVA 4AJ0A 2FZ3B 4ZTOH 5HDBB 2O6DA 2Y24A 2AABL 4W9GC 1TQBB 1J86A 1R0AH 1PAMA 5IOKA 1UXSA 2FHBA 2B59A 3ULSA 1JXGA 4YL4A 4K3JH 1I31A 4AUJA 4BQBA 1AJ7L 4GUOA 4FFTA 1GPOH 3JTBA 3KM2A 5CU5A 3GXNA 3CZFB 1OKEA 1HNFA 3CXFA 3QXDB 4XBEL 1X7SA 1YJDH 1IZJA 1R3KB 2G4EA 3VGDA 4F37F 2FEJA 2MOGA 3CD4A 2NR6A 1TEFA 3EGDB 4OCYL 2YBGA 5IHZB 4HK3N 5IW1B 2ZXQA 3WFEH 4RGMC 4PREB 5IJKC 1UD5A 4MSWB 1P5VA 5IBUG 3O6FA 3GHEH 3HI1A 4GRLC 5B1JA 5SX5K 3MJ7A 2DYPD 3EH5B 2DQGH 3FFCB 2AJUH 4QCIB 1CICD 2DWEA 1I1AC 4K3DL 3FHAA 1N4XH 4UOJA 2HX8A 3P73B 2EDNA 1KG0B 1W0VA 2VO5A 3RZCC 3FTGB 2YUVA 3GMQA 1P1VA 3PF2A 3GHBH 3RJQB 1JTOA 4X42A 3UADA 1IBHA 4LK4A 1ZWIA 3UCRA 3K3QA 4U1JA 4JGUA 3OZKA 4MX7A 3SGDH 4GAYA 1GZQA 1JN6B 5LLIC 3EOBB 1V3LA 5D8JH 3PWPB 4R26H 4OJYA 2P42B 2L7JA 2WQUA 2ZOLA 3BN3B 1S7TB 5HHVH 3W11C 3LQZB 5EA0L 4WHDA 3QUKB 3Q1SH 2FHFA 1QRND 2H1PL 1FI8C 1MIEH 4HJ0C 3O11A 4N8UA 1WBYB 4HJSA 1MWOA 4FZ8H 4J23A 5F9AC 1E42A 1VPOH 1Q9WB 4TUOA 5CIPA 1AP2B 5DUBA 3T5WA 4FQ1H 3H42L 1G6RA 1ECZA 2APFA 2FK9A 1JI2A 2APTA 2JQMA 4FFYL 5CSZA 3D25A 3G6DH 1W8NA 3EF7A 1BQ5A 2DYSB 4NN7B 2X4SA 5D71L 3MV11 2NT1A 3BDYH 4OIIH 3MGTB 4PJHE 2L0DA 5LGHH 4KXZH 2E7CA 3VXUA 2F5BH 3RU8L 5C9JB 2R23A 4KX7A 2EIDA 1KTKE 3AT8A 2KT6A 4JY4B 5I26A 2BHUA 2OQJA 5DD1L 3ARGD 5CZVH 3GXUB 5DQJB 5EMYA 4KVNL 4QTIH 4BHUI 1FZJB 2QSQA 1MPAL 4KHXL 5D7KE 2KDYA 4C59B 4EN2A 1RK0B 3MCLL 1Q72L 1JK9B 1CBJA 3IEAA 5GZOA 1FORH 4NJAH 4LF3B 1QATA 5EU5A 2ZUYA 3ZIYA 3ETSA 4TMPA 3ULVF 4FAAB 1CMOA 5KJ4A 4Q2ZB 4WEEA 4P3WA 3ARFC 5L8LB 5ILTL 5I1KH 2KPWA 1MHCB 1P2CA 4NOBA 4JRWA 1KPRA 1KC5L 1UWXK 5T3XD 3EBIA 4IOFD 4XODA 3S4SA 3UTQA 2X05A 1Z5HA 2NXZD 2C4FU 5L0QB 1MG2C 1W0WA 3NSDA 2XXCB 3QW9A 2HJFA 4NQDD 1BGXH 4HMDA 3DVGA 2XX0A 3FUJA 3SPJA 2DAVA 1KDIA 3OR7B 2O4EA 3TPKA 3EYQD 4PWJA 2PO6A 3GBEA 4OGXH 1RZQA 1E4WL 3QYCA 1XDTT 1D5RA 1D7CA 4JHAH 2X09A 5CFHA 2PYEE 3GLZA 4KHTL 1A3ZA 1NDTA 4IHBA 4XNDA 2XHNA 3DX2A 3NMEA 3UZVA 5AW3B 1SJMA 1EHKB 2AAVA 2BZDA 3US0A 2BHYA 2ENSA 1YQVH 3GO1L 4M7LT 5MEPB 4Y5XA 2RALA 3NABL 3DO4A 3BE1H 1T5WB 3C6EA 3CVHB 3DSNB 1A4KB 1L9PA 4V1DA 4DFHA 4A7VA 3V9CA 3ZDZE 3IDNB 5K9JL 2XT1B 2DM2A 3PQYE 4KRLB 4LLYA 2MPAH 3CXDH 5E95B 3RJOA 3U25A 2CBPA 5IJVB 2E8YA 1QBAA 1KB5L 3C6SA 5EUOA 2IOOA 1JF1B 1Q90A 3K81A 4IRSB 1I9RH 2P4AB 3LEYL 1IKOP 5IBLD 4OM1L 4Y0GA 5CMAB 1JPGB 1XH0A 5DZNA 5I17B 1MF2H 1CDHA 3NK3A 1F90H 3QFJA 5D7IA 5T3ZH 3PGDB 3OZLA 4X6FB 2X4PA 2ZUWA 4PJBB 3HS0B 4QF1B 1WUZA 1UWGH 5AOIA 4IQHA 2DKMA 3MRRB 4PJDA 4AGPA 3NJGA 4NQCE 2WXHA 2C3GA 3NTCH 3MMEB 2R51A 5JUEL 4XMUA 3WYRA 3ZKND 4D2NA 1CD0A 4Z7OE 3TN0B 3HG1D 4WRLA 4L05A 3SKNA 4GY4A 4WI6A 3MRIB 1P4IL 1SN5A 4XAWH 5EFIB 3DJRA 1J0YA 4QJ3B 1JGLL 4Z7QF 5IBTH 4PG2C 3BH9B 4Z7NE 5AG8A 5F6IB 2UY7A 2F53D 2EH7L 3FCBA 2P7TA 3QNYA 3BYYA 3E6FB 4R90H 5BJTB 4G7YH 3HLKA 1PEZA 5GQBA 2PW1A 2VABB 5I1CH 2NDFA 3G5XA 3D0AA 2HTKC 1QSEA 4HLJA 3T0XA 1I85A 3GIZH 3ILQD 4Q6IA 5KYUA 3V9EA 4H5SB 2WZ6A 2KQNA 3X3FL 4GRWB 3VSUA 4AEIH 3C5XA 4DO5A 5CN3A 1HSAA 1GIGH 3ESOA 4F7CA 1HKFA 1HINL 5TQ0L 5FUOH 1LP9A 2DQFB 3RIFF 1K4CA 4A6YH 4BE5A 1J0ZA 4GI8A 2KZKA 4A2HA 4O2EA 5JW5A 4FXGB 4BZ1L 2HRLA 1S7VA 3Q3GB 2YOAA 2WCSA 1LO4L 3X1FA 3D51A 5EUKB 3NFSL 5JPMC 4X5XA 5K93A 3NJXA 2BLFA 4JDEB 5BUAA 3LN5A 1OE3A 2FB4H 1T89A 2FX8L 4Y2LA 3TBTB 1KGWA 3FUKA 4F15C 1FPTH 2AK1H 4OZFB 4PD4K 1P6WA 1MHPL 3JWDL 2AS5M 2WP3T 1CF1A 2FIKB 5CCKL 4PJ7F 2LE9A 1KXVC 3JV0A 4YLBA 1WCQA 4L37A 5HYQB 3LDBC 1DN2A 1HHHA 5K39A 3SY6A 3AUWB 3I85A 3EJUA 3UYPB 4QJ5B 1KBVA 2JCWA 1LNUA 2UXVA 3C60A 4PJHB 3RKDC 4BBWA 1VZGA 1YVLA 5CGBA 1MEXH 4N0UA 4Q6YA 1LEKA 2Y6SD 2NY3D 1GKOA 4S1RH 4MMYB 3FW6A 4D9RD 2X53A 4P5TC 2NNXA 1SM3H 1KTDA 4DP6X 1XGTB 3X12B 4FXTA 2IH1A 4ZW7A 3OSKA 2HJKB 4YK4B 4BQ6A 5B39A 3RJDA 2QVKA 4BXVA 1BQLH 3A23A 5J12C 3GFUA 5E6IA 1T0PB 3B7TA 3S96B 4UBDD 1F1GA 3B2UD 1VRSA 2VSDA 1T7WA 4WNQB 4WWKA 4QHNA 5JR1H 3MGAA 3P54A 2BSTA 1EUUA 5LBSA 1YECL 4V2BA 3ULUD 1PJ9A 2XWBB 3VDAA 2FUTA 4CW1B 3DKHA 2IPKB 5D7LA 1V5JA 3LMJL 3U6XS 1Z0MA 5ADOL 3MUGA 1VZHA 5DHVA 4KKZA 4U1LA 1J8HE 1SY6H 2QDWA 4K5OA 4NENB 4OB5H 5C0CD 5J6GB 2QFRA 3BFQG 3LHPL 4IM8A 1ZE3C 3WDJA 4EI6A 5FYJU 3BQUA 3QZWA 5DUPH 1SHMA 2WUBH 2ZXEB 1P1ZB 1AGCB 2GHWB 2PYEB 2ADIB 3FONB 1UJTA 2BVPA 3TJHD 3UTSA 3MRMB 2BM3A 2N0MA 3B9KA 4FX5A 3HIZA 5AKSA 3JWNG 5HHME 4Y2DD 3BRDA 4LSVL 4BK5A 4FYSA 3MQIA 3KYAA 3MBEB 4RGMB 3ZRSA 3HCVA 1IMHC 5LWYL 4E5XA 4H88H 1BFVL 1Z9SB 3ZDZB 3CVIL 4GW5B 4GRLB 4KDWA 5I0XA 2K9FB 3MV9A 4ZUUA 5HJDA 2V6HA 3NCYS 1AC6A 2YARA 4FQHB 1I1AB 3ZU8A 3ZO9A 4P9HC 3OXRA 4N4YB 4IS6B 4FG6C 3B8SA 3F7RA 4P4KA 1PD1A 1RUQH 2ENPA 3PGCA 3RZCB 1GC1C 2ICWB 4C56A 1OCWH 3CVHL 2ADJA 2DQHL 5A16B 2UWEF 4YGVB 3D18B 4G3YH 2KMWA 3C8HA 1EFXB 1SN2A 2EC9U 3BAEL 4QRUA 2PLTA 4Q9QL 5H8DA 2XWCA 2HT2D 4MS8D 5JXED 2R7EB 5CEYB 1FBIL 2CM5A 3KWTA 4A68A 4BGDA 2AHIA 1A25A 4H26A 4DFIA 4QUOA 4NQCB 4I4WB 1U8PA 1EO8H 4BSWB 4MFHA 1X44A 3LRSB 1X5HA 3PWLB 4W4OA 3S9DB 2J8UF 3HE6C 1JZ2A 3GRWA 4PB0L 3RILA 4DP9X 4FTVE 3KDPB 4NN6C 3S3CB 1AFVL 2CE6A 3SCMC 5JHBA 1R3IL 3ZL4L 1JHTB 1KBGL 1RUAH 1ZS8A 4AGOA 1ORQB 3VJ6B 4Z7NB 4ZMYA 1UQSA 4ILDA 4WEBL 4Z77A 2MKWA 3PP3H 1IEBA 1JFQL 4X0KB 2GK0B 5AALA 5HHNB 1DVTA 3V4VB 5TQ2L 3FYEB 1S7UA 2ITDB 4PJCF 1ZGLM 4D0CA 3GEFA 1G7JB 4KWUA 4EQ2A 4ECNA 5FGSA 4GUCA 3IXAB 1A7QH 4Y1AD 4EDXA 1NUDA 4KZCA 3NJJA 1U21A 1G9HA 5DFVD 3G6JE 5F1KC 2FLMA 4KNQA 4AMKL 4P46C 1TJGH 3DPBB 3TZVA 1BHGA 2WWMD 2B1HH 4TN9A 1XXFC 2VN7A 3L1FA 4HKXB 1C7TA 3DRQB 4AQAB 1G9NH 4LDOB 4UT7L 4K8RH 4LASH 5LBVA 1B6UA 2WLLA 4Q52A 3KLSA 4HZLB 3CZGA 1NBYA 4QKTA 1U6AH 3TO4A 3FQUB 2QMJA 3KL0A 4DGWC 2VUYA 1KJ2H 4JRXD 4PUBL 1WEJH 1T83A 2HWZH 4G70B 3ARFB 4OKVB 4Z6AT 1DQIA 4R7VA 1U8KB 4OF7A 4UT6H 4LHUD 1ZJBA 3KYKL 2BO0A 3II2A 5TE4L 3VMPA 4FNLL 4QMEA 4O2CA 1U3HC 5F7AA 3LZRA 3NAAH 3BPNC 1ETZA 2V8MA 5ISZE 2VLKD 1MXDA 3IDXH 3UJTL 3CFKA 2ZONA 3MODH 5E00B 1CD9B 2ITEA 1OTUC 4RETB 5DJ8A 1SOQA 2YJQA 2FL5B 4LP4A 5EC2B 3O4OC 1C8QA 4X6DF 2CKBA 3GBDA 2WB7A 3MTRA 4X80L 3I6GA 2XLLA 4YHOH 4ERSL 3KLAB 2HN7B 4UQCA 1GW6A 2VJ8A 3VXNB 1J0IA 2HFGH 4U1IB 5D7JD 1MJUH 1VGEH 5SWSA 2FJHB 2XYCA 3GMLA 1EANA 3NOIA 5F1NB 3U7WH 3OSVA 4HS8L 3RTQC 1OOAA 5CAYB 1B0RB 4JB9L 4K7PY 5FDWB 1MWAB 2PP9A 4DH2B 1UH4A 2ATPB 2NOYA 1T66D 3RWDA 5BZZA 1QFHA 1DANU 5ALCH 3ULVH 2DLFL 2P52A 5TGBA 1G1KA 4UIMB 3VFWB 3SDCD 5LAPA 4PJ8A 1J8HB 3RLSA 5I5JA 2A0LC 3KD4A 4U0RC 1VA9A 2X6VA 5LCVL 1D2OA 3RVTC 3WNKA 5DJZA 3NFNB 1AO7D 4F7MA 5C0DA 1BQHA 3HC3H 4PJFF 5IHWA 2XBDA 3L1OL 4ZUSB 1DQLL 2VISA 3GLAA 4GBXD 4APQB 1YEJL 4MQ7B 2EDTA 3BIKA 2ZNWA 3TV3L 4S10A 3M46A 3QWNA 1OAUL 2VDLB 2I5YH 2BSSB 5C0EB 2MHAA 3HR6A 3RFRA 1WGOA 3AB0C 2IPTH 1A6WL 2BWIA 3HLAB 5ICXA 5FEBA 4F58L 3RWGA 4J6RL 2ZF8A 4KUZH 5ABDE 2HA1A 3WUZA 3ZZ1A 5JHLH 4PIBA 3V7AG 3H4FA 2NYZA 1TZHB 2X9WA 4A7GF 3O45B 5DTFA 1NKGA 1J7VR 1XAKA 4JG5A 3QHFL 1LD9A 4N5UA 4ODUA 5GRXG 3MBXL 4PW4A 4FF9A 5AWNL 2FNWA 4MA7L 2WLNA 3MYJA 4AJYV 5CJ5A 4OIFA 4HG4J 1Z5LA 4IBVA 4PJDB 1MUJB 4N26A 3WXWH 1I8KB 3CDZB 3D4YA 1OPGL 2APSA 3P4OA 4IKLA 2J6EL 3DMMC 4OLWL 2BOLA 1UOKA 2FQDA 4X7SH 5JPMB 4OV5A 2Z35A 3L95A 1DVYA 5DQ9A 5GSRA 2HKFL 3QIWC 1H3WM 1PKQE 2AGJH 3VGHA 1UH3A 2ATAA 2WW8A 3K72A 3VM7A 4ZW8A 4KKBC 3QUMH 2O6FA 3FH5A 4XC1L 4E2OA 1BZ8A 1URIA 4I0PA 3S0PA 1A6AA 4LEXH 3QJTB 4OGYL 1DVXA 1G1CA 3OM3B 4HEPG 2E7LC 3LDBB 5ITBL 4IMLB 4IKIA 4X4XA 4YX2H 5E4EB 4U4BA 1MFCL 2EE2A 1A9VA 5HPMA 4XCEA 3RX5A 3MV7D 3RL1A 2DBLL 4GSQA 4QYAA 2QEJA 4CDHA 1IZKA 2YGOA 1BVNP 3WN5A 4ZDHB 3ETBF 4O51B 1N59B 4P5TB 2R0WL 4FMFA 4Q56A 1OP5K 4G1MA 2A77L 5DC0A 2KYIA 5JDJA 1JGEA 3G6JB 3FQXA 5DVOA 3OGCA 1AS8A 3QHTC 4H8HA 4GW4A 5I1GH 1IKFH 3BAWA 4UCFA 5J12B 1GGTA 3RAJH 4PGCA 4HEME 4R83A 3V4VL 1YNTF 3BMWA 3HC0B 3O3AA 5SX4H 2ADGB 5IJDC 5DDHA 4A2FA 1S7VB 4EI5C 3G5YA 1BPLB 1P7KB 4M00A 4BFEA 3L4YA 1RIUH 1T0MA 3IFLH 4P3DB 1CXEA 1AY1L 1HQRB 3CQQA 3EGXB 3HBPA 3O8XA 1GYCA 2JV6A 4PRIE 5GGQL 2X4NA 5HHOA 4B0MM 5TE7L 5DI8B 4JPWL 5EO0B 3RQ3A 3MX0B 3RB7A 1RUML 5EBWB 1GGIH 2ZUXA 4YDLC 5F1OB 2IG2L 3SODB 2YD8A 4U3XA 5KBMA 3VVWA 4FLSA 4XPHH 3V6ZB 3OAWA 1EDQA 3GXDA 3BCFA 2XETA 2XN0A 2I07B 3KBHE 3OPUA 2WXKA 3C60B 3CN3A 1A02N 2HFEB 1AGEB 4KOBA 5KVEL 1RJZB 2WXOA 1IAKB 4IGBC 5LXVB 2EO9A 4PV1C 1Y18A 2HVKB 5I2IB 2AQ1A 2GUYA 2P5WD 2Q86A 1GOFA 1TZIB 2PCFB 1LK3L 2HX7A 2OMUA 4IBYA 3V5DB 1U8QA 1G6RL 2NY4D 4UYPB 2WVVA 5KYWB 1VFAB 2IIJA 4KZDL 2IH1B 4TRPL 3NACH 2HT4C 4FNPA 3VWJC 3PHAA 1IC5L 3SDYL 1QBML 2AV7A 2R4RL 3D50A 3QI9D 3T8VA 3TTYA 1S9YA 5IFHL 4E41E 3MLUL 6TAAA 3CSBA 4XXDA 4L3ED 2GJRA 4LEOA 4PY7B 3FQWA 1L6XA 1RZIA 4QHNB 5ALBH 1AR1C 3SDDC 1D2PA 2GHZA 3REVB 1PW3A 5C07E 4OUOA 3RNKA 5EN2A 3SPVB 1ZVYA 4RBPH 5GSVA 3UC2A 4FA7B 2RJMA 4HS6A 3WY4A 1OZTG 1NGPH 1GAFL 3ZKQD 3QDME 1G9NC 3OB0H 1NC4B 4K8RC 4PV8A 3CX2A 3I6LE 3FQYA 4P0DA 4Y5VC 3W2DH 4R7NA 5E99H 3GT6A 1JHLH 1O9VA 5D7EA 3IMSA 4KU1A 4MJJA 4OGAD 3L3KB 2Q8BL 4LL4A 3VWKD 4GMTL 3RVUD 4K5NA 2QQQA 3KDMB 3V4PA 4QRRE 3ZX1A 1FZMA 3EUDA 1NPUA 3IE9A 3F3HA 3UTSB 1DLHA 4PG9A 1X5YA 1EH9A 3HE6B 2BJMH 2P80D 3DXAD 3LRKA 2PWDA 4JFEA 2IH3A 3C2AH 3C6LC 3FO2B 1AHMA 1QPXA 2XTLA 1SBSH 4NN6B 5AW1B 3GZKA 3SCMB 2Y0SA 3LZLA 3UO1H 3VXTB 5EPMB 4E5XB 3CFBA 1UTDA 2J5WA 4NO0D 3FU9A 5G4OA 1UCBL 5B1AB 2CJ3A 2VZVA 1IBFA 3MXVH 5E23A 4J3TA 3MRLB 2JMRA 2HH0L 5KVFH 3H54A 3HC4H 2X89D 1KN2L 5JQ6L 2ZUVA 4JY6A 3R06A 3FC8A 5GJTH 4J3OC 4QRTB 4N20A 5HDOA 5EF0A 5DLLA 2WPGA 1Q9LB 2WXNA 4XH2A 4EJ1C 4ZQTA 3MRJA 4WO0A 4UAHA 3NCMA 4NQTA 5ANME 5C7ZA 4PTUA 3D2UA 1RIHL 4H26B 3W0WA 1I53A 3IJEA 3MUY1 5A6LA 4WV1B 1F4AA 5E8EA 3MRNB 3BEWB 4JHVA 2BNRA 3PY9A 4GFXA 4ZMXA 1TU2B 5EIIA 4EOWL 4MAUL 1VGKB 2EYTA 3HZYA 4YPJA 4JKWA 4OCSL 4H25B 1PKQB 1GSKA 1L9MA 3KVPA 3MBWA 5CLZA 1T2JA 4WZ9A 1QVOB 2ZCLH 4HXAH 2G3ZA 5D1QA 1BJ8A 1U3HB 1JGDB 5ABZA 3G5ZA 1SMOA 2CDFB 1FE8L 1O6VA 3ILDA 4GFTB 5E2JA 4DKFH 5BVPL 3Q2VA 2NCMA 2QSVA 4AJWA 4Y1SA 5E9DB 5DJ0B 5DS1A 4D0CB 3X2QB 1AZNA 1IGFL 4RISL 5DJCA 5CWSB 4DF9A 1Q94A 3TT3H 3E38A 5I8OL 3U83A 3O4OB 1TETL 4OJEH 3FUFA 1QI3A 5AOKA 1JYXA 1DUYA 3MRDA 1MRCH 2GB2A 1JZ6A 4BYHA 3GLDA 3IGAB 3M17B 5F9WC 2MTPA 1LO0H 5BRQA 5IG7A 5AW8B 1CL7L 3NN8A 5DMGC 1DO6A 3WBDA 3STBA 2ZF9A 4WCYL 3TO4B 1UA6L 2WV3A 2P48B 1QBLL 1WD9A 2XRAL 3LZOA 3SPGA 3TA3A 5AD0B 2VC2H 4KX8A 4PJ6A 2MTEA 3RTQB 2ZJSL 4I77L 4PRIB 2DQDH 4ZFFA 4OD1L 1AGBA 2L4OA 4WJ5A 3EXLA 2VLME 1IC7H 1XEUA 4J6IA 1BZ7A 3B83A 4XNUL 2RCSH 2XN9B 1KDJA 3ROLB 5EEUA 4HV8B 2AI0L 2WNWA 4UDTB 4LP8A 2WKGA 2CAKA 5C0AE 4KRMB 4P4RA 1L0PA 2RH0A 3SOTA 2EUWA 5F8QC 1J87A 4A66A 4U0RB 5HHQB 4XWOD 3HE7A 5SWZD 5F70A 2NX5A 3FOLA 2BMKA 2IH9A 2DPKA 3I75B 3EH4B 1O7VA 3QDJA 2AQ2A 4IJTA 4NERA 1A7NH 2XACC 4FLRA 4PV9A 3H6AA 2CUIA 1JZ4A 4JK0D 4U0QB 1CU4L 5FYLH 4U31A 4UV4H 3EHBD 2NY1C 4XO8A 1BJ1H 4G8EA 4MMZA 1FV1A 2WMPA 3QS2A 4E41B 3ECBB 3AB0B 3KWVA 3F7PC 1HE7A 3PJLA 5C3LD 1MXGA 3HAEA 3LX9A 5I18L 1WFUA 2N1KA 5C07B 3VXMA 1E28B 2CIIA 4KI5D 5ANHA 3AAZB 2EVFA 3SBQA 1O7SA 4NXSA 4FP8H 2Q9OA 1LQSR 4G42B 3QQ4B 3RWDB 2A9DA 5GPRA 3B3IA 3Q1EA 3UH8A 5J7CC 3VRJB 1L9TA 1OLLA 4I3GA 2YWZA 3X14B 2A83A 4LLQA 4HFWA 2AEQL 2HLFC 4NP4H 4QWWC 3S35L 5GRJH 4B9GA 4QNPE 1MZYA 1AQKH 1RULH 3QH3A 4G8FB 5DJYA 1N3NB 4RA3A 4RGND 4XNYL 4JMXA 3DMMB 4XMPH 4CVXB 3AREC 1U8HA 2NY5L 4P9HL 4QRRB 3LKRB 5KZCD 5GGTL 4EIUA 4TULH 2JKJA 3QIWB 1GC1L 2XNAA 4P23D 6FABL 43CAA 4A39A 2OTWA 5KWYC 3D09A 3PXHA 4AMWA 1KCUH 2NYKA 1SUHA 1GTFA 1MCPL 3Q44A 4JM0A 3UGEA 3KEDA 1IUZA 3IJ9A 2FJGB 1UWEH 5A2CA 3O6KH 3UO8B 5HHXL 3FRPA 4HS3B 3CU7A 1TJIL 4UDUA 3FCGA 1YMMA 1TTRA 2NT0A 4G9FE 3SDAC 4E9QA 4YSOA 4HBCH 1QWUA 3QIBC 3GXTA 1M3JA 4BM7A 4K2UL 5KSAA 3EBGA 3Q7JA 1PU0A 2H8PB 4JFSA 4WO4A 2ICES 2G2RB 4MRBA 4M8QA 4K7FA 1VFBA 1HCFX 3QJZA 1OAZL 5E6ZA 4R7LA 1S5HA 5CCHE 1Z5LB 3N41F 3NP4A 3WLBB 1DEDA 1AGDB 4IHOB 1FFOB 1KLUA 4P9ML 5ANMB 2Y5TA 1DSWA 2AMGA 3VRLF 2BWQA 4EI5B 3S88H 4JAMA 2GFBB 4XMXA 2X70B 3PU7A 3RGVC 2VAAB 4UV7L 2BNQA 1C5BH 4M3JA 1NCJA 4JS7A 3A0OA 3HNTL 3Q5OA 1TSRA 3VFOB 1A6AB 1JHKH 1U95B 5BRPA 1H0DA 5IMMB 2OZ4H 3SJVD 1EXUA 1KYOK 4PY8J 5F89A 3U7YH 5I1JL 2YMOA 1JNLH 4ZUTB 3RL1B 3WXVH 2YD1A 4JL2A 1A1MB 5DD0L 1OGAD 4IGBB 4NWTH 3BXNB 1NGWA 1YCSA 3ZZLA 5BUPA 3QZLA 2C7FA 3LVEA 4YXLL 1KGYE 3V6OA 1XR8A 2OK0H 2CUHA 3NA9L 5CJQL 1A6ZB 1IC1A 1PZSA 1WC7B 2VZ3A 3LB6D 5HVWA 4L5FE 4NGHL 5B3JF 4Z7QE 25C8H 2XTJC 4CKVX 1ORSB 1WSST 2VDML 3BP6B 5I0DA 1N0LA 4S0HA 2W0KA 2R56L 1QYGL 2YAEA 4AM0B 2QR0B 1P7QD 1S4IA 5CD3B 1F4WL 3LKOB 4NHCL 5ENWB 2FAUA 1AR1B 3SDDB 3MRHB 4LXFA 3U1PA 4KV5E 1WTLA 3MA9L 3Q2CA 1GGBH 2VSCA 3NIFF 5I1DB 1Z9OA 2EDXA 4JVWA 3O3BA 3MUZ1 3BWAA 3ECUA 3LKPA 4CJ0A 3QULA 5FFGA 2ZXDA 2N7BA 2BPBA 5INDA 1HE8A 4Y5VB 1TVBB 2QGCA 4KRPD 5DRZA 5C0AB 1F11A 1KACB 1UACH 1U92A 4OIBA 1BZQK 2YSSB 4ETYA 1XF1A 1RVFH 2OMYA 3I02A 4U3CA 1U4FA 3AQDA 1I8IA 5E1AB 1HAWA 4R4FH 1V05A 4XHJD 3O4LE 1KLFB 1MOEA 3EF4A 1H19A 1KMGA 1AIFA 1ZDSA 4FQXC 4OZ4A 5FHBH 5FWRA 3T2PA 2FJFB 3CFJB 3C6LB 4G8GA 3WMQA 1NEUA 3U6RB 4PJ7E 1UA7A 1X7QB 1Z9LA 5HYEA 4O02A 3SKUD 1A9BB 3GXIA 1JF6A 4WTZA 5DVNA 3OKLA 2WB1A 1N7ML 4YFLI 5EZOL 4AXWA 4BFJA 4XXDB 3KXFE 5DWPA 5EWIH 3GMPA 3E8UH 4WI3A 1LK2B 4L8CB 1T7XA 4DN3H 4NYLB 4JHWH 3ERXA 4XNMA 4XBMA 2CKBL 3K7UA 3MLRL 1CQKA 4XN8A 2E27L 3UX9B 3VG9C 3Q8CA 3FUNA 4P48A 1LE5B 1ZVHA 1ML0A 3NZ8A 1I8MA 1WAAA 5JDSB 9CGTA 3FQRB 4E9VA 3IAPA 3HNVL 4GKSB 4XN2A 5D2NC 5ELIA 5ACZB 2I7OA 4R7NB 1T1ZB 3DK2A 5DT1H 1EZLA 1I3UA 1CICC 3MHZA 4K15A 4A37A 3EFOB 5BRZE 1VENA 5IUCA 1ACYL 4EXPX 5AL0A 1A14H 1HZLA 2YEQA 4P2QE 4PS3A 5F9JA 3QEHA 5INCB 3DURA 4PRPD 4L3CB 4QRPA 1QSFE 3N85H 4N8VA 1MY7A 4MDJA 1NFDF 3VFGH 3QUZC 4AV5A 1I9EA 1OK0A 2CHWA 4XI5D 4DCQA 4TPRH 3E6HA 2IOMA 1T04B 3VXPB 1C7SA 5FUZH 2BSED 3LS5L 3P3YA 3BT2L 4QKXB 3WFCH 2AXGB 3BUBA 3T3PF 5CEZH 1NCWL 1PF3A 4HPYH 4ALAL 2VXVH 3HB3D 3VD7A 1INDL 3R06B 4DPRA 5E2WL 4NM8L 1FHNA 3US1A 1C5CL 2VLJE 4N3TA 4W9EC 2VLRE 3AY4A 1IT9L 4YDVB 2XTJE 3CC1A 1A1NA 2G9KA 2W07A 4NQDA 5EU3A 2YUZA 2Y72A 3QQDA 1XD1A 1J10A 5F9WB 1N70A 4JPIB 4TLKA 1TSHA 4HP5A 3M1BB 3H7BB 3ARGC 3IJEB 5LQBH 1FNSH 1TQWA 2BW5A 1JMXA 1PBYA 4XWGL 1Q9OA 3BVNB 3O41B 5E2TH 1WA1X 2D7TH 3RWJA 1J9TA 1DQQA 3PWNA 2ZP0T 4PIRF 3WY1A 3H6JA 5F7YC 1WFTA 2JJSA 1QA9A 3DX6B 3QDGD 1FFNB 1JPST 3T4YB 2E46A 2UWEE 4KKLD 1F56A 4I1PA 5DVLA 5TK4A 3A6BH 5IVNA 4NFBA 2IGFH 2V2WB 4LBAA 2GC4C 4JZJA 3RA7L 2GBVA 2IBGA 4WUUD 3WAKA 2DV6A 5T33L 1MRFH 4ES9A 3ALWA 2CK0H 1IGIL 2JXMB 4N86A 4IOFC 3A4AA 4IBWA 3ENEA 5D1ZI 2J8UE 2V0AA 1G4MA 3E1F1 4JFFB 4JO5A 4Y8DC 5HYFA 2NXZC 5D7SL 3MRDB 5BOJA 4Z7QB 2VDPB 2FT7A 2AEOA 4OLVL 4YNYA 4NZJA 2XQYK 1MCIA 4OZHF 2NY1B 1T1YB 2BFVH 4M7LH 5KJ7E 4X8CA 3BSHA 4RZCA 4ZXBC 2JSFA 2YXMA 3EYSH 3Q48A 4MNHB 3V4UL 3VSQA 2UXTA 4ODBD 4AYMC 3K6OA 3GMRB 4HLZG 5EOQH 3FT4B 3TEXA 2Y5EA 5JW3L 1WT5C 1KSRA 2ROYA 1AGBB 4ISVB 1AGFB 2XQYA 3DOSA 2H32B 4JHZA 3X3GL 1BZ7B 4U33A 2G60H 3PQYA 3MRBB 3STZA 2XWJB 1JZEA 2BSBA 4KKCC 4KTDL 5HTSA 5D2NE 2CM6A 1OW0A 4QLRA 1T7VA 2VM4A