4WI0B

Crystal structure of coh3scab-xdoc_m2scaa complex: a c-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
156
structure length
156
Chain Sequence
GTTVSGYINPDFVTTSTTAPIVKAGFTVEIVGTTKSAVTDSNGYFEIKDVAAGTYTVKITKANYLTREIANVSVTADKELSTSASPILMWAGDMAIGGTQDGAINLEDILEICKAFNTSSTDAKYQVGLDLNRDGAISLEDVMIVAKHFGKVSSDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Coh3ScaB-XDoc_M1ScaA complex: A C-terminal interface mutant of type II Cohesin-X-Dockerin complex from Acetivibrio cellulolyticus
rcsb
molecule keywords Cellulosomal scaffoldin adaptor protein B
molecule tags Structural protein
source organism Acetivibrio cellulolyticus
total genus 41
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1330.10 Mainly Alpha Orthogonal Bundle Type 1 dockerin domain Dockerin domain 4wi0B02
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 4wi0B01
5K39B 1OHZB 2JNKA 3G3LA 3MN8A 4FL4C 1DAQA 4WKZA 4DH2B 5AQ0A 4EIUA 3E8VA 3KCPA 2VN5B 1QMUA 2XHNA 2MTEA 4IU3B 2CCLB 1NKGA 2B59B 4FL4A 1DAVA 5G5DB 4YOKA 4U3SB 1H8LA 2OZNB 3HN5A 3NJVA 4UYPB 2Y3NB 4WI0B 4FXTA 2VN6B 3UL4B 5LXVB 4IYKA 4UYQB 2NSMA 3NJXA 1UWYA 4IU2B
chains in the Genus database with same CATH superfamily
1UH4A 1EEZB 3V6OE 2AKRA 3VFNA 2MKLC 4QMEA 1MWAL 1HQRB 4N22A 3SODB 3UCRA 2BZ7A 2IDTA 5I28A 3ZDZB 1EHAA 3DECA 3ARBB 2R0WL 4JZOB 3ARFB 5KAQF 3EDJA 3H3KA 2PW2A 3ULVH 3QRFM 3MLTB 1ZCRA 4I18A 2V5YA 5MERA 3V5HB 3EYVA 4D0DB 5KSVA 4ONHA 5LVEA 1RPKA 1XBRA 1AGDA 4PJCB 2F8OA 3RVWD 3DVNA 1BEXA 1QBMH 5E2VH 3ZE2F 3ZKNC 4XPHH 3WHE0 4YNYB 1KNOB 3AG2B 4LLVA 5TDOA 1RK1A 1U4EA 2FD6H 4H20H 2VL5A 5ETUA 1XDTT 2DWEA 3LEYL 4RFNB 2OMUB 2X4UA 4B95C 5C0JA 4IBSA 2Q5BA 1FZMB 2LQRA 4FL4A 3GF8A 3GJFK 4HAGA 5DYFA 3L2NA 5JDSA 1GGYA 5DI8A 2WB7A 1Q72H 4AXWA 2OZNB 1F11A 4CVZA 3QUZC 2VZTA 3IVKA 2J4WH 4YUEH 4WTZA 2AEPH 1XGPA 2GBVA 3L1OL 3VG9B 3U7WH 5AVZB 3KLHD 3KPOB 3Q06A 5I0VA 5JA9A 1A4JB 1V5JA 4CN6A 1EMTL 1YG9A 1X9QA 3QWNA 3T0XA 4CU6A 1KIPB 4HLZH 1OALA 5AQ0A 3V0WL 3X17A 3O45A 1AAJA 5ISZB 5AAMC 2ZOKB 4IEFB 3EH4B 4TNFA 3TESA 4Y2DD 5D1QC 5L7XH 3UZEC 2Z7YA 1SGKA 4PRNA 5CN2A 2CAKA 5D2NE 4DCQB 1H0DB 2MSPA 4AX3A 2O30A 2GAZB 1KGJA 1PGRB 1TPXB 2BC4A 5I6KA 2DL2A 2AGJH 2V2TB 1PG7H 2XV3A 2VDPB 5EORH 4OZFG 4K2UL 1NCWH 2HMID 4B3VA 1UA3A 1UHVA 1ZVSA 2DQMA 3G9AB 4DN3H 3FONA 1JI1A 4XMLL 5HP5A 3RDJA 1CFQB 3JWNE 4BK8A 1BD2B 4MRBA 3N1QC 5E2TH 5TQ2L 1A0QH 5L0QC 2B2XH 3SDCC 1NC4B 2AJUL 3MLSL 3HR6A 3LRLA 2EC9U 2IQAB 3B7RL 4PV1C 4N8VA 2ARJB 1X4YA 3PABA 4KDTC 1JL8A 1EFXD 4NO3A 1A3RL 4A6YL 4ZMYA 3DO7A 3PJLA 4BIKA 3SE8H 3VXRB 4QRRD 4U3XA 2IGLA 1TCMA 3FU6A 4AQEB 2HFTA 5HHXL 3ZE0B 2Z35B 4J3TA 2VH5H 3CFKB 2OYLA 1RZQA 2R29H 1I1YA 2PP8A 5DQJB 3WXVL 3LNIA 4BZ2L 4IBWA 1BQUA 1E67A 3OHXB 3T4YA 1DUYA 4N5UA 4ZRGA 5IG7A 2XN9A 5FGBA 1HINH 5D6DC 3BN3B 3S3JA 3FXIC 3AUVA 1HNFA 4HWZA 5J1AA 4DQAA 2YXMA 3I3EA 4GG6F 5F7EH 1W91A 5HYJB 4BYHA 1BJ8A 5MI0B 2P24B 3U4EB 4IGBB 4A2HA 2YAQA 4ZD3L 4KO6A 1RKRA 4HC1H 1DQVA 2EC8A 3GB7B 4BK5C 2QQQA 3UTZA 2P7TB 4NS0A 2HT2C 5AWNL 5BOZG 2WZPA 1HHKA 2IH3B 1U91A 1WIUA 2XRAH 3CLWA 3O4OC 3PHQB 5EUKB 2HKFH 3EH2A 4JR9L 5IB1B 4P5TB 4O2CB 2F7OA 1A7PH 3MU3A 4JM2D 1EDHA 3D85A 4CJ0A 3FCBA 2JKJA 3TP4A 3BAYA 4J3OH 2EIMB 1T04B 4X6FA 2YAEA 3MFFB 3RB5A 1SUJA 1EPFA 3TVMC 2XZCH 2XWEA 1JPGB 2YPVH 3FU9A 4G6FD 4L5FL 1F45A 5T5NF 2H45A 5E8DH 5L2KD 4LOUC 4UIMB 4UB0L 1BF2A 1EWHA 2BSEA 3WNKA 4NNYB 3FJTA 3QEQD 1MRCH 5GRUH 3VWKC 3MR9B 2X2HA 4PG9B 3ES6B 1BOGA 3JV4A 3QDMD 5B7FA 1NFDE 3MI6A 3WMPA 2XWRA 4PP2B 2VDKL 3RNKA 1Y18A 2VQUA 2QGEA 4G70B 5IBUG 4BQCA 2VDOL 1DJHA 1I1FB 1XWVA 2VAAA 3PWLB 3DMMA 4HUKB 2XWJB 1BQLH 2C4FU 3R7QA 2JQZA 5FOJA 3LKOB 4OGAC 4MZIA 4OY9A 4Y1AA 3ETBF 2X1WL 3GXNA 4CVXB 3AABA 5JW4Q 1UOVA 5EUOA 2EKJA 1UKTA 3QJTB 4EF3A 2D7PA 5F44A 1R5IB 1EZVY 4JMXA 2Y1ZA 3B9KD 3KPPA 2GK2A 4KWUA 4Y9BA 5LBSA 3V4VL 3BUDA 3IAPA 1Z3GH 3MRKA 3E6FA 5T1MB 3ROLB 3GIVA 3ARQA 4HS8H 3NPSB 4FFZH 4M9PA 3LHAA 4XOEA 2X4SB 5TF0A 2BNRA 2F7PA 4UYQA 5GISH 4HUXB 3GSNH 1F2XK 3GUFA 3TEUA 3IDJB 4L9DA 4QRUB 3EYFA 4LVHB 1AO7A 3ARBC 2HG5A 2FECL 3A5VA 4DEPB 1DJZA 1SOKA 3HI6L 4HT1L 4P04A 1RU9L 2Y69B 3ZHNA 2EUZA 3SKMA 1DQJA 3IDXL 4X6DE 1G9NC 1LE5A 2IG2L 3QUMH 1W9XA 2FBOJ 5E23A 4C4UA 1JDDA 4ZFGL 1A3LH 2R9HC 2VDRH 4FTDA 1J8SA 1NAKH 1PG7X 2R0LH 5LDSA 3X3GH 1NIFA 3FU5A 3KLAA 3PHSA 3EBIA 4X6CF 2MCPL 1COBA 4QRAA 4YO0B 5DK0B 5MENA 2DW5A 2AANA 5CBEA 1RIHL 4XMVA 4M1CC 1NINA 3L5XH 4YGVA 4QXGH 2I9TB 2YWYA 2Z92A 4HBCH 2K45A 4F57H 4X7EC 2Z1KA 4LHUD 1UA6L 5DURD 2NZ9C 4NM4L 3NBNA 3IETB 4QCIA 3VFGH 4AW4A 4HDIA 3MRGA 2ICWJ 3H9SB 3QHZH 2H8PA 1NGQL 3KYKH 1U0QA 4I9WE 4XBEL 3ASNB 3DDFA 3QR1A 1OAKH 3C87A 3G5YB 5FM5O 3G5ZB 3EH5B 5JHDE 3UG5A 1CDUA 1OM3L 3MRMB 2VM9A 3HVNA 3ML8A 2WNKA 1T03H 4AT6A 1JMXA 1DEEA 4BH8B 4XPGH 2DQEL 4PRDB 1G1OA 2C9QA 2BS9A 3KPRE 4Q0XL 3DX0A 2MKWA 4LB8A 4ELDA 3RX8A 3MYJA 4PG2C 4AYSA 2BO0A 1TPXC 3KXFA 3PWNA 3QORC 1FORL 3DK0A 2AK4E 3MRHA 4DZ8A 3NTCL 5FA4B 5ADPH 5KBNC 1XSOA 4OZIA 3HMWL 3KJ4C 1RAMA 4OFKA 3OXRB 4XZUA 4BH7B 2XVGA 4XXWC 1QSFD 2OZ4H 4HJJL 2SEBB 3IRZA 2O61A 4FLHA 1OAUH 4QRQA 4OT1H 5DJYA 1H3UA 1T21A 4H8PA 2EYTB 3TC9A 3F7QA 1ZWIA 4O2EB 4NJAL 2Q8BL 2GABA 1RV6X 1CN4A 3SJVA 1PQZA 5CSBA 3BH8A 1QRNB 4PRIA 4MXVF 2X1OA 2X12A 1JXKA 2I5YL 5CJBA 3OQRA 1T0NA 1IEHA 1YMMA 3TH2T 4LLMB 3HS0C 2VR5A 1KYFA 1PZDA 3LY6A 1FLRH 5FO7A 5GRWA 4BFRA 4U6HA 4W9EC 4YHPB 4P0DA 1QTYT 4I3RL 4RVBA 3Q2WA 1XR9A 3OAZK 4OBSA 5EC1A 4HZLA 4BZ1L 1P84K 2PCPA 1MFAH 4LCCB 1KEML 5TDPB 3VFWA 2WIIB 2V3EA 2JB5L 4IMLB 4ODVL 4WFFE 3VSVA 1R4XA 2JV6A 1A3ZA 3RFZB 1PL3A 1GGCL 2Y36H 4FULA 4RX4D 3S35X 4OCYH 5C0IB 1XGTB 2G9HB 4BFJA 5L8LB 1R3LA 1P6FA 4DZBA 1UCBH 3RNQA 1BQSA 1FWXA 1DCLA 1N0LB 1VFBA 5J3HC 3S5ZA 4ZFOL 4JPVH 3LRMA 4X7TB 2IOOA 4D0BB 2ZPKH 1S7XB 4PJ8A 2P8LB 3HE7C 3BZEB 3LEVL 4JHUA 3GTTA 1H3TA 4MAUL 1HX0A 2C7UA 3WXWL 5H4YA 2K70A 1UZGA 2P44B 3UG3A 2VLJB 5HI4C 3IFOA 2BSRB 2X6UA 2ZP0T 3CC5B 1JZ3A 1TQUA 3PWPA 1MIML 3ARUA 3MTXA 4H44C 2WHVA 1Z5LB 2WLYA 3MV9B 4OGXH 2BSCA 5JHAA 3SKUD 2ZF9A 4PJXA 2G3XA 1QPKA 5ACZB 3WD5H 2VZ1A 4ACTA 1UB6A 3CPLB 2PF6A 3HN5A 3OLDA 5LJYH 1HDMB 1S7RB 3IMVA 5CGTA 1A6ZA 4NEHB 2Z91A 3VDAA 1BFVL 4I3SH 1EXUA 3MHZA 2ARJQ 4L9LB 4LDLB 5AZ2H 2ICWB 4LNRB 4YHZH 1ZHLB 5IIEA 2XYCA 1UJ3A 4FQXA 2DYPD 4V1DE 3DX4A 3DYOA 4EZMA 1X5KA 1ZMYA 1DAVA 2BOBB 1FFNB 1KGCE 2H2SC 3ULVC 5HY9A 3ZE1B 2CDGA 2EDTA 1BD2E 1JVKA 4JPKH 4Z7IA 3QUMB 4MVBC 3VRIA 4IKJA 4KPHH 4C55A 5JNYA 2HKHL 1TEFA 4BGDA 2JK5B 5F7DB 1UD8A 1TVHA 2P5EE 4S1DD 4ANVA 1EJOH 2EDXA 1JWUA 2V7NB 3PIQB 3R18A 1CCZA 1WISA 4JHZA 4X9GA 2P1YA 3CZJA 4GW5B 3VXRE 4FQHA 5FO9B 2EEDA 1M9SA 3BDYL 4JFWA 4QHLA 3ZE0E 4M8QA 1AE6H 1QFWL 1II4E 1UWXK 2APWA 4RNRB 4R90H 1TZGL 5C0FA 4OFQA 4R4ND 5ABAA 3ULUL 5CWSB 2ZJSL 1FFQA 4JREC 4P59H 3P2DA 5AKSA 4M5TA 4WI5A 5FOBA 2IBBA 4MCYB 3DK2A 5IWLA 3IFLL 5IBLC 5HYJE 3VSUA 2X09A 4LVHC 4GOSA 3TZVB 3T77A 2JJWA 3EOAB 2Y1YA 4A37A 4QNPF 4J23A 3GI8L 2IO5A 4NCDA 5KYWB 2NR6D 1F4YH 3VB8A 3ARGB 3L4VA 4MDRA 1V7ML 5F7MC 3ARWA 1NGXB 3BIKA 1XR8A 3BPOB 4GQPH 3N9GH 4MWFA 1FNGB 1E9OB 3IRCA 1KELL 1MH5A 2F1BA 5EA0H 4O02A 5B1CA 4M6NH 4OFPA 2QPUA 1P4BH 2ZCKL 4HEPG 3UMTA 1OSPL 4IU2B 5ECGA 2C26A 3H6AA 3LJ3A 5L2JB 3IGLA 2DWXA 4N26A 1WAEA 3QIWB 3WN6A 1P4IH 5IUCA 1YECH 5HYSB 4JDTL 3EG9A 1TUPA 2GJJA 2HUHA 3Q5OA 3S8WA 4YIQB 5T1KB 4CNIB 1ZKAA 3HOGA 1BQRA 4LCYA 4I48A 1R5VB 4C57C 5JXEC 2DI7A 4OM1H 4AY0A 2X9ZA 5C71A 1I7TA 3MZGB 2D0FA 2Y07L 4K3DH 5I71B 3D39B 4YX2H 1DJYA 2H26B 3VI4F 4UTBA 2IMMA 3IPEA 3T2NH 1KTKE 4YC2B 2WXOA 4ELMA 3MRIB 1U3HB 5TF1L 4A55A 1JP5A 4ILDA 5FKPB 1UATA 3HHRB 3ZTJH 4HAKA 3RUGF 1HSAB 1YNKL 5C0RH 3FQNB 3NZUA 3FQRA 5JW4R 3B6SA 2X6MA 5DA4A 2X70A 1EUUA 1F4AA 3I50L 4TQEL 3K1DA 5HD8C 3UTSE 1M7DB 4GKZA 4NFBA 1ETZA 3N04A 1IFHL 1ZV5A 4ADJA 1SVCP 3EO1A 4X4KA 5H2BA 2X42A 3MLWL 1FAIL 5EWIH 3VTTA 4AM0A 3F64A 4K9JA 1JVLA 3PY9A 5HGDB 1OCWL 4WY7L 1ROWA 1Y1UA 1TMQA 3L5WB 4LAQH 5EZLA 1NCDH 3MBED 4HIEA 4Y19B 4GBXB 2XPGB 4FQ1H 3ZT7A 2O5YL 4QDGA 2EE9A 2CK0L 1MCNA 4E42B 3O11B 2X6AA 2ZCHH 3KE0A 4M6ML 3FQXB 5T3XE 5J06A 4G7VL 3TBCA 4AIZA 4JB9H 4BV1A 3I6GA 3T4AB 2NNCA 3HN3A 4J3OC 4EI0A 3RL2B 3AS3A 2UY6B 3F05A 3HC3H 3BUQA 2DWTA 1M53A 1ASPA 4FXKB 4XMKL 3JT2A 1Y6NR 1YY9C 2MNUA 3D2UA 3O2WH 4XP6H 1RVFL 5HHQA 1MI5B 3W9EA 3GLEA 1JERA 1VLXA 4X80H 4FMVA 1GCFA 4HPOL 3N40F 3NJJA 1W6WA 4WWPA 3LD8B 4PIBA 6CGTA 4IOIB 3WEAA 4EBQH 1BWMA 3HNVL 5KTEH 3IU4L 2EDOA 1EIBA 4PW3A 3DIFB 4L3CB 3NAAL 1EHNA 2DY2A 1RUML 4XBMA 3L7EA 2GTZB 2K8QA 2VN7A 1DBML 5DHVH 4S2SA 1QA9B 3DVFA 3H9SE 1H8SA 3H4HA 1TDQA 4YN3A 1KJ3H 3WJJC 3P4OA 5CFAA 1B2WL 3IJHB 4Z78B 3TCXA 1NAMA 4XVTH 3VFUA 4WFHE 5CZVH 2CLVB 4O2FA 4H8HA 2FDBP 2KZ1B 4Z6AT 1U8IA 5K93A 1QVOA 3OPZL 5D4JA 1JHKH 1HKLL 3CFCL 5AVTB 4JANA 3BVVA 3K80A 5IM7B 5IT2H 3VFRB 1J8HB 1OW0C 2WY3B 4HK3N 4BFGA 3S5LG 3BWUC 3P9MB 3CN3A 1NFDF 5C09B 4EOWH 1OTUC 5CLXA 3SY6A 2R4SL 4RWYL 5D5MF 5BRZA 4MJJA 4PJBF 2ZWNA 3ESVF 1NCGA 1H15A 3O3UN 3A6OA 5E1HB 2GFBB 1Q1JH 4NZUH 3N85L 4TNWK 3GPEA 2A9DA 3VVWA 5F7UA 2WLJA 2QHLA 4KROC 3BEWB 2Q7NA 2P52A 1N0XL 2VN5A 5ALBL 2YGVA 4XO9A 3QFJE 1BPLB 1YEJH 2E6PA 3EJYC 4LCUB 5GZNA 4H0HB 2Z93A 2E86A 4M43H 5FGRA 3TXAA 5ABDE 1TENA 5GIRB 1NCTA 1UTDA 1XGRA 5M95B 1KB9J 3FRPB 1JZHA 1MWAH 1ZT4A 1EHLL 3CHQA 3CZFB 4PRPD 5G4NA 3BMWA 4OIFA 4BSVB 4JDZB 2R69A 1ROCA 2L7UA 3VXSA 4NM8L 5E1IA 2R0WH 3D87B 3NEXA 2BIPA 1F90L 3X14B 2IXQB 3OMAB 4ERSL 3DUHA 1EV2E 4RA3A 4K07A 1TQCC 4FQCL 4P2OD 4AVKA 4ZZFA 1E7UA 5ID0B 2HJKA 3KW7A 3QIUC 4X6DF 3PDOB 4G8IB 2J5LC 4ANXA 2GYSA 4GPVA 4D94A 2WXGA 4Y16A 3T6ZA 1A2YB 5K5YA 4U3SA 3WNJA 1S4IA 3PWVA 1D7FA 5DT1L 2OL3B 1H8NA 2DYSB 3LKSB 4KMTL 3VWJA 3RILA 4ODXB 4BKTC 1CTNA 3LEYH 1HQ4A 3RIAF 4BDVB 2L8AA 2NLJA 3ARGC 1ITBB 4U1JB 4YDKL 1W2KT 4QR7A 3GGWA 4MJ5B 1ESOA 4OZFA 1FYTA 3TF7C 3DOSB 2BPBA 3MRLA 2Z31A 3LPFA 2WINB 3QT2A 1GKEA 1KIUA 5DDHB 3ZDYE 1MCDA 2MCAA 6PCYA 1Z9SB 3VSQA 1WICA 1EMTH 1RZIB 4G7YL 5BXFA 3MBWA 3CJJA 2IOIA 2VZSA 3V0WH 4QXVA 1X7SA 2ESVA 4PJDB 4Z7QE 2FIKA 3OKYA 5DD0L 3MKKA 3L4CA 5EU6B 4HLZG 3QWRD 2G5BA 5K9QI 2Q3AA 4G5AA 1NBYA 3MOBL 2C7FA 5HHME 2F7RA 4F7PB 2J8UE 2WO2B 3MV7A 1V54B 4HIXL 1XF4A 2FUTA 3EJSA 4F7CA 5IEHB 2HZHA 3ULSB 4BXVA 2VMFA 4DTGL 3IKCA 4M5YL 5C7ZA 3QJVB 2Z34A 2EQDA 2OP4L 1JYNA 4DO6A 5DS2A 2MOVA 4HK0B 4K2UH 4JBSA 4U1MA 4B0MM 1HWHB 2E9JA 1U3HC 5CLWA 3STZB 1TEGA 5T3ZD 4G1EA 4ZS7L 4IJ3B 2KUTA 5A16A 2E8ZA 2FHBA 5TQ2H 3SE4A 3CDZA 3B4NA 2A74C 2FB4L 3ZJAA 2AJUH 3X13B 3MLSH 2WXLA 1Q38A 4AYMC 3U46A 2KKQA 1EAJA 1UUNA 1YEFH 2JKLA 1FNHA 4F91B 5E6ZA 4YK4B 3ZDZF 4A6YH 1A3RH 2EJ1A 1AQDB 2ZOWA 2VDNB 5IHUL 3PWUB 5D9SB 2OMBA 5G5DA 3OGCA 3SE3C 3FCSB 5EFIB 5I9QB 4OIIH 2JCCA 3PPSA 4R3SB 5HHXH 1FO0A 3WXVH 3GLZA 2J8HA 1TMCB 1HSBB 3P3TA 4UM8B 1ZHNB 3CFEB 4JGJA 3W3BA 4WRLA 4PJCF 1DBJL 4JO4L 5L9DL 1FG2A 3B5TA 5SWSB 1QYGL 4RCAA 3DXAA 5IHLB 3HRZB 4QHUA 1G4MA 2C9AA 1D5MA 5IQ9A 5HHOE 1HOEA 1FE8H 2X0VA 1AIZA 2F54B 1PKOA 5MHSD 2BVYA 4B3EA 2AEIT 3O41B 1HNYA 1TJXA 4ZD3H 3K81A 1OTSC 2OXHA 5DHYA 4LSSL 3P1VA 3DDGA 4YS4A 4FXKC 3OBAA 4K5MA 4D7PA 3UO1L 2PWFA 4P05A 5B38B 3JYCA 2DWYA 2LVCA 5AWNH 5L4MA 2AS5M 3AS2A 2OKMA 2D4FA 3JWNH 2NTFB 3LD8C 4CBPA 5IVXA 1I1CA 2GJZA 1LP9F 4OLZL 5KYUA 2DBLL 3TJHD 2FLBT 1JPSL 1SHMA 2HLFD 1PJWA 2X3AA 3KPTA 4WI9A 5ANHA 4GKNA 4J1UA 4MAYD 3PP3H 3NA4A 5F6IB 2VITB 4DPBX 3IDUA 5FK9A 3UTOA 1UYWH 4GRWE 4TQ8A 3F7VA 1NEZB 4PR5A 2WCPA 5DJCA 4J3OG 5C0CD 3O3BA 1FZOA 2B77A 3AMLA 4WNQB 2F19L 2YXWA 3FSAA 5EBGA 4ZUTA 2APBA 2GTWA 5AYTA 4UB0H 3C6LD 2E7BA 1P5UA 5DSCB 3DGGB 4TSBL 2F53E 3CHXA 2XV0A 4M3JA 2ISDA 1PNDA 1KXTB 3LEXA 3NFNB 4MA7H 3FB8B 2VDKH 3BGMA 4RMSA 1RJLA 4TLKA 2VDOH 2RR3A 4XP9L 1TIUA 4FJYA 2PYEA 5C0AD 2BVPA 3V0HA 4JG0L 2NQCA 4K5PA 1OO2A 1OPOA 2DKSA 4MJ6A 2E3VA 4N86A 2B14A 3AQXA 1Q9LB 4H8VA 4MTMA 3O4LD 1VRSA 3ELQA 3JWDH 2JIXB 5GRZA 3RUGA 4GQ9L 3ZE0F 1FZKB 1IKNC 4TNWF 2IH1B 2ZX8A 2NYYC 4M48L 5F0MB 1T2QL 1BLNA 1G7MA 4ZK8A 3WTUA 4HOWA 4Y5YA 1HL8A 1H3XA 3P77B 4Y19E 5DJXB 3OAYH 2YGPA 4ABVA 3U4BH 1CLVA 4UWQB 1MVYA 2LOEA 2P28B 5T1JA 1MG2C 1FSKC 4FQLL 4XO8A 1XMWA 3DRQB 3LNHA 1KLUB 1EANA 4M4PA 3V0VB 4HT1H 3BUYA 1RU9H 2J73A 3OR7B 2IG2H 1E2WA 4ZFGH 2XVLA 4KRLB 3WI9A 2ADGB 3D69B 2BK8A 2JKWA 2DH3A 3VD0A 1A6WL 5KYNA 3IJ7A 4X4XB 5BZXA 5B7MA 5DVMA 5C08E 4L18A 5C07B 2MCPH 1U93A 1U58A 2AQPA 5LXVB 2X3CA 1TCRB 3QC5X 3H7BA 3P54A 1CFSA 5D7LD 3QUZA 4O51A 4ZFZA 3CWGA 1OAQL 1PKQB 1QI4A 2P8MB 2MOQA 5DD5L 1QFOA 1K4CA 4B6ZA 1MFDL 1ZTXE 3TN0D 4OU3A 1UA6H 4NQCA 1J0KA 3RPBA 4NN6C 4UQ2B 4NM4H 3PL6C 1QZ1A 3G5WA 1NGQH 2FCBA 3BP4B 4GG8B 2JELH 4H1LH 2RBLA 3LNEA 4XBEH 5AAMA 5IEKA 4FA6A 4QYOB 2YHGA 3QXUA 3UZEA 1OM3H 2D31B 5E7FA 2YUZA 1P6WA 1E8XA 4M03A 1BAWA 3ARDD 1SN0A 1PEWA 3QYCA 4LE8A 2O6DA 2DQEH 1RJYA 1P0SE 4C56E 4Q0XH 1JYWA 4H8UA 4P5RA 4L8DB 5C0BA 2YD8A 3TIEA 4BGLA 4EIBA 2ZXDA 1JAEA 1X4ZA 4G5ZL 1CTOA 1M2VB 1R46A 2V8MA 3VA2C 1YRKA 1FORH 4JRXB 1OGTB 5KW9H 4NSKA 3NTCH 3WL9B 4BHUI 1MNNA 3HMWH 1ZT1B 5DA0B 3SDCA 3KPNA 1GKOA 3CXFA 3PFQA 4JG1L 4UYPA 3RDTB 5KBKA 2X53A 3TA3B 4G9FD 2HJLB 4O00A 4KDTA 3C5SA 1L9QA 4JFXA 3QHTC 3STLA 3IMRA 3E0GA 4NJAH 1CD9B 5F3HB 5F71A 3EJZC 5I0WA 1SEBB 3QDGE 4DGWC 3EYOA 3IJ8A 3DSNB 5KS9A 3U0PA 1QFUL 5H8DA 5LQBL 4JVPA 1W15A 2GJ6A 1UB5B 4FDWA 2QGDA 2NY1B 2XTJD 4HU2A 5I9QC 4I3RH 1ACZA 3PAZA 3ABMB 3KBHE 5D6DA 2QGCA 1K9TA 4N3TA 4BZ1H 1WAAF 1E2VA 5DFWH 2AK1L 5DVPA 1KEMH 3OKEA 1RIVL 3S48A 4CKQA 2JB5H 3EDEA 4WO4D 4YR6B 4Z7NB 4I0PD 3I84A 3AUWB 1CT8B 5I1GH 3VGDA 4RA0C 2WKLA 4IRSD 3WKML 3VYPA 4FABL 3RJDA 3RKDD 2L3BA 4HMCA 4XBPB 3HG1B 1D9KC 2R2EA 4MYWB 4OCRL 1FFPB 5DUJA 1VZGA 1EXGA 4LLWB 1BQKA 5IVZB 4BK5A 4MCMA 5D93C 4YZFF 2J7LA 5I6LA 3O3AB 4NYLB 4ANKA 2R4RL 4X5QA 3GHEL 3RVVC 3LEVH 3IGUA 2ID5A 1A02N 3WXWH 1A14L 4X9BA 1RPUA 2VDOB 2ZSVA 3GTNA 2WUCH 4MXWL 2YN3A 4Y4HB 5CEZD 2HVJB 2BS71 1GS8A 4ZPTA 4MQ7A 5AB9A 5T1LD 4CJ1A 1MIMH 5ALCL 1XCXA 4WFGE 1U30A 5ITFB 2CIIA 1KCLA 1PZ5A 2EVFA 4M9OA 5SWQB 3K6SA 4PY8J 3HI1A 4GLRH 4EI5D 3TPKA 3TVMA 2IJ0C 2ZXGA 3HUJA 3GMQB 2ZSWA 1BFVH 3V4VB 2VISA 3FCTA 5E7BA 3W9DA 1SVZA 2WBXA 5E9DA 4CADA 1C7SA 1ONQB 4MA1B 4FA7B 4LL4A 1JPFB 3QUYC 1DLFH 1IBHA 1GY1A 2IDFA 4WI2A 3J7HA 1URIA 2D2OA 1D2OA 4LBEB 3LIZA 1ZGLB 2FVNA 3ARTA 3BQVA 5JIPA 3DV6A 3MA9L 3MV01 3EGXA 3SD5A 1JTTA 2VE6A 3EYUL 3TBYB 5F1IA 2HKHH 3T6XA 3S88H 5FYKE 4ZTOL 3IE9A 2YQ2A 4GXUN 1NPUA 1PEZA 4PJAB 1L6ZA 5F88B 4DKTA 2CKBA 1ACYL 1XH1A 3G6JA 2BIMA 3BT2L 2EDNA 5TFSH 4WAFA 5F7FA 2HJFA 4A39A 3S96A 2X4QB 1TG8A 4R7DA 1ZV2A 4AQ8C 2HTKD 3BDYH 4ZX3A 2P8PB 4Z7UE 3BEVB 2IAMB 3LV3A 4HEPA 4NQVA 1BX2A 3APCA 1WS8A 3LH2L 4CMMB 5L8JB 1TZGH 4QTFA 1I1AC 3ULUH 4YHIB 3JYBA 2ZJSH 2O6CA 3NYKA 1FCGA 5I1AA 1Q0EA 3HNTL 1X4XA 3MJ7B 2VMDA 3SYAA 4IU3A 1CJYA 5LNDA 2NNRA 1XQ4A 2WQXA 5I8OL 3DSFL 4PJ5D 1KV3A 2MRYA 5D71L 4GKSB 5HGBB 1W8OA 4GEIA 1JF1B 4YDVB 3CMGA 1GTNA 5E1AB 2W07B 5CD5C 3EHBC 1P1VA 1AGCB 1V7MH 1WK0A 5L6YL 2WYIA 4G8GD 3D5OF 3VGGA 3QK0A 2ZONA 5D7SL 3LRKA 5JHLA 3CZLA 2JFCA 1J05A 2Y72A 1XEUA 1J5DA 5ESVA 4KKQA 1KELH 1ZVHA 1KIQB 2RQ8A 2ZWZA 2ZCKH 3GZOA 3RB7A 1ZK9A 1OSPH 4HGMA 5FV1L 1LMIA 1LVEA 3AGWA 4JO3L 3HPJB 2PP9A 4G43B 1DTUA 1NUDA 2QMKA 4K73A 2PWGA 4K15A 4JDTH 1LP9A 4GKLA 4J39A 2YOCA 1NQBA 3L9YA 3G5XA 3QEGL 1RULL 1C08B 4EZKA 3QARA 5ACLA 5IKCA 5F9WB 4YEEA 5IZ7A 4P4KD 4XVOA 1BZDA 4RZCB 2DQCH 2QFRA 2Y07H 4G8FB 5I6NA 1U2YA 1F00I 3LKQB 4PRHD 3ZE1F 1SMDA 2L0DA 2PETA 5TF1H 1JUFB 3T6VA 4FG6D 3QORA 2W94A 4X8GA 2RMNA 3L3IA 3FPYA 2A5UA 5FWRA 3OR6B 1BJ1H 1D7BA 4YFLF 3FQ4A 1ACCA 3ZTJG 4YH6A 4XXWA 3MUJA 2NY2B 1DBAL 1HWWA 1QNZH 2Y2WA 4ZFOB 4FGMA 3ZXAC 3ASOB 4NUPA 3V4PA 1DQDL 1TJIL 1IFHH 3B9VA 3B9AA 3TA3C 5D1XB 3AQZA 1WPCA 4DOHE 4NKQB 1AP2A 1FAIH 4JMNA 4A63A 1JHTA 1X5HA 4KBPA 1NGPL 2XBTA 4I5BB 3DUUB 1OCWH 2VZOA 4WY7H 5AYQA 4R4BB 3JWNC 1A8ZA 2G5RA 3HS0A 2Q6WA 3VMOA 4BEIA 2OMZA 2O5YH 2RACA 4ZMAT 1M71A 4AEFA 2H3NB 3G08A 2CK0H 4MNQB 4N90D 1I7RA 1NCNA 2QADB 3OG4B 2NY1C 4EKXA 1Q9OA 3MGTB 4M6MH 4PVNA 3UBHA 4G7VH 3L95A 3N0PB 3F7PC 1B2YA 1XB6A 2AXHA 4FCHA 3CDYA 2FZ3B 4HSAC 4WHTA 1WBXA 2RB8A 1U8QA 2FWOB 1TYJA 2ZOUA 4XMKH 4X6BB 5C07E 1RVFH 3S5LA 4NO2B 1KT2B 2BM3A 2ADYA 1CIUA 1RUQL 1LDPL 4AK1A 5B3NA 1BJ1J 4HWNA 3HE7A 4XAKD 5DJZA 4DVRL 4YPJA 4E9VA 2HXAA 4ZTEA 4GRMB 3HNVH 1ML0A 5DUPL 3IU4H 43CAB 5DQ9A 3H9HB 4RIRA 1O6TA 3NAAH 4PJEB 1ECYA 3K6OA 1RUMH 5F7KC 4NX0A 4R6UA 2YPKB 1DBMH 3NIGE 4JFSA 3K72B 5KUKA 2DS4A 1UD4A 2YPLA 5G4MA 2UVEA 1SY6H 2ORBL 1NCUA 3L6FB 2ILLA 1FC1A 4J3UA 3QZOA 1P7QA 4QRPB 1AQMA 3TLRA 2IPKA 5FCUL 1B2WH 3PHOA 4HH9A 2X41A 1IQDA 1OK8A 4IRZH 3TFKD 2CA4A 5A2AA 2BERA 5JYMA 1M7IB 3JWDC 3LVTA 3UTTB 3BUBA 3US9A 1YC7A 4ZYKA 5FB8B 4APXB 4FJ6A 4EN3B 1EA9C 3OPZH 5B39A 1HKLH 1KG0A 1VADA 5DZ9A 5KVGE 2B1OA 3KYOB 4UV7L 5EBWB 4MA1C 1U36A 1SXNA 2YGOA 1FH5L 3F6LA 5D7KD 1B4RA 1B9ZA 2HX9A 2XG4A 2GY5A 2R4SH 2HTLC 2YR3A 3IJ9A 4RWYH 4JHAL 4JRXE 1CVSC 4PJHA 4QKXB 2J57A 2O26U 3KDMB 1R19A 2BRQA 2F15A 3OWRA 3N85H 3NH7L 1IE5A 1Z9NA 4N8CL 3UJIL 2YQBA 3SHSA 4AC2A 2K6YA 4X5PA 1PVHA 1N0XH 3GSOA 1U8KA 5ALBH 1XAKA 1KB9K 4G6AC 1BEYL 5JOFB 4JCMA 4G42A 4K7FA 5BZDA 3UC0L 1C12B 1OARL 2PYFA 4M6OL 2E46A 4JVUA 4HOZA 4Q89A 2WZ6A 1YEDB 1PDKA 4OIAA 4R0LA 5EOTA 2WP3T 3GSRA 3QPXL 2YK1H 1D5IL 5D6CA 1K8IB 4HJ0D 5IQNA 1HI6A 2AAAA 1EHLH 4OF0A 3RWIB 4POUB 1L9SA 1XIWC 5G2NA 2IAMC 4F2MA 1IO4C 1ETB1 3MRDB 3OKLA 4UT6A 1GAFL 4NM8H 1F90H 4EQ3A 3B2MA 3LZFH 4ERSH 3N1MC 2WXRA 1BVLA 1JOIA 2XKNB 5TGBA 4FQCH 1S46A 4NO5B 3OZ9H 4HXBL 3MV8B 4XWGL 4PS3A 5AL8A 4G8EA 1R75A 3V8OA 2XBDA 2QQNL 1NLBL 2NCEA 4RGOL 1A25A 1JV2B 2CNZA 2YKKA 5DT1H 4J6IA 1WBYB 4YFEA 4KMTH 1KMGA 4LASL 1JZFA 2WQAA 5DEGA 3RI5K 1H5BB 2J12B 1JXJA 5CNHA 4YDKH 3P3RA 4JQVC 1HXMB 1FL5B 3HIZA 1XSIA 2MOGA 4I2XE 1LMKA 2V2XB 1QBLL 3HNSL 4KK9C 1YMHB 5I5JA 2MWCA 3ZSSA 1GTFA 3B3IA 3F58L 2Q8AL 2YBRB 3WIFB 4WW2C 2CU9A 4G82A 4NNXB 3HCVB 4H0LC 2DMGA 3C60A 1WGVA 4TLSA 2MQ0A 4ALAL 4DGVL 4WWKD 3CFNA 4G7YH 1TSHA 2FWSA 5A6IA 3B3BA 4K7PY 3FAXA 1JGUL 1P1ZB 1NGYB 4GUPB 5ESAA 5KVDE 1X5GA 1L9OA 3L08A 4QXTB 2Z4QA 5DD0H 4QHMA 5JORB 3DX6B 4JDVB 1IL1A 1N7ML 3PQYD 1JS4A 4FCAA 4F20A 5I5RA 5JXEA 4NRZB 5HI3C 4FKEA 3MOBH 4FMKA 2BLFA 2VCOA 3JVGC 4FQIL 1I82A 4M02A 2X9XA 8PAZA 4G7QB 3KPSD 4HIXH 3GQFA 2KC0A 4DSYA 2R29A 2ED7A 3SN6N 3HLAA 1OWWA 5GS2H 4M5YH 2YQGA 1HH6A 4NQDD 2OP4H 3NFPB 1T83C 1V3MA 2A9BA 4F24A 1OCCB 4X5WA 3RBSA 2B15A 1UKQA 1A6UL 2EEFA 4WU7B 4F7TA 3UZVB 2BX5A 1S9XA 3OM3B 1W72B 3BVNB 2WQSA 3LN9A 1VGKB 3CPUA 4LEXL 2FB4H 4Z7WE 1I7UA 4FXGB 4HJSA 2A3TA 4YHNA 1KLGB 1F6LL 4HC1A 2WBJB 3T2OA 2HCZX 1QQDA 2XX0A 4PVBA 5IHUH 2J1YA 2MQCA 1MHHB 1SJHB 4KTDH 4Q9CA 5IFJB 5FYJL 2I85A 2F9BT 4JFEA 1HHJB 3DX1A 3WEXA 3DTUB 3HB3C 4NB7A 4PVLA 1QSVA 2WWMC 3I9GL 3LHPL 2VLKB 3VJ6A 1PLCA 1R47A 2DBJA 3NZHL 5E1GA 2ATKA 1DBJH 3BPCA 4JO4H 1A6AA 1UH2A 1QYGH 2A77L 2V7HA 3PG2A 1UXLA 4XXCC 4JFFB 5E6SB 1UEMA 3QUHA 3QDJA 2DQTL 2QADC 4RDBA 5C0AA 4R4FL 4IBVA 2WM0A 4P9HL 4CSTA 1T89C 3QJZA 4QIRA 4LSRL 3VD1A 2HX7A 1AFVL 4GS7B 2YPVA 4M7LL 3T8VA 4YMPA 2CRIA 4HALA 4RDQF 4LSSH 1I8UA 3D3VD 5TTRA 4ODTL 3UO1H 2BVUA 4XAWL 5EBMB 3VAEA 4NKOB 1MFNA 3IDIA 5D1ZD 4HMDA 1VERA 3O9WA 3V55A 1GJIA 1XSKA 5EZPA 2OMTB 2EUVA 4HKBB 1JK8B 3VRJB 2DBLH 4BUHA 2DH2A 3OX8A 4E36A 3JWNG 5JOPD 3UBXB 4NQED 4PJDF 1A4BA 5EDSA 1M56B 5EIIG 2GEQA 2NW3B 4LP5A 4PGBB 1HYRC 1SBBA 3WJJA 4BE5A 3CDGB 4PJFB 4QF1B 4B9PA 1ORSA 4F7MB 1U8NB 3T0EB 3BLBA 3VMPA 4OZGE 1JNJA 2V9TA 4NKMB 1WF5A 3IBEA 4X8CA 2OJ1A 5E94B 2F19H 4KO9A 1FL3B 1LE9B 4FTVA 1MJJA 2APXA 1OW0A 4HJIA 4EMZA 4AQAB 3U6RB 4LLQA 3VXQB 3FCUB 4KNTA 1NIAA 4ZMXA 1CL7I 3ULUC 3QCVL 4NQSA 4L3AA 3GSNA 4OZHA 3WS6C 4YSTA 3TPUA 2L4OA 3F04A 3P0YL 1I53A 2IANA 1H3PL 2UYLA 4F37K 4XP9H 3FTGA 1XO8A 2AJZA 5AVYB 2Z4TA 3VXME 1MFVA 1T5WB 1S8DA 2DIBA 2R2HA 3EO0A 4UZSA 5LG1A 3RLSA 3PP3K 4OZ4B 2CDEB 1U8HB 2JB6A 3MUHL 1T66D 2BJML 3QUKA 3MDJA 4HWBL 2HFFA 1KTJA 3F6JA 3ZKND 3ARRA 3PGCB 4GQ9H 4PJ7E 3B43A 2HH0L 2P80D 1QD0A 4M48H 3QUXA 4HX1B 4WNSA 2VR4A 1T2QH 2CUIA 4K5NA 2YRPA 3MCKB 1TNNA 2NZIA 4LDEB 3WAKA 3B2DC 3IDMA 1N59A 2QR0B 2HRHA 4GRLD 3SKNA 4UBDC 1N64L 3IYLW 5AVWB 3VFSA 4F8LA 3BPLB 5BO1L 1XFPA 2NSQA 2AV1A 1T1YB 5E51A 5DVLA 2X4RB 3QIUA 1FNEB 2WV3A 4YHYB 5C6TL 4L29B 4OCMC 3SE6A 3MKGA 4K7PL 5IBTL 3L1GA 2EABA 2WB1A 5I1DA 1E28B 3EFFB 1CD0A 3RZCA 3DTXA 2FJGA 5MEOB 1A6WH 1TZIB 4YZWA 1SHXA 3B37A 4RAVA 5AAWA 1IBZA 1NKOA 4NP9A 1KCSL 4N6QA 1IM9A 4WV1A 5D1QD 5IREA 1WBZA 2Y3AA 1N6UA 4H2CA 5E8PB 4KFZC 5IGXL 5F97E 3IFPB 2R1XB 5EHFA 3OAYK 1HXKA 3DWTA 3GJEB 3GTVA 1OAQH 2FJUB 3BXNA 3OKMB 2LLGA 1KPVA 1CDGA 2KLSA 3R0NA 5IJKA 5DD5H 3RI5F 1FNFA 2AXGA 1MFDH 2W9LA 4QRPE 2FBJL 1AR1C 3THMH 1QSZA 3RPIA 1W8NA 1MDAA 4LLYB 3GSQB 1PF3A 3GSXB 2OZ4A 3VI3E 3AT8A 4IOSD 4D8PB 2DQFB 1K8DA 1XGUB 2DQHL 2YAFA 3D4ZA 4AKQA 2GBAA 1CXLA 4Y7MA 4H1LG 4RGNC 1QZNA 4JJ5A 1FFTB 2AJYH 1P7BA 4E9LA 1AXIB 4X98A 2CUHA 4NI3A 1XZWA 1R34A 2JTDA 1EO8L 1ZS8B 2YD4A 3BVDB 1P53A 3OKDA 4HUUA 4ORGB 2W81C 3CVHL 2BP0A 3QAQA 3IMWA 1TNMA 3C75A 1M57B 3VNZA 2BRRH 1N6QL 3T5WA 1FG9C 4DJMA 4TRPH 5A2BA 4G5ZH 3QZWG 4Z3IA 3UZQA 1KDJA 3ARED 2XQ0A 2DKUA 2Y7NA 3B1UA 5DRWA 3JV6A 2A74A 3S97C 2QL1A 2QPDB 3FT2B 4XWOC 4MJID 3SDDD 1PLGH 3C5ZB 1BBDL 5E6IA 4G1MB 1U9KA 1AYRA 2ED9A 4R5XA 4W6XB 5HYQB 1G4RA 1OEZW 2DYRB 4Q6IC 4IDJL 3RPKA 4UM9A 2JJTC 1SVBA 3WBDA 4OH2A 1M4KA 4RQQA 2AAVA 3SE3A 4HPHA 3KLDA 3RTQA 4KC3B 5IROA 4PWIA 4M56A 3CQQA 4TLUA 1F6AA 3FO9B 5GJTL 3REWB 4BELD 5LQBH 2HT2D 2JMRA 4YDJB 4F3FB 1UXMA 3A47A 3HFML 3B56A 4AVJA 4WEBH 4S0HA 5AOMA 5I82A 2OJEA 1BREA 1E9QA 4JO5A 3C09B 3MV8E 4P2QB 2YRBA 2NUPB 2VC2L 4F1SA 1NDGB 2AK1H 4MDJB 2QMJA 1RIVH 2A99A 1IC4L 1A8JH 5IW1A 1G87A 1SEQL 5HPOA 2FE0A 3AAZA 4C54A 3DURB 5ITBL 2CZNA 5IB2B 3WKMH 1YEWA 4FABH 1XF3A 4UTBL 5EC2A 1KV7A 1YUHA 4OCRH 1IGFL 5EG6C 3RVTD 4UT7L 5TE6L 4NFCA 4LCWA 4Z7NE 1JF6A 2R4RH 1IAMA 3GHEH 5IW3A 3LNGA 3UGXA 1EEQA 4I9WD 2ERJC 1DVZA 1AJ7L 1CG9A 3QRBA 3VWKD 4MXWH 5JHDD 4B53A 2KT6A 1LGVA 1GY2A 4X83A 2WGNB 2PCXA 5KSBE 2IFFL 3CSGA 1OOWA 4PV9A 4OSUL 2VSKB 5ALCH 1I8MB 1KBBA 2HAZA 3L5IA 1IFGA 2VQ1A 3MRFA 3H4FA 2B20A 4UMGA 3L9BA 1NDTA 5KVMC 5BS0D 3ROOB 1WTGT 1BZQK 4QEGA 1M2OA 4OGAD 1ZLWK 3Q05A 2XV2A 3OMZA 3TBSB 2KHAA 2XSKA 1L0QA 1VB9A 1ZE3H 2AK4D 5JPMA 1IBBA 3IT8D 1V3LA 3D7PA 3BWAB 2P9RA 2FJFB 2DEWX 1LO0L 1P9MC 1WA2X 2DWDA 2QDVA 2VNCA 4U1KA 3VXUA 1IAII 3H42L 2X89A 4XP4H 2WBKA 2UWEA 4XT1C 1VA9A 3MMEA 1J5OL 2H9GA 1RHHB 4FQQA 3GMPB 5JLZA 1S7QA 4ZTOH 3V79C 3ARBD 1SJEA 3ARFD 1OAYL 1D6EA 4B9YA 1K2DB 3CVIL 3OSVA 4N2AA 3BN9C 3SDYL 2ADIB 4MNHB 4TOYL 2YFOA 3BWZA 4PRBA 1ITCA 4Y8AA 1NL0L 3OKOB 4NZRH 1IKNA 2PO6A 3VVVA 4ECNA 2R9HD 4PMFA 4NUMA 4PJ6A 2Y1VA 2KL6A 2GCYA 4WFFD 4AL8L 3DX9B 3S0PA 2WMPB 2UZIL 3LH2H 1K5WA 1SBSL 4LCVA 4RISH 3SGJC 4P57A 1E9PB 4UTCA 2ATAA 1NC2A 1NAML 4WUUB 1BF5A 1D5XB 3NUKA 3HNTH 2F0CA 4XZ4A 2ZWLT 4M1CD 1T20B 2QZ5A 1MDTA 5TK4A 2YD9A 3NZ8B 4AEEA 5LB1A 2KBGA 3JUYA 5I8OH 1MRFL 1KIRA 2W59A 4Y4KB 1AMYA 1UACH 1W0YT 3OTTA 1CGSL 2X2YA 1E65A 1DVFC 3LAFA 3MREA 4I77L 1RQ5A 3FQ2A 3I3DA 5L6YH 5EOCL 1QBAA 4I7ZC 5JA8B 2B1AL 2RALA 3R19A 5D7SH 3PWJA 5ISZD 2QQLL 4MSWA 4CW1B 4PY7B 1T7ZA 3MNWA 4YBLC 1WYJA 3ZN6A 3NCFB 1QWNA 3QNXA 3GPSA 4OFVA 4KUCF 4JO3H 1HOCA 2DEYX 3C6SB 1LO5B 4PJFE 1IM3A 1IAOA 1NGWB 2YD3A 3PL6A 5JOEA 2BWDA 4Z0XA 5AUMB 2ED8A 3AGVA 4ONOA 3C9NB 4BWTA 3WLWC 2DLEA 3WFCL 3WS3A 3QEGH 2VLRA 4MKTA 5DEFA 5GGUB 1MRDH 4LOVA 1ASOA 4FYTA 1M1XB 1BAGA 2R69L 1Q9KB 3IGAB 1BD2D 1BPVA 1LO2L 3P02A 4DPAX 1NC4D 3CXDL 2H6PA 4HFWA 1CFNB 3FQWA 3BVXA 4HS6A 2FO4A 1HCVA 1TITA 1D3CA 2CHDA 3OVUB 3VRLF 1ZLDA 3BH9B 3VXRD 3D25A 5JUEL 1C5DA 3FB7A 4PJAF 3TCLA 3KCWA 4M4RB 5G55A 2X4NB 4E5XA 4FFWC 1MVUA 3J07A 5TQ0L 5I19L 1BLIA 1L7IL 3W0WB 4CAGA 4KMLB 3NN8A 2OQJA 2YAPA 2EDHA 3I02A 3FO1A 1DQDH 1TJIH 3GRBA 4AIXA 4PM1A 3QP3A 3KS0J 5HYJD 3T8XA 3O0LA 2YMXL 4IGBD 4WU5A 1NGPH 5EN2B 1XGQA 5INCA 2F8XC 4QXUL 5HPMA 2X5PA 3I9IA 4AYBA 1PZUB 2IADA 2WO3B 4M61A 4XMPL 2ENPA 1QLRA 3FFOA 4Y4FB 3T09A 3FN0L 2JNKA 3POHA 5DHVA 4ZMLA 1E6OL 3QCUL 3AQDA 5HI4D 5I16B 1CTMA 4TVPE 4F7EB 4UNIA 4APQB 4WSGA 3SCMB 4ODHL 2VTFA 5TDNA 2EDBA 3BGFC 4P5TD 3L54A 4XNXL 3WY3A 1UASA 4TV3A 3QEUB 1OGAB 1JGEA 2K9FB 1D9KA 1U8MA 1P5VA 3AZUA 3DX7A 1RUQH 1LDPH 5IMMB 4H5SA 1BFOA 3L3GB 4DVRH 2GT9B 3O3DA 4ODUA 4DETA 1A9EB 4CC4C 1R3HB 5DUPH 1OHZB 2GTQA 2GUYA 2NT1A 3HZVA 1NCBL 1CI5A 2WVVB 4GXUM 3L9EA 2KPWA 4CMHC 5CSZA 5GGRB 2V33A 2XA3A 4PTUA 1BA9A 4WDIA 1IJNA 2Z0UA 4QO1B 4JRLA 4N9GB 3S3BB 4YDZA 1XGZA 2HG0A 3L3OB 2ORBH 2R59A 4M8UA 1SRDA 3IF1A 1PX4A 1F0LA 5FCUH 1FVEB 4K94L 3VH8B 4PJ9C 5ELIA 1CXKA 3RWHB 4AENB 4F27A 1SYSA 4KJQC 2H1XA 5DMGC 3VFVA 4H25A 5AOLA 4XOCA 5E03A 4MNGA 3ATAA 4UQ3B 3QUYA 3QJOA 1MWAA 1N4XL 2BOLA 4JDEB 1IBFA 4PGDB 4UV7H 4Q7DA 4C47A 2VN4A 3IDNA 5LCVL 1IC5L 1FH5H 3MQIA 5C8JB 3UOAB 5AKVA 1P4LB 4Q14A 1MNUL 3ABLB 1KJVB 5IB3A 1TEYA 2EKSA 4IRJB 3FRUB 4U1IA 3II2A 1J12A 4HULB 5I6OA 1GZPA 5J13B 1T2JA 1VKXA 4ZXBA 4JRYB 2NX5B 1NZRA 3UJIH 1KGXA 1WA1X 2CLRB 2ZAGA 2R23A 2XOTA 3BUTA 5GHWL 2NXYB 4CA4A 1DVXA 1O7VA 1Z32X 1MFEL 3ZR6A 2D3NA 1BEYH 1ED3A 1AXSB 2P5WB 4IHOB 3HC0B 4JN2A 4M6OH 1XZ0B 5F9OL 1S9KC 1TKWB 3U6XA 4AQ8A 1QOKA 5JW5A 5H94B 3O8XB 4ODWB 5C0DA 3NFSL 3FFDB 2VXQL 3QPXH 2G75B 1D5IH 2HRLA 4JFPB 4J28A 5D7JB 5ILTL 4IDLA 4NERA 4MB3A 1ICTA 3FU3A 3QWOB 1L6XA 1HT6A 1I1AA 1QWUA 1MHCB 4L4VB 1G7IA 3DPBA 3D51A 3KPSA 3O6KL 4ADIA 4HIQA 4P2QE 1GAFH 3CXHJ 4P06A 3NRQA 3Q01A 5GGSA 4BFIA 1YEEH 3VSTA 4JO1H 4EUPH 3HMXL 2AKRB 3VFNB 4EXPX 2NQ3A 2CE6A 4BSJA 2QQNH 2CSPA 1VGEH 1NLBH 1S78D 1OB1A 1MY5A 4RGOH 3PCYA 4Y4KC 1KGUA 2PW2B 1QSFE 1K4DA 2X9WA 3IFNL 4I18B 2FEDC 5DRXA 1VJSA 5MERB 3EYVB 3H9SD 3GI9L 1NMCB 2VDLB 4ONHB 5KSVB 4PJEF 1ZLEA 1AGDB 4BINA 4XO4A 3DVNB 1OT4A 3D2TA 5CP7A 4AVIA 4LLVB 3HNSH 2AZUA 5TDOB 5AENA 1RK1B 2VW6A 3BPNB 5LG6A 1NOAA 3CZGA 2VL5B 3L3HA 3F58H 2DWEB 2FJHA 5ETUB 3LVEA 2X4UB 4PS8A 3ZYOA 5C0JB 4OD1L 5ESQA 1IKOP 3W11C 1XVSA 4FL4B 4ALAH 3HC4L 1DVTA 4DGVH 3LIUA 5JDSB 1KN4L 4IBQA 5DI8B 4AXWB 1JGUH 1F11B 1ULVA 3DROA 3LN4A 4OLUL 4CVZB 3IVKB 1W0WA 2H0EA 3S3PA 1XGPB 2C34A 5DJ2A 5F3BA 3DGCR 3WHE1 4A6YA 2O93L 3BGAA 5HD8D 5HHNA 3SYQA 1YNTA 4U6YA 3ZOAA 2CRYA 3UAJC 4FQIH 4GSRA 2C1PA 3MZTA 1JN6A 4AOFA 5A7EA 3O45B 2K6ZA 4LU5L 4L8CA 3MOQA 5IV2A 3ESOA 4UNTA 1I9IL 1V55B 4PRNB 1Q0YH 4HBQA 3TWYA 4PWKA 1RH8A 1QRND 1MCFA 4HPYL 1KZQA 2FQGA 4FFVD 3SDAC 1A6UH 5LGYA 3APDA 1FDLL 1WCBA 5CCGE 3KM2A 3L48A 3ULAB 2BC4B 4LEXH 3X2QB 3E6HA 3HS8A 2R15A 1OT2A 3LZRA 4K3EL 1EXHA 4U0RB 3IJEA 3RAJL 2AZAA 5A3IC 4PU2A 3GXDA 4XNQA 1ZVSB 1JGLL 5K9JL 2DTMH 3FONB 2IIJA 2ZWSA 3U0WL 2RQEA 4XVJH 5FYJH 4OUUA 4HGKC 3C2SA 5D2LE 5INDA 2J2ZA 1FZJA 4KFMA 1BM7A 1RP9A 5EIIA 3I9GH 3NGBB 4N8VB 3LHPH 5DRNA 2ZUSA 2VUYA 3PABB 2OK0L 5KVDH 5F21B 3NZHH 4NO3B 4QT5A 3BAWA 4Z3GA 3DO7B 4XVUC 4PWEA 3A0OA 4R2GB 4OKDA 4FKKA 4GMSL 2PPAA 1MAMH 2HRPL 3UGUA 2NZ1A 3FB5A 2VLJD 4M3KB 1I1YB 2QSTA 1FRGL 4R4FH 4P9HH 2XA8H 3T4YB 5HVHC 1DUYB 1K3ZA 4JFDA 4LSRH 2VXTL 3WGUB 5IG7B 2XN9B 4NKIL 3F00A 4OCSL 2ICEA 3MV9D 4M7LH 3V4LA 3MJ8A 4Z18A 3O2DL 1ZE3C 3QDAA 3U7YH 4HWZB 5J1AB 2DQ6A 4RESB 1CYGA 2C3WA 4U1GC 3SQBA 2P80A 4HP5A 3PF2A 3QO0A 5HDWA 4KZDL 1FCCA 5FF6A 3HVDA 3QPQC 4PCSA 2XG5A 2EVJA 3UL4A 1TZHA 2FATL 3UTZB 4OF7A 2B9BA 2DJ4A 5JMOC 4Y5VA 4BFKA 2R0KL 2AJXL 2FR4A 1HHKB 3TU6A 1U91B 1YHPA 1N2RA 5I1CL 5IW6A 2D3VA 4WTXA 1O9VA 5AW5B 3ZQWA 5GS0D 3T2PA 4NQTA 3EJYD 3D85B 4IMKC 3VXOA 4YBQC 5HYIA 4E9RA 1DN2A 4X6FB 3JQOB 3OG6B 5AB1A 1LEKA 3HBQA 2O6FA 5C70A 5D7EA 3QCVH 4KK5C 2WUBL 5CJQL 2VMEA 3H7LA 1CGTA 2NY4B 3P0YH 3HPLA 2G5UA 5EEUA 1H3PH 4WO0A 2UXTA 3QPKA 1SFHA 1CK0L 3AM8C 1M05A 4ENEC 1YA5A 3W0WE 2B0SH 3NK4A 4KKLD 3W2DL 2F5BL 1KC5H 3JTSA 2MFNA 3GDBA 1BOGB 3JV4B 4YHLL 3RNKB 1KCBA 1Y18B 2BJMH 5EZJA 1Y7VA 2A6DA 2JJUA 4HWBH 2VAAB 4N0UE 1R3KA 2HX8A 3DMMB 3HE6A 3TZVD 1JWMA 1MXGA 5AG9A 1R6VA 4KKBC 2WKOF 5SX4I 1AKJA 1HHIA 4Y1AB 3ARGD 4OLXL 2IQ9H 2X05A 1XIWA 5C6PB 5EUOB 1BECA 1RZJL 4E0RA 1MFCL 4JQXA 2VDML 3NJKA 1IGIL 2OI9B 5DMKA 3ZPDA 3KPPB 3LQZA 1YZZA 4L23A 3MRKB 3E6FB 2IALA 3MVSA 3GIVB 2EIDA 4LMQI 1OGAE 4K7PH 4H1LA 2BNRB 1OD9A 2CR6A 4FLSA 3EYFB 3QIWD 1AO7B 3LIZL 1MVFA 4RSYA 2HG5B 1TTGA 1A1MA 1SMOA 2DL9A 1CL7L 2XJKA 3SKMB 1DQJB 1LE5B 3O6LL 5IGXH 2Z8SA 5T1KD 3DNKA 2ZICA 3QZWA 4PJGE 3KLSA 3P0VL 4MHHG 1A4CA 5HDBB 3WEMA 4WW2A 4F80A 4PJFF 1G9EA 3KLAB 1E4KA 5KN5A 3HG5A 4MA8L 4MS8C 1ZIAA 4NIYE 2D8KA 2HN7A 3D39D 5I74C 3TGXA 3EIFA 2FBJH 5MENB 4ZJ9A 4DKEL 3EAKA 4HXAL 1NCAH 5CBEB 1U3HD 1WFMA 3Q9PA 5A2KH 1LTXA 4J4PD 4YGVB 3FT4A 5A6MA 2Y5EA 2Z92B 3BYYA 1VCBC 3EDFA 3I9AA 1HESA 4JQIA 4QY8A 3QJUB 5E2UL 3JVGA 1PZCA 4QCIB 1CXFA 5I1HL 4HDIB 3MRGB 1EO8H 2WWOA 1MW1A 2H8PB 3K4ZA 2BMKA 1ASQA 2XWCA 3WUWG 5LGKA 3CVHH 1BVZA 4NUQA 2MCG1 5AD0A 3ESNA 1YPZE 1KPUA 1C16A 4GSUA 1T83A 3IDYB 3LRGA 4GAYA 2E9GA 2A0LC 2NX5E 1B0WA 4X4YA 4BZ1A 4AT6B 4ZTPL 1DEEB 3V4UL 3H56A 1DAQA 2BSBA 1FUNA 2XWBA 5E6YA 1YNLL 2Y23A 4GBXD 4Y19D 5BZZA 4Z7OB 3OKKA 1CBVL 5I1KL 4FP8L 4BWWA 4DGYL 1A7RH 3MYJB 2YD6A 3KPRA 3KXFB 3BHBA 1BBDH 4K23H 4ZO6A 5F6HI 3PWNB 2CCLA 4YOKA 4IS6A 5LUMA 3FF8A 3PNWA 3MRHB 4U0RC 4DZ8B 4IDJH 4OZIB 5BMFL 1JK9A 4L4VE 1U8JA 3IE4A 4XZUB 1LK2A 4W6WB 1KBWA 2VIRA 1MI5D 4QRQB 2J6EH 3S7GA 5A2JH 2O61B 4WEUD 5DJYB 3HFMH 1T21B 4R4BA 1JD7A 1HH9A 2XUWA 1ZWIB 5EH1A 1MQKL 1Q90A 3WJLC 4XXCA 2ENJA 4AG4H 2VC2H 4RBPH 1PQZB 3L45A 3SJVB 3BH8B 4P2RA 4PRIB 5DFAA 2FWUA 1IC4H 1YUKB 2OYPA 1SEQH 4O4YL 1T0NB 4ZOBA 1TLMA 1YMMB 4MDIA 1ZAGA 2BIHA 5ITBH 3CDCA 1FH2A 5FO7B 4U6HB 4XR8C 1XR9B 1JYXA 5E4EC 4GUCA 4UTBH 4HZLB 1TXKA 5EC1B 5M94B 2PCPB 1IGFH 4IBUA 1QLEL 4F8TA 3VFWB 2VN6A 5FGBC 4UT7H 5HDRA 4KK8C 4HGWA 1ORQA 5F0PB 3LX9A 4KKCC 2FX9L 2XJLA 4R96A 4GMTL 5LGHL 4WK0B 1R3LB 4PRPE 4DZBB 3RNQB 4QOKA 3U2SA 1VFBB 3GYRA 3GO1H 1J8HD 1RFDH 2IFFH 2CMRL 3NABH 4P48A 1KJ2H 1X5LA 1BVKA 4PJ8B 5C09D 3V4PL 4L1DA 2C7UB 4RMUA 3A4DA 5EF0A 3ZUCA 4PJIE 4GAGL 3ASWA 1I9EA 3BQUA 4PWGA 3IFOB 3UJJL 3PXLA 4LIQL 2OM5A 3PWPB 4HWUA 3ALXA 3X1FA 3PGDA 1M42A 4PJXB 4Q9RL 1LO0H 3RGBA 4JW3A 1F3RB 2NYYD 3B9EA 1UB6B 3HKFA 4S0SD 2JKTM 1ZLSL 2GHZA 5CS7A 3PHAA 3WEOA 1A6ZB 3WS6A 1ZY9A 2Z91B 3SGDI 3ZKMC 3GSWA 3DI3B 4F8PA 4K7PX 5C0ND 2FYVA 2Y06H 3WO4C 1S7UA 3APFA 4XHJD 3DARA 1DJSA 1J5OH 3FSWA 4YHKL 4OCLC 1EXUB 2NDGA 2VR9A 3EOTL 5B4MC 1SQ2N 1QW8A 5IIEB 1L6PA 1UJ3B 4L4TA 4FQXB 5F7WC 2VSMB 1K6QL 3E2HC 1N3NA 1QSEA 1FNSL 2P43B 3CVIH 3SDYH 1HKFA 4TOYH 4RMQA 4V1DA 1SF3A 5HY9B 1E7VA 2CDGB 1NL0H 2CGYA 3Q1EA 1LJMA 1AZVA 1ZHKA 3VRIB 1NMBL 5JNYB 2YSTA 4JY5L 1N5YL 1TVHB 1V05A 1DQKA 3SKOA 4YWGL 2UZIH 1JWUB 4OFYA 1IZJA 1SBSH 2E8YA 4WI4A 2P5EA 4WLCA 5FKAA 2ZOTA 4WF7A 1NAMH 3L1EA 2Y25A 2V5MA 3BSZA 4FQHB 3H2QA 2CO7A 1AG0A 4QHLB 3QIBC 5E1QA 5C2UB 4M8QB 1A65A 4PQXA 1WZAA 4ALAC 3QJXA 2IV9A 5K69A 1MRFH 2HVBA 4J2QA 4BUGA 5C0FB 3RX9A 1SPDA 4PBVC 2W0FA 1CGSH 1O9WA 2R51A 4I77H 5FOBB 4URTB 3V0AC 4LRNH 3RVXD 4WEMB 5GXBB 4U3CA 4M6AA 5EOCH 5AZEL 3ULVL 5A40E 2B1AH 3T77B 5CZKA 4YSQA 2QQLH 3ARPA 5EU6D 4MMYA 1EZSA 1NEUA 4PB9H 4H7VA 3U1SL 4MJ4A 2B08A 4DQOL 2V6HA 3GMOA 5E2VL 5AEAA 3A4AA 3AY4A 5ICUA 2XFGB 4N8PA 5FEBA 4M8RA 1INDL 4N3UA 5ICZA 3BIKB 1XR8B 3AG4B 1YQVL 3W5MA 3N06B 3ECUA 4MWFB 5E6UB 1HYSC 4NC2B 1UWGL 4KZ0A 1MH5B 4JKPL 4ZFFA 4O02B 2NUTA 3WFCH 3LH8A 4JM0A 1BAFL 4YE0A 1OKEA 3U30B 2R69H 4UT6L 5I73C 5MHSE 5HDOA 1BVNT 3US0A 1JXFA 3MO1A 2D0GA 3ZHKA 2BCKA 3CXDH 3E1F1 5D1ZI 1KGWA 5KVFE 1JJUA 4AYID 3R1GL 1ZS2A 3EG9B 3EJZD 5T3ZL 3UROR 3BZ5A 5ICXA 4ES9A 2WCSA 3Q0HA 5EOCJ 5HJBA 1HWGB 3H85A 1Z66A 4LCYB 4I48B 3FNKA 5JUEH 3IEAA 2FX7L 3IDYC 1I7TB 2O6PA 5BUPA 1L7IH 1E3XA 3HG3A 4KXAA 1RZKL 4OF5A 1AACA 4P9HC 5EIVA 3WOVA 2EXWC 4ELMB 5SWSD 4TS6A 2BFGA 4XI5C 5EORL 3SPIA 4Q6IA 5C0CE 3QZPA 2F54D 3AY2A 1LILA 2Q76A 2JJTA 4Y1AE 4JE0A 2EINB 4GB9A 2A4ZA 2YMXH 3FQRB 4PYHA 4TNGA 3B6SB 2WXJA 4QXUH 5EMYA 4WTZG 3Q3GA 4JG5A 2TRYA 2X70B 3II1A 3ZSTA 5F1OB 4XMPH 4TNEA 4GKZB 1ETZB 3FZUD 3SEPA 3EO1B 5TE7L 3UTSA 2GBTA 5H2BB 2CO3A 1G7LA 1E6OH 5D72L 2C3VA 3LQAH 3OF6A 4AM0B 1SY6A 2P26A 2BNRE 2QSCL 4OIBA 4TMPA 4L8SC 3NJLA 1QR4A 2BZDA 3R06A 5EZLB 4HIEB 4N0CD 1AO7E 4IRZA 1QHOA 2JLLA 2VH5L 2HPTA 5JPNC 4KHXL 4A04A 4L1TA 3O4LE 5C1MB 2C9SA 1XD0A 4EXKA 4AIZB 2PKDA 4BQ9A 3I6GB 3AROA 2VLLA 3ARVA 2PXYA 1UENA 4PUBL 1WFNA 4HG4K 2RD0A 3FU0A 4A7GA 1GGBL 2XBZA 2X38A 5DS1A 5GZOC 1WSST 4P46C 1G6RA 1NCBH 4UDTA 3WGVB 2F5AL 3HG4A 1QATA 3CAFA 3D2UB 5HHQB 3W9EB 3X11A 4A1RA 5CJXC 4KQ3L 2VRQA 4GH7B 5FCSH 3HAEA 1JZGA 1UOWA 1J87A 5IVNA 3RGVA 2A83A 3T3PB 5FA3A 4K94H 2F18A 2Y7LA 3C12A 5JIMA 2EDJA 4AGMA 1AY1H 3BO8A 3L7EB 3RWFA 1UD6A 3DJZA 4S2SB 4JK0D 4NQXA 1KEGL 1BQHG 5IHZA 1N4XH 1P9MA 4H26A 3P4OB 2WK2A 1UWYA 1UT2A 5LCVH 2JIXD 1NAMB 1G43A 3VFUB 4C4KO 4ANUA 4O2FB 1MNUH 3L4ZA 4B9ZA 4JKMA 5D7LE 1U8IB 2KDGA 2VR3A 1QVOB 1A66A 4Y1TA 4JANB 1VF5C 1IEAA 2IDUA 2Y2TA 1AG6A 2YQ3A 1RL1A 3WE6A 4Z7OE 1FI8C 4X5LA 1X5YA 3WTWA 5GHWH 3C5XA 5FYLE 5BRZB 4PLKD 1WZ1H 5CJOL 2ZAIA 1OOAA 1H15B 4F5CA 4OZIE 3MLXL 3UAFA 5F9OH 4IOFD 4D2NA 4QXWA 2Y24A 4TF4A 3RG1C 3CXHK 3LDBB 3NFSH 4K5OA 2VXQH 5ILTH 4Q97A 3QZNA 2VN5B 4QYAA 3TT3L 1EHXA 3P30L 4LT7A 3SGJA 5F8QC 2IWEA 2EO1A 3O6KH 5C07D 2XC8A 1RK0A 1QKZL 3H8NA 3QFJA 5F9JA 2Z93B 1OQOA 3HMXH 3FPXA 1XGRB 3RIKA 3N5AA 1RZFL 4HUMB 1ZT4B 1YMME 3FT3A 3FQUA 3LRHA 2GSGA 3MA7A 4YL4A 4JFHE 3GRWL 3OSKA 4EUPG 1LEIA 1RD6A 4XE5B 4XODA 1Z3GL 5DVKA 1DVFA 3VXSB 3QI9A 4A7SA 2LAGB 3A23A 3L7FA 5DK2A 5GISL 3GSNL 1KULA 3IFNH 1J11A 1LQSR 4ABUA 2HJKB 3GI9H 3GSVA 5I66A 2ZKHL 1A5FH 3Q2CA 2X7LA 4Y16B 4U3SB 4LKXA 3M07A 3PWVB 4Q58C 4DWHA 5DMYA 5DD1L 3VWJB 3VMNA 4AE1A 1CDHA 4HSQA 4KTGA 1HQ4B 3SPGA 2XTJE 2NLJB 2NCMA 3MNVA 1EDQA 5JHBA 3BE1L 3GGWB 1CDIA 3ET9F 3HC4H 1KXQA 4OR1A 4PWFA 4OZFB 1FYTB 3FU8A 1KN4H 1G0XA 3MRLB 3T8MA 2Z31B 4FLQA 4G83A 2VYRE 1MPAH 1JGVH 3PWPE 2EIJB 5E5MA 1KIUB 4JRXD 3TEYA 2X0UA 2H41A 2F08A 4QXGL 5AB2A 3QCTL 4OJFL 5L4FA 3L5JA 3U30C 3RDTD 5KSAC 5BXFB 3MBWB 4LL1A 5EEZA 1B0RA 3TA3D 5ES4B 2ESVB 3BI9X 3VGEA 5K9OA 2FIKB 1UCTA 4OLWL 2YAHA 2OPCA 4LU5H 2BW5A 3DBXA 8FABA 3ZL1A 3GMRA 4UCFA 3GBNL 2G5BB 1I9IH 2FUQA 3MX0A 5DYOA 5GRYA 4KNQA 2OCCB 1OY3B 1G1CA 1NBYB 4HPYH 5CEZE 3QISA 2LE9A 4ZMOA 3MV7B 1FDLH 2WKGA 2EDDA 5J11C 1UKSA 1KPRA 1XF4B 2NY1D 5AW2B 4F7CB 2J8UA 4I1PA 3IKCB 4XPAL 3FSVA 4K3EH 1TTAA 2GC4C 1L7TL 3RAJH 3BOVA 1DQIA 4U1MB 3LXCA 5E5RB 3JTTA 2EDLA 5F7LB 4G1EB 1JVOA 3JZ7A 5A16B 3U0WH 3VQLA 3CDZB 1J1XL 3CUPA 5JIQA 1TOXA 5J6SA 2HT4D 3HG1D 1ZRUA 1U6AL 3U46B 3K6IA 5EU3A 1L0PA 2OK0H 2CHNA 1NFKA 5G5DB 1F1AA 4HAFA 5EU4A 2PW1A 1WIPA 3OGCB 1ZSDA 5AVQB 2JCCB 4KMQA 1FO0B 4Y4HD 4OJYA 3CHOA 1FRGH 1RXLA 3M86A 1H6TA 5FYJU 3TO4C 3N2JA 1CF1A 2VXTH 4HISA 4WI0A 4OCSH 5K9QG 1FG2B 3H2PA 3O2DH 1NPJA 3DXAB 5FDWA 2QPEB 2EEAA 4KUCD 3RIFK 4QHUB 4TN9A 1D5MB 1P4UA 5IQ9B 1BF8A 1TQBC 3BAKA 4W9FC 4CC4A 3ZO0A 2OMNA 4J12A 4ZO7A 5HHOA 3D1MC 1A3QA 3B5GA 4JFYA 3A6BL 4KZDH 2EZ0D 4GG6E 2YEQA 3ZT5A 2TRHA 3F83A 5DHYB 2OXHB 3F85A 3Q2VA 5B21A 3DJTA 4L0ZA 5KVEE 2WNXA 3GNML 2ZXAA 1HS6A 4L48A 2R0KH 1FHGA 3DHMA 5IBUB 2Z7WA 1E5YA 2G4GA 3BLPX 3CMOH 3UIYA 4PJ9A 1XAUA 1SUHA 5H37A 2BH0A 4PJ5E 5IVXB 3EF7A 2GJZB 4KJPD 5I1CH 1MLBA 2QHRL 5J4MA 5KYUB 4RMWA 1CICA 4JPIA 3V9FA 2W60A 4R5VA 4GKNB 1MCJA 2QV2A 4G6AD 4J1UB 3RL1A 5FK9B 4TLTA 1AS8A 3I9PA 2VXSL 3R7RA 4OGXL 3V8CA 3KYMA 3F7VB 3L3JA 4PR5B 5DJCB 3WKNA 2WUBH 5CJQH 2XNAA 3O3BB 1FZOB 3B2XA 4U7MA 1NIEA 1X5MA 1I3GL 2IAMD 3CK0L 4ZUTB 1RJZA 3RVWC 2GTWB 5DJ6A 1QI5A 1CK0H 2VWEE 1P5UB 3QWQB 1ZT7A 4XNUL 3SKJH 3LEXB 3NESA 3IDGA 2F53A 3MPCA 1E8ZA 1KBVA 4YHLH 5CINL 3RYMA 3BGMB 3Q8BA 1RJLB 2OR8A 3ISYA 2ZKMX 1IT9L 2BNQA 2EDEA 1G0DA 3DJ9A 2PYEB 4HMEA 2BVPB 3ZYIA 4YPGA 1ILSA 2Z8VC 3FHQA 4D8OA 4MJ6B 1OF2A 2IGTA 4OLYL 4ISVA 1BFSA 2D3LA 3FOLA 3E1ZA 2Q7YA 1RZJH 4PRHE 2WQVA 4UF7C 4B50A 4GO6B 3RUGB 4CGTA 1XT5A 3BKML 4G7SB 4KK9D 3CSYA 4LVOC 5AOJA 1QG3A 1GYVA 1CFVL 1BLNB 1G7MB 4LP4A 1CS6A 3P9WB 4Y5YB 3BKCL 4Y2DC 1ANUA 4PW9A 1AE6L 3BMVA 2WVUA 2APVA 4LMQE 1KCWA 1KCVL 3X12A 1BXAA 2GJPA 2QPFA 4H0GA 3PJSA 3WUWA 1CL7H 1SM3H 4RGMC 3BUYB 2IPTL 4HJGA 4EO5A 4KI5E 1NBVL 3MLPA 3O6LH 4Y5XC 1H9VA 2WIMA 1DQLL 1RI8A 2HMIC 1O5PA 5FECA 2FSDA 2B7DT 1JGDA 2DMBA 3DVGA 3P0VH 1LWHA 4ODSH 5AYUH 3V7AE 4P3WA 4PBWD 1Q0XH 5G4OA 4UZUA 4NC0B 2DMKA 1L0YA 2K3HA 4MA8H 4Y89A 1U93B 5F70A 1U58B 1XCTA 4BQ6A 2E4FA 2JH2A 2ZG2A 1XGYL 5C08A 4HXAH 5IMLA 3TNNA 3GZQA 3H7BB 1CFSB 5EO0A 3GXMA 4IK7A 4F58L 1MCOL 4X6CE 4NZJA 3OV6A 3QUZB 4O51B 4ZFZB 3ZKSD 2CO1A 3LS5H 2Z31C 1K4CB 1P4BL 1A6TA 3T6WA 4FA8A 4NQCB 4LGSB 3ZDXB 2AW2A 5E2UH 1NANI 4WI8A 5I1HH 2X1QA 2NY2D 4HUWA 1ND0A 5JXAL 3BJ91 2GSIA 5DJAA 1XHHA 5IEKB 4PRAA 3MJ9H 5D1XD 4WJ5A 5F8RC 2X6VA 4OLVL 2ZX9A 4I4WA 3NOIA 4ZTPH 3SDAA 3WHXA 1JV5A 3LQAC 3W39A 4WI7A 3CNKA 2DF3A 3LXUX 1YNLH 1SXBA 1RJYB 1EBPA 5BRZE 3U9UA 2RAMA 2N7AA 3CFBA 2BINA 5C0BB 3TIEB 4MNQD 4FP8H 4YX2L 5K39A 4WJG3 4DGYH 5FHBL 2QADD 5I1KH 2FEEI 2KS0A 4C56A 3QQDA 5JORA 2V2WA 2MPVA 2WLZA 4NSKB 5DD6A 1WP6A 5EUOF 1DQQA 1IMHC 3SDCB 3CFQA 3KPNB 4UYPB 5C0RL 4JGUA 5JMRA 3CN2A 4JM2C 4NZTL 5SV4A 5EU7C 4JFXB 3FTWA 3STLB 1QPXA 4UDUA 4GP8B 2WLMA 3N1FC 1VZIA 2F6AA 3VXSE 5JDJA 3EYOB 5KS9B 1IZKA 3U0PB 1HIMH 4O4YH 4MGXA 3QDGA 5KEZA 4K94C 1HHHA 3CFDA 2C9UA 2GJ6B 2XWDA 4K71B 4RRPG 5F7HA 1RJCA 1HCZA 4MXVE 3MJ6A 2OYKA 4PSPA 1WIOA 2GITA 3OZLA 1KB3A 4FQ1L 1I1RA 4QRPD 1PBYA 1QLEH 2FQFA 3OKEB 2DTSA 1EFQA 4G2AA 3B2UD 5HDBF 3T1WA 1M3IA 2FX9H 4NGHL 2WCGA 4JB9L 3MODL 4GMTH 2AXWA 2ZQKA 5LGHH 3UTTD 4ZAKA 1CB4A 4EN3D 3RWDA 4UOQA 3GXIA 2R2EB 5BRPA 1YC8A 2DM7A 3SQRA 2CO2A 3RIFF 2A6IA 1FYTE 5FXCH 3V4PH 3GXUB 3K5RA 1I8LC 1P2CA 3F7LA 5E8OA 4LRIC 2FNBA 4RBPK 1OANA 1I4FA 1A4AA 1EUTA 4H8QA 5IQLA 3BRGC 3U9PL 2ZSVB 4GAGH 2LAAA 3D0VA 4JFQA 3B9KC 4M7KL 3SDXB 1E5ZA 4ZPTB 1OQXA 1VZHA 1CU4L 4MQ7B 4LIQH 2QGBA 1AS7A 1YVLA 2CIIB 2ITFA 4Y1SA 1BBJA 1PZ5B 3CZEA 4FQPA 3B8SA 2AJSL 3K6SB 1C1EL 1E4XI 2QJDA 5F9AC 4MAZA 3HI1B 1KYUA 2AVFA 2VDMB 3TVMB 2YKLL 4JDEA 1MCSA 5EPMA 1A7QL 1UM5L 3HUJB 2ZSWB 4XVTL 2VISB 3FCTB 3VE0A 1BXXA 3W9DB 5E9DB 2OTUA 3MV7E 4CADB 4Z7OF 2NNAA 3EOTH 1UM4L 1O5DT 3UTPD 1K6QH 4H13C 4DK6A 1FYHB 4JE4B 1PAMA 1QEWA 4X9IA 1XMEB 5FAAA 1FNSH 3KLKA 3MTRA 2ZG1A 2QZQA 1RPQA 4OZIF 4N2HA 3DV6B 2H3KA 3EGXB 3LH9A 3UP1A 1BVNP 2VE6B 3MV8D 4HEME 3VFOA 2CUMA 3PUUA 5F1IB 4JY5H 3UXFA 3VXPA 6TAAA 4HD5A 4P2CG 7CGTA 4FOMA 4OD2A 4WK4B 4XRCA 4HCGA 5I8CA 2CKBB 2YXFA 3G6JB 3HBPA 3TH4T 2HJFB 3EGDA 2V37A 1YEJL 3S96B 4R7DB 1DUZA 1HFUA 4NQDE 4XCNA 4EEEA 1E0OB 2JCCE 3P3UA 2GIMA 2YD2A 3LV3B 3VTAA 4NQVB 3SY0A 1BX2B 4XCEA 3CCHA 3NSYA 4Z7UA 2W0PA 5DWPA 3BZFA 4Z0BL 1AC6A 4Y5YC 1Z5YD 5I1AB 4ZUVA 2V3FA 3KWWA 5F96L 2CRZA 4IU3B 4I89A 5AZEH 3QXTA 5D70L 4TXVB 4U0QB 5CGYD 3FS9A 1I7ZA 1U2CA 3V5DA 3O2VH 1SJXA 2OSWA 3UTQA 3S3DB 3CBKB 3U1SH 5DFTA 4HS3A 4DQOH 1U3NA 3NP4A 5SWZA 3M1BA 5GRVL 1VEPA 2EUXA 4QNPE 1QFWM 5DVNA 1WZLA 3N43B 4FLRA 1INDH 1F13A 1YQVH 3VD7A 4RRPM 2RFXA 3IWUA 1U2HA 1J05B 1UWGH 5ESVB 3T0AA 1PSKL 1DLHA 3NIFB 4JKPH 4AQOA 3J2PA 4PJXF 1HL5A 2RA1A 2WN3A 2UX7A 1BAFH 4L3EA 1HJCA 1HZKA 4UT6H 3QQ4A 2UX6A 1JZEA 2WWKO 1GOGA 1RIUL 2YOAA 3K2MC 3FUIA 1G7HA 5B3JF 2ZUVA 2Q3ZA 2FGZA 1JPTL 3S5YA 3CSFA 3D3VE 5I6PA 1PY4A 1LP9B 3R1GH 2YC1A 3G5XB 2CBOA 4KTEL 5DZAA 1EO5A 1VAHA 2WBJD 1F3JA 3RRQA 5T3ZH 1JG9A 2Y1AA 4MQTB 4F8QA 2ICWI 1PYWA 5IKCB 3UFIA 1T0OA 1D7CA 1YO4A 1WVZA 2FX7H 2DIJA 3EH1A 5JOPE 5DQDH 4NQEE 4B97A 3F6IA 2E0PA 2VLKD 3INUL 4P3CH 5LNGA 1S9WA 1AHWC 1RZKH 3BD3A 1JPEA 3RY4A 1KZYA 1T1WA 2FBRA 1JSYA 2F1EA 2PYEE 1L4IA 3QORB 4KRPB 4RAUA 2RJMA 4JFFD 3OMNB 4CILA 2YD5A 3VI4E 3L3IB 3GFUA 5CUSL 3NCYP 2I26N 3QJRB 4OJAA 3KJ4B 5GSRA 5J5EA 4N8UA 4J5VA 4XBGA 4YFLI 2ZNXA 3BUIA 2XTSA 2VGLM 3F8UB 1SDYA 3FYIB 2DM3A 4WUKL 2HSIA 3PU7A 3PV7A 3RUGE 5DFVD 2UVFA 3WY1A 1IUZA 3V4PB 1UADC 3WJLA 1YEFL 5TE7H 1H8LA 2I60L 2OXGA 5D72H 1AP2B 1CGXA 3BW9A 1JHTB 3UYPA 3L8QA 3V5KA 2QSCH 4FI6A 1S7WA 3PXHA 1U95A 4ATWA 4U7KA 2D0HA 3HS0B 4WSKA 4K55A 2Q6WB 4G11A 2Y6SC 3QA3A 4OIIL 2OMZB 4V2BA 4ZBJA 2BHUA 1BQHA 1M71B 2C4XA 4KHXH 3G08B 2YSSA 4B0MB 4K71C 1I7RB 1X7QA 2P47B 1Q9OB 2W92A 3TCTA 2Y22A 2N59A 2GVYA 1NCCL 2WW8A 3T0ED 3L95B 4PBXA 4Z3JA 1MKFA 4PUBH 1CE1L 3LQMA 3FBQA 3FTXA 1GGBH 1FE8L 1FP5A 4WHTB 1WBXB 5T5FL 4C83A 1U8QB 4DERA 3JVFC 3TBVA 3W5NA 2F5AH 3S5LB 5I26A 3KG5A 2X3BA 4QTIL 2Y2YA 4S1DC 4KQ3H 4PGJA 3S4SA 3GMNA 3HE7B 5DJZB 3NA9H 1I85C 3II3A 1JNLL 4WHYH 1BIHA 4BCZA 2DD8L 3WJMA 5DQ9B 4XE0A 3DJSA 2UZXA 4RIRB 1INEL 4V11A 4QAWA 2E56A 2VUKA 1O9ZA 3T3MB 4R4NC 2YPLB 3EZ8A 2A9NL 3F7KA 4HIHA 1KEGH 5E2WL 3EFOA 4Y2LA 1P7QB 1QACA 1J9QA 3U9WA 2IPKB 2NY6D 3B7SA 3CLFH 3PHOB 5D1QE 3GMLA 4HH9B 3UJTL 3UMNA 1IQDB 4BSWA 1UYWL 4ZNEE 2BVQA 2G2RA 4ZYKB 1RZJC 3S36L 2O4EA 3DIDA 1RSYA 4EUPA 5C3TA 4E9SA 2K3TA 5B39B 4ELMF 1KG0B 1VADB 5IR1A 3SBWA 4AV5A 2LV4A 4KDVA 5DK3A 3TJPA 2Y7OA 2XG4B 3OLEA 4FG0A 4KO7A 5GS3A 4PJHB 4MA7L 5CJOH 4IIQC 1L5GA 1IVLA 3MLXH 5J9PA 5E9AA 4A66A 3SPCA 1GSKA 4HETA 5D5ME 4TVPD 1TLKA 4PJBE 1MZYA 2VJ0A 2VRKA 2CLZA 1FA4A 3GSOB 3TT3H 2LR4A 1U8KB 4W9HC 3P30H 5A6LA 1PD0A 2XWTA 3KPLA 3V7MA 2J44A 4G42B 4K7FB 2P42B 5BZDB 2D7TL 3SOTA 1K3IA 2PYFB 1M6UA 3MLRL 1JNHA 1QKZH 3JWDL 5EOTB 1PDKB 3QIBA 4R0LB 4ZSOA 1H6UA 3GSRB 2LFEA 1S5HA 3FFCA 3T2QA 1RZFH 5D6CB 3NCWA 3N6YA 1HI6B 5HI5D 3T0BA 2EIBA 2GJ6E 3GRWH 1YAIA 3UG4A 4F2MB 4HIJA 4JREB 4NFDA 1UZ6F 3OKLB 5GQBA 1BZEA 2M1KA 3U4BL 2J3SA 2ITDA 1BVLB 4MJIE 4UNVA 5TGBB 4KI5F 5KUMA 1KCKA 3NVQA 4G8EB 3A67L 1ZGLP 2ZKHH 4I9XA 1DFXA 1GZQA 3MRCA 5DD1H 2BZCA 4W9DC 1QPPA 2YN5A 1IGYA 3V6FA 5DEGB 2EC9T 4LHUG 3T3PF 4JM4L 2OR7A