4WI2A

Structural mapping of the human igg1 binding site for fcrn: hu3s193 fc (wild-type)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Structural and functional mapping of human IgG1 binding site for FcRn in vivo using human FcRn transgenic mice
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi2A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi2A01
4DZBA 4WU7A 1J0YA 4W4OA 5ID1B 5IOPA 1RZ7H 1GYAA 4E42B 1AJ7H 3CFDA 5J0BA 4YHOH 1T7XA 2WQ8A 3GMLB 5EN2A 1I85C 1OWWA 5JIKA 1DQJB 3QIWD 1XFPA 2YSSA 2YA0A 1MWAA 3O41B 4IRJD 1REIA 4JG0H 4WFHD 5D71L 5EO1A 1MCDA 5DRXA 3LN4B 4MJ6B 4KKLC 2JELL 2XKSA 1D5ZB 2ADJA 3UTQB 4OZIF 4X4ME 1EX0A 2A2QT 4D9RE 4CU7A 2ZWLT 3NIDF 4HW6A 1AY1H 3ARZA 5C07D 3H6JA 1BD2E 4W68A 2A9ML 4IDJL 5CEZD 4OLEA 2GITA 1I3VA 2EKSB 3DHJA 3H9SB 4FMKA 4ZUTB 5AUMB 1QSEA 3V6ZB 4NSKA 5L9DL 3PP4L 4HWEL 1UQSB 5MI0C 4XP1H 3MRNA 4FFVC 4TOYH 2HG5A 5E9DB 3WDIA 1QKZL 5CGMA 4HT1H 1ZA6B 4OCWH 3MRBB 3VDBA 1IKNA 5C6WH 4JKMA 2KBGA 3B9EA 3DUSA 3CVIL 2AXGB 2EC8A 3F7QA 3HPLB 4XMPL 4MAYD 1J1XL 4LFHD 4FHBD 4LCIH 1PZUB 2P7TA 2VDKH 1OWRM 4UB0H 1OW0A 1GZPA 5FYJE 5I2IB 4HC1A 1S7WA 4NO2B 5GS0L 2F54D 4XCFH 3DIFB 3LMJL 4MD5B 2OM5A 5D7LE 2NY4D 1ORQA 4NQDB 1QBLH 4QCIB 3MACH 1AQDA 3LIZH 4NRYB 2R56H 3T3MF 8FABB 5ITFA 4IMKC 3ARDB 3SDCB 3BKCH 1YECH 1BWMA 1MCRA 4X80L 1EV2E 1OPGH 1QR1A 5ISZA 4FQHA 1R0AH 1U3HD 1MCJA 3P4MB 3U7YH 1PKQA 3VG9C 3BKMH 3M1BB 1CXIA 1PG7X 4N8VB 1KULA 1AGDB 3X12A 4OUUB 3BDYH 3LPWA 4P9ML 1QVOA 3OAZK 3WUWG 3NA9H 5HXMA 2CLZB 3JV0A 3SY0A 4DK6A 3BUYB 3MYZA 2IBBA 3GSOA 5EUOE 2CLVB 5C0IB 1YNTA 5DC9B 3C5JB 4YFLI 1FYTB 1IGCL 4OD1H 4YGVB 1GGUA 5EU3B 1FZMB 4D94A 4WDIB 4JFEB 1A6VL 5FOJA 3G5VB 5FM4A 3EYFA 2VXUL 3FN0L 1IAOB 2W9DH 1CL7H 1VKXB 1YNLL 3DTXA 4P99A 5JO5A 3CFCL 5I1HL 4NQSA 1I75A 1N6UA 4PRID 4NBYB 3SKNA 4AJ0A 1D5XB 1MJUH 1ZT1A 1DLFH 3G08A 3ULVL 3IFNH 3MLVL 2FNBA 1TJIH 1LE5B 3P73A 3F62A 3L7EA 4L8DA 3TBTB 2IH3A 1OD9A 3QCUH 5FDYA 3VXSD 3U82B 1YEFH 4O2CB 1YEJL 5D1ZB 3HR5B 1C5BH 4MVBC 4WV1C 3VGBA 5A2IH 4LSDA 3GUTA 4LEXH 4LEOB 1C5DB 2HT4D 4O02H 4ENED 4YWGH 4ODVL 4XWGH 4JFED 4KAQL 4LASH 4O4YH 4G80A 4GRLD 5GGVH 4M7KL 1G7LA 5J06A 1QHOA 3MLZL 1HI6A 4P3CL 3SGKA 2P5EE 4RISH 2VZVA 2VXVL 3GIVB 1NJ9B 4BFIB 5FDWB 3QUXA 1B4RA 4O58H 4I0PA 2BMKA 2JCCB 4CNIA 4XPFH 1ONQA 4MJ5B 4FFZH 1KJ2L 1ZV5A 2K1MA 4YX2H 1W72L 3D2UB 5C0BB 1FP5A 3EJZD 4DVBA 3TBSA 5F96L 5TDPA 1CG9B 1DBJH 3BN3B 3FFCA 4QT5A 4RFNB 2FEDC 3QUKB 4LCYA 1X6LA 4OCYH 3FOLA 3LKPA 2HJFA 2VH5H 3MYJB 2AV7A 2X09A 2FX7H 3CFEB 1QSFB 4KKCC 4YAQB 3QDGE 2LVCA 5JZ7D 3VGFA 4TPRH 1BQLL 3FRPA 3DETD 3RQ3A 3QIWA 4YO0B 4NRZA 4L4TE 3FAXA 5F3HB 4M8QB 4LPVA 3QJHA 5FUZH 1DN0A 3VH8A 2Z31B 5ILTH 5IMLB 5IBLC 5DR5L 4ELMA 1HXYA 4KGLA 5GGVY 4M1DH 1NBZB 4YK4C 4OCXH 1CLZL 2YPVL 3KR3L 3OPZH 1CFNB 2EIDA 5IB4A 4JY4B 2EYTA 2LU3A 3LKNA 3QFDB 5C07A 5I1KL 5I75B 2A1WL 5E5RB 5F1IA 3E3QC 1Z3GH 4DN3H 4NOFA 4NO0A 5J7CC 1YEDA 3L5IA 2AEQH 1BQSA 3H42H 2DQGL 5IT2H 5TGBB 1KCKA 5IEHA 3NH7L 3ARPA 3KDMB 3RWHB 1HHGB 4KMTL 4QHNA 3BKYH 4MCZB 2X1OA 1JNHB 5ACMA 1MCHA 2A6IB 4PLJC 2DQTH 2G60H 1H15A 2MPAH 3SPVA 3O4LD 5FV1L 4CGTA 4EIGB 4LLQB 3ZT7A 3RZCB 1GGYA 4TULH 3FQUB 5IJVB 4MMZC 2ICEB 1DR9A 3EZ8A 4MAYA 4QEGA 3V6OC 3ULUC 4FFYH 4NN7C 1BD2B 4F58H 4NNPL 2DKUA 2OSLB 5T3XE 5KVGH 5FCSH 3RL1B 1U8NB 5IMOB 1TZGL 2W59A 1VDGA 2F54A 4Y16B 2YMXH 2DLIA 4Y8AA 4R4BB 2EKSA 4KTDL 2HVJB 3LEYL 3IRZA 4TRPL 1PQZB 5EBWA 5I0DA 4TUOA 4PJIF 3GNML 3MGAA 1U95A 4KHXH 4GOSA 4NO3B 3RAJL 4QWWD 5DA0B 5IG7B 5BCAA 1CXKA 1OTSC 3BE1H 4J8RA 4PB9L 4UQ2B 2E5EA 4KI5D 4M1CC 1U3HA 1EBAA 3ZKNC 5JR1H 1BEYL 5C0CD 3L3GB 1QEWA 4PB0H 4F7MB 1ZMYA 3PHQB 5GGRA 1T1XB 4JREC 2JJSC 2ED8A 3DJ9A 4L29A 4U3CA 5T1KB 3HE7D 1A5FL 1PSKL 2YOCA 4GBXC 4PRBB 4YHZL 4JQXC 5HHPA 3EOTL 4NO2A 4AEHH 1EK3A 3CH8A 3OAZH 5CKAA 4NQDA 2NY3B 4M61A 3N9GL 5F6IB 3GSVB 4XRCA 3U7AA 3VFOA 3I9GL 3V52H 3FQRB 3N06B 4UTBH 3UAJC 2DQIL 3ARDA 1X5LA 5IR1B 4GRMA 4LPTA 2AJSL 2GCYA 3ROOA 3SDCA 5E94A 3WN5C 3VRJA 1K8DA 1RJLB 3TVMD 3MRDA 1CGTA 1MRFH 4LU5H 4PRIA 5IWLA 4JFHE 5DO2C 1CICB 5C0AE 3P4MA 1NDMA 4JY6B 2YC1B 3FHQA 1EERB 4LSTL 4YC2C 4LCWB 4OQ1A 4N8VA 2P1YA 1E28A 2YBRA 5BQ7A 4OT1L 4OFYD 1PG7H 5F9AC 4HUVB 1RZKC 2BY3A 1SMOA 3V9FA 5JDSB 4UOW1 2Z93B 5EOCJ 5C0IA 4YJZL 5BOZG 3LB6C 2J6EA 5E4EC 4WI9A 2YUXA 2OCFD 3MXVH 4ODSL 5GS1B 3MV7E 2V7NB 4JFEA 1M1SA 3TF7C 1G1YA 4K23L 2K7QA 3G5VA 4GRLA 3T0VA 2UY6A 4WI3A 1Q9KA 2ADGB 2BHYA 2NY0D 3JTTB 1DBAL 3WFHB 2KL6A 4L9LB 4NQCE 1D5XA 2WWKO 2MSPA 1HDMB 3BPOC 1PY4A 5FFLA 4TSBH 5IP4A 4MA1B 4LCUA 3NZHH 1OVZA 4HS6B 1BVZA 4M5ZL 3RP1A 1GXEA 4UAOB 3LCYA 1DQLL 3V4PH 3TBTA 5GRJH 4JKKA 3EO9H 3RI5F 3BEVA 3UTPE 2GJJA 2JIXD 5C6PB 3SDXF 1C5DA 1RZ7L 1WTGT 1AQKH 4WWID 4JZJC 1AJ7L 1ZLUK 4UUJB 3S5LG 3LS4L 4MSWB 5D5ME 3CPLA 3MLXL 3KHOA 5JXAH 2BCKA 4J7RA 5M95B 3RGVC 3FCTA 4DGIL 1VFBB 4JG0L 4ALAH 4P5KB 2CRMA 4MNGE 4POUB 2A9NH 3DUUA 3BJLA 2BJML 3GIVA 4NNXB 4NO5A 4U6YA 4TTGA 1Q9LA 1AY1L 1M05B 3BW9A 4M5YH 1N59B 1IMHC 2DIJA 5CWSA 5D7IF 1IGTA 2X4NB 1SEBB 3QFJD 1CG9A 4KZDH 2DQJH 1GHFH 3QUKA 5BRZE 4QRPD 2Q86A 3DRTB 5C86A 3L3IB 1WWWX 4XP1L 1A1MA 3C60B 3UZEA 5E0QA 1MHCA 4JRYB 1MSPA 4W6YB 5D6CA 1KPRA 4HT1L 3O4OC 4L4TB 4OCWL 4ONOA 3SCMD 5I74B 4CVZA 1ZHNB 1ZEAH 3O4LA 2QHRH 1RULH 2WLYA 4FQXD 5IROC 1KFAH 4P49A 3KS0J 1SMAA 2XZCH 2XTJE 3MJ8A 5IMLA 1S3KH 4LCIL 4X0KB 2VDKL 3QEUB 4PJ7F 4RGOH 4S2SB 1NBZA 2CO7B 4OZGA 5IW1B 1CFNA 1JL8A 1FFOB 1K3IA 3PQYB 2P5WD 2Y6SC 4MDIA 4WNQB 5DD1H 4XCFL 3B9KB 5DJ6B 1CS6A 2DWEA 3MOQA 4ZOCA 4J1UB 1QBLL 3MACL 3WDJA 5L2KB 1DVFB 2Y5TA 4GUPA 1GL4B 5C0DA 3L7FA 1YC8A 1GC1H 4XBGB 3BKCL 3RWHA 3OKMB 1YECL 1OPGL 4X9FA 3ZSTA 3EYUH 4GG6F 3P0YH 4X99B 1R0AL 2BNUB 3AREC 4LL9A 1GSMA 2WBJB 3BKML 4OZFG 4Z7WB 3JSSA 1E6OH 5C0CA 1NC4B 2ICEA 3MRCB 4J3TA 5E5UB 4L8SA 3HG1E 1U8KA 4URTB 4BZYA 3CSYA 1Q1JH 1SYSB 1JGLL 3NA9L 1SJEB 3MFFB 4I18C 3BH9A 3TA3B 5LGHH 5DD3H 4XXDA 2Q7NA 1M71A 1A7PH 3ZDYE 2FHFA 5IMOA 3S35X 4OD1L 5CEYB 5F7KC 5EIQA 3CFJB 4ZS6C 3EO0B 5F7NC 5HGAB 1T0NB 3SO3B 2B1AH 4B50A 3ZDXF 2W9DL 1S7VA 1FL5A 4Q2ZB 4PV9A 5IMMA 4V1DD 2EE2A 1F3DJ 3VD4A 3Q5TA 4JVPA 1MQ8A 1MJUL 5D1XD 5HI3C 1DLFL 4OCSH 4P4KC 4X6DF 4Q6IB 1BWWA 5GRVK 3IFNL 2F8VA 2VDMH 1TJIL 3QA3B 2X1QA 2WBJD 5DFWH 3JWDC 3C6LB 1G7MB 2VQ1A 3VXNA 4F8TA 1T1XA 3AU1B 3QCUL 2J8HA 1I1AB 3J8F7 1YEFL 3H3PH 5T1KA 2B0SH 4Y5VB 1C5BL 4OFYA 1QSEE 3MLSH 3CX5J 1OTTC 4OI9A 3PUCA 5DC4B 1SBSL 4X6BB 1NLDL 3BO8B 4XP9L 4O02L 3OQ3B 1HH6A 4YWGL 3C8KB 3W0WD 3WS6C 4XWGL 5AD0B 3KPSB 1UH3A 4LASL 4O4YL 4PREB 4BSVB 5GGVL 3WNKA 4MQSB 4D0DA 3BXNB 3IXTB 4JFZH 5IK3B 3SDAC 5IR1A 1Q0YH 2V6HA 3O6LH 1UCBH 1QTYT 1RJLA 4PJ9C 3ZE0E 1LD9A 3E8UH 4QGTA 4RISL 5FYLL 2FL5A 2FHCA 3KYMB 4O58L 2XQBH 4XPFL 3C6LD 2GFBB 1A3RH 4FFZL 5CD3A 4YX2L 4Z95L 2HFTA 4P23C 3STZA 2I60H 2MNUA 5D93C 4OCYL 3U0PB 1OT1A 3MV7B 2YD5A 5IESH 2UUDK 4UILH 5JDSA 2JIXA 2FX7L 4D8PB 1UXWB 2FYYA 2B4CH 4LVOC 3P4NA 4TPRL 1INQA 4P3DA 3MO1A 3TYGH 5GSRB 1NUFA 5IVZA 1ZLUH 5FUZL 5ILTL 2ADGA 5DVOA 3WFHA 3VFTA 4M1DL 3BDBA 1TPXB 1HDMA 1JWMB 1SM3H 2IADB 4OCXL 4ZPVA 4U3XA 2PNDA 4GQ9H 2BY1A 1V3MA 3H7LA 1H8OA 2R29L 5C0RH 1HILA 5DQ9A 4YEFA 2H6PB 1QR4A 3QFJA 4OI7A 3VMNA 3H42L 5IT2L 4QRPA 4EUPB 3BKYL 4GKNB 1F42A 3RX7A 2DQTL 2G60L 3QHZH 5H2BA 4WI6A 1G9NC 1NCNA 2MPAL 5C0FB 2IAMD 1CGYA 3SCMA 3L5XH 1UWEH 4YQXH 4FZ8H 4FQXA 4PD4J 4TULL 1ADQA 3CAFA 4PUBH 2BSSA 5KSAC 2Y25A 4WCYH 4FFYL 1A9EB 1Z6JT 1HHIA 1HSAA 4PJXB 4LBEA 4AT6B 3DMMC 1SJHA 3HUJA 4F58L 4X6EA 1W8NA 3DV6A 2HMID 3T2PA 4K3EH 1IGJB 2DLHA 3AMKA 4JR9H 3U7WH 1A6TB 1NKRA 5B8CA 2P5WA 1Z5LB 5E4IA 4FFWC 3L3JB 4HH9A 1OSZA 5CJXA 4GQPH 2CUHA 1BLNB 2N1KA 1J88A 3P4OA 2AXHA 3RWIA 3OB0K 3C60A 3MV8D 4JHAL 4JRYA 1GGCH 1D9KD 1KACB 4LHJB 3E1F1 3BE1L 3KPMB 4WGVB 1ZVYA 1E4XI 3BX7C 5F1NA 1ZHBA 3MUGA 5JR1L 3BQUD 4WO4D 1W0WB 3VD5A 1NDGA 3D9AL 4PB0L 4WU5B 1YEKH 4HWZA 3GMOA 1ROWA 4XPAH 4WWKC 3RDTD 1FFPA 3FFCE 4G6FD 4X0KA 5HYEA 5K9QG 3L3DB 1QUNA 5J1AA 1BVLA 3X17A 2YZ1A 4V2BA 2PN5A 1D6EA 3NAAH 4WNQA 4AEHL 3B6SB 3B9KA 3ARFC 1DEEB 3ZKMC 2R2CA 4JPWH 1DVFA 3V52L 1TJGH 4KK5D 3BHBB 3GI9H 4JCLA 3MZTA 4O51A 4UTBL 5I8CA 1JYNA 4KRLB 4MA7H 2QQKH 3U2SB 4V1DA 4QHMA 1MRFL 4LU5L 1KB5H 1I7UA 2I9TB 4PJDE 4ELME 2YRLA 5D1XA 1CFQB 4EXPX 2R4SH 4N90D 1BVKA 2NLJB 4JPKH 4X99A 2B5IB 4PJBF 4L8CB 2H45A 3QUZD 5FF6B 2WBJA 2EYSA 1FCGA 3NABH 4V2CB 2HTKD 2NY6C 5C07E 1GAFH 2HFFA 5CEZE 3HC4H 1P4BH 1PG7L 1PY9A 5H37H 1WBXA 4P5TD 1FO0H 5I6XC 1OGTB 3LQZB 1DANT 4OTXH 3VGHA 5CD5C 2BVQB 3MXVL 1T1YB 2ZG2A 3W0WA 4EXKA 3S35H 4Y4HC 5E99H 3EO0A 5FHBH 3JVGC 3WO4C 5HGAA 4I4WA 1FAKT 5I8EB 1GIGH 1OAQH 5SV4A 2HWZL 1KN4L 2NXZC 1YYMH 3QNXB 4O2EB 5KVFL 4QF1A 3QWOA 4J4PD 4X5WB 4Q6IA 1K4DA 1RZIB 4TSBL 2Q3ZA 4Z5RA 3WNMA 3K2UH 4JPIA 3LV3A 3O3EB 2AKRB 3C6LA 2XZQH 3D0VA 3IETB 3V4PL 5JXEA 5GRJL 3V5DA 2F54E 2NPLX 1BJ8A 5DMKB 2CR3A 4PJ8D 2NR6D 3CU7A 2Z8VC 3EO9L 3MBXH 3TNMA 3VFSA 3WBDA 5LGJB 4I3SH 2VXQH 4P4RB 2Z4QB 3SE3C 5DTFA 5CAYB 3UYPA 2P47B 3MNZB 2NY2D 5DJ2B 4LHUB 1AQKL 4JAMB 2FZ3A 1AGCB 2GSGA 4OJFH 3VXUB 1MY5A 4G42B 2APFA 3BIAX 4N1EA 2EEDA 4MNQD 3ZL4H 2UUDH 4GLRH 1RIHH 4TTDC 3RWCB 4ALAL 4I8DA 1HH9A 4TUJA 2P46B 3BP6B 2A9NL 5I71C 4ZUSA 2NW2A 4YHPB 4L3CB 1OAKH 4C54A 4M5YL 1MCWW 3P2TA 5A43C 5DJXA 5AZ2H 2N4IA 3FB5A 1MHEA 1NANI 3MLTB 4KZDL 3OSKA 3SBWC 1U8PA 1UGNA 1FZOA 3BKJH 5A2KH 3VRLE 3T0ED 1XCQB 2CD0A 2Z35A 1FNLA 2ED9A 3QZWA 1C1EH 4DK3A 1Y0LA 4G8IB 2VR5A 4DAGH 4I5BB 1YUHB 2CIKB 3RVXC 1ZEAL 2IAMA 2QHRL 4WHTA 4F7CA 1RULL 3QQNA 1HXMA 1BPVA 4J3VA 1KFAL 4OB5H 1TTGA 1M6OA 4LSPH 3ORJA 5DJYB 2XZCL 1HN1A 1U8LB 1S3KL 1N0XH 1NFDA 7FABL 2VWEE 1NCUA 3IJYB 4YR6A 3VXSE 4RGOL 1XF4B 3R0NA 4LSQL 4RFEA 2VNCA 3WXWH 4PGCB 1QBML 4RMQA 5DD1L 1R3KB 1OHQA 4K94C 5B38A 3UPAA 3UZQA 5I1AA 4RGNE 4QHUA 4U1GB 1HINH 2RBLA 2IPKB 4H8WH 1GC1L 3IKKA 1NBYA 3MV8A 2D0GA 1D9KA 1DCLA 3IJHB 3NBNA 3EYUL 3P0YL 1UM6H 3WIHA 3QH3A 4HH8A 4UV4H 1T21B 5JA9A 3AY4A 5FGBC 5EFIB 3BQUA 4WO4A 2JTDA 4OCRH 3VWJD 5IHZA 1Q1JL 3RDTA 2PUQT 1X5GA 5L2JA 5CLTA 2AS5M 1ZE3C 1IM9D 5DD3L 2X4PA 2H32B 4JO3H 3PWPD 5SWQA 4X4XB 1IGJA 1A7PL 4PJEF 4JFFD 3WD5H 1D5MB 1BF8A 4HUUB 2WANA 1EUTA 2G5BB 3EHBC 5C71A 2B1AL 1HHKB 3O6KH 1KG0B 3AXLA 4FZEH 5DK0A 1U8QB 1E4WH 2HJLA 2EEAA 1EEYA 4IIQB 1MVFA 4HMCA 2VDML 2B39A 4LOUC 1J7VR 2W92A 3ARDC 3SKOB 2OZ4A 4OZIA 3SDCC 3SKMB 2OJEA 2CRYA 3H3PL 2B0SL 2V2XA 3MLSL 5KZCB 5F7DA 3FZUC 4JFOB 4P5TA 4POYA 5JPNB 2XKNB 4GAFB 5I8KH 2RCSH 3TNNA 4JFYB 3EO1A 5BV7B 4M00A 1TCMA 4G8FB 5I1JH 1UZ8A 1LWRA 4RZCB 1JNNH 4HKBA 3O4LE 2OMBA 1AR1C 3ETBF 3BHBA 4JFZL 1Q0YL 3KYKL 3O6LL 1UCBL 5GGTL 1NSNL 1WZMA 4PRAB 1UA6H 4HAGA 4WI8A 3RKDC 5BW7C 4NZRH 4WENB 3C2AH 3E8UL 4QRTB 2EC9U 3ES6B 4J4PA 2YD2A 4ZSOE 3TJEH 4ZDHA 1P7QB 2XQBL 5JHDD 4Y89A 4OZGE 1A3RL 4L8CA 1KN2H 1OT2A 2FO1A 5FF6A 5TE6H 4F33A 1G9NL 1H3VA 3SGJC 2I60L 3QULA 4PJ8A 2NY1D 1X6NA 3GIZL 1QRKA 3R06B 5FCUH 5L8JB 2COQA 4GRWE 5HJ3B 4CADB 3TO4B 4BH7A 5F9DC 5IESL 4RRPA 3C09B 4U1KA 1EFQA 2B4CL 2R0LH 3F65A 4WIQA 4GT7A 3E6HA 3RIFK 2CGRH 2PXYB 4HIIB 1AHWA 2QLVB 3KPPA 3V6BR 3DO7B 5D1ZC 4KROD 3O45A 3QRGH 5DD5H 3TYGL 5DMJB 4KI5E 1TENA 1G1CA 4R7NB 2A73A 1BZ7B 5C0CE 5JW4N 4ZQKB 5KG9B 4KPHH 3WS3B 1ZTXH 3IU3B 1KLUB 1N4XH 1SM3L 1JJUA 1S7TA 4AM0B 5M7QA 3MRGB 4ZFZB 3TBYB 4GQ9L 1CU4H 3FJTA 1ED3B 4NRXA 4ORGA 5CJ5A 3IETA 5C0RL 3IS1X 2O93L 1XH3B 2H3NB 3T4YA 4HK0B 5EOTB 2PW1B 1NAMB 5LKNA 3CDYA 3FN3A 1ZA3A 3T0EA 2X70B 4KUZH 4X6FB 3MLYH 3MROB 3QHZL 4HD9A 1RFDH 4LVNB 3UP1A 5MEPA 4Y5YB 3D0LB 2OLDA 4P2RD 1I1FB 1UWEL 5D7JB 3U46A 4YQXL 4RFNC 4FZ8L 1R24A 2O5YH 3ALPA 1EAPB 4YHNB 5C70A 1ZLSH 1YPZF 4E5XA 2YUWA 4PUBL 4Y1AD 3VXRE 4LSRH 4WCYL 4M7LH 2FH8A 4RAVA 1UKQA 1BJ1J 5J6GB 4R2GB 3FQTA 2D7TH 1HHJB 5HHNA 2I26N 1RPQA 2C4FU 3H9HA 3RWFA 4K3EL 1RUMH 3BP7B 2EECA 3U7WL 5SWZB 5DT1H 1VACA 2FR4B 4NUJA 2Z31C 1A2YB 3MLTA 1U3ZA 4BKLB 5I19H 4D0BA 1CGUA 3IFOB 1P69B 4PJGB 5MENB 1KT2B 1CTOA 1ND0B 4HUKB 4HZLA 1XCQA 3BVNB 1S9YA 2YWYA 3BMVA 3O3UN 4X4YB 3GMNB 4AEFA 3QPXL 3HE6D 5AG8A 2HT3C 2FDBP 1EFXD 5TDNA 4HG4J 2DQEH 5JW5A 4K8RC 1YEKL 2QSCH 2OTUB 1XGPB 3ZDZF 4XPAL 1G6RB 4ONHB 1X9QA 4IOFC 3DBXB 5EZJB 1IM9A 2YPLB 3F7YB 3GBNH 3RZCC 2Z91B 4PGCA 3LEVH 5FA3B 3NAAL 4RGNB 1EJOH 4JFFA 2D9QB 4NBXB 4LCCB 1QSVA 4JFDD 4JPWL 4ETQA 1TJGL 1EGJH 3GI9L 4WHYH 5IMKA 4MA7L 2EIEA 4BELD 2QQKL 3VFUA 1NUGA 3RVVD 5ALCH 3O2DH 1KB5L 3OMZA 3S96A 4Y16C 3RY4A 1CD0A 1XF5A 4JPKL 3GO1H 4Z78A 3BP5B 4KK6C 3CSBA 1RJCA 3NABL 2VE6B 2C1PB 3MRIB 3UTSD 5DS8B 3HC4L 1P4BL 5GRVL 4Q9CA 3HMXH 1TCRB 4ZFOB 2DICA 3QFJE 5CBAA 2DB8A 4QRPE 1FO0L 5IW6B 3KAAA 1KJ3H 2EH7H 3ULSA 3TJHC 4OTXL 2EDHA 4EVNB 3UDWA 4NPYB 3LD8B 2IH1A 1IL1A 4PV8B 3S35L 5E99L 3RTQD 5FHBL 4JANB 5TE7H 2BERA 1EEQA 2HVKB 1S78D 1A1OB 1S9XB 2V7HA 4X5XB 5JPMA 1E4KA 1GIGL 3PF2A 5IV2A 2D7OA 1N6QH 1CFTA 4ZAKD 2BSTA 1U3YA 3INUH 1YYML 1A9BB 3LKOA 3RVTD 3I6GA 5GJTH 2NY3C 1GOFA 2VO5A 5F6IC 3K2UL 2V2TB 2KQMA 5JHDA 3IKCA 3PJSB 2XZQL 1DP0A 3KWWB 4ZXBD 2D4DA 4NNYB 1T7YA 2BOBA 2B2XH 2GAZB 3VXMD 1NUNB 3ARGB 3MBXL 3FB6B 3MUY1 4EBQH 2E8ZA 5D72H 2VXQL 2HFEA 1MCWM 2C3WA 3JWOC 4HIHA 4N0FB 4JFOA 1CICC 1MCOH 1XAUA 5F3BA 1WIPA 3QDJB 2ARJQ 1MI5D 4OJFL 1KJVA 4PJIA 2AXJA 3DPBA 3QCTH 5C0GA 3S3JA 1YYLL 2AW2A 3LDBB 2VLLB 2ZOLB 3ZL4L 1VADB 4BSWA 2EYRA 2O5ZH 2CDFB 3QI9D 1OAUH 5JORB 3WE6A 4ZSOB 4HKXA 3PGCB 2NYYD 5GS1C 2H2SC 1U8JB 3ULVE 1MF2H 2MHAB 1AGEA 1KTLA 4UI2A 4XBEH 1O7SA 3GSUA 5EBLA 3TH3T 5GZOD 5AZ2L 3DECA 3L3HB 3A6CH 4GRWB 4PRPE 4PJ5D 5CIPH 3FL7A 2ZCLH 2XQYK 5HHOD 5DSCA 4L9LC 5FGCE 1F6AB 2DLTA 4G8EB 3K3QA 3OZ9L 3BKJL 1T7VA 1KIRA 3L3OA 4P5MB 1X44A 4MA1C 1RK0B 4U1HA 1D6VH 1C1EL 1X5YA 4V1DE 3KLAB 4UAOC 4DAGL 3ULUF 3V7AG 3TM6A 5LCVH 3MNWB 5D8JH 4FQ2H 3VMOA 4P2RA 3K1KC 1IVLA 4OB5L 1LGVA 5DHVA 4TVPL 1OLZA 1JZ2A 3OGOE 4LSPL 4R7NA 5F8RC 3EJYC 3QIUB 4Y1AA 2ED7A 2V2WA 4NZUH 4OZ4A 5KG9A 4P59H 4OAWA 1CIUA 1UCTA 3DVGB 3WXWL 3MRGA 3TBYA 2GJ6E 2BNRD 3UBXA 4D3CH 4F57L 1U58A 1ED3A 2XG4A 4CVXA 1U8HB 5FAAA 5T5FH 2DM7A 4U0QB 3W0WE 2DBJA 4JKLA 1T5XB 4LP4A 5HYSA 5JNYA 3WSQH 1HINL 4MXVF 4H8WL 4FTVE 4F7TA 3NTCH 2I9LB 1VFUA 4YDJB 5DEGB 5GIRA 1M7IB 3HE6A 3VXRB 1UM6L 1TVBA 4G6KH 1EFXA 1U36A 3AB0B 4PGDB 5D7JA 4AH2A 1RY7B 1R5WB 2DLGA 2W38A 4FQLH 3C60C 1JIBA 4OCRL 1MFNA 4ZS7L 2MOVA 1BX2A 1HQRA 1PGRB 1WBYA 4ZFGH 4HKZA 5T3XH 5C6TL 1J11A 5I74C 1HKLH 1JZ4A 4JRXD 3X11A 1SY6H 3FN9A 4OIIH 3BP7A 4MS8D 3WD5L 3JUZA 1IBGH 5DRWA 3JV4A 3QQ3A 4IRZH 1XGUB 4EKXA 1CIDA 2QR0B 4L9DA 2GT9A 3O81A 1I8LC 3SDXA 3VCLA 1T20A 2LE9A 2MCPH 4BKLA 3IFOA 5MENA 2YD7A 3O6KL 1E4WL 1MCCA 5FKAB 3BVNA 2Q20A 3I75A 2BRRH 1N6VA 3MRKB 4MMXC 2OR9L 1EDQA 1DVFC 1VA9A 1FZKB 1CLYH 3FT2B 3BEWA 4LDOB 3O3BB 2WAHA 4PJCB 4OGYH 5ICYB 1AKJD 2HLFC 3HC0B 5D7IA 1WK0A 4PJAF 3DBXA 2OR7A 5EZJA 5I8KL 4JVWA 5EPMA 1CVRA 2RCSL 1CWVA 1JGEB 4TNVK 1N5AB 5I1JL 3CUPA 1XGRB 2EDNA 1KTKE 4N5UA 1JNNL 1J8HB 3RTQA 4HJGA 4Z7OE 3TA3C 2WK2A 5I15L 3B43A 3O6FD 3LH2H 1R3IH 2Z9TA 4QRSA 5DK2A 4BH8A 3LKSA 4XH2B 3S37X 1UA6L 3AS0A 4ZAKA 4Q9BA 4NZRL 3ARBD 5K93A 3C2AL 4RIRB 3SGDI 2X9YA 4WJ5A 3TJEL 3SO3C 4C55A 1KN2L 2E8YA 4PJ7A 3GM0A 3ZKQD 4PGEB 5TE6L 4K3DH 4ZXBA 2C1PA 4ZMAT 3D69B 1KIPB 3QXDB 2FO4A 2Q7YB 4CL7A 1BZ9A 1TCRA 3BRDA 4Y88A 5FOBA 1NCBH 3KYAA 3O3AB 4MWFA 1I7RB 3OX8B 3SE9H 4DUVA 4OD2B 4NFCA 2R0LL 5JXEC 1MI5A 1T0PB 2CGRL 2FLRT 4EN3D 1I1AC 2F19H 5GS2H 3FFDB 1NFIB 4Y5VC 1F3JB 3QRGL 5DD5L 4GG6A 1B90A 1V3LA 3QI9A 3VMPA 3WJLA 5BS0D 1NGPH 1XCTA 4KPHL 3P9MB 3HZKA 1TZHA 3LQAC 3T1WA 3QP3A 2BK8A 4UINH 5IB3B 3Q2CA 2VLKB 3ZYOA 1N4XL 1ZT7A 4TUKH 1R5IA 2MFNA 2Z92A 5DUMH 1CU4L 5ICXA 3D5OF 5JLZB 3PJSA 4WW1B 5DA4A 4NNYA 4F2MA 4IRSB 4PJ5A 5C2BH 3NN8A 2NNAA 5HHOA 5ETUA 4HUWB 4MJIE 4EOWH 1NCWH 3ZTJH 2ZUVA 4E0RA 2VC2H 6FABH 2BDNH 3QUYB 5JUEH 4KUZL 4N0RA 3MLYL 3QDJA 3E0GA 2ZNWA 1RFDL 3T4AA 4DKFH 3N0PB 3QDMD 1L0QA 2KH2B 2V5MA 4KTEH 3UJJH 4JFQA 4N90E 2O5YL 4M03A 2W0FB 1ZLSL 4X6DA 4XPGH 3V5HB 4XI5D 5JORA 4KDVA 4NQEE 4WEBH 4LSRL 5A16B 4F7PB 5F71A 4OZIE 4M7LL 2ATPB 3WUWA 5KS9B 3F6LA 3NIDE 3G6AB 1FNEA 4YIQA 4LARH 2ZNXA 3MUHL 4I0CC 1YDPB 3VGAB 4PRPB 3PWUB 4POZC 4UDUA 5DXWA 1RUML 3FO9A 3Q6GL 5FGCB 2YPKA 3HAEH 1RHHA 1MLBB 2BNRA 4JFPB 4JFXA 1U41A 2R1WB 3U4BH 5HGDB 5I19L 1TPXC 5DMGD 4PJHF 1BOGA 4HHAA 4QLRA 5A40E 1GZQA 4NT6B 2DQEL 4HPOH 4JM2B 4KDWA 2GUOA 2QSCL 2CJUH 3DYPA 3IDMB 4X98B 4GAYA 3KGRA 1FQ9C 2GJ6B 5FYJL 5CJQH 5GGSB 1KJ2B 3REWA 5D1QB 3Q6FA 4KZEH 1W72B 5GSVB 5F72S 4JRXA 3OAYK 3NCYS 3KNBA 3R4DA 3LEVL 4KJYA 3OKLA 1FNGB 3T65A 1EJOL 4WUUE 1NGWA 3QNZB 3S5LB 3MODH 5L0QB 4M7ZB 2XA8H 4FTVB 4IMLB 3V5KB 4EI5B 4M8VA 3VDAA 2XACC 1FFQA 1YN6B 3U4EB 2OP4H 2R23A 1JE6A 4MNQE 3P0GB 4PRHD 1BP3B 1IRAY 1A1NA 1R3HB 2EZ0D 4XCYB 5ALCL 3O2DL 1A4JA 5DEGA 5KN5B 4P2OD 1DBMH 4NC0B 3X3GH 2C3XA 4C83A 2WWMC 5I66B 4D2NA 5CSZA 2R4RH 2E9WA 1LNUA 3VFWB 1J05A 1R5WA 2H2PC 2J5LB 1OAZH 1K4CB 2H8PA 4EQ2A 5LXGL 2OTPA 3HMXL 4K9EH 1AKJA 4Y4FB 5IVXB 1F3RB 3PXHA 3IS0X 5E6IB 5C0EA 1IEAA 1KJ3L 2EH7L 4KJWD 4XCNA 3T0EE 5HVHB 1U91B 1KSRA 2XWTA 4JJ5B 1IE5A 1XGTB 4JLRA 5SWSB 1XGUA 4QKXB 3H7BA 1UG9A 4UQ3B 1MWAH 3RWEA 3GMQB 3MX0A 5BOPA 3NFPB 4QXWA 5F44A 4A2LA 2CR6A 2FJHA 2QHLA 3B2VH 3O6FA 1N6QL 1I3UA 4NQVB 4XVUC 5E8EB 3S36X 2W0PA 4I48B 1MJ7H 1NGQH 3ARBA 1JUFB 5GJTL 4YBHA 4N0UB 2V5YA 3GSNA 3REVB 2WSKA 2QQLH 2HLAA 2B2XL 3FMGL 4MDJB 3G6JB 4EBQL 4KKBC 1KTRL 5D72L 4XNMA 4XVJH 5GQBA 2V17H 3GMPA 4JHBA 1HEZB 4KI1A 4U6VH 5MERB 1MCOL 2RAMA 5KW9H 2YUVA 1E4XH 1TVDA 4X8JB 1KB9K 5DUPH 1KXQE 2DQFA 4LRIA 1N3NA 2VLJD 1RZGB 4FOMA 4K7PX 1YY8A 4EN3A 4JCMA 2JJTC 3GBLA 4PP1D 1ITCA 1OGAB 1Q94A 2W9EH 4OZFB 5HD8D 2O5ZL 1OAUL 3JV6B 1LEKB 5CMAB 4IS6B 4LVHB 2VLRD 1IM3B 3DXAD 5BS0A 1UVQA 1Q0XH 2QQQA 1A02N 4HJ0D 4U3HA 1MF2L 4HC1H 4BFGA 3S37H 2PR4H 1T89A 4XBEL 5EWIH 4LHQB 3ILPA 1EZVX 5I76B 2A0LD 3PWPE 3JWNC 5DJ0B 3SDDD 3A6CL 3CIQA 1TETH 5J56B 3GMMB 1JWUA 4JFFE 2D4FA 5HHXH 1CFSB 4YEEA 1ZANH 5C0JA 2ZCLL 3L5WB 1KIPA 4UBDD 5B39A 2ZOKA 4JDVA 1BQUA 2Q7YA 3BWUC 3MR9B 4WFGD 1X5JA 1FLRH 3F58H 4F15B 3OG4B 1D6VL 3IVKB 1N8ZB 2EEBA 2UZYB 5FYKH 5EU5A 1S5HB 3LEXB 3QDMA 4Y0GA 5EU7E 5LCVL 3VFNB 5T1LD 2J7LA 4FQ2L 4G9DA 1NFIA 1NPUA 1F3JA 3IDXH 3FRUA 4TYUA 3WDHA 3CGTA 3FB8A 1AC6A 4GW5A 4PJBA 4NZUL 2F15A 3D87B 4F3FB 5DRNB 1YY9C 5ESVB 3ME0A 2AJ3A 2VLKA 4OLWH 5CGYD 1EHXA 3QYCA 2WMPA 1OAYH 4D3CL 1TITA 5C0ND 4AG4L 4LNRA 4P9HC 3LN5B 5F9OH 4ZODA 3EW3B 4P3WA 4MJIB 1YJDC 3HLAB 3RVWD 4EIZC 3N1FC 3HRZB 3LSOB 3VXOB 4LLMA 5E2TH 3DARA 4IRSA 4W4NA 1B0WA 1CDUA 4MQXC 1ITBB 4H1LB 3WSQL 4HUWA 1U8IA 3T0WA 3QHFL 3MCLH 1WCBB 3T1FB 5D2NB 3LKRA 2CRZA 4NQEB 3TBWB 4G6KL 2CO6B 3P77B 3RHWF 3LHPH 2ORBH 1MRDH 2D0HA 5JHDE 1KYOK 3V5HA 4FQLL 4KDTC 4PRDA 1Z9MA 3OJMB 3D39B 3FB7B 4NHUB 1I8KB 4ZFGL 3G6AA 5T3XL 1HOCA 1HKLL 1YDPA 3PWJB 2CMRH 1SY6L 4FA8A 1RVFH 4OIIL 2GY5A 2CKBA 5T1MA 1LILA 1NGYB 1IBGL 3MUZ1 1PW3A 1CGVA 1FAIH 4H26B 4ZYKB 4PJIE 3L5JA 3MJ9A 4QTHB 2MCPL 3OAYH 4KKLD 3CK0H 2OXHA 4PRHA 1FL6B 1U3JA 4B7IA 2D31B 4KK8C 1BQHB 2BRRL 3MREA 4P2OA 3S98A 3PNWB 5C8JB 4P46C 4OCLC 4LAQH 5B22A 1XR8A 1BMGA 4OLVH 4U1GC 2CLRB 1NANH 5L6YH 1MVUA 1CL7I 1CLYL 3IDMA 4FFVD 4OGYL 5DEFA 1NGXA 4FXGB 4MXQC 4WUUB 3SGEI 4FQIH 5D1QA 1W72A 5JOPD 5J89A 3ARRA 4YHIB 2X4TA 4NKOB 4XZUA 3GSWA 5DRZB 4L1HA 4QGYA 1A3QA 1M7DA 3CLFH 4UOW0 3S5LA 3LQAL 1P84K 1FZJB 4GMTH 4EI5A 1I1RA 2UZIH 2BOCB 2P4AB 1YN6A 4OV6F 4P2RE 1ZGLB 1ZHLA 3L95B 5H8DA 3LH2L 3P0VH 1FNHA 1A7NH 3TGXA 1NMBH 4Y1AE 4KFZC 3UDWC 1RUPH 5TDOB 2IBZX 3VD7A 2KDGA 5LAXA 5IHBA 2DLEA 3QEHB 3QG7H 5I18H 5CEZH 1IZKA 4KVNH 3H3BC 1RJYB 4NC1C 4K3DL 2OL3A 4D9LH 3RWDA 2NX5D 4GJTB 1QYGH 3BWAA 4JZNB 4IIQC 1X4XA 3G5XB 4OFDA 4Y4FA 3WO3B 5KSBF 1FVEB 1NCBL 1EUUA 5HTSA 5D2LF 3SE9L 4KRPB 1MIMH 5D9SB 5HHQB 2HKHH 2F19L 4UQ3A 1C08A 2VLJA 2XNAA 3LRSA 4PS4H 43CAB 2J3SA 4NHCH 5DLMH 4Z7VE 5MHSE 5DD0H 1NGPL 1WWBX 4JZOB 5BV7C 3DXAA 4UINL 2R2BB 1JUFA 1AD0A 4TUKL 3TIEA 5DUML 4HEPG 4ELKB 2JJUA 1ZT4B 1XF1A 1OSPH 3SDDA 2ITDB 2VSCA 1S9WA 3HI1B 4M9OA 4PJEA 5C2BL 3FOMA 3RNKA 2E7LC 3SDXE 3C5ZB 4JFDE 4GKSA 5JIPA 1J86A 4EOWL 1NCWL 5EOQH 3O8XB 3MLWH 2VC2L 1IAMA 2BDNL 5JUEL 2XFXA 1MJJB 4O00A 2YD6A 4DKFL 1FV1A 5FK9B 2AV1A 2GTWB 4G9FB 4FABH 1U92A 2Y1VA 5T1LA 4LLVB 4XX1E 4OZFA 2FIKA 4XPGL 2ILLA 4MVBD 3TO4C 4K7PH 1X4ZA 3OKOA 3C09C 4WEBL 1Q72H 1EHNA 4HS3A 4LARL 3UTSE 1R5VA 3RVUC 2PXYC 1ZVHA 4XHJC 3IJSA 5HDQH 2GTZA 3AAZA 5AYQA 3GJEA 1A0QH 5IJKA 2XV6B 1Z0NA 4QHKI 2FWOA 3ESVF 5BVJB 5JQHC 5DJCB 2C9AA 4CU8A 1J12A 3TV3H 3U4BL 2EO9A 1J1PH 5IFHL 3AGVA 3WFZA 3F12B 3IVKA 2H26B 1KXTB 3ZKXB 1R3LB 4XWOC 1DBKH 1J18A 1YMHB 2LABA 3GJFK 2FEDD 4HPOL 4ODWB 5B3JE 1UWGH 4YHMH 1U8OA 2CJUL 1LO2H 5CHNB 4MJ2A 3CDCA 4P2QD 2UWEB 5CJQL 2DQUL 4LVNC 1YMMD 3VXME 2FJGA 4KKCD 5GGRY 4LQFH 4Y5YC 5ESVA 4AIOA 3TLRA 5DDHB 4K7PY 2J6EH 4FRWA 3EYOA 5DYOB 1KIQB 3ZYZA 1I85A 5FKPB 3UBXI 1SYVB 3MODL 1P7KA 1H3PL 3HLAA 2XA8L 3LSOA 3VXOA 1T66C 3WFEL 2OP4L 5IBLD 4R2GC 4EDXB 4EDWH 4BFBD 1ZSDB 4GG6E 4XGZA 5HVFB 3BZ4B 3I85A 4JM4H 3MRHA 1EZVY 3V2AR 2OTWA 3IDYB 5KVEH 2BRQA 1DBML 5J6HA 3X3GL 2O5XL 3KJ4B 4C56D 4PLOB 5BZWB 2MWCA 4LDEB 2RR3A 3H9YA 3PV6A 4AENA 2R4RL 5FYLD 3UTZA 4NKMA 1OAZL 1CD1B 1N7MH 4U1NA 3S6CA 1P7HL 12E8H 4PJ5E 4PLJD 4K9EL 4LLDA 3BRFA 5HHOE 2D7QA 4DW2H 3W9EB 1O7VA 2FGWL 1YC7A 3ZDXE 2HRLA 3BD3A 1MWAL 5H35A 3ULUD 1OM3H 3U9UA 3QSKB 5FO9B 3B2VL 3ARQA 4X6DE 1AGBB 1MJ8L 4CMMB 4RGNC 1TZIA 1W8OA 5C3LD 1YPZA 4X4ZA 5J13B 1MJ7L 1NGQL 1KCUH 1MNUL 1L9MA 2UYLB 4LCCC 5E70A 1KCSH 1FG2B 5C8JA 1RZJH 4XCEA 2AI0L 2FX9H 4J3UA 5E1AA 2QQLL 5ADOH 4LNVA 1QO3B 1F4XL 3PL6B 2BNRE 3CSGA 2BXZA 4N9GB 4IMKA 3WIFA 2P48B 4LLUA 3DURB 2VXSH 1MEXH 3MCKB 4XVJL 2NX5A 2V17L 3RWJB 1DUZA 1OTSD 2E7CA 2X1XR 4U6VL 1WICA 3MRFA 1FH5L 1FJ1A 1T5WB 1E4XL 2GIYA 4M1CD 3VI3F 3QEQE 3BOVA 3ZKND 5FB8A 2NY5C 5DMYA 5FO7A 2F8XC 2Z0BA 3OF6D 4CMHB 3NZ8B 2W9EL 3A67H 4LF3B 3L95A 1WUNT 2D9CA 4GBXD 2DMBA 3VXTA 1Q0XL 4HIEB 4OM1H 1IGYB 4HC1L 5E4EB 3S37L 3E6FB 2PR4L 5HI4C 5EWIL 1K2DB 1KC5H 3CLEH 2JCCF 1TETL 3T8XA 2J8UB 3GB7A 4ZUVB 3UAJD 5HHXL 3FT3A 3EDDA 4UIMB 3L3KB 5DJ8B 1G6VK 4MA3A 5EOCL 2Z8RA 5E95B 4WFED 1FLRL 2NXYB 5C92A 1FDLH 5DO2D 4XT1C 3GM8A 4YDLC 5DJDB 2EH8L 3RUGB 2CUMA 3S88H 4I77L 5FYKL 4Z7VB 1TFHA 3ARGC 4FQQB 4EUPG 4KJPC 4TQEH 3ZE2F 1G9MH 4S1RH 3IDXL 3N50A 5DURB 4WV1A 4BM7A 1KJMA 1K3ZA 3TIDB 1KGCD 2X44D 3DLQR 3TEUA 2YD8A 3LB6D 5E2WH 3ZMRA 4HS8H 4OLWL 5F89B 4UTAL 3LDBC 4Z7NE 3U0TA 1OAYL 4ELKA 1FN4B 3N1PC 5F9OL 1CT8A 2QBWA 2XRAH 3MRLB 4JEGB 4MD0A 5E2TL 2YKLH 4DCQB 5ABDE 1H3TA 1P2CA 1JWSB 3HAEG 4PTTA 1KCVH 2IBZY 3O8XA 2VZUA 3W5NA 1BBJB 4QHLA 4LGRB 4K7FB 2ZUUA 2QKIA 4Y19D 5FK9A 2R0ZH 3ZE1F 2E3VA 3W82A 4UV7H 4N8CH 2R2EA 3LHPL 4LLVA 2ORBL 3M17B 3I3DA 4K71B 3MJGX 3WEXA 1JV5A 1WQVT 3D25A 4X9GA 3TZVB 1QFOA 3R1GH 5ID0A 4P2QA 1MUJB 1Y6NR 4YXLH 2CDEA 1FFRA 1CLOH 1F5WA 1YMMA 3GJFH 3O4OB 2CMRL 4JO2H 1RVFL 1UM4H 5J9PB 3UTOA 2PYED 5HGBA 3V0WH 3HE7C 1LE9A 1FAIL 3RGVD 3QIUC 5ENWA 2E27H 5CJBA 5D7KD 2WZPD 4A6YA 2Y07H 5BZDB 3UMTA 3CK0L 5LQBH 3KPNA 5HYQA 2ADIB 1JZ6A 5BXFA 3MV9B 3OHXA 1BIIB 5IFJB 1S5IH 2GK0B 3BZEA 5BS0E 2H26A 3OR7A 3QAZB 2C3VA 5K9KB 2J8OA 2CXKA 3U83A 2BSED 1C12A 2SEBB 4LAQL 4C56A 1YNKH 1BM3H 4OLVL 1YMHA 5CSGA 5L6YL 1TNMA 1BBDH 4QYOA 4HV8B 3HS0B 1IC5H 4H88L 4I1NB 3TH2T 4LPUA 4YXHH 4JRWA 1QFWH 3IXAB 2VL5B 3ZT6A 4KUCF 4FQIL 1I8IA 3AB0C 5IF0B 4P2YA 4WFFD 1KIQA 1Q9OB 5BMFH 1ACYH 1IZJA 3CLFL 4HG4K 4WUKH 5CP7A 3PWLB 2C1OB 4GMTL 5I30H 3QDME 1DE4B 4U7MA 4WEUD 2UZIL 4QRUB 2HT2C 4G8GE 2VQTA 3V6OA 5H94A 2ESVD 4EDXA 2DJ4A 2H9GA 3P0VL 3VXQA 4KRNA 5JTWA 1A7NL 4DOHE 1NMBL 1JZ7A 2YRZA 4PJBE 1RUPL 1EA9C 2A38A 1EXUB 3BDXA 3CH1A 3FTGA 5FUOH 3DNKA 3VRIA 1P4IH 4Z7UE 3QG7L 5I18L 4QRRD 5CEZL 4KVNL 1ETZB 5EA0H 1B0RB 1U8MB 3L1OH 2UY7A 3PGDA 1OARH 3H0TB 2IANB 1QYGL 3NIGE 1K5NB 5EUOF 4YHKH 3MGTB 2OYPA 3BGAA 1ZS8B 2ZSWA 3BIKB 2FBOJ 2Q6WB 2F58H 3W9EA 5KVMC 3ARED 1MIML 4L5FH 1INEH 2W9LA 2HKHL 1DQDH 3IFLH 1ADQH 4PS4L 3C6SA 3EYVA 1FL3B 2JJSA 3FQWA 3HZVB 4NHCL 3K1DA 5DLML 5IEKB 1LO4H 5HPOA 5DD0L 1A47A 4CMMA 4GBXA 1MLCA 4PJFE 3VW3H 3MZGB 4I0KA 1GVIA 3MMEA 3DX9B 2QADB 4ZS6D 2AQ3A 3OKNA 4UMGA 4XP5H 3AUVA 1C8PA 3I2CH 2FSEA 1OSPL 2DWDB 2DI7A 3FONA 3BT2H 2CSPA 5CEXA 2W65B 1ZGLP 1C16B 4MQ7B 1A7QH 2C3GA 3QEQB 3WN5A 3PWNB 5HI3D 1XF3B 2D2OA 4P4KD 5EOQL 3MLWL 4U1JB 5SV3A 4YHYB 1S7SB 1E4JA 3PXJA 4MGXA 4AEEA 2BSRB 5E00A 3KXFD 2QV2A 3NPSB 4N5EC 4S11A 5GS0C 2OBGA 4CVUA 1LP9B 4HGMA 4Z9KB 5DHYB 4YPGB 4G7YH 4K7PL 3FO2A 1NC2B 1OTTD 1Q72L 2DN7A 1S7RA 2AP2A 3K4AA 3RIFF 4HIEA 1I9JH 2X4OB 1QG3A 3C87A 5T33H 4OGAC 5HDQL 3WXVH 1DSFH 3ISWA 4R26L 5K33A 2WUBH 4PJAA 1A0QL 1R6VA 4Y5XB 4ODUB 3SDAD 3L3KA 1MAMH 4PYHA 2XN9D 1EEZA 3TV3L 1XZ0A 1J1PL 4OBRA 4PJ9D 5B21A 3D3VE 4HGWB 4F7EA 3SGDH 5HHVH 4Q0XH 5A1AA 3CFKA 1WAAF 3LRGA 2W07A 4OFPA 4M7LT 4N68A 4X7TB 3SJVD 3ZHDA 3GMRB 4Y19A 4IRSC 2B20A 1DBKL 5C08D 4P23D 3D18A 4IHOB 1UWGL 3TO2A 3QUYC 4LQFL 5AZEH 2AXFA 3IDNA 4JZJA 3PGFH 2A6KB 2XPGB 3FQNB 3F6IA 2PYEA 3ULVC 5FM5O 1EPFA 2W0LA 4L8BA 2EDTA 1S9KC 4UT6L 3RGVA 3HCVA 5IIEA 3PG2A 4DCQA 1CDCA 4APQB 3VGAC 4EDWL 4ZO7A 3VFPA 3L5HA 2NW3B 5F9JA 1NEUA 3OGCA 1KF9B 1T1ZB 1NCCH 2VLRE 5KVEL 3DXAE 2CH8A 2EE3A 3K81A 4WRLA 4RQQA 4RGMB 2ZCHH 1MFBH 2ZUSA 2PTTB 4I3GA 1N7ML 1U93B 3PWVB 1XIWB 1XT5A 4Z7WF 1UXSB 12E8L 4PJEE 4QOKD 2YD4A 3ZTNH 2VL4A 1G7QA 4DW2L 3V7MA 3GSXA 4X7CC 5D70H 4R96A 3W9DB 4WFGE 5J9PA 4KJQC 4CW1B 4JM2C 3KPOB 5FYJU 5IROA 1Y18B 1JF1B 2BVOB 3DX7A 3C8HA 2XWBA 5EB9A 5KSAD 2BHUA 4I3RH 1NLBH 5FUCC 1BFOB 5D1QC 1OM3L 5IKCB 3Q5OA 1FNSH 3DMMD 3CZFA 2JB6A 5GXBB 2ESVA 3MV9A 2WV3A 3RPKA 1BIIA 5IFJA 5E7FA 1KCUL 1T04A 4M7ZC 4NN6B 5K9KA 5L0QC 1J0HA 4EI5C 1KCSL 4B41A 1RZJL 2MQ3A 2FX9L 5JW4R 3TN0B 3K46A 5ADOL 4QRRA 3ARYA 4B53A 1MELA 2HFGH 3WNLA 3UJTH 1L6ZA 4XPBH 3IXAA 1L9NA 1MEXL 1T3FA 4HUXB 4LLWA 5A3IC 4GSDH 3DX8B 2YN5A 1UYWH 3AC0A 5IF0A 4U1LA 1PD6A 1NFKA 4G8GB 4L4VD 2J5LC 3AREA 3TP4A 4PJHA 1V5JA 2C1OA 3CDGA 2DYPB 4AMKH 4QRUA 4Y4FC 3NCFB 4WWKD 2VDPH 3BYTA 4JQIL 1OP5K 5IUSA 5E6IC 5ISZD 1JGDB 4L3ED 2RB8A 4R8WH 4I18A 1CTNA 4MX7A 3UTTB 1WSST 5HVHC 1AO7D 4OM1L 4PPTA 2VISA 3ARFD 1UJ3B 3STLB 3ZKMD 1KC5L 4Y4HB 3CLEL 1XF2A 4PBWD 1Z0MA 4XNYH 4XNUH 2DAVA 4PY7B 4HZAA 1PYWA 5ICZA 3CVHL 2IANA 1KPUA 1QLFB 2H1PH 2N56A 4M6AA 3IDIA 3BIKA 1FDLL 3I3EA 1VB9A 1V7MH 4P4KA 3OKEA 4LKXA 5FO8A 5HHMD 1LK3H 2NTFB 3M45A 3S88L 4K07A 2DF3A 1UB5B 3H2WA 1XEDA 2NY6D 2ZUQB 3BZFB 4JDTH 3KXFA 4TQEL 1G9ML 1KB5B 4S1RL 1FL3A 2BX5A 5CBEA 4LKCB 3WLBB 3RWGA 3MRQA 2C7UB 3CC5A 5E2WL 3WFCH 5CD5D 4HS8L 2C4XA 1QRNB 3BESR 3WS6A 1FGNH 3DX9A 5JOPE 4R7DB 1KELH 3OKDB 1ZVSB 3DROB 5I17A 2XRAL 4IDLA 1FO0B 4LVHC 4YZFF 2YKLL 2VITB 3PDOB 3SDAA 2NXZD 2XN9A 4GKZB 4OZHB 1PZ5A 5IBUB 4PG9A 4J3WA 4PJ9A 1KCVL 4U2YA 4WEMB 5GGQH 3G5YB 1EMTH 4Z76B 2PW2B 1II4E 1EH9A 1G0XA 4M02A 5MEOA 1YPZE 1JI2A 3I6KA 2IFFH 4OUOA 5I1EH 1CBVH 1SVZA 2R0ZL 3D85D 3SJVA 1N26A 2OZ4H 4UV7L 4N8CL 1BECA 4DFHA 5C08A 4P23A 5F97E 5DHYA 2ICWA 2LFGA 2JLLA 2VLMD 3QR2A 4F15C 3IDGA 3R1GL 1I3RA 4R0LC 4HX1A 1LK2B 4Y2DB 4MNHB 4HKJA 4YXLL 1CLOL 1QRND 1B3JA 2CXGA 4PJXF 4GW1A 5DZLA 1UM4L 3KYOB 1A6WH 1CFVH 1KTDA 2G75A 3HZYB 2DMCA 3V0WL 5I8OH 1QLEH 3D3VB 4BUGA 2WQRA 4TTDD 2NY7H 5LQBL 2DOCA 3BD5A 1QFUH 4HGWA 4RX4D 1HHHB 5HSFA 1S5IL 5C9JA 3BGMA 3QQ9D 1N64H 1RU9H 1TVHB 5J12B 1VEMA 3BPCB 4HLZH 5GGTA 1YNKL 1BM3L 1CGXA 3ZDZE 3FHAA 2JJWA 1FORL 1KIUA 4RAUA 1BBDL 3FQXB 4WW2B 2WINB 1IC5L 4AIZA 2X4SB 4YXHL 1QFWL 5D2NC 2GK2A 3V4UL 1ERNA 5J3HC 4QOKA 3WL9A 3C5SA 2FJFB 3QUZC 4QXTA 2QTEA 5K9JL 3BPNB 3RVXD 4NO0D 4RBPH 2AGJH 3QO1B 4GO6B 2XPGA 4FXKA 5BMFL 1ACYL 4WUKL 3RIAK 4ORZC 4UDTB 5I30L 4OF3A 1T4KB 5KSAA 1WFUA 3T77A 3IGAA 2OQJA 4XCCH 2CDGA 3DMMA 5C09B 5E8DL 1GOGA 2NW3A 5IB1B 15C8H 5EU4B 5DUBA 1G7HB 1T1ZA 4NQTA 4NUGH 5FUOL 3NCJH 3VFRB 5EA0L 3MSPA 2PTTA 5CLWA 3H9ZA 5F7HA 2WM0A 4RNRB 1OARL 5CZXC 1WZLA 1A8JH 4YHKL 3WFBH 3ZDYF 4OV5A 3CX2A 3AFLA 2R9HC 2H41A 2F58L 3H9SD 3WHXB 3GGWA 4L5FL 3KPRB 1INEL 1AXSB 1NGZA 4L4VA 3ZSSA 3SE4C 1DQDL 2AJYH 3IFLL 1ADQL 4KV5E 5E9DD 2NY2C 4NYLA 1G7JB 4WWKA 1AP2B 4L3EA 3QNYB 3AM8C 4XHQA 3O11A 3ELAT 4RDQG 1Q38A 3VW3L 3U6RA 4P2QE 1AO7A 4DUWA 1YMME 2HTLC 1OP5H 5DJAB 3ARFA 3EHBD 1A4KA 4XP5L 2A6JA 3MA7A 3O9WB 1T0MA 3I2CL 4I9WD 2YEZA 4ERSL 3BT2L 5HYJB 1B6UA 5INDB 4X6CB 5ANMA 1A7QL 1I7ZB 1CLCA 5A2FA 3DX8A 1I7TA 4KMLB 1JTPA 3S4SB 4NQDD 4RAHA 3GSRB 5KSVA 1K6QH 3M07A 4LOUD 3KPLB 5GRZA 3ARDD 1A6AB 1OTUC 2R0KH 3SDCD 4FQJH 3RI5K 4C56E 3E3QE 1JZ3A 4G7YL 2B1HH 3SGEH 3ZE0F 3FZUD 2DTML 3PDDA 4KRPC 3UTTA 4FQPA 1I9JL 1QLRA 3OJDB 1QPXA 2APBA 5F7LB 1DSFL 4QXUH 4S1DC 1QA9B 4JO4H 4Y4HA 1AR1D 4LIQE 5F7YC 3JVGA 4G6AC 1CE1L 2EE9A 1W0VA 3QUML 1MAML 4HDIA 5ERWA 1FYTD 3RKDD 1DDHB 3ULUE 2VKWA 5HHVL 4Q0XL 3HB3C 4NIKB 4Q9RH 3MUJA 2AK4B 4B7LA 1UB5A 1JHTB 5FECA 2F53E 1JPGB 3D85A 3C5ZC 5DGRA 3MNVB 1RK1B 2QQNH 4IOSD 9CGTA 1GGTA 1PKOA 3O8XC 4KC3B 1FLTX 3SE3A 5E6YA 2AABH 4Z7QF 5CUSH 4M4PA 3MRPB 3HNVH 5AZEL 5K9QI 1QRNA 1LO5B 3PGFL 1H0DB 3VWJC 3VFMB 1Q8MA 5D1ZD 3DROA 3LRHA 5KSBA 4G6MH 3HFMH 5C7XH 5C2UB 5F6HJ 5D2LA 2BHZA 1AGFB 4WI4A 3TPUB 1S7XA 4RX4A 4HJJL 2IALA 2IQAA 5IB5A 1NCCL 4I13B 1KENH 4PG2C 3B3IB 3B83A 1Z9SA 1ZXQA 1UH2A 5C9KA 2ZCHL 5E2UH 5E8NA 1MFBL 3SBWA 4DJMA 3LKQB 4LSSH 2K3TA 1OCWH 1FVDB 2BC4A 4EI6A 3ZKXC 3VA6A 3D2UD 4WFEE 5D70L 5C0BD 1E27A 1JMXA 3MGOB 2ZSVA 3AROA 3MRRB 2P8PB 3OXSB 1FVCB 4QRQA 4HWBA 3OXRB 4I3RL 1NLBL 4YE4H 1ORSB 1QSFD 5ID1A 1FNSL 1CZ8H 1RUKH 3VWKC 1J1OH 1J0KA 4E42A 2R2HB 1RHFA 3GMLA 1DQJA 4P0DA 1UEYA 2R1YB 1KGCE 1TVHA 1BJMA 2Z31D 3O41A 4OKDA 3HTLX 4JPVH 3RX8A 3UPCA 4YDIH 3LN4A 4MJ6A 3RY6C 1D5ZA 2HFGL 1MH5B 3UJTL 2UZXB 2X4QB 3UTQA 1FSKB 1WZ1H 4XPBL 4DGVH 3IDYC 4KY1H 2EXWC 4GSDL 4YUEH 2HT3D 1UYWL 3KJ4C 5T1DL 4OKVB 4UU9B 3H9SA 4ZUTA 2BNQE 2X4RB 4JKPL 5AUMA 3V6ZA 4K8RD 3OKYA 1JFQH 1BGXH 1UQSA 5FGBA 2PO6B 5MEQB 4UDTA 5DHVH 2Y72A 4PLKC 4AMKL 2DQHH 4GKOA 2VDPL 5E9DA 5LBSH 4IOFD 4R8WL 1DQTA 1ZA6A 5C09A 3MRBA 5EBGA 2W60B 1EBPA 1WC7B 5IB1A 4ZTPH 3RZCD 2PYFB 5CSBA 3K80A 4RA0C 2DDQH 4PGZA 2AXGA 3HPLA 5DI8B 3F5WB 2VABB 2C3HA 1BD2D 2PYEE 4MXWH 5K9OB 4XNUL 4XNYL 5D7LB 4F37F 2R1XB 2ITCB 3CMGA 4RNRA 5J13C 5I2IA 4I2XE 5AAWA 1AIFB 5D7KE 3Q48A 4Y16D 3DIFA 4MD5A 1RJZB 3ARVA 1U9KA 4QCIA 5IQ9B 4KK6D 3KPRA 4NRYA 3LPGA 8FABA 3IDUA 3PL6C 2K7PA 3OJ2C 4LK4A 1CE6B 4JDTL 3JUYA 1TTFA 1GOHA 2BVEA 4GFTB 2VTFA 4YDVB 1DLHB 3U0WL 3TJHD 2O61B 3WFCL 3VI4F 3VFGH 1QFPA 4AL8L 1T03H 5GPRA 3M1BA 4KUCD 4HFWB 5DJAA 4E41E 4CMHC 1AGDA 1KELL 5T1KD 5EUOB 4OUUA 1MFDH 3U30B 4JJHA 4QO1A 3ECBB 2CLZA 4WFFE 1H8NA 2X9XA 3BUYA 4Q6YA 2NQCA 3VFVB 1XGYH 2CLVA 2MQ0A 43C9B 3C5JA 1FYTA 5GGQL 4NDMB 5BW7A 1B0GB 4YGVA 1EMTL 1FZMA 2NY3D 5EU3A 1U6AL 2ESVE 4WDIA 1OF2B 3LQMA 3KPLA 2IFFL 5I1EL 5FM5M 1IAOA 1VKXA 2BP3A 3IFPB 4DN4H 1B9ZA 1NCDH 3SGJA 4U6HB 4W81A 3ZKSD 2NXYC 3TBVB 1SVCP 2EDWA 1CICD 4S0TD 3VA2C 1LE5A 4Z0XB 1LO3L 3U36B 5F93C 1WGOA 1FBIH 4LCWD 1U42A 3I6LD 5EIIB 1CFVL 4X9IA 3SKJH 5I8OL 4XTRC 3MXWH 1QA9A 1KNOB 1QLEL 4WGWB 4O2CA 5EO0B 3K8KA 5D1ZA 3HR5A 3MJ6A 4MLSA 5BJTB 4C58B 5ESAB 2NY7L 3UYOD 3VRLF 1F90H 2NZ9C 4BK5A 2ATKB 2Q8AH 2AQ1A 4Q97A 4LEOA 3HC3H 2H2SD 4PJGF 5CJOH 4YHOL 2F53B 1IQWH 3N1QC 1ACZA 2IGFH 1N64L 1RU9L 1JK8B 2P5EB 2WUCH 3J7HA 1I9IH 3QPQC 3VJ6B 1JPGA 2ARJB 2VQUA 3T2QA 3IB4A 5I16B 1NJ9A 4BFIA 5B3NA 5FDWA 2N7AA 3HZMB 1JI1A 4ZUUB 1AI1H 2JCCA 3S3PA 3PV7A 4MJ5A 5EU6E 2X05A 2AGJL 3D2UA 1PDKA 5C0BA 2EXYC 4K71C 1HQ4B 2BVUA 3QDGB 4HQQH 4MCYB 4RA3A 3TZVC 4ZD3H 5DJZB 1Q9WB 3S3SA 3EJYD 3WV0A 1JPTH 3K4DA 3MYJA 4TOYL 3KXFE 3CFEA 1QSFA 4YAQA 5ESQB 4XCCL 1IARB 1JMZA 3EGSB 4U2ZA 15C8L 5HY9B 4OLUH 4NUGL 3V6FB 1JPFB 4YO0A 3PABB 5EBMB 5F3HA 1HYSC 4M8QA 4NJ9H 2Z31A 3NCJL 4XPTH 4DZ8B 4UB0L 3IRPX 3QAZC 1P1ZB 4JY4A 3WFBL 1JF6A 1T22B 1YQVH 4JDZB 3QFDA 5D7SH 5DVLA 3W39B 4U6XB 7CGTA 5DQDH 3LIZL 4M3JA 2R56L 2Y9RT 3O0RH 5L7XH 4EQ3A 2AJZB 2NMSA 3QZWG 5TGBA 4OGXH 2AJYL 3C60D 5HVGB 3KDMA 2V9RA 4JRYD 3SKUD 1HHGA 2DL2A 1O0VA 4MCZA 4M6NH 1JNHA 5EZLB 2A6IA 4R3SB 3B9AA 4L4TD 5C08E 3NPZB 1B2WH 2VSDA 3U7YL 4LLQA 1RIVH 1WITA 3RZCA 1B88A 5JIIA 4NKDB 3FQUA 5IJVA 1IGFH 2XT1B 4X4MA 1AFVH 3UPRB 3BDYL 4XNQB 5TH2B 1ODAA 1BD2A 2ERJB 1MH5A 1ZKAA 3B2UC 4M6MH 4DTGH 1CR9H 2BNQB 2OSLA 3PQYD 1TQBB 3RL1A 1U8NA 3B9KD 4Y16A 4MA8H 1CFBA 5T5NG 4FNLH 4R4BA 1K6QL 2Y7QB 5L2KD 3QDAA 2CUIA 1DVFD 4LPXA 2HVJA 3PIQB 4YNYB 2EICA 1PQZA 1CL7L 2R0KL 4FQJL 1KPVB 4RDQF 3SOBH 3KHQA 4NO3A 2B1HL 5IG7A 2P8LB 2HLFD 3EZJB 1KB9J 3ROLB 4UQ2A 1LO0H 1GC1C 4QOKE 1NC4D 3L3GA 4K55A 4F7MA 3PHQA 4QXUL 3FO0H 3TCLB 4S10A 3MBEB 3P3YA 4I2XB 3EOAB 3TA3D 1IEBB 4BJLA 3RJDA 5AYUH 4LEXL 4GRWF 4PRBA 1X7QB 3HNSH 1MFEH 4YGAB 2I07B 5E24E 2QADC 4G7VH 1MCEA 3T2NH 5GRXG 5IQ9A 3GSVA 4Q9RL 5F6HI 3FQRA 4IM8A 5MP6H 4H1LG 4PTUB 5F88B 4YHLH 5C0AB 2QQNL 1KCLA 3CXDH 3DX6B 4YHYC 4E41B 2AABL 4ZG1A 5CUSL 1CICA 5J11B 3HNVL 4JY6A 2YC1A 5JXED 5FXCH 3NPSC 2D7NA 3G04B 4LCWA 4HFWA 1I1AD 1DBJL 5EUOA 3EYSH 3ECBA 3HFML 4G6ML 4KH2A 4L4VE 5IM7B 5C7XL 3V7AE 4HUVA 1ZWIB 2VH5L 3RPIB 3VFVA 2IPUK 4JN2B 2Z93A 1YN7B 4NDMA 1D5BB 3KPSD 3B8SA 5ISZE 5GS1A 2E9JA 4L3EE 4OF5A 1LEIB 2ZP0T 2V7NA 5GGUB 2MMXA 4JFHD 4NQCB 4Y5XC 1PKQE 3GSNH 5FYKE 3VGDA 3FAWA 1P9MC 3Q3GB 1AO7E 2F74B 5KANI 3JTTA 5E2UL 1WVZA 2YHGA 2ICWI 4L9LA 1BQHG 4LSSL 3OPZL 1OCWL 2A9MH 4MB3A 4HS6A 3X13B 5ANME 3EYQD 2VMFA 4AQ1B 3QIBB 4KHTH 1Z3GL 1KYOJ 4DN3L 3KLSA 4ODBD 1B6DA 2X7LB 4GAGH 2AEQL 2X41A 3BN9D 5HHME 4J3OC 3MV7D 1YQ2A 5BJTA 2A6DB 2C26A 4PRNB 4YE4L 5D5MB 2P42B 5E8PB 2ATKA 3T04D 1PEZA 2VZTA 1H5BC 1CZ8L 5EC1B 4Z18A 5E7BA 3CVIH 2ZCKH 4UUJA 4POZD 1PEWA 2G2RB 3UZVB 4MSWA 3EAKA 1WTLA 3A6BH 5CINH 4MNGB 2P5EA 2VOTA 1WISA 4U1IB 4APQC 1VFBA 2B4CC 4JPVL 2X4UB 4P5KA 4YDIL 4FQ1H 4BK4A 5EU6B 3LMJH 1WZ1L 4NNXA 3HZMA 4DGVL 5JA8B 5KVGL 3HAEB 3NFNB 2CRIA 4KRMB 1M05A 4KY1L 4PJCF 5BRZB 1N59A 1TJHH 2Y36H 4RGMC 2KPNA 3FO1B 3VD9A 4XPHH 2YMXL 1TXKA 4Z6AT 2X4NA 1HZHH 1LVEA 1SEBA 2F5BH 3UC0H 4WHDA 4U31A 1JFQL 3DRTA 1XIWC 4MCYA 3L3IA 1WAAA 3EDEA 1UB6B 4WI5A 4KHXL 2DQHL 3BH8B 1UC6A 5LBSL 5C1MB 3DRQB 4PP2B 2QSTA 4L4TA 2CPCA 4N0CC 3EOBB 3CFBB 1ZHNA 3EGSA 2XTJB 1P84J 2VLME 5IB2B 3OKKB 4NQXB 2DDQL 3PABA 3P40A 2EIZB 3K74B 4NWUH 1I8LA 1SQ2N 4MXWL 4BQBA 1IT9H 3CSPA 4HIJB 1D5IH 4RMRA 3QEUA 1IGCH 2FRGP 4S2SA 3T0DA 5D2LE 3IF1B 5IW1A 1UWXK 1FFOA 5JW4M 1IQDB 3PQYA 4NN6C 5DJ6A 1F4YH 3L9RB 4J1UA 2WWMD 4PYGA 3TN0C 4R90H 2P24B 5L2KA 1A64A 1J0ZA 4J6RH 2H2PD 1T80A 3C8DA 4F9PC 2DTSA 4XBGA 2FGZA 3OKMA 4X9BA 4WFHE 2X40A 5GS3A 1UZ6F 3HG1B 3X14B 1FIGH 2BNUA 2EDLA 3VFGL 1T03L 2CKBH 4Z7WA 1NC4A 3MRCA 4DZBB 4QNPF 2DM3A 5GZNC 1MCNA 4WU7B 1MFDL 1SYSA 5IOPB 1SJEA 3MFFA 3MJ9H 3TA3A 4WY7H 1U2HA 1X5XA 3BZDA 4ODVH 1XGYL 5EN2B 4XVUD 5EDXA 2GW5A 2YSSB 1UJ3C 5CEYA 3FKUS 1MWAB 2VAAB 3CFJA 4P3CH 5EO1B 5DRXB 1T0NA 1SHMA 3P30H 4Q2ZA 2ADJB 2VDRH 4DN4L 4CN1A 5E1HB 1NCDL 2XG5A 4KKBD 2L7JA 4TNWK 3NCCB 1DANU 3ULVF 5DFVC 1W72H 3ROLA 3NZHL 4KXZH 1VFOA 3QA3A 5F96H 4XAWH 5KS9F 1QSEB 1G7MA 1FBIL 2VDNH 4NSKB 2AEPH 2ZUQC 1M4KA 2FEEL 3ILQC 3AU1A 3MRNB 3SKJL 1I1AA 3MXWL 1CGSH 3H9SE 1CCZA 4Y5VA 5KVDH 1F90L 4W70A 4G6JH 4X6BA 2Q8AL 3O6MH 3BO8A 2CIIB 1L6XA 3DUSB 2I07A 5CJOL 3C8KA 1IQWL 3C08H 5AD0A 3KPSA 2IGFL 4PREA 4BSVA 5JXAL 2WUCL 3MV01 1ZOXA 2VDOH 2FIRT 3BXNA 3IXTA 2P7TB 1I9IL 5IK3A 1GGBH 4M6OH 4LDLB 1GZPB 2YPVH 2OL3H 1S7WB 4I9WE 4JM2F 4JY5H 2R39A 3KYMA 1ORQB 1AH1A 3B5GA 1AI1L 1URLA 1AQDB 2GFBA 5ITFB 3DV4B 1FIEA 2DQGH 3RGHA 4UZGA 4NQDE 2DQJL 1GHFL 3D48R 4ZD3L 5IVOA 3CDFA 3U0PA 3MV7A 4Y2DC 1JPTL 4LHUD 4D8PA 1UXWA 3VXUD 1NKOA 1PKQB 5F21B 1YY9D 4PRIE 4Y4KB 3MA9H 1HE7A 2ZG3A 1D5BA 4U33A 1LEIA 1CYGA 5GGUA 1ZLWH 3X12B 4OLUL 1QVOB 5GSRA 4NJ9L 3SY0B 5D6DC 4XPTL 1M7XA 1JWMA 1WV7T 2IADA 5SX4I 4R6UA 5J12C 4G5ZH 5D7SL 1FYTE 2AVGA 3EYFB 5DQDL 5IVXF 1N5YH 3DTXB 3MLPA 5JO5B 4P46B 4NQSB 4WW2C 5AG9A 5L7XL 2H6PA 2HA1A 4JFEE 2XOTA 3SKNB 4OGXL 1FRGH 1ZT1B 3B5TA 4EUPA 3G08B 4M6NL 5D5MA 4GKNA 5E8PA 1K9TA 3P73B 3BPNC 3L7EB 4L8DB 5JW4Q 5C0FA 1B2WL 1W2KT 2IH3B 1RIVL 4FXLA 3B4NA 4AQOA 1MAJA 3EFDH 1E6OL 2DM2A 4N1CA 1IGFL 3GUTB 1AFVL 1A9EA 2V9TA 4PJXA 4AT6A 5LGHL 3EOTH 3HMWH 4M6ML 4DTGL 3PP3K 1CR9L 3HAEA 4G80B 1A6TA 3G6JF 3N9GH 1G7LB 1KUMA 1Z5LA 2KKQA 3FO1A 4MA8L 3L3JA 4FNLL 1HI6B 4P46D 1QACA 1FG9C 4ZNCD 1KCRH 1HSBB 4BUHA 1BLNA 3RRQA 4IBLT 4Z7OF 1UWXH 3NIFE 1UB6A 3QUXB 3SOBL 4I0PB 2BMKB 3W11C 4MXQD 4CNIB 1ONQB 4OCSL 3KPMA 3TBSB 3EDFA 5TDPB 1LO0L 1RSFA 3FFCB 4QT5B 4H8WC 2JCCE 1B4JH 5EZOH 1W0WA 4NQXA 4LCYB 4GMSH 3FOLB 3LKPB 2HJKB 4WU5A 1I4FB 4Y7MA 2HJFB 2AV7B 4DFIA 4M48H 4YDKH 3L3DA 5AYUL 2WW8A 5T5NF 4ODSH 4F9LC 3HNSL 1MFEL 1MCPH 5C0NC 3NCEB 3QIWB 3B6SA 4EEEA 4EZMA 3U9PH 4NRZB 1HYRC 4G7VL 3T2NL 3O9WC 1DEEA 3QJHB 3VH8B 4IRJB 4PJDB 4ELMB 2ZZUT 1HXYB 5MP6L 4WHCA 4YHLL 3U2SA 3F7VB 3BYYA 4OGZA 2I9TA 5E03A 2EYTB 5C07B 1HIMH 3LKNB 1CFQA 2NLJA 4FMFA 2I5YH 1YEDB 3WLWC 35C8H 5IEHB 3P9WB 5L8LB 4QHNB 2JJTA 3EYSL 1I8MB 5KZCD 5L8KB 1H15B 4NWTH 4JG1H 3SPVB 4UILL 1OGTA 3LQZA 5IGXH 3LS4H 3MLXH 4MHHI 2BVQA 3ZE1E 1T1YA 2VAAA 4DGIH 3BI9X 4MAYB 1S7UB 3Q1SH 3GSNL 2Y23A 4X7DC 2DBLH 2FLBT 1X5IA 5I8EA 5K59E 2BJMH 5EIVA 2L4OA 4OFVA 3T09A 3QNXA 3CD4A 4O2EA 4X5WA 2F54B 1P7QD 1RZIA 1PBYA 2LQRA 1CDHA 2NY4B 3O3EA 2AKRA 2ARWA 4FG6C 4K3GA 4KHTL 5EBWB 1GGIH 4KK9C 4PBVC 4TUOB 5DMKA 4GAGL 1U95B 1XMWA 5LGJA 1FC1A 4P4RA 4HWUA 2Z4QA 2MKLC 3TO4D 4J8RB 3TYFB 1JGUH 2R69H 3MNZA 1I9EA 2Q8BH 4OLYH 5DJ2A 3S97C 4Z8FH 4LHUA 2CIIA 4JAMA 1U3HB 1AGCA 3VXUA 4BZ2H 3RVUD 3S8WA 4G42A 1FYHB 2ZCKL 2PXYD 3M8OH 1QEWB 4XHJD 3L5XL 5GGRB 1WZKA 3A6BL 4UT7H 4FN0A 4L29B 5CINL 2YR3A 3LPFA 3RWCA 4ZO9A 3MJ7B 4FQ1L 1GJIA 3BP6A 5HHPB 1QFHA 3NCYP 1DFBH 2HKFH 3TFKC 1CDJA 4YHPA 4JR9L 4L3CA 4M61B 4XRCB 1TJHL 1ZAGA 2Y36L 3DV4A 3VFOB 1QQDB 4XPHL 1INDH 4LLYB 1HZHL 3BGFB 4GRMB 3CXHK 4XWOD 2F5BL 2GCYB 3O2VH 4MAUH 5E94B 3ROOB 3UC0L 1K8DB 3VRJB 3MRDB 4PRIB 1Y6KR 3F7PC 3HHRB 3I3BA 3WHE0 1WIUA 4KDTA 1GGCL 1NDMB 4G8IA 3RKPA 4Y4KA 4I5BA 1YUHA 2CIKA 1MCSA 4YBQC 4ZOAA 5D7JD 1E28B 2YBRB 5BQ7B 4JKWA 3VXSB 2QJDA 1JGLH 4U4BA 5DJYA 4LCWE 1T66D 1U8LA 4NWUL 3I6LE 4R2GD 1IT9L 1D5IL 3IJYA 3X3FH 4X7FC 1XF4A 1L7IH 5I1DB 3EUUA 2VR4A 1NCTA 4OIBA 5SWZD 3VGGA 3ESUF 1R3KA 1F4YL 4Y8DC 4GRLB 1TMCB 1YEIH 4P2CG 1Q9KB 5F7WC 4R90L 4P46A 1T7ZA 5MEND 3PP3H 4J6RL 1FSKC 2IPKA 4P48A 1VEPA 4HIXH 4WI2A 4LCUB 2Q1EA 3IJHA 4X7EC 2R4SL 1RZ8B 1FIGL 1T21A 4WTZG 2CKBL 2PO6C 5EFIA 3EOYG 1JF5A 1RZFH 1GAFL 3NACH 3BP4B 2G5RA 3BEVB 2GY7B 1SBSH 4U1SB 1NLDH 4XP9H 3MJ9L 4A6YH 2YPLD 4WY7L 2H32A 3GHEH 1OD7A 4X4XA 4RGND 1VCAA 3CPLB 2IBGA 2YD9A 1D5MA 2BCKB 4HUUA 2ZUWA 1OAXH 2G5BA 3FCTB 5JMOC 4KU1A 1TTUA 4JQVC 4RMTA 1HSBA 2OMNA 3P30L 1HHKA 3DUUB 1OAQL 1KG0A 5FYLH 3GBMH 2IMNA 2VDRL 5EUKB 4ZTOH 1U8QA 4NO5B 4U6YB 1Q9LB 3HNTH 3V8CA 3BW9B 4KQ4H 3NVQA 4IIQA 5INCB 3HUJE 5CWSB 4Z95H 3JBG7 2PTVA 1IGTB 3ZHKA 4XAWL 4YDLB 2VDNL 1CDIA 2AEPL 3SKOA 1HCVA 4LIQH 2Q86B 2P5WE 2HJKA 1A1MB 1I4FA 3SKMA 1JBJA 1MHCB 5GHWH 1CGSL 3P9LB 4I3SL 5KVDL 5D6CB 2AJUH 3UROR 1KPRB 4ZO8A 4KVCH 3ULUH 3UJIH 5JPNA 4CVZB 2XKNA 4G6JL 1WAAE 3O4LB 3O6ML 4JRYE 4JFYA 1UT9A 4G8FA 1MCLA 3C08L 3NCBB 5HI4D 4RZCA 3U30C 4IRJA 3BFOA 1T1WB 3MJ8B 4PJDA 2VDOL 1RIHL 3BSZH 1GGBL 4M6OL 1A22B 3F7VA 2DD8H 4OZGB 4PRAA 2E7LA 2OL3L 4MDIB 4QRTA 4JY5L 3ES6A 2DWEB 2R29H 3P4LA 1OAKL 1P7QA 3DSFH 5EG6C 2UWEF 3LN9A 2AJVH 3PQYE 1C7SA 2Y5TB 4GUPB 5C0DB 3L7FB 3OV6A 5T3ZD 3ARGD 3WUZA 4ISVB 3CVHB 4KJPD 4MZ3A 1I8MA 3R06A 5L2KE 1N0LA 1QFWI 4OF8A 5HJ3A 4CADA 2FD6H 3TO4A 3QDJD 3RBGA 2Z8WC 3MA9L 2XA3A 2PXYA 5C0CB 4HIIA 4L8SB 1U8KB 3DO7A 2DIAA 2IEPA 3CSYB 1S7UA 2D7PA 1DEDA 3BH9B 3HE7B 4LPYA 1F8TH 4Z7WE 4XXDB 1BZ7A 3BD4A 4ZQKA 4YFEA 1N0XL 1M71B 4TSAH 4XMKH 4U6TA 3WS3A 2E9BA 1KLUA 3IU3A 4AM0A 4ZFZA 4KMQA 3UCRA 4G5ZL 3KLHC 5SX5K 5B39G 3I50H 1N5YL 1S7VB 1FL5B 4PV9B 5IMMB 4ZUWB 1XH3A 2H3NA 2M1KA 4JHAH 3GRWH 3RFZC 1H9VA 4HK0A 5EOTA 1V8HA 2PW1A 3TVMB 1NAMA 1FRGL 1QBBA 3TYFA 1KLGB 2X70A 1RZKH 4X6FA 1F13A 2K9UA 3MROA 1LDSA 5CP3A 2VQ1B 4Y5YA 3D9AH 3D0LA 3K8MA 4J3XA 1I1FA 3RIAF 3VXNB 4LGSB 2GKIA 4UV4L 4YHNA 1EAPA 1LDPH 3EFDL 3STBA 1PJ9A 4NCDA 3QIUD 5E2JA 3MJ7A 3EBAA 2X9WA 3GJFB 5J6GA 1HH6B 3HMWL 1HHJA 4JO3L 2ZUYA 4M62H 2YA2A 3EKCA 2XY2A 5SWZA 4MJ4A 1FHGA 4D0DB 5DVKA 3U48A 1QQDA 2FR4A 4AZ8A 4LLYA 1A2YA 3KPSE 1S8DB 1KCRL 2NY0B 1XGQB 3BMWA 4PJGA 1KT2A 1LD9B 1YEHH 4FZEL 2FL5B 5ELIA 1VFAB 1ND0A 5IBTH 4LRNH 3MLRH 4U49A 1QPPA 4X4YA 3GMNA 3VXRD 5CD3B 3DGGB 2R15A 2E6JA 3STZB 1B4JL 5EZOL 1PX4A 3QHTC 3VXSA 4GMSL 3R8BB 3QXVA 2OTUA 1XGPA 2JIXB 1G6RA 2HT2D 4ONHA 4M48L 2FYYB 4YDKL 2XY1A 3P4NB 3ZYIA 4YLQT 2J8UF 5I1DA 2YPLA 3THMH 3F7YA 1INQB 2Z91A 4P3DB 3MO1B 5FA3A 1MCPL 2DKSA 3WIIH 5H37G 4AIXA 3U9PL 4Q7DA 5LG1A 2LVEA 5IVZB 4LCCA 1X5FA 3KG5A 2DQDH 2HWZH 1KN4H 3HR6A 2ERJC 3VFTB 5KVFH 4Y2OA 5IBUG 1X4YA 3RUGF 2X1WL 3MRJB 3GHBH 4Z7VF 4ZPVB 1TQBC 3WKMH 1NFDE 1HIML 4OCMC 2P8MB 1BIHA 4GS7C 3BP5A 1RZ8A 2I5YL 1HILB 1PX3A 5DQ9B 3QFJB 3QQ4B 3B9VA 3ZZ1A 4QRPB 35C8L 2VE6A 4YZFE 3BUTA 3BP4A 3MRIA 5DS8A 4U1SA 5F1OB 3QWRD 4ZFOA 5FCUL 4NWTL 5H2BB 4JG1L 5IW6A 3SCMB 5IGXL 3MV8E 4EVNA 4FQXB 2GYSA 4FP8H 4NPYA 4OFKA 5DMIH