4WI2A

Structural mapping of the human igg1 binding site for fcrn: hu3s193 fc (wild-type)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Structural and functional mapping of human IgG1 binding site for FcRn in vivo using human FcRn transgenic mice
rcsb
source organism Homo sapiens
total genus 35
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi2A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi2A01
4RRPG 3V2AR 1F3DJ 3OZ9L 4JJ5B 1SMOA 4ZS7L 2XXCB 5FYLE 5EA0L 4TVSa 5FHBL 3DX7B 3LKQA 1MWAA 2V2WA 4QXTB 5EDXA 1S9XA 4JFDD 3LKNB 3RWDB 1INEH 4UIMB 4NKDB 1YDPB 3AU1B 3G5XA 5C0BB 1GSMA 4MYWB 5HHPB 1HK6A 1IEHA 3HZKB 2VZVA 3LS4H 4G9FB 5E5MA 1YC7A 5ISZB 1MJUL 4LARL 2P46B 4EI5D 1LDSA 1TCRB 3ZDXE 5ACLA 5F7DA 1KJMB 1JN6B 5IJKC 1F02I 3RDTD 5JLZA 4ZFOL 4WFEE 4OV5A 4PRIE 3ULSB 4WNQA 4XCEA 3LSOA 3QEUA 4GKNB 4NRYB 1KT2A 4RISH 2CUHA 3VCLB 4ODWA 3O3BA 3OGCB 1ORQB 5B39G 1WZLA 5E94A 1NGZB 3C6LC 1TTUA 2Z91A 5IB3A 3MRLA 2IAMA 4RX4A 1VFAB 4ZOCA 4UU9B 3NIFE 3TV3L 3T77B 3V79C 5M7QA 1ZEAL 1IKFL 3TNNA 3GRWA 1GH7A 4HWUA 5TQ0L 1PGRB 3D39B 5CD3B 5BW7A 1D3CA 1VCAA 3C8KB 3LPFA 2CR3A 4JPVL 4XNYH 1A14H 1MY5A 1AGCB 4LNVA 3P30H 3O2WL 4OZFG 2MPAL 1QRND 2IPKB 4DUXA 4W68A 1BFSA 3QI9C 1U2CA 1AKJA 1NUGA 1X3DA 4U6YA 2X05A 1U8NA 4JFFA 5SX4I 2GUOB 4NCC1 3FO2A 3B8SA 1Q94B 2UWEE 1RFDL 3OKEA 4PB9H 3DHMA 5I1CH 3EO0B 4CL7A 4F9PA 1NGXB 2DLHA 3LQAC 4C57C 4YXHH 5CJBA 3JV0A 4DUWA 2DLIA 2QQQA 3FT2B 1CLYL 1X5HA 4JHZA 2LU3A 4CDGC 3V4UH 3MRIA 1KIRA 2CK0H 5E6ID 4PRAB 3ZKND 4FQXD 3LB6D 4UB0L 1FZJA 3HZMA 4U0RB 1A9BB 2YKLL 3D18A 5FV2A 2BVPA 2BNQB 4QRRD 4J4PA 4RZCA 3T1FB 4LKXB 2Q3ZA 3MA9L 4BELD 4NRXB 1QBML 2I26N 1S7RB 4HPOL 4S1QL 1MSPA 3SGDH 1FNSL 3C6SA 4K71B 1ND0A 1S5HB 4FQIH 3GK8L 1KTDB 2ZNWA 4PJ7A 4U6HA 2NY7L 4QGYA 4L4JA 5E4EB 4YBLB 4Y19E 1C12B 3ZYOA 1C16A 5F8QC 4LHUD 3CC5B 4RDQF 4HXBH 3BP5B 4TVPH 3H6JA 3QDGD 4N1HB 3DMMC 4KTYA 1L9MA 4Y4FD 4DGYH 1BF8A 3KYOA 3MXVH 3QFJB 4PS4L 4Z7QF 2FECL 1T83A 3K81A 5SWZB 1O0VA 5I1IH 4RBPH 1D9KD 1UCBH 5I9QB 5F7UA 2YC1A 4MD0B 3LN4A 4Z0BH 1P1ZB 3UTQA 1CVRA 2Y07H 3HAEH 3IDIA 4LEOB 4N1EA 4HUUA 4AL8H 4PJHB 2O26U 4YGVB 2BRRL 3IETB 5LXGH 3T2NH 4JO1L 2VWEE 2YD1A 3G6JF 3QUML 1E6OH 4IOFC 3RUGF 4QNPE 1EXUB 1JK8A 3TFKC 3V5HB 2EYTB 5C0AB 2W0KA 4NHCL 5D4QA 5I17A 1DBAL 5D1XB 3IFPB 2DQHH 4XAKD 1HNFA 5FUZL 1F2QA 3VG9B 5BQ7A 1P6FA 2EO9A 5TF0A 3SE8L 4JRYB 1Q0YH 2VL4A 1KN4H 1FN4B 3WFHA 4RAUB 3MV7E 4X6EB 1CTNA 3SKUD 3CFKA 4NQEB 4ZAKA 1H5BB 2NY5C 2VLME 2OJZH 2IF7A 3HR6A 4MXQC 2DYPD 3ARPA 3NCCB 3UTTD 3RHWK 3CXDL 1RV6X 4HH9A 12E8L 4JRWA 4MAYB 1XH3B 3EDDA 5HHOE 4R4BB 3MC0A 4PTTA 3BP7A 1T89A 4OCWH 3QQ3A 5CD5C 5I8KL 5F96H 3CSYA 4KQ3L 2XN9A 2EDNA 4WHYG 4FQ1H 1AXSA 5JQ6L 3LCYA 4KPHL 5F9WC 4KGJA 3KR3H 3FQWA 5KSVA 5GS0L 5IBLD 3I50L 2Y72A 2IFGA 4GBXB 1QBLH 2N7BA 2ATPB 3REVB 4OCXL 2BVTA 2DM7A 4NBYB 4W70A 1F58L 1U3HA 1HINL 1IC7L 3U6RB 3MREA 3V4VH 3KYNB 4XNZB 3INUH 4D9RE 5L6YH 5FYJL 2F5BL 3EAKA 3PGFH 4WV1C 1T20A 1P2CA 4KKCD 1LMKA 5E8NA 2VLRE 1EJOH 3CSGA 3L6FB 1H15B 2UV3A 4PJ9D 4QHNA 5T1KA 5M94B 1NCAH 4LLDA 5T3XD 2PO6C 5I16A 5FKPB 1IGML 3QDHA 3MCKB 4CU7A 5E9DE 1KBGH 4RFNC 4KTEL 1SYSB 1MCCA 2R1XA 1IRAY 3HPJB 4WO4A 5JTWA 2JJVA 5T5NF 5JOPD 1CGWA 2AJSL 3UJJL 3S35L 3O6FA 3EZ8A 1U6AL 1J9CT 4Y5VC 4ONGH 5JW5B 4G7YH 1MQKH 5EU6E 2ZZUT 4J6RL 1C5CH 4LAJH 1UM5L 4S10A 1AH1A 1KXTB 1YN7A 4FA8A 1EO8L 5FM4A 5TF1H 1JPFB 1IBGL 1A9EA 5KG9A 4NT6B 4UMGA 4F15C 3G04B 2WINB 7FABH 5D2NB 1NSNL 3C09B 4F33A 2ED9A 3BEVA 3CH1A 1JF1B 2OK0L 4UDTB 1R5WB 1FBIL 4DCQA 1FFOA 1KFAH 3VDAA 1CYGA 3DROB 3MPCA 3F6IA 4JN2A 3J7HA 5JPNB 5D70H 4DTGH 4YQXL 3T0EB 4OFYA 5DVKA 1CE1H 1V05A 2CKNA 4M7ZC 1XF3B 2WM0A 1A0QH 4GUPA 1HH9B 4PYGA 4C56D 3VFSB 5I1JL 1DUYA 1QZ1A 3O6ML 1I9JH 4XX1G 1YEIL 1UZ6F 2YEZB 3DXAB 1OGTA 4Z5RB 1UEMA 3KYMA 4HKBA 3OJ2C 1AGBB 2BVOA 4G5ZL 4GG6F 4YDKL 2X9XA 4HW6A 2LTQC 1CZ8H 1WEJH 2B2XL 1MH5A 2MQ3A 3IDMB 1K4DB 3TH3T 4E9LA 3ZMRA 3K4ZA 4PJAE 2V2XB 4IRSD 5EBGA 2DQCH 4PGCB 4B41A 1JGLL 4HK0B 4GKZA 4KJQD 3MUJA 3BPLB 1DVFB 3IFLH 2EC9T 1ZWIA 4EVNA 2D7MA 3UMTA 5J12C 4LFHD 3SO3C 5TGBB 4R7DB 4AMKL 5DWUL 2BSRB 1XGUA 3V5DB 2DWDB 5DD5L 3ROLA 4FFWC 3DBXB 4R90H 3BGMA 3MYJA 4XB8A 2DQEH 1D5BB 4BH8A 4F7PA 1M7XA 4HUNB 1DUZB 2QADC 3QFDB 2I9TA 4IJ3B 4K3HA 4O02H 3QHZL 4ZUUA 1I7TB 4Y4KB 3HC0A 4IRJD 4MXVF 4NKIL 4EI5A 5KSAC 1VSCA 1NGPL 1BJMA 4HZAA 5BMFH 2ARWA 3RDTA 1A64A 2V5MA 5B3JE 5C0FA 3CFBB 5C3LD 3KS0J 1TENA 2FX7L 1JGEB 1YEFL 3FB7A 3NFNB 2W65A 1YUHB 1F3JA 4NKMB 1NBYB 4ONFH 3MBED 3OG6B 4X98A 3MV11 1C5BL 4LPXA 1INQB 2QR0B 4JZJA 3RIFF 2CUMA 3G9VA 4H1LA 4QHKI 4R96A 4ELMB 1JL8A 3ULVE 3EYUL 2VDKH 4HPYL 1DBJL 3MRHB 1BECA 3MR9A 1KB5A 4BZ2H 3GSQB 2QV2A 4BKLA 4OM0H 2BVQA 4HEPG 1MPAL 4HIJA 4PJEA 4YFDB 3V9FA 5FA3B 2HT4D 1OARH 3TT1L 5BVPL 1G1YA 2IBZX 2ENSA 2A73A 5BO1L 2HVJA 3BKMH 1IM9D 4JFDB 4P48A 4NO0D 1ZT4A 3VXSE 4ZSOA 2LAGB 3P11H 4CVWA 4X6DE 1YMHB 4OZIF 5IK3B 2IFFL 2ICEA 4QRUB 3C5ZD 3HR5A 3KXFE 3L95B 1I9IL 3BN9D 3PIQA 5KVFH 4UOW1 1I7UA 2HFGL 4X4YA 1KYOK 5F9JA 4RCAA 3LQMA 3IDUA 3B9KD 4GLRI 1OAZL 4EDWH 3GSRA 3VGGA 1BGXH 5C9JB 5K33A 3RGVC 5KJRL 3E6FA 1MIEL 4KRMB 3UO1L 1UH2A 1HOCA 4NM8H 4XVSH 3KPPA 4PP2B 3MOAL 1LILA 4Z7UA 4PG9A 5E6IA 1YEGH 4AENA 3MRJA 2YWYA 1JGVL 4U1SA 3PQYE 5CJXC 2B1HH 4QRRA 1YMMA 1GGCL 4NGHH 3GUTA 1UM4L 5E2WH 1HSAA 3AC0A 3ZE1F 1AC6A 4X7CC 5IVZA 1FC1A 1QRNB 4BZ1H 1BQSA 2ZKHL 1MCRA 2YUVA 4HQQL 4S11A 1RUKL 4MSWB 3CD4A 5LCVL 5FA4B 4OGXH 5DT1L 3VGAC 2CRMA 1RULL 5IT2L 1JHKH 1HQRA 4LCWE 5EC1A 1A3LH 2I27N 4HGMA 2RGSA 2SEBA 2NY0C 4WFHD 3BGFB 1XCQA 5I66A 1U8JA 2GJ6E 3CX2A 3P9LB 1A6WL 2B20A 2F54E 4ZUVB 4YAQA 1UWGL 4OI8A 4X8JB 1K5NA 4YJZL 4NWUH 1WITA 4ODVH 4R0LC 5CWSB 3CFCH 4LBEA 3U4AA 1FVCB 1MFCH 1OCWH 2ICWB 1WVZA 5ETUA 4FQXB 1RJCA 1QFPA 2JCCF 5HHXL 4WWKC 4JO3L 1LVEA 5GS0D 5L2JA 1QR1A 5KS9B 2DQTL 2IMMA 2XWTB 3HE7C 4Z7VA 1Z0MA 1WWWX 2PYEA 5IB1B 5JHLH 1JPTL 3K2UH 4MZ2A 1GZPA 2AP2A 3P9MA 2YD6A 2ZG2A 5EU4B 3ALPA 2NZ9D 3PWNA 1RZJC 3DURA 3OAYH 3QDGB 3MLPA 3WS3B 1RUMH 4CN6A 2X89A 3GKZA 4Y4FB 1N8ZA 5CP7A 3BP4B 2M26A 3ORJA 5JIKA 1D9KB 4JQVA 4LCIL 4APQA 4PRNA 3IAGC 4OZGA 1JGUL 3AVEA 3I3BA 3FZUD 4MDIB 4WU7B 4E42A 1JYNA 3NBNA 3QEHB 4L4TA 3I2CH 4U1KA 1FL6A 5CJQH 1T5XB 3EYQC 3ZTNH 4ELKB 4TULH 2XA8L 3U0PB 1DEEA 1DJSA 5DTFA 4RGMC 3CDGA 3PP3K 4Z78B 2DLEA 3KYAA 4EI6A 3D9AL 1NGWA 3HZVA 4BK5A 4HUWB 3H9SD 4JHWL 2FO1A 4GRLC 1KELH 4X9FA 3EO9H 1I1AC 3PWVA 5JPMB 4MA8L 4JREC 1QYGL 1UG9A 2FGWL 5EOTB 3AREA 4FABL 1FNGA 2DBLH 5FYLL 5J11C 5HYJB 3BH8A 1XGRA 3ARFD 4NZUH 1ZVHA 4YFLI 2Y25A 5L88L 4WEBH 1T22B 1ZGLB 3KPRD 3UTTB 1XF5A 5AZEH 1JUFB 2DYPB 1TVHA 4JFEA 1Q9WB 4KY1L 3UROR 2GI7A 4YDLC 4BFBD 32C2B 2AEPH 3ARZA 5E8OB 2IQAB 3JTTB 4OAWB 4AG4L 2VXSH 2APWA 3AM8A 3O45A 3HAEA 3RBGA 4MDJB 2KBGA 3FN0H 3MOBL 3MLXH 4L8SB 3VXRA 3T65B 4I2XA 4HZLA 5DJ6A 5F9OL 1NFDF 5E6YA 3O8XD 3W5MA 5I6XB 1HYRC 1R3IL 5TE4H 5C6PB 1I1FB 4PRPA 4GW4B 4P3DA 3OKOA 2H32B 2RQ8A 4CADB 3WMSA 2EEAA 4LCUB 3IJYA 1OB1B 4M61A 3D3VD 3SDAD 5HDQL 1UJ3B 4UNTA 3NGBC 3TCLA 1F4XH 1MEXL 5L8KB 4ZPTA 4M93B 4KVCH 4PJCA 4Y5XB 2MJWA 4DFHA 4LNRA 4TUJA 5MENA 3H3KA 3GBNL 4PJ9B 1OGAA 1X5AA 2HLAA 3MQIA 1N59B 2F15A 4U6XA 4PV8A 1QOKA 2W92A 3U1SL 3MBXH 1IAMA 1WWAX 3P0VL 3ZYIA 3IFOA 1OM3H 4OZHA 4TTGA 1IL1B 2BHZA 1A7OH 2CIKB 5KVEH 4WDIA 4K2UL 2ADJB 3K74B 2R69H 4EXPX 1UB6B 3L5XH 4OD1H 1NCBH 4AEFA 1MHHA 1BBDL 1G7HB 1SM3H 3KPTA 3K8KA 4NOFA 3HC3H 5AZ2L 4WTXA 1L7TH 5IW6A 3ARXA 1CGSH 1OP5H 3RWCB 4KMQA 3CVHL 1HILB 1G7MB 5K9JL 4TSCL 2Q6WB 4N68A 5GRVL 3FFCE 1U8PB 4AT6B 4J3XA 5DSCA 3BW9B 3MCG1 4Y4HC 3FB5B 4P4RB 5C07A 3L5WA 3QDJD 5I1HH 1HH6B 5JXEA 5HYEA 2F5AL 1S7TA 5FDWB 1OAYH 2QEJA 4PREA 2OJEA 4NFBA 2PCPA 3FOMB 4JPIA 4JQIL 2GJZB 3O4LD 4KKBD 1RPQA 2EDHA 1A3QA 2XZCH 2NY6C 2FBJH 2GEEA 3IT8D 4QT5B 1GJIA 1ZANL 2ZPKL 4F7EA 4U05A 2P49B 3U2SA 2XWJA 3E3QE 2YXMA 4KZDL 3OKYA 4JR9H 4C56B 1MCOH 5SWSE 4YXKH 2P24A 4X80L 5FK9B 1U8LA 1JGDA 2C1PA 1NCDL 5A1AA 1A6UL 3SBWC 1EEQA 4U1JB 1ZV5A 4GKSB 5FO7B 1ZKAA 3BQUA 2GHWB 1MRDL 4L3ED 4YE4L 3DARA 2VDOL 3QNZB 4ZFOB 3IKKA 5F97E 4IRSB 1ZVSA 1AGEA 4OSUL 2QQNH 3QRGH 4U49A 3MBEA 4M9OA 2HKHH 3T8XB 2J8UE 4ORGA 4TUOB 3WFBL 1QKZH 4O2CA 3WNLA 4QTIH 1OTTD 4XB7A 1DQDH 3ZDZE 5JW4N 1GZQB 4JM2A 3RY5A 4DZBB 3BJ91 3CFJA 5GS2H 2C4FU 4CDHA 2EYRA 3LQZB 4CVXA 3VRLF 3IF1B 1P4LA 2Z8WC 3E6HA 1ZHLB 2VC2L 5TE6H 3LD8C 2Z4QB 2EC8A 1WTGT 3WXWH 5DQDL 4D0CA 3UZVB 2DD8H 2C5DC 4F7CA 1M71B 1AD0A 4ZNCD 3H3PH 4IRJB 2C4FT 1HZHH 2CMRH 4XXDA 2P8MB 4U2ZA 4JB9H 1RIVL 1P84K 2FHCA 4Z7WF 3VD3A 2VLJE 2XZZA 3DV6B 3SDYH 3JV4B 3X3FH 3SDCB 1J86A 5D8JH 1TQBC 1QSFD 4XVJL 3RX7A 2V9RA 3ETBF 4NBXB 1LO4L 1JP5A 4LF3B 3TO4D 1LNUB 4G8GE 4ODUA 5KSBE 2QSTA 5LAXA 5B8CA 3PABB 2F8XC 2WUBH 1F4HA 1UM6L 1YEEH 4F7TB 1CTOA 1CICC 3OAYK 3MRCA 2DQUH 4QO1A 4A6YA 2GSIB 1JE6A 2BOCB 5ELIA 3IFNH 1YN6A 1S7SA 1M7DB 2Q86B 4G7VH 2VN7A 2L7UA 3GJFH 1QQDB 3S37H 2PKDA 4HIIB 4Q6YA 5C2UB 2W1NA 4WW1B 1IM9B 2AK1L 3M07A 4NO0B 4PLKC 1U3ZA 4TQEL 5LQBH 4KHXH 3C5ZB 3IDGA 1EV2E 4OLYL 5EBWA 1HHGA 1KB9K 43C9A 1X7QB 4N8VB 5DUPL 4AK1A 3QUXD 4M6NL 1AY1L 4NRZB 4LL9A 3B9KB 3IVKA 3O0RL 1OAUL 1CFQB 3MNVA 1XGTB 2VQ1A 3BHBA 3DSFL 1D5MA 1E6JH 4KUCD 4PD4K 3STZB 1IMHC 4HWBL 4QCIB 5AUMA 2H2SC 2IQ9L 4JRXE 1JFQL 4QRTA 4JANB 5F1NA 3ZE2E 3RVWC 5F70A 4JFHD 3CX5K 3BZ4B 3VA2C 2DIJA 2HJLA 5IEHB 1V3MA 5CS7A 2PTUA 3G08A 3ES6A 1A1OB 3VWKB 5D7KE 2YMXH 5C8JB 3NZHH 5LGHH 1GXEA 1MJ7H 2R2EB 2OMBA 3K8LA 3QUMB 5GSRA 4LHUG 3L7FB 2UZIL 2HFTA 3F7QA 1JZ3A 3GNML 1LK2B 4LQFL 1RUAL 3X14B 4R4FL 2VDQH 1QSEE 2JIXA 5J3HC 5E00A 3B2VL 4XZUA 3KPNA 1RVFH 5FYLD 1LHZA 4X6CF 3KPQA 3WJLA 3JWDC 2D0GA 2MQ0A 1HXYB 1MVUA 3QUZC 3WHXA 3TO2B 4W4NA 2ERJC 2HG5A 1A7QL 4H88L 5DXWA 2J88H 3TBVA 2FBOJ 3VMPA 5CBAA 5D5MF 1KEGL 2WBJA 5D7SL 4RAHA 3HE6C 2Y6SC 5BRZD 2Y5TB 3LRSB 5KN5B 1C5DB 5HI5D 4XH2B 1F8TL 5CKAA 1U8IA 4O5LL 5ID1A 2G9HA 3W9DA 2WQRA 2XTJD 4HFUL 1HHIA 1YNLL 4V1DA 2E3VA 4MXWH 3B5GA 3Q1SH 3HI1A 4P9ML 4P0DA 1TZGL 5FHAL 5FEBA 5DDHA 4RWYH 1TDQA 1JV5A 5DR5L 5EZLB 25C8H 3I02A 3V6FB 4G9DB 5C70A 2XTLA 4P23A 1R3KB 4QOKA 1J7VR 5CSGA 2AJYH 4EJ1C 1CG9B 2M1KA 2OR8A 4H8WH 1OP5K 1MFAH 3GMMA 4DKFL 2VLKD 4BSVA 4L3AA 3MLWH 5DYOA 3RWDA 2YSSB 5F7YC 2XIDA 3RWGB 5GGTH 3KPRA 1R5IA 1J11A 5IMMB 3BPCB 1TJIH 3GDBA 2QLVB 1FP5A 3QG7H 3LQAH 1U8MB 5GGSB 4HKJA 1AO7E 3KPSA 3QB7C 4PJGA 5IB4A 4ERSH 4GRWB 3ARGC 3GSUA 1BP3B 1VFMA 3H7BB 3QEQD 2CIIB 4HV8B 1N26A 1XAUA 3AXLB 4OCRL 2VMFA 1LP9B 4ZQKB 3VFUB 2VKWA 1NCNA 4MVBC 4ENEC 4NNPL 2I9LB 3OR6B 4OUUB 4ACPA 3Q0HA 5GZOC 2YA2A 4TTDC 3KLAA 2JKXA 5IHLB 3MLRH 1JZ7A 1KTLA 3O8XA 1A6VL 2OMNA 4MNQD 5M95B 4F3FB 4K3EL 3Q3GA 3QWQB 3S3PA 3ULVL 3H9SB 3NIFF 3WNMA 2R9HC 4KJYB 2X4UB 5CD3A 5HHVH 4DOHB 4TSBH 3C8KA 2EDBA 2VAAA 5I71B 4LU5H 1U8QB 4X9IA 4PGZA 3WIHA 1I1CA 5DGQA 1VHPA 3FO9A 3HNTH 1P7HL 1NGQH 3ARFB 5IVXA 4B5EA 3G6DL 3N9GL 4NUJB 3FT3B 3RL2A 5EORH 4RFOL 4QF1B 1PSKL 4NWTH 2ZSVB 5A3IC 5C9KA 6FABH 5D1QC 2BERA 4X9GA 2F53E 3GMNB 3PWLA 4UTAL 1UGNA 3ESUF 1CBVL 3V6OA 5MHSE 3TA3A 5JXAH 5EUOF 3RTQC 1BM3L 2R1WA 1OAKH 2H26B 3FT2A 4M4RA 4KZEL 4LSTH 1T5WA 4K3DH 5DFWH 3SN6N 1AI1L 1BD2B 1DBKL 3NFSL 3OKLB 1MCWW 4U1IB 1YEDB 4TUKH 1X5GA 3SKMB 4ZMAT 3LS5L 4CKVX 1P69B 4DVRL 5FCSH 3D3VB 3K8MA 3SDAB 2A6DB 5MEOB 1A7PH 3QI9D 4OIIH 1Y0LA 2COQA 2IALB 5EIIB 3O2VH 4GSDL 3OXSB 4UDUA 1HIML 1N6VA 4P2OA 1UVQA 3ZE0E 3VRJB 1LE9B 4DKEH 4PJDE 2NY5H 1G9NC 1P7QB 3O4LA 1U92A 4MJ5A 1WGOA 3VFPA 4YPGB 3MV7D 5A2LH 3RJDA 1U8KA 3MJ8A 4HGWA 5J7CC 3MJ7B 5FB8A 2ZCHH 3U7AA 2VE6B 1QFOA 2QHRL 1F6FB 3IXTB 2W9LA 1YPZE 1QEWA 2VDNL 2W0FB 2O5ZH 4U1GC 1EHNA 4HIXH 4LCCB 1IEBA 4MD0A 4JFOB 2ADIB 5IBTL 4Q9QH 5SWQA 1PKQE 1FFQA 4HMEA 2R23A 3VXOB 3GIVB 5C0EB 4LFHG 4PJHA 1BAFL 3CH8A 2XV6B 4G8IA 5C08D 3IRPX 2H9GA 2XFXA 2NX5A 2LV4A 1FGVL 4FN0A 1L7IL 5FECA 5D7LA 2HMIC 3UAJC 2V2TA 4I9WD 3QDJB 2PF6A 5GHWH 4XCFH 2H32H 4K8RL 1P9MA 3X13A 4JY6A 1DR9A 2VISB 4XAWL 4I48B 1F13A 5JZ7C 1B6UA 1I1RA 1RZ7L 2E8YA 3FRPA 4TYUA 3W81A 1UENA 3CLFL 2CJUL 4FRWA 3G6AB 1NLBH 2J4WL 1VFUA 1G9MH 4HXAL 4NJ9H 4RMVA 3HLAB 5T3XH 4LVHC 1S8DA 2IG2L 3Q6FB 2FIRT 3MV8A 1IGYB 2H8PB 5CZXD 5E08L 4IOFD 3TFKD 3FTGB 2XY2A 2F74B 3R06B 5IM7B 5GGVY 3WCYA 4L3EB 5CSZB 5IFHH 5H94B 5CUSL 2R0WH 5EU5A 5BJTA 4H20L 4XTRD 3VGHA 1MFEL 4QRQB 1B2WL 2ATPA 1LO3H 2Q20A 2ZJSH 1KPUB 3ARSA 2R8SL 5L0QB 5IP4A 1P7KB 1N2RA 3F5WB 1T0NB 3HG1D 3SJVB 5C09E 3UTPD 3WDHA 4HBQA 2ADFL 2MFNA 3I6GB 4JGMA 4WI4A 4PJBE 5T33L 5CMAA 2FSEB 1T7ZA 5E4IA 2FX9L 1AFVL 2A0LD 3N1MC 2KZWA 3SKOB 1K85A 5E1HB 5CD5D 3VW3H 2APFA 2D7QA 3ELAT 3PL6A 4L29B 2NY2C 5F3BA 4TNWF 5F9AC 3HUJB 4RMQA 5DRWB 1W8NA 4YHNA 1CLOH 3NIGE 4PRBB 5TQ2H 5HVGB 4H0HB 4PJXF 2P4AB 3OZ9H 1ACYL 4OF8A 4MWFA 2D4DA 4ZS7H 2IBBA 3HCVB 5DJ2B 1V7MH 5EA0H 5I30L 4OF6A 1INDL 1OWRM 1QSFB 4XX1E 4HKZB 3RAJH 2ZUQC 2X4SA 3CXHJ 4PUBL 4P46C 3U9UA 1JZ2A 1JWSB 2J12B 4PJIB 4XXCA 3X3GH 1OAXL 4FTVA 4LARH 4LIQE 1X5IA 3I3EA 4CNIA 4PJFE 4M6ML 2BC4A 4NT6A 3REWB 4OBRA 1ROWA 2HJKB 3QDMD 4G80A 1XIWD 4EBQL 5C0JB 2PO6D 3RWHB 4RMSA 2VLLA 3NPSC 1D5XB 3CCHB 2YK1L 5I0ZA 5I1DB 3CFDA 5TDNB 3HNVH 1JF1A 4DVBB 4F2MA 5C0BE 2GTZA 4XC1H 5I1LA 2BY1A 4YDVB 1CWVA 3TV3H 1PG7X 4G9FE 3SDXB 2JTDA 5F72S 2AJ3B 5ISZE 1IKFH 1UB5A 1WJ3A 4Y16D 4YLQT 5TQ0H 1MIMH 4JPVH 5DJXA 4UNUA 3RNQA 2AXGB 5DI8B 4KK5C 4DN4L 3QUXB 5F7EL 5LG1A 3O2WH 2DN7A 1VEMA 2FD6H 2MPAH 5K9QG 5DS8B 5C0CE 1OTSD 1IGCL 2DQDH 2H6PB 5EN2A 4XP6H 1MF2H 4DAGL 4Y2DD 1OQOA 1W72L 4HKXA 1QR4A 3FO0L 3Q6GL 3BN3B 2HJFB 4ZD3H 3FO1A 1FC2D 3UBXA 2ITCB 2BNRB 3C8DA 3R0NA 3RP1A 3PDOA 4H26A 1RFDH 2WK2A 3IJHB 3IDJA 3FRUB 3JUYA 3SDDD 3D39E 2VXVL 2X70A 3D69B 4I3SL 2XZAL 4HS6B 2EKJA 4H25B 4HMCA 2QSQA 3KLHD 2D9CA 2OSLB 3GHEL 5IB2B 4PJAF 1I85C 3IS1X 3VFRA 2E7LA 1R3LA 1JNHA 3GJFA 1CLYH 1CXHA 4LLMB 3TM6A 5ENWA 1RUQL 2O5XL 3FQRB 1HSBA 3MJ9A 3MRNB 1KULA 1OF2A 3J8F7 1P6AB 2IH1B 4UB0H 5FDYA 5I1AA 4ZUWA 3DBXA 5MI0B 2VUYA 2G75A 3MA7B 3MA9H 3GSNA 1HHJA 2VLKA 1QBMH 1IQWH 3S96B 35C8H 1FLTX 4S1QH 5E5UB 3EFDL 1CE6B 5IIEA 5EC2A 1FNSH 2YUZA 3WSQL 1H3PL 4PRHD 2KH2B 2Q7YB 4KHTH 2GK0A 3U9PL 4N90E 2E6JA 5BRZB 3C60D 2UVEA 3B83A 2DI9A 5HYSA 1HHHB 1IC5L 4C59B 5B3JF 1LQSR 3OXRA 1J05B 1T83C 4PRIB 1BOGA 3EYVB 3B9VA 4ZS6D 5EPMA 4LGPB 3IAQA 5JIIA 5ITBH 1NGYA 4AIZB 1BVKB 2KPNA 5GZNC 5TDPA 3WO3B 1VEPA 2ATKA 3MRHA 1R3JB 4KKAC 4RGNC 2OR9L 5CIPA 1BFOB 3WIFB 3BUYA 2BRRH 3VFWB 5GPRA 1CT8B 1FVDB 3BPOB 4MX7B 1OLZA 5LBSL 5TFSL 3VXUA 2DQJH 3MV9A 5IJKA 1EEZB 2BCKB 2FO4A 3BJLA 4BH7B 4LSDA 4NHCH 4ONHA 4MD4B 5I74B 3QFJE 3ZKXC 5JW4Q 1Z9SA 1UXWA 4PR5A 2OXHA 5HI4C 3PJSB 4ZAKC 3BESR 5DJYB 3C6LA 4KV5E 3QEQB 2UWEB 5CEXA 3S34L 2R1YB 2I07B 2VSDA 5DZLA 3STLA 4X83A 1T89C 2F54D 1VFBA 2L4OA 3G5ZA 3PV7A 4OF0A 2CDEB 4QY8A 4YHMH 3EHBD 1QFWH 5ANMA 3WN5C 1OPGL 5C0AE 3B6SB 4MNQB 3P3YA 4BFEA 3JSSA 3P4MA 2PR4L 3CVHB 4M7LT 3U36B 3V6ZB 3PF2A 1MHCB 3QIBC 2G60L 5DURD 4JRYE 2EH7L 3DYPA 4KPHH 2X4PB 5EZOL 3SCMD 3V8OA 3KVQA 4NHUB 1DQLH 4D9QD 1X5KA 2V7NB 3ARDC 1U3HC 2ZUWA 4K8RD 4R2GC 1DBMH 1RAMA 4NP4L 1CGYA 5IQ9B 3I3DA 1RZJH 1F11A 5F1IA 1F58H 4FFYL 1IC7H 2ZUSA 1QTYT 4S1RH 5IBUG 3LVEA 5FYJH 2F5BH 5BS0D 3ZL4H 4HS3A 2YZ8A 1P4IL 5GGUA 1TQCB 2DQIL 1OAQH 1Q72L 3KNBB 5DFVD 4P49A 3MLTB 1IFHL 3QPXL 4D9LH 4WO4C 3QJHB 4FNLH 4GRWH 3IU3A 4U6VL 3VXMD 2VITA 4M5ZH 1EEYA 5GGSY 3S35H 1XR9A 4DW2L 5C08A 4TRPL 3G6JA 3QHFL 4Z8FL 3GIZL 3K7UA 3L3KB 1EZVX 2B39A 4GG8A 5AYUH 5E8EA 1Q9KB 1UM5H 2V5RA 1VGEL 2XI9A 4HG4K 5JHDD 3MMEA 1F90H 1KGCE 4QHUB 4QRPD 5HGGS 1IBGH 4EDXB 3NCFB 4NQVB 4NQCD 3C5JB 3DMMA 3CUPB 2C3WA 5EU4A 1JWUB 1MCPL 1RHHA 3VH8B 1RI8A 2XWBB 2NXZC 1AE6L 1FL3A 3EOBB 1NSNH 2Z31C 3MV7B 3EOAB 3SGDI 4OLZH 3WLWD 3BO8B 2JLLA 2X9YA 2OK0H 1FBIH 4MLSA 1EAPB 1FNHA 1QA9A 4OLVH 2FB4L 2K9UA 4WWKD 1NFIB 1KLGA 2Q76A 1ZE3C 2O61A 3VXPB 2FGZA 1A3RL 43CAB 3OB8A 4YQXH 3F12A 2VIRA 5JUEH 4XHJC 2W9DL 3D0LA 4WCYL 1GHFH 2FWOB 1BX2B 1E27B 4Y1AD 4M7JL 5I1JH 5D2NE 5DO2D 3TT3L 2WANA 3RUGB 1F2XK 3O6MH 1RK1B 2J1KA 2X1XR 1YEIH 2K1MA 1U95B 2QQLL 4N9OB 1AD9A 3V5KB 2GW5A 5EUKA 4GT7A 1NBVL 3HG1A 4YDKH 1G7JB 1HHKA 4PJ8B 3W9EA 3O3AA 4U1HA 4HFWA 5FCUH 1PG7L 4YO0A 1V7NL 4TSAL 3TYGL 4JVUA 4EN3D 1JGLH 1QACA 4MQTB 1ZHKB 5ABDE 2XACC 1BZ9A 1XF1A 4K9EL 5ICZA 3HFML 1DL7H 5FGRA 5ACMA 3UTSD 4P4KC 3DXAE 1PW3A 4JO4L 3VFGL 3C87A 5FYKU 4AMKH 3QZWA 5DWUH 2IQAA 3V95A 5EBLB 3L3OB 2FATL 4O2EB 2NQCA 5KVGL 4KQ4L 1WBZA 4OCSH 2X4NB 1YY8B 3FT4A 1CGUA 4Z0XA 5F3HB 4IDJH 5IG7A 4P9HL 3FQNA 4GRLD 1RJYA 3QO1B 1SJHA 3BKYL 1I1AD 1WC7B 1IEAB 1E4KC 5F93C 3QHZH 3L3GA 1O5DT 4M62L 4G8FB 4NKIH 2D9QB 3BEWA 3UX9B 2G2RB 1NGPH 2VDRL 4WV1A 2D7OA 4LP5A 3N1GC 3CIQA 3CPLA 1S9KC 2FX7H 3L3IA 2AJVH 5MP6L 3L3DA 2AGJL 4P3CL 4JFQA 2PXYC 3DRTA 2NNAA 3P40A 1DQTA 1F4AA 1NC4D 1R24B 3QJFB 4M8QB 5ADOL 1GAFL 2C3GA 5DC0A 4L9LC 1KG0A 5HPMB 1MOEA 3FCTB 3QQ9C 2BFVL 4QYOA 4FFVD 4HPYH 1DBJH 1HQ4A 2CO7B 1MFNA 1KJ2H 5H35B 5CZKA 2QSCH 4IMLB 2OTUA 5EU7E 3NCJL 4CW1A 5F9DC 2OZ4L 2ADJA 3TT1H 1XCTB 3IS0X 4WI5A 5BVPH 1RZ8A 4OBSA 5BO1H 3RHWF 2RFXB 4Q6IB 4NDMA 4PJ5E 1UWEL 1YA5A 4GG6A 1I8IA 2IFFH 3EJYC 3TNMA 2DQGH 3Q5YA 2R29L 1CR9H 1I9IH 1RZGB 1G7MA 3PGCB 4ELME 3QAZC 2HFGH 4MQ7B 1AXTH 3RL1B 4OCYL 3LMJL 3O9WB 3W82A 1YNKL 5I1EL 4UAOC 5E03A 4FXGB 3BE1H 3QDMB 3TBSA 1XIWB 1W0WB 3CFEB 4QTHB 1NJ9B 2X4RA 1EUUA 3LZFH 1G84A 4P4RA 3S8WA 4JHAH 2CDGB 4PJEF 3PWPD 5ADPL 1MCHA 5FF6B 3I75A 1SMAA 4JFDE 5HY9B 3MOAH 3QEGL 5INDA 4PBXA 3RVTC 2FYYB 2V5YA 5LWYL 5C71A 2MTPA 4Y5VB 4BFGA 1JGVH 4YR6B 3S88L 4QT5A 1BFVL 5J1AB 2VXTL 4Y16B 1FFNA 1Q38A 3ILPA 3NA9L 3BIKA 3TIDB 3SGKC 1AGDB 1WF5A 4JFXB 4GRMB 4Z77B 2EDXA 5IHUH 4KROC 3QA3B 1FFRA 4PRHA 5ICXB 4HQQH 3VWJD 1BFTA 5GXBB 1A02N 4HHAA 2H3NB 4U1JA 4Y2DB 3U79A 4X4XA 4Y4HD 5DT1H 5FO7A 4UIKH 4OCNC 4MCYA 1FV1A 3OF6D 4Z9KB 2P7TA 5IF0A 2LE9A 3SDDB 5DEFA 4WW2C 1MCKA 3GSVB 2MCPH 5I75C 4IM8A 4HDIA 1N3NB 3CSPA 1B0RA 4E5XA 4UI2A 5EO9A 5KAQF 3MLVH 3B5TA 2J5LC 1NKOA 1UYWL 4LLUB 2V7HB 2J8UF 1IM3A 1PD6A 5D7JD 3IGAB 2AEIT 2CRZA 1FG2A 1GZQA 4JKMA 4MS8C 5HHXH 4E41D 3FB8B 1F97A 3GJEB 4DZBA 5IB5B 4IS6B 1T4KA 1YEJH 5HHQB 4N0YL 4PBWD 4JO3H 1HKLL 2PW1B 5FO8A 1MAMH 5LGJA 5KSAA 4ZFZB 3UPAA 3BRFA 1MLBA 3MRMA 4HS8L 3MRGA 1WCBB 4L4VD 4OZIA 3AAZB 3VXSB 4M1GL 1WAAA 5CEYB 4X6DB 1JPTH 2P8MA 3Q48A 2WP3T 4YHKH 4WW2F 3C60B 3OKMB 4ETQA 3QIWB 3SDCA 2DKUA 5F6IC 4ZOEA 3ABZA 1S9VB 3IDNB 3IAPA 4KMTL 1K2DA 5J12B 4QRRE 1W2KT 4RGOL 4M9PA 1YMME 4CGTA 5JORA 1KXVC 1BJ1H 5T1DH 1FGNH 5I8OL 5KSBF 4CN1A 4NO5A 3S4SA 1NLDH 1ZLVK 1YEHL 4ODSH 3QIUD 3GEWB 4LCIH 2ARJQ 3LPWA 1BWMA 1YNTB 1X4YA 2AI0L 2EKSB 1JGUH 5ITFB 1IAIL 3QXWA 2XA8H 1CFNB 3DV4B 4OT1L 1MRCH 4POZC 3RIAK 2EH8L 4OI9A 3D9AH 1VA9A 4NSKB 2EXYC 4TOYL 2PTTA 3JWDH 4JHWH 2OI9B 4WTZG 2ZOKB 1BEYL 1A1NA 2VXUL 1UA6L 2A74A 3ZYJA 3RGVA 4JFYB 1QYGH 4N8VA 2K7PA 1QVOB 2Z8SA 5FYLH 4HUKB 3NMEA 2CSPA 5HHNB 4OZGF 1EFQA 4N1CA 3H9ZA 4GXVL 1L9NA 3MNWB 2E9JA 1I8MA 3JWOL 4QCIA 2P5WD 4WI2A 3CLEL 5IKCA 4FMKA 4KY1H 1DLFL 3AM8C 5CP3H 2F54B 5CJXA 3IU4L 4EUPH 5J9PB 1YZZA 5F7WC 1NCCL 1Z3GL 2W60A 4P2RA 1GPOL 5JW4R 3WO4C 4ZDHB 1KEML 3F7YB 3DX9A 4KK6C 4X0KA 3VWKA 4XAKE 2A83A 1FYTA 3MOBH 4KDTC 4U1MB 5C8JA 4PLKD 5DURB 1ZOXA 4WY7L 3VH8G 4AEIL 3QQ4B 1MCBA 4HBCL 1DDHB 2VJXA 3SCMB 5BVJB 5F9OH 3FMGL 4RDQG 1DQMH 2HA1A 1FVEB 4OD3L 2EIZA 3UTTE 1NDMB 4MA7L 3ZKMD 2ESVD 4OFIA 5TJWK 3OMZA 1SY6L 4Z6AT 2AJXL 4LSUH 1T6WA 5HDQH 4F57L 4ISVB 5IJVA 2BY3A 5T1LA 2H2SD 1VERA 4K55A 1ZA3A 2VDLL 5EULV 5E1AB 2CLZB 4I18C 5GS3A 4WUUD 5BS0B 4DQOH 4KAQH 1DFBH 1VFOA 2RB8A 4R0LA 4PB0H 3GBNH 3CGTA 4M1CD 5ALCH 5IROC 3U0WL 3W2DL 3TPKA 3QISA 3WIIL 1ZLSH 4QHLA 3U1SH 4WWKA 1R5VB 4LCYB 1OT2A 4GXUN 1FPTL 1B0GA 3I6KA 3QWRA 4ZXBD 4XMLL 3VXMB 1KPRB 4BSWB 3LV3A 4OLWH 2JCCB 1NMBH 3BZDA 5E70A 3RY6C 1G7LB 3AS3A 3HE7A 1JPGB 3ARUA 3TESA 4CU8A 4K2UH 3WFCL 5KANI 2EDYA 5CJOL 1MWAL 1TJGL 4UT9L 3OWEA 5AZ2H 4PJCF 4L8CB 1LD9A 4G42A 2P8LA 3IB4A 4EKXA 1H0DA 3BKCH 5ERWB 3KPOA 3B2UD 4AEHL 5JHDB 4N0UB 3CVHH 5I19L 1KN2L 4QRPB 1XZ0A 3QUZD 2PYFB 1MCDA 5D2LA 4NQCB 4X7FC 4CMHC 5HI3D 2R4RL 4LLVB 4BQ6A 4F58L 2OP4L 1FCGA 4YHYC 3HE6D 2Y6SD 4KI5C 3UJTH 4WVRA 5JOPE 1M4KA 3RWEB 5E5RB 1JZ5A 1XGPA 3MV01 4LRIC 1Y18A 2F58L 2VQUA 4I2XE 3BYTA 4I0PC 2X42A 3K4AA 4I8DA 3JBG7 1BZ7B 1NDGA 4NNXA 3EO1B 4JQIH 4PRPE 1AQKH 4JY4B 3MO1A 1HKFA 3W39A 1ZANH 2ZPKH 1FJ1A 1JHTB 4BUGA 3GRWL 2IBZY 3VFUA 4JZNB 3FQUB 4LSVH 4Y1AB 1NFDA 2WNGA 5ESVA 3O6KL 3X12A 5EZJA 4MD5A 2AERT 3FB6A 5TDOA 1CLZH 1EMTL 1YJDC 3BQUC 4ALAL 1NCDH 1JTTA 5IMOA 5EIQA 5KSUB 3OKKB 4KI5F 4XNXL 5JW3L 1ULVA 5E8PB 4I5BA 5CHNB 4KTDH 4YE4H 1QSZA 1MCJA 3QUYB 3UTOA 1DBBL 3U7YL 1KJVA 4PGDB 5T5NG 4DKAA 4OSUH 4EN3B 4C56E 3OAUL 1AGFB 1D5IL 3N06B 3C5SB 1K8DA 3UTSB 4JM2C 4AJ0A 5CBEB 4RMWA 4Q9RL 1OL0A 3FQXB 2Y7QB 3MRQB 3TZVD 2C1OB 1QO3B 4HLZH 4JLRB 4NM4L 1MELA 4V2CB 5CILH 1T2QL 3P77B 2H26A 4XP9H 3SGEH 2AK4D 4LQ1A 5DLML 4ZTOH 2R9HD 4ODTL 5IHZA 1BD2A 2WAHA 4M7LL 2XPGA 3S9DB 5DQDH 3MGTA 1MI5D 4JPWL 5D96B 3LKOA 1W72B 3DRQB 3UP1A 2GT9A 5B3NA 3GMLA 2R2CA 1KJ3L 3SQOL 4MNGA 4KRPC 1FNEB 1H3GA 3R8BB 4FXKA 2R0ZL 2XRAH 5HHMD 1MFBH 3VGFA 1F4WH 1N5AB 5A3ID 3QG6B 4JM2F 3TWCH 5D1QD 4L5FH 5BZDA 5HDBF 1S7VA 4TNVK 5FUCC 1NC4B 1BQHA 4BQCA 1VESA 3ZE0F 1OD7A 3RTQD 1Y6KR 1ES0B 1S7XA 2PETA 3AY4A 1KACB 3DVGA 4HLJA 4OFDA 5K59E 3PHOB 4Z76B 4O2FA 4UQ2B 4NPYB 1FH5H 3OG4B 2LAAA 3TF7C 1FDLH 2KUTA 2AK1H 1DCLA 3VFVB 5I76B 1UJTA 1T0MA 4RQQB 4NYLA 3ZZ1A 2X4TB 5MEPA 5INCB 4U7SA 5D6CB 4L8BB 5I15L 5E8DL 1G0DA 3OL2A 4DUVA 1NAMH 4M6NH 3TVMD 1AY1H 3LH2L 4LLWA 3O0RH 1RK0A 1OAUH 4FQLL 1DQJA 3Q5TA 3I6LD 3OBAA 4NN7B 2L7JA 2CLRA 4HWBH 2Z8RA 4OD2B 2ARJA 1WK0A 5GJTL 3HN3A 2RIKA 3NZ8B 1I1YA 3MNZB 3QXAB 3GGWA 2YOCA 1U93B 4M7KL 3NCYS 4QRSA 3L3HB 3QCUL 1KJ2A 3DTXB 1VPOL 3RI5K 3P0YL 2I60L 5FKAB 4JFZL 4M6OH 4CN4A 5EOCJ 4LSSL 2A9ML 1ZSDB 3GNMH 3MRPB 4R9HA 3EYFA 3F7RA 3VRIA 5GRJL 1JTPA 4FQHA 3R0MA 1SJVA 5ACZB 5GGQH 3VWJB 4YHOL 3R1GH 5A16A 2HMID 3LEVL 4Y4HB 1S9WB 1GVIA 5C2BL 3B2VH 3TN0C 1CQYA 3RZCC 5CSZA 1TTFA 5H94A 1T1WA 3WL9B 5BV7L 3VGEA 1A7QH 4H88H 1KEGH 4P2QA 3V52H 2PW2A 3GSOB 3T08A 1WV7T 2V6HA 4XPAL 5E7FA 3SKNA 2X2YA 3SJVA 3H7LA 4XBPA 3D85D 4FQJL 1UWXH 1NMCB 3VXQB 4ZYKB 5D7JB 4HFUH 3X11B 1YNLH 1D5ZA 5IMKB 3ME0A 4E41B 5FOBB 3RZWA 4P9MH 1ONQA 3SPVA 5GS1C 1UXSA 3SKOA 4KJWC 5FHAH 1YQVH 2IAND 2NYYC 2Z92B 4WFHE 5DR5H 1QG3A 1A6ZB 5T1MB 3TBTA 2Y4SA 2IPTL 1TZHB 4P5TB 2D31B 1T66C 4OKDA 2HFFA 2P47B 1TXKA 2UYLB 3NIGF 3CDYA 3OJDB 2DDQH 1Q9OA 1A7NL 4Z7WB 5HGBA 3FKUS 1TITA 4DKFH 5DJ2A 1LO5A 4N5ED 4FFZH 4JDVB 1XFPA 1B90A 1CICA 1ZHNA 4WGVB 4ODXB 2HN7B 3GMRA 3QH3B 2K7QA 3S5LB 5GRVK 1VENA 3SOBH 5C0CD 3IRZA 4FP8L 3AS1A 3FFDA 3GSWB 4FQQA 2JB5L 3BP6B 4QHMB 5IESL 4WUKH 5FM5M 2XQBH 3TBYB 1NC2A 3DLQR 3QIUB 4IBLT 1FZOB 5DA4A 3T0BA 5J0BA 1N4XL 4DEPB 1I3VA 2XG5A 4OCRH 4XNUL 4MQXD 4N0FA 5EBMB 1NMAL 2J8HA 3NTCL 4NNPH 4NQDA 1I4FB 4R3SA 5AYQA 5C6WH 1A6VH 3K1DA 3SDXA 1FG9C 1DE4B 2ESVA 4K3EH 4R7NA 3ULVH 2R2HB 4UV4H 5ID0B 2MKWA 4YZFE 4XNMB 4CMMA 4JEGB 1MJ8H 5KVDH 1Q9LA 2KQNA 4GRWE 1ZT7B 1F3DH 4HWZB 1LP9E 1KCLA 1UH4A 4LASL 2GY7B 2IGFL 5D5MA 2H6PA 2P48B 3N9GH 3CDFA 4PPTA 4JDZA 1KCSL 1AR1C 1RU9L 4JVWA 2NY4D 1PSKH 2IAMD 3F7VA 2MHAB 4LPWA 4RX4D 2FX8L 3DGGB 1Z5LB 5IHBA 1BLNB 1RIUL 3V6OC 1WIOA 3IKCB 3TA3C 1PYWA 4WWID 1I3GL 1UZ8B 4JN1L 5I18L 3BPNB 4DOHE 3HPLB 3MLYL 1CBVH 1XF2A 3VI3E 3K46A 4D0DA 3MRFA 3U46B 2GAZA 4KZEH 5DRXA 5E24E 4U0RC 1AI1H 3G5VB 1MVFA 1DBKH 3NFSH 5E6ZA 3T3PF 2RAMA 1NEZA 1T04A 3WLBB 2NLJB 1FFPA 3P73B 3KPRE 5LJYH 1AJ7L 5IVXF 1HNGA 3U30B 3LS5H 4HWNA 1AKJD 4EXKA 4PG2C 3QULB 5ESAA 1DQQA 2XNAA 4JFFD 4LSQL 4XBGB 3KPMA 3QBTB 4GFTB 1OSZB 3NN8B 4K71C 4P2OC 4X6CB 3HE6A 3P4NA 3T04D 1MHEB 3BWAA 1PZ5A 4GSDH 5CLWA 3MLZL 1CE6A 1HIMH 2H1PL 3O3EA 4WUUB 1KIPA 4B0MM 4POUB 5E4EC 4YBLC 3CK0L 1A2YB 3EJJX 2MQCA 5CP3A 4GAJL 4EUPA 3T4YA 1IGJB 4EEEA 4OGYL 1FIGH 3P4OA 1AO7B 4GAGL 1T0PB 4P5MB 5D1ZB 3L9RA 4ZXBB 3GI9H 2IADB 4HIEA 4KK8C 2AV7B 2Y9RT 3D3VE 2B7DT 2HWZL 3WFDL 4J4PD 2AQ1A 4ODHL 2HT3D 4NUGL 3VFNA 2QHRH 4ZPVA 4MJ6A 2VDNH 1WIPA 3D25A 1NL0H 4YHZH 1N6QL 3QCTH 1T2JA 3OKNA 4NQXB 5C0IA 1T3FB 3TCXA 1XF4A 1R3JA 1TJHH 3NIDE 1BFOA 4RAVA 3WIFA 3EDEA 3VFWA 3T2PA 4X8XA 4NQSA 3C08L 3OHXB 3DVFA 2NXYD 2Z35A 2AJZB 4IRZL 1M05B 1RIHL 1FGVH 5D1XC 3GMPA 3T4AB 3AGVA 1P53A 1A4KB 4YUEL 3G5YB 5C6TL 1JNNL 1HXMB 2FJFA 1WSST 3ARGA 4WHTB 2OQJB 4ZO8A 5JNYA 2WLYA 2ZSWB 4XAWH 2NY3D 3WNKA 4UBDC 5F89A 2B0SH 3BDBA 1H5BC 1RZ7H 4X7DC 4FQCH 2QKIB 5GGRB 3CLFH 5DHVH 5EO1B 2KL6A 2UWEA 2ZP0T 1YQ2A 3RA7L 2LVCA 4MAYC 4X9HA 2J7LA 4JY5L 4KV5F 4HXAH 2GCYA 4GS7B 4PJHF 1BIIA 1CD1B 1GRWA 1HDMB 1C08A 2BMKB 5DUMH 1KNOA 5BZWB 4KKAD 4RGND 3VI4E 3RKDC 2CO6B 4HAGA 1ETZB 4J3OC 2IG2H 3GM8A 2OTWB 3QDJE 5AD0B 1INEL 5B4MC 1ZS8A 3OKDA 5E08H 2AV1A 3VXTB 3U36A 4I77L 5HD8C 3VD4A 4NC1C 2VZSA 3GSXB 4YBQC 3ZDYE 4GBXC 4D8PA 5MEQB 3O4LE 1JPSH 2BHUA 3MGOB 1QLRB 5MERA 5DEGA 4JFPB 1X5YA 1B2WH 5HI4D 4ZAKD 4HUVA 3V0VA 2R8SH 1IC4H 4ONOA 2P5ED 1KGCD 3FONA 3BVNB 4A2LA 1JWMA 5IUSA 5DJZA 3L3JA 5F7MC 5HPOA 1IT9H 2VSCA 4Z7NE 3RTQA 2GIYA 4PJDB 2ADFH 3DNKA 1ADQH 1U42A 4J3UA 3PWUB 2YUWA 3VDBA 4Y19A 3RVXD 4LKCB 1A4JA 2XN9D 1CFSA 3TZVB 1MJJA 1UWXK 1AFVH 2FX9H 2ZCLH 3D0VB 5EUOB 3SY0A 5C0GA 1U8OB 2AK4B 1FZMA 2BOBB 3QIBD 2J6EA 3QJHA 4LLYA 1MNUL 5TH2B 3WUWA 3ALWA 2K3TA 4Q0XL 1SBBA 2FR4B 5GIRA 5ILTH 1U58B 5DD3L 4UILH 5DJDA 1U3HD 4S2SB 4NZRH 4CVZA 2ADGB 2EDJA 1ED3B 4R2GD 5CKGA 1IJ9A 3GHBH 3HS0A 3BAEH 2FJGA 4ORZC 5HHMB 5I1CL 2EYSA 3MRBA 5CCKH 5T1KD 4OGZA 3JV6A 5D1QB 4AZ8A 3F65A 1I9RH 1WZ1H 4YC2C 3DX6B 3MRKB 5D2NC 2X7LB 4LSPL 1PQZB 4M6MH 3C09C 4Q2ZB 3BIAX 3V4UL 1PX4A 1RJZB 3SE9H 5IFJA 1U3JA 4PGEA 1GIGL 4C4KT 1WZMA 4X7TA 4RNRA 4WO4D 4OQTH 3U4EA 2HT2C 3O6FD 4BA8A 4H5SA 2WIIA 1RZKC 1QNZH 3EOTH 1M7IA 3T0EC 3ECBB 4U0QB 3KDMB 3TIEA 1EEUA 3PNWA 5HHOA 3VXPA 2DMCA 3IJSB 2AVGA 2CLVB 1K4CA 5KTEH 5FYKD 4K7FA 2JE8A 3RWIB 1N5YH 2MSPA 5DJCB 1SJEA 4DN4H 5GSVB 3TJHD 4OFKA 4Q58C 3TVMB 4XWGL 1YC8A 1JBJA 3KPLB 4M02A 1JVKA 5D7IB 3UPRB 3VFTA 4HXBL 4TVPL 3E2HC 1N0XL 3QUKB 2AABL 4ZOAA 3EYSH 4DGYL 4CUCA 3TLRA 2GTWB 3MXVL 1E4WL 2L0DA 2F19L 5I1IL 3HB3D 1UCBL 5I8CB 3BPLC 1DVFC 2YRZA 4Z0BL 2AXJA 2Y07L 2E7LC 2BHYA 4L1DA 4ZTPH 4I3SH 2E6QA 2XZAH 4NO3B 4OFYD 4PJBB 5D9SB 2C9AA 5JDSB 3BZEA 5HJ3B 3DI2B 3GHEH 1ZHKA 2DL2A 2Q8BL 2VLRA 2EICA 4FOMA 3T2NL 3JVGC 1FE8L 3DUUA 1RUQH 2O5XH 3ZLQC 3S5LG 1E6OL 1AQDA 1HI6A 5E9DA 3WEXA 5K9OB 1B4JL 3I9GH 2CK2A 3O3DA 1KIQA 3L3OA 2JF1A 2DIAA 4FTVE 3MUZ1 4XI5C 2HTKD 2XYCA 1VGKB 4JFHE 2DQHL 3E0GA 4IJ3C 2JB6A 1NAMA 4XRCA 4ZFGH 4Y4KC 1Q0YL 5IR1A 5EU6A 2BY2A 1H3PH 4LEXH 4G8EB 4IHOA 3U9PH 1FL5B 2G2RA 3NACL 4R6UA 4PJFB 3GMOA 5C7XH 2OXGA 4OCWL 1XGQA 3LN9A 4JVPA 1Z6JT 4UINL 4ZFFB 1HYSC 3EGSA 5F96L 4YHPA 2V9TA 2YD9A 4FQ1L 5I1GL 1KPVA 5AG9A 3O2DH 3O41B 2IANB 3FCTA 3U82B 4RMTA 5JOFA 3QNYB 5LVEA 3PHQA 3T09A 4XWOD 4N0CD 5BRZE 4YEEA 1RQ5A 4PJXB 3AROA 4P46A 2PTVA 2FH8A 3ULUE 2YD2A 3TJEL 4G6KL 5TFSH 2XTJE 1TVBB 5J6GB 2VR4A 1AR2A 4X6FB 1YEKL 1DN0B 1ZK9A 5C0CB 4ZUTA 4MB5A 1EJOL 1OOAA 4M1DH 1X4ZA 2VABA 5J89A 4LVEA 4PV9A 4N0RA 3RVVC 4PRDB 3RL1A 1LO0L 3O9WA 3I84A 1KBGL 1AHWB 5DVLA 5DRNA 1I7RB 3QQ9D 3S34H 1S78D 1A7RH 3KS0H 3O11B 4PJAA 5KOVC 1MCIA 2EDOA 2VLKE 3VXNA 4J3TA 4JCMA 3LKQB 1MWAB 1CFTB 1N64H 3MTRA 4XCNA 4PTUA 1W0VA 1OPGH 1WUNT 1S9XB 1MQKL 2P8PA 1C5CL 4XHQA 4H8WC 3G5XB 3N0PB 4R8WL 4YR6A 3LKRA 2PR4H 2G60H 4KK9C 2ZUQB 5F7DB 4OB5L 2DTSA 3TIDA 3QEQE 3GBML 2OL3H 5GISH 5JLZB 2IPUG 3AUVA 3EJYD 4EIGB 2HFEA 4K23L 3L7EA 4OV5B 7FABL 3WS6C 5DGRA 4WNQB 4XCEB 3LSOB 2Z8VC 3QEUB 1KT2B 4NP4H 5DK0A 1IQDB 4ODWB 3O3BB 1IAOA 3ROOA 5E94B 2NY4B 2P1YA 4MNQE 2Z91B 5IB3B 2A1WH 2IAMB 4PYHA 1KFAL 3BGFC 5KBNC 2KQMA 1I85A 4OKVA 1D6EA 3QNXB 2GITA 3TNNB 3RVTD 1OTUD 2CUIA 1YMMD 2EZ0C 3HI5H 4F7MA 3MACL 4K07A 1IFHH 2DMKA 2APBA 3ZKNC 2GK2A 4FQXC 2BSED 1I7ZB 2CKBA 3LB6C 1I9JL 2G5BA 3ARBA 1RURH 4GAYA 1S9YB 3QWOA 1AKJB 4U6YB 1UFUA 3C2AL 3MCLH 5K9KA 4DW2H 1U8NB 4TRPH 3QHFH 4JFFB 4Z8FH 4R4NC 1JYWA 4RMUA 3G9AB 1CZ8L 2DL9A 3FO2B 2AEQL 3OKEB 1WCBA 1K8IA 2DQCL 3AAZA 3EFFA 3VXSA 2A6JA 5CEYA 4X6DA 2X1QA 1J1XH 3IFLL 1CQKA 3KXFA 5ANME 3FOLA 3MRIB 1MCPH 1KIRB 1F4YH 5FAAA 4POYA 4Y4FC 4OCMC 2R4SH 4A6YL 5I73B 1FZJB 3HZMB 4NOBA 3D18B 5L8LB 2BVPB 1D9KC 4RZCB 1SVZA 1WBYA 2VKXA 3BISA 1EBPA 1TIUA 3GMQA 1NUDA 3EJZC 5KS9F 4O02L 1A3RH 8FABA 3C6SB 4JKKA 2YD5A 4LDLB 1S7WA 1ND0B 1X5XA 2PYED 5J4MA 4WCYH 5ITFA 4PJ7B 3PQYA 4U6HB 3BOVA 3HMXL 3VA6A 4ZO9A 5BMFL 2DAVA 4KVNH 3EUUA 1EX0A 3TT3H 2NXYB 1V8HA 2HKFH 3AB0B 4GW5A 1C16B 2BVYA 3BI9X 3BFOA 2P5EA 4RSVA 4Z7QE 1I8LA 2X89D 2ZOKA 3AMKA 3KYOB 1X9QA 5SV4A 2NY3B 5IEKA 2YC1B 3LN4B 3S3JA 1G7PA 1PG7H 3UTQB 4LCWA 4APQD 1V7NH 2VDKL 1T1XA 4OZFH 3IDIB 3WN5A 4HUUB 4BZ2L 4L4TD 4HUXA 5C08E 1EFXA 3MNWA 1EK3A 2DKMA 2CRIA 3RUGE 2GJ6A 4FXLA 3V6BR 3HFMH 3D2UA 1OARL 4QXWA 1E4XL 3QIBA 5H37G 1JK8B 4I9WE 3BKML 1RJLA 4L8SC 1J8HA 3P11L 1XR8A 3ARDA 1CFVH 5I17B 2XQYG 4OJFH 4KQ4H 1LE5A 1MFDL 1C1EL 5IBLC 3B3IA 2Q1EA 1A1MA 5KVFL 5HVHB 1CDJA 2AEWA 4YFEA 4P9HH 5BQ7B 1Q1JH 3ARED 3DYOA 5DVMA 4XPGL 3BKYH 3WFHB 3F62A 3CFKB 4TVPD 1QFWI 5D72H 2X1WL 2XA3A 1BGXL 3MFFA 3M8OL 1MLCA 4JFED 4M93C 2VDRH 4HH9B 4XVSL 3S6CA 1IILE 2N4IA 4Y5XC 1G9MC 4U31A 2WUCH 4PTTB 3KGRA 4PJ9C 5DHVA 1YEGL 2BK8A 3QQ3B 5E1AA 5MP6H 4LLQA 2IH3A 2XN9B 3DO7A 1AXSB 1G7QA 1JF6A 3S98A 3VXRD 5ADOH 1GAFH 4NGHL 4QWWD 5DRZB 5GRWA 3FQWB 5KSVB 5E2WL 3RU8H 1NCTA 4PRPD 1MCEA 5DD1L 5J13B 5FGCB 4BZ1L 5HDLA 4Q9BA 3UTPE 3HG1E 4HIHA 3NCJH 1YJDH 1U3HB 1PEZA 5GGRY 3MREB 4IOIA 1JHKL 5BV7B 4HX1A 1T20B 1CDUA 1P2CB 1Q8MA 5MEND 1G6RA 5E8NB 4WI7A 4QHNB 5T1KB 1OGAD 2R29H 2Z31A 4LLDB 1U2HA 5I16B 1TZIA 1YNKH 5I1EH 4YH6A 1ADQA 1NPUA 2R1XB 5FGSA 2VNCA 2JELH 4OV6F 3BT2L 3PP3H 1OCWL 1MFCL 4G6JH 3JTSA 1N0LA 5FUOH 5IFAH 2DQFA 5ADPH 5SV3A 3O6FB 2M8XA 1SEBA 5ALBH 3QEGH 1A6TA 2YPVH 3ARWA 1T21A 3HZYA 1Z9LA 1YN7B 3LKPA 3K2UL 4J1UA 2NY1D 4JZNA 1A9EB 4X5XA 2YHGA 5KG9B 3QDME 4G43A 4LDOB 2GY5A 3WIHL 1OSPL 2ZWLT 5C07D 5EZIL 4F33B 3QR2A 4OM1H 5JXED 3BEVB 3T3ME 1PX3A 3CH1B 3OKKA 4KI5D 4K3GA 4DCQB 2ORBH 1NBZA 1FFOB 3MZTA 1WT5C 4WHYH 5HGHA 4IRSC 4QXGL 4ZNEA 3RNKA 4JN2B 1BMGA 4Y89A 1RUPH 3QUYA 5T5FL 2YPKA 4P4KA 4QHKJ 3M45A 3RJQB 4OQTA 2X4QA 4W81A 5H37H 3UYRH 1QRKA 5CJQL 5DMIL 4LOUC 4GUPB 4U1LA 1UYWH 3DI3B 1AGFA 1UZ6E 1DUYB 4MCZA 2J8OA 1OGTB 2X1OA 3KYMB 4JG0L 4HKBB 2BVOB 4JQXC 1E4KA 3A6BH 3BIBX 2BX5A 4N0YH 1HKLH 3BQUD 4LSRL 1CGTA 3P77A 1HE7A 1MH5B 3VJ6A 4NJAL 4IRJC 1CI5A 3GB7A 1AP2A 2VO5A 2E6PA 5GQBA 4XP5H 4NZUL 2QQKH 4DZ8A 4HGKC 3E8UH 4GKZB 1CXLA 4PJ5B 3SDCC 5AZEL 4GMSH 4EVNB 4OTXL 3RWFA 2PXYA 2GQHA 3CMGA 4K94L 5DUBA 3VE0A 5EO0A 2AEPL 4L9LA 5JR1H 3L5HA 3FFCA 1JNLL 1XGUB 2FZ3A 5IW1A 4JM2D 4RGOH 3ROLB 4EOWH 1BJ8A 3BGMB 3FN0L 3MYJB 2AXFA 2E7BA 3MLXL 5I8OH 2EE6A 4AM0A 4O4YL 1ZA6B 4BH8B 2I9TB 4PRHE 4MXVE 2X4OA 1T7YA 2CQVA 1JTOA 2DTMH 5EU3A 1Z0NA 1ES0A 2HT4C 4ZUUB 3DX8A 3HC0B 1F6AA 1WAAF 1IAIH 1EZVY 4EI5B 4R97C 1M6OA 4OT1H 3RDTB 2R2BA 4JZOA 4J2XA 5C0FB 2EH8H 3P4LA 1F4XL 4LPYA 5FO9A 5SWSA 1X4XA 3C5ZC 4RIRB 4M43H 3FB7B 3HI6H 4M48H 1JHLL 5FGBC 4Y5YB 2W65B 2D0FA 4KRPD 4AH2A 1F3JB 5JOEA 5INCA 3W11D 2FH6A 1QPPA 3DUSB 4X98B 2VXUH 3B9KC 4OZ4B 1IARB 1WISA 4KKNA 2FHBA 4JZJB 2DICA 4R96B 5DJ8A 3UJIH 2B4CL 3MR9B 4BKLB 1OM3L 2BVQB 3DJ9A 4GXVH 4HIJB 3JWOH 4PJEB 5KVEL 3O2DA 1DLFH 4OIBA 2J8UA 3VWKC 4LIQH 5IQ7H 1NCCH 1J1OH 1N7ML 1Z3GH 2A73B 2GSGA 3L5XL 4LMQI 4OZIE 1GPOH 1SM3L 1ZT4B 4ZSOB 1FO0H 3SGKA 3HC3L 2BDNL 1L7TL 1MAKA 1CGSL 4GQPH 3LOWA 3U4BL 2ICEB 1R3HA 3HR5B 1J5OL 3PIQB 1ZXQA 5CEZE 1I7UB 4X4YB 1EHXA 5F9JB 2D7PA 3FMGH 4XPBL 3ILQD 2V17L 1KV3A 5C0ND 4ZOBA 3GSRB 2YPLD 5JO5A 4I3GA 3H0TA 3PGDA 3E6FB 1X5ZA 1HOCB 2NPLX 1SY6H 3KYKH 2AJXH 4WW2A 4HK3J 3KPPB 1IKNC 1OAYL 3FJTA 3LN5A 1CCZA 2VLJA 4Z7UB 5E6IB 4PG9B 2VDLH 2BNUA 4AENB 3MRJB 2XZCL 4U1SB 2FBJL 4RA0C 1ZT1A 4QRRB 4G8GA 1YMMB 5KSBA 4D9QE 3GUTB 1PG7W 1J0HA 3W2DH 4LPCA 1HSAB 1MCOL 1QBBA 4P5KA 3FN3A 2VL5A 4YXKL 2DLFL 5IVZB 1FPTH 2DB8A 4XMLH 4QEGA 5GS0C 2JIXD 1EGJH 1G7IA 2E9BA 3WDIA 3O4OB 3PDDA 3SE3C 1RSFA 2OL3A 3WFCH 5B38A 3F8UB 3BZFA 1HQRB 5EC1B 5BS0E 2JJWA 5CJOH 1HN1A 4C83A 4LHUB 1A6ZA 1TJGH 2SEBB 4UT9H 5EOCL 1IAKA 3K4DA 4MNHA 2YS4A 4P5TA 1LEKA 1XCQB 5I66B 4O51A 1U8JB 2QQNL 2A6IA 2WBJD 3DVIA 3QRGL 1FSKB 1RZIA 2CR6A 2A77H 2UYLA 3A67L 4YAQB 4YDIL 1JI1A 1QKZL 4F58H 2OP4H 1UACH 3VXME 1PAMA 4QTIL 2JCCE 4LBEB 2DI8A 2HTLD 3W0WD 1LEGA 4V1DD 5ETUB 3V0AC 3MXWL 2B1AH 2F58H 2N1KA 4X99B 3M1BA 4NQUA 4ZUSA 1FRGH 5L2JB 4JRXA 5F1KC 3B43A 1QR1B 2FIKA 1LK3L 1JRHH 2FL5A 5TE6L 2DF3A 2D2OA 2UZXB 1T1YA 4DFIA 2XY1A 5JHDE 4N0UE 2DJSA 2NYYD 15C8H 4P23D 4QRPE 4XP1H 4QOKD 4Z7VB 3UEZA 4JAMA 3THMH 4NQCE 2PYEB 3GRWH 1HZHL 2CMRL 3WNNA 1GZPB 5D2LF 1H9VA 4UT7H 4MJIA 3P9MB 1U8HA 1ZHBA 4GAFB 5CLTA 1FORH 3O6KH 5D8JL 4KJPC 3PWNB 2DIBA 3NA4A 1EMTH 1MCNA 3DURB 3DSNA 4ALAH 1DE4A 5I71C 1ORSA 5J6HA 2DWEA 4CRPA 4XNXH 1QSEA 1U36A 4RRPA 1N8ZB 5CP7B 1YEEL 3ARFC 3KPSD 4YZFF 3ULUL 5HYQA 1DBBH 4GRWF 4KMLB 4APQB 3CU1A 5DJAA 4TPRL 5IMLA 4Y1AE 1LP9F 4E42B 4L4TB 1X6LA 4U1KB 4YIQB 1FL6B 3OAUH 3U0TA 2NR6D 2YRPA 1DEEB 1J0IA 3AS0A 5DTFB 4G7VL 1D5IH 2VDML 3CDGB 4KDTA 4EI6B 1GGYA 4N9GA 3UC0H 3MGAA 3HA0A 1QLFA 3MJ9L 1NGWB 3HZVB 3P9WB 2ZCKL 2O5YH 2P45B 2XQYK 3OJMB 3DVNA 1TFHA 5LQBL 5FYJU 5C0DA 3CSBA 4KHXL 4NM4H 1DP0A 3PWVB 1T2QH 5B39A 3VI3F 1E28A 3DPBA 3GSNL 3JWNC 3AREB 5DLMH 1FNGB 1UKQA 4ODTH 4ESKA 3BH8B 2AS5M 4FQ2H 4XPHL 1S7QA 3SDAC 5IV2A 4JPWH 1U91A 1XF5B 2OLDA 4I18A 5CGYD 3UTSE 1TVHB 4JFEB 5ESQA 1L6XA 1KJ3H 3SQOH 4XMPH 4HJGA 5IROA 1MHEA 2APVA 2BP3A 5HSFA 4HCRH 2R0ZH 1KENL 4GQ9L 4OZFA 3B8YA 3N1QC 3O45B 2DLTA 4JGUA 3RIAF 1VKXB 3TA3D 2GFBA 1JNJA 2NTFA 3VXRB 4JHBA 4I2XB 4W4OC 1MJ7L 4HZLB 5DJ6B 3T2OA 3RY6A 1MY7A 4DWHA 3AY4C 4XVTH 4PRPB 2YD3A 3OKOB 2DM3A 4E0RA 2VDQL 3TPUA 3IJYB 3WKMH 2WLZA 5BXFA 1HCVA 4M61B 4LCCC 2YXFA 5L2KA 3TCLB 4P99A 4YWGH 3F7PC 2FLRT 4PJCB 3LIZH 1EUTA 4P2OD 4LNRB 4TUJB 5MENB 1OGAB 2HLAB 3DIFB 4U6XB 5I15H 4LRIA 4EZMA 4PV8B 1RMFL 4I0PA 3LH2H 1M05A 1VB9A 1IE5A 4YDJA 1UT9A 4FQLH 3IFOB 1A6AA 3NFPA 1IGTA 4OZHB 2FJHA 2VH5H 3Q1SL 4D3CH 1FHGA 2APTA 3KLDA 1CN4A 5F88A 3L1OH 4WDIB 1VADA 1G1CA 2B8OT 4KKBC 4OCLC 3BYYA 3O6LL 4G6MH 1OLLA 3RPKA 1MHHB 3MLSL 2C3XA 3UTZA 25C8L 1S7UA 1PBYA 5KVMC 3H9HA 3WE6A 1VPOH 2NW3A 2F53A 5I0DA 2Z0BA 3TYFA 2I60H 2NY1B 5HVFB 4LSSH 1MFAL 2NX5D 3R8QA 4AQ1B 2ZOLA 5DSCB 3N50A 4YHIA 5D7LD 3FL7A 3WBDA 5GRJH 5A40E 3PWPE 5C07B 3L5WB 4L3CA 1CXFA 1EHLL 2DI7A 4BFIA 4YHOH 1S7TB 1KCVH 1JJUA 3BDYH 3IXAA 3LEVH 4NKOA 5HGDA 1SYVA 1TJIL 2C7UB 5C2BH 3LQAL 4PREB 2OJEB 5MEQA 2PCPB 4JPIB 1MCSA 3ZDYF 4JFPA 4PGBA 4S1SH 1BVLA 5L0QC 2DBJA 1WBXA 4F7EB 3FAWA 1REIA 4JKPH 3U2SB 3JXAA 3D48R 2XWJB 1J88A 4M00A 5GRYA 2ITDA 2P42B 4U7MA 1PY9A 4O9HH 3UCRA 3O81A 1UQSA 3HRZA 5HGAA 5E2UH 1K6QL 3MV8D 2P24B 1RZKH 1U8LB 1JGDB 2EECA 2C1PB 1P4BL 3RKDD 5CINL 1F45A 4NN5B 4H1LG 5B4MD 4FG6D 3GO1H 3BQUB 5HD8D 3DOSA 3CZFA 5A2KH 1YPZA 2IPTH 4GBXD 2NW2A 1ZVSB 1AGEB 4PP1C 3MBEB 3LEXA 5EORL 1PKQA 5DJ0A 1A7NH 4ORGB 3PWJA 3BXNA 4O2CB 4N5UA 3KLSA 3RPIA 4FZ8L 6FABL 1I3RB 3SGEI 4AY0A 2ED8A 4E41E 3SEPA 4IIQB 4JM2B 3VRLE 2EYRB 4XCYB 3VFOB 2JB5H 4CVXB 4NNYA 3PL6D 5IESH 1P4LB 3UYPA 3E6HB 2X7LA 4LSTL 4L4VE 4K3DL 4YX2H 4JDTH 3HUJF 3C9NB 1EPFA 2HH0L 2MCG1 3WJJA 4HJ0D 4UQ3A 5DK2B 4D0CB 1KCUL 3T0XA 4XNUH 4F7CB 1AD0B 3EDKA 4Z7WE 5CJ5A 3OPZH 2WQ8A 4XXDB 5F44A 3NTCH 4HC1L 4L8DA 3EDJA 2R56H 3MRDA 3FHAA 1A7PL 2I5YL 1I3UA 4BJLA 2UZYB 3NH7L 3O2VL 2YPLA 2XKSA 1SEQH 3DYMA 1TPXB 2BJML 4ODUB 5KAQG 1I8KA 4P2QE 4XGZA 3QUXC 4PJIF 5LAXB 3ZSSA 5B8CB 4FTVD 4J8RA 4WU5A 3EBAA 3BH9A 3H8NA 4DKEL 2DJ4A 2NY5L 3MRCB 2F9BT 4WI9A 1JF5A 5IOPA 4A6YB 1X5JA 3MRRA 4LASH 1CL7L 2IGFH 1YN6B 1S7SB 3UDWC 1KCSH 4MA3A 1J1PL 2FHFA 3A6CH 4FHBD 1NEUA 4KI1A 4LVNB 1RIUH 2O5ZL 2HP4A 5C09A 3QQNA 2H41A 4HIXL 3MUGA 3SDXF 4OUOA 2VXQL 5TPWL 2XKNA 4Q9QL 2WP3O 3MLYH 3T0ED 2LU7A 4PJBA 5JDSA 2BSTA 3IDGB 2B5IB 2GYSA 4R26H 1T6VN 5EBWB 1HHGB 1J87A 5DD6B 3LRGA 43C9B 4U1NA 2ED7A 1MREL 1AIFA 4TNVF 3IVKB 5I2IA 3TN0A 3MNVB 2P5WE 1AJ7H 2VQ1B 3BHBB 4WIQA 3RZCA 1D5MB 5GHWL 4XCFL 5AUMB 2X1PA 4YNYA 4QRTB 5F1NB 3ULUD 3KWWA 3N85L 4HAFA 4YHLL 2HJLB 3WXVL 3WFEL 3W0WA 3G08B 3ES6B 2MOVA 2H1PH 4XNQB 1A7BA 1NLBL 5IVNA 4WJ5A 1J0YA 4UUJA 3ZT7A 1CXEA 1DVFD 2HVKA 2EDWA 5HXMA 3PXHA 4X6BA 2CDFA 5GS1A 4P57A 2D03H 1KLUA 1PLGH 1FO0A 2ESVE 1FZKB 4GAGH 2HLFD 3CDCA 4PIRF 3BSZL 2JIXB 4DGVL 4JJ5A 4X6CE 4XP4L 2R39A 4NUGH 5E00B 4XZUB 1CDYA 3DX7A 3KPNB 3F58L 4QXTA 3O41A 4JO2H 3KPQB 1YYMH 2AJUL 4HT1L 4WUUE 5IFHL 3LKNA 3MODL 1N6QH 4UIMA 4OLXH 4NKDA 1MVUB 1YDPA 3AU1A 3WHXB 5C0BA 4BQBA 5HHPA 1O7VA 3CJJA 3HZKA 1B4RA 3BPOC 4G9FA 2HG5B 5CBAB 2JJTC 3TBVB 3ZHLA 1LO3L 3ARQA 5ISZA 1SY6A 5J8OA 2WBJB 1TCRA 4LHQB 4J3VA 1KJMA 1JN6A 4IDLA 5EOQL 3RI5F 3ZDXF 1U8IB 4PLJD 4IRZH 3WYRA 5I74C 1RIHH 5ID1B 2G9HB 3W9DB 4Z95H 3ULSA 1HHIB 4V1DB 4GKNA 3CMOH 4NRYA 1JNNH 3A0OA 3VCLA 3HI1B 3OGCA 1ORQA 4RA3A 1NGZA 1GC1H 2KZ1B 5DDHB 3V4PH 3VW3L 1VFAA 1JV5B 4UU9A 3T77A 1SQ2N 4G3YL 4I0KA 3I02B 1Z9OA 4P23B 4QOKB 3RA7H 3D39A 1EGJA 4JY5H 4Y8DC 1YYLL 5KW9L 3IDXH 3GMMB 3QDAA 1AGCA 3VXUD 1V7ML 4XCCL 2W91A 3HAEG 1CFTA 4BSVB 5DMKB 3MV9D 2IPKA 5DYOB 2LQRA 3RAJL 3EW3B 5CZVL 4OLUL 1OQXA 2BSSB 3KPRB 1R5IB 4I77H 2Q3AA 4N8CL 3X3GL 5L7XL 3H9YA 2WBKA 2GUOA 4HKJB 1Q94A 3C6LD 3KPSB 1QSVA 4PJGB 5IB4B 4X4ZA 3GSUB 3EO0A 2UWEF 3RVVD 1NGXA 3ZKQD 4L1HA 1IQDA 1L0QA 1OY3B 3HNVL 3KLAB 4XC3L 4BK4A 1KTLB 2YD4A 3O8XB 5DMGC 4XC1L 1CD9B 4PRAA 1TQCC 3Q3GB 3QNXA 1IGIL 1A9BA 3U7WH 2BNQA 2KDGA 3T1FA 1QD0A 4LKXA 3JV5A 1MIML 2VAAB 4NRXA 1S7RA 4PG2A 1I7ZA 1ODAA 1MNUH 4HEME 4KK9D 2O93L 3PP4H 3FO9B 2FD6L 4KRNA 1NCWL 4Q0XH 5IVXB 1S5HA 2DQDL 4H0IA 1S9YA 4XP6L 3RL2B 1KTDA 3QXDB 1MF2L 2VWEC 2XICA 5DD3H 3BD4A 2Z9TA 4ZD3L 5CEZL 1C12A 5A2FA 3CC5A 3BP5A 3PWLB 5D93B 5EUOE 2HRLA 1OD9A 3KJ4B 4KUZL 3TA3B 2AK4E 2R1WB 3QFJA 5SWZA 1T5WB 4LSPH 2EZ0D 4UV7H 1MI5E 1P1ZA 1GGBL 2Y36H 1GIGH 5IBUB 4LEOA 1KCRL 4YGVA 3IETA 3V8CA 3ESVF 4LVOB 4LDEB 1Y0LB 5HHME 1EXUA 1IQWL 35C8L 3V5HA 2EYTA 4UDUB 5A2IH 3H3BC 4QNPF 4R4ND 5C0AA 3F6LA 5D1XA 4P2OB 1UVQB 3IFPA 4X4ME 2Y06H 4KHTL 1RZFH 1CD8A 3MZGB 1FLRL 3DMMD 2HYMA 4JRYA 1FN4A 3O4LB 1HWGB 4RAUA 4F37K 4XWGH 4X6EA 4HCRA 1U92B 2R0KL 4MJ5B 2VDPH 3VFPB 4NQEA 2RJMA 1U8KB 3MJ8B 4HGWB 1H5BA 1N0XH 4PJ8C 5FB8B 1II4E 2AABH 4MAYA 1XH3A 1E4WH 1QEWB 3V7AG 2F19H 1D7FA 4R4BA 5IGXH 3PG2A 5TE7L 2Q8AH 5ITBL 1TVDA 1IEBB 3CXHK 5GGVH 4QGTA 1MRFH 2V5TA 5LKNA 5SWQB 1H3VA 2E9WA 1SBSL 2JJSC 2R23B 3BGAA 3EJZD 5FFLA 2Q8BH 4G8IB 2HAZA 3MOQA 5T3ZE 2H9GB 2XFXB 1FE8H 2NX5B 4DN3L 2HRPL 5CZXC 5D7IE 2DQJL 1EDQA 3I6LE 4GBXA 5FECB 5D7LB 3REVA 1B4JH 2A9NH 2V2TB 3TH4T 3X13B 4JY6B 1CU4L 3U6RA 4XTRC 4MXQD 3KYNA 5HYJD 1UKTA 3L6FA 1H15A 5JMOC 2CPCA 3NCBB 5FKPA 3NACH 3MCKA 1VDGA 2Y1VA 4YHML 1SYSA 1S8DB 1QFWL 2VOTA 3MV8B 2A0LC 4MHHI 3HPJA 4UINH 5FIEA 5I1GH 2CGRL 5FHBH 5JW5A 5DRZA 1L0YA 2IWGA 1DQLL 4L9DA 5EU5B 5BJTB 5L9DL 2X9WA 3TO4B 5DMYA 4YXLL 1MJUH 2W0LA 1DBML 1JPFA 1KC5L 4WRLA 1RZJL 4CAGA 1N2RB 3TJEH 5AG8A 4Q6IC 4G6KH 2EE9A 3G04A 2WINA 4S1RL 1X5FA 5D2NA 1YEKH 3ZL4L 5CMAB 3LDBC 3O9WC 4UDTA 1R5WA 2IANE 3LRHA 4YK4B 1OAQL 3LEYL 4IMKC 1XIWC 3PL6B 3SQBA 3DROA 4D9LL 5F3BB 1LO0H 1G0XA 2CH8A 1ZEAH 5JPNA 4YHNB 4PJXE 4FNLL 1OW0C 3T0EA 3QCVL 5KOMC 4M5ZL 1XF3A 4MWFB 4YEFA 1HH9A 2YR3A 3VFSA 4W6XB 1V5JA 4Y16C 5AYUL 2YEZA 3DXAA 2UY7A 4Z5RA 3VGDA 2X4SB 3U9UB 4R8WH 5DQ9B 1AGBA 1ZGLM 1F90L 4K3JL 4FTVB 2AW2A 4OB5H 3DHJA 4WEMB 4CNIB 1NFKA 3GZKA 1UC6A 2BC4B 2Q7NA 1K4DA 3GBMH 3IDMA 1OTSC 3KJ6L 3KG5A 4G80B 2IEPA 4K23H 2V2XA 4PGCA 4Y2DC 4YC2B 3ARRA 2VLLB 4ZO7A 3N1FC 4HK0A 1QFUL 4OLZL 3CFDB 5F6HJ 1DVFA 4P2CG 4UOJA 1JZ8A 4F2MB 3T3MF 3SDDC 5TGBA 4P59L 2GTZB 5I1LB 4I3RL 4R7DA 3R4DA 5DK3A 4HJJL 4OLVL 3QRFM 3KLHC 4OF7A 4BYHA 2BSRA 3JVGA 3V5DA 2DWDA 1UB5B 2YKLH 3DO3A 3MJGX 4YGAB 5JUEL 1X5LA 2R0LL 1LDPL 3IDYB 3C8HA 1GHFL 3MACH 3ARBC 3T0AA 3CVIL 5DJXB 3RNQB 1D5BA 3ULVC 4HPOH 1DUZA 3CU7A 3QFDA 1L0XA 4C54A 1I7TA 4Y4KA 1PZUB 5EN2B 3GK8H 4WFGE 1WFUA 2NY7H 3T0DA 3C2AH 3UZEA 3NPZB 4MQSB 4HKXB 2EC9U 3FO1B 3UBXB 1PKOA 3CFBA 3E2HB 1T2XA 2AEQH 5F6HI 3PDOB 2XTJB 4H26B 5FCUL 1JGEA 3IDJB 3NFNA 4X5WB 2X70B 1YUHA 2IJ0C 3C60C 5AWNL 3DETC 4NKMA 1NBYA 3QIWC 1IGFL 4PJ5A 4PS4H 5CAYB 4HSQA 3PV6B 4FFWD 1R3LB 1JNHB 3GJFB 1INQA 2QR0A 3PE9A 5F7KC 3VFRB 1DL7L 5ENWB 4ELMA 1HSBB 4LOUD 1K3ZA 4ZS6C 3ZKSD 3GFUA 4A6YH 3GSQA 1OF2B 3ULVF 5KANG 2QADD 5I1AB 4JFFE 4ZUWB 3TBWB 4P3WA 2G75B 4OCSL 4JO1H 5FA3A 3D87B 4WFFD 4IDJL 3GSNB 3QUMH 2G5RA 1HHJB 2VLKB 1KUMA 5KSAD 1ZA6A 4JFDA 2XT1B 1J0ZA 5IIEB 5EC2B 1YMHA 5FM8A 1DBAH 5IK3A 4QRUA 3L95A 2GK0B 4X6DF 5FUZH 4GW1B 2GKIA 3HMXH 4JJHA 3SE8H 5CEZD 5HYSB 1H3WM 4QXUL 3SDCD 1GGUA 2EIDA 2MWCA 2OI9C 1I8LC 2AAVA 1FAKT 4RIRA 2AJVL 3OXRB 5C9JA 1WFNA 1NCUA 1BOGB 4Y5YA 3DECA 3CXDH 5EPMB 12E8H 1T03L 4PP2A 3DUSA 4MA1B 5E2VL 4OZ4A 5E99L 1NGYB 5JW4M 5TDPB 2CXKA 2ATKB 5I8KH 4HMDA 4PJ7E 4KQ3H 1KJ2L 4RBPK 5JQ6H 5CIPB 3EHBC 3BUYB 2QSCL 1NANH 3PUCA 5GS0H 1E4XH 3I50H 3VXUB 3ZYZA 3MV9B 1QRNA 5GGTA 1KOAA 2FO4B 4OCXH 4NC0B 5HVWA 4IEFB 2EIEA 4MSWA 4ONHB 1MHPL