4WI3A

Structural mapping of the human igg1 binding site for fcrn: hu3s193 fc mutation i253a
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Structural and functional mapping of human IgG1 binding site for FcRn in vivo using human FcRn transgenic mice
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi3A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi3A01
3FQWA 3BESR 4MDJA 4F2MA 5BV7H 3SE9H 4ENEC 1BFSA 3LVEA 3QEHB 3CNKA 4ZYKA 2QHRL 3EJYD 3M17A 4HJ0C 4X6FA 4PRNA 4RMUA 3GRWH 5D1XD 3MRRB 1KELL 1MF2H 2DLFL 2ZUWA 3QIUC 3TBTB 1FV1A 4MNGE 5C92A 4TVPE 1J1XH 4DAGH 1ZVSA 2YC1A 2DKMA 1GIGL 5ACMA 1OTTC 1I7UA 4RGMC 4IEFB 3GB7B 1FFPA 1IC7H 4GG6F 5C0DA 3PXJA 4JCLA 1B0GB 1MRCH 3CC5B 1EO5A 2L0DA 4O58L 2CIIB 2A9MH 3FT4B 1QBLH 1JNHA 1MFDL 2X4RA 4U2ZA 2F54A 1CBVH 4NT6A 4OCWL 4KUZL 3ZKXB 1QACA 4N1EA 5AAWA 5C6TH 2G9HB 1IFHL 1FPTH 5IOPB 4L3EA 4Y4HA 4FMKA 4Z7NE 4N8VG 4KJPC 3SDAB 5I1GL 1EK3A 1SBBA 5T3ZD 4Z7VB 4NQDD 2AK4E 4R7NA 5J12C 4EOWH 5E8PB 1YNTB 5ADPL 5BCAA 5FF6B 3Q2CA 5K9KB 4MD4B 3QDAA 3QNYA 4WUUD 1BJ1H 3A67H 2Q7NA 4P0DA 1GGIH 4BELD 1SQ2N 1N7ML 2D0FA 5HHQB 2LFGA 1QLFA 2VL4A 1TVBA 5IK3B 1T3FB 3NACL 3P0YH 1AR2A 3CMOL 4F33A 5IB4B 2HRPH 2JE8A 1BBJA 1FFNA 1BZ7A 4BSWA 1MLCB 5CINH 1TFHA 2XKSA 3HLAA 1DUZA 4OGXH 3VWJD 3BQUC 5EC2B 3QQ9D 1L0YA 3KPNA 2V5YA 4ZFZB 4E41E 1A3LH 3LZFH 1UJ3C 5CJ8A 2EYRB 4G5ZL 4FXKB 5HHOE 3LOWA 4R96B 5EOQL 3DECA 1U8MA 4P59H 1RUML 2XRAH 4H88H 5TH2A 5C7XH 4JZOB 4K71B 8CGTA 5B38A 5IQ9B 1FZOA 4YHIA 4U6XB 3W9DA 3QZWB 4JZJB 4YUEL 1U58B 1TVHB 5C0JA 3U1SL 3SDXA 3WFCH 4JY5H 3A6BH 3G6DL 4LLVB 3QCUH 5F70A 2DL2A 1OAQH 3P9MB 1FVCB 1NGWB 2GT9A 2Z93B 3RY6C 3D85B 4ZDHA 1YYMH 4R2GC 4JG0H 1HIMH 2FHCA 4Z7UE 3LV3A 3PWLA 2DMBA 5T1DH 4KI1A 4M5YL 2R2HB 3D39A 3P40A 4GG6E 1F3RB 4DKEH 1DQLH 1A6WL 1RURH 2AS5M 2A77H 1KCLA 2A0LC 3O4LA 4GAFB 3ARBA 4ZQKA 3DETC 5E4EC 5F97E 1KCUL 3THMH 1FAKT 3MA7B 2PUQT 3DGGB 5I8EA 3T0ED 1MCEA 5IJVB 3FO0H 3UJTH 1J5OL 1WZLA 4I9WD 2VMFA 4R0LB 5GSVA 4TPRH 1SEQL 3DBXB 2NXZD 5GXBB 2SEBA 4FOMA 5DZLA 1SJHA 3TJHD 3QUXB 1G7QA 5DEGA 3MNVB 1XGRB 4Y5YC 3DXAD 4LVOC 5FV1L 3UTSA 4QXWA 5IMLB 4I2XA 3O8XB 1T7WA 3GSNL 3MLVH 3QUMA 3ZDYF 3V8CA 1S9YA 4NRXB 5KSVA 3R1GL 4Q7DA 3WUWB 1KV3A 4Z5RB 3C8KB 4QXUL 3QDMB 5C07E 1NJ9B 5C08E 3CVHA 4BSVA 4L9DA 3PWPB 4NKDA 4QY8A 4CVXB 3FRPA 2OJEB 4FS0A 3VD9A 6FABL 2H3NA 5E94A 4JFDE 5I1EL 1A6TA 1RIHH 3BE1L 4RZCA 1I9RH 2P8PB 2I07A 1MJUH 4NQEB 3ULUL 4YXHH 1V7MH 2DM2A 2JCCA 5GRUL 2WWKT 4L4VB 4XC1H 1JGLL 1DSFH 1IILE 2OBGA 2GSIA 2J4WH 4NZDA 4ZFOA 3SY0B 2HN7A 3SGJA 1K5NA 5CCKH 4NCC1 4KC3B 1Q9LB 3HNSL 2HP4A 3GBMH 4DTGL 3QDJB 1DBJH 2AJXH 1CIDA 1T2QL 4LCUA 5JIHA 3RIFF 4P9HL 2FX9H 4KMQA 1K8DA 4X5WA 4RMTA 5L7XH 2NY3B 5B22A 2AXFA 1RY7B 2QQLH 4OQTA 2UYLB 1WAAA 4Q0XL 4CVUA 2FL5A 2CLRB 3HI6H 3OKLA 4MX7B 4LSSL 1GZPB 1OAKH 4WUKL 3O6MH 3MXWL 2UY6A 1NAMA 1AHWC 2PN5A 1T89C 4JRXA 3HZYB 1XGPB 3REVB 4GT7A 3VD5A 1SY6A 4OLXL 3TCLA 4UI2A 3GJEB 4U6YA 3VGFA 3QCVL 3DYPA 5ESAB 3R0MA 1NEUA 2GITA 4OCSH 2VOTA 3ARYA 3KWWA 4AH2A 1WBYB 1ROWA 5D2LE 1I1CA 1GL4B 4JM4H 4BQ8A 1JZ6A 3FT2B 2BHYA 2P5EB 4JHWH 3HC0A 1MHPH 3MV8D 5GPRA 5JORB 5J13C 5KZCB 4ZUSB 1ZGLM 1NSNH 1EBPA 3EOTL 3U4EB 5SX5H 2W60A 4X80H 3ZDYE 1EZVY 2NY2B 4JKLA 3T0EE 3WIIH 3OKOB 5HDLA 2C1OB 4CADB 4FTVB 4FQ2L 1HH6B 3D9AH 1WJ3A 2P8MB 4FQXB 4D0BB 2WMPA 3G6JA 1I7TA 1U8HB 4QOKB 2OYPA 3MRNA 3S3PA 3HB3C 4G9FD 4W6WB 1CT8A 3MV9D 1FYTA 1NFDE 2F5AH 5FXCH 1W8NA 3FN0H 4GUPB 3IDGB 4QXGH 3ZKMD 3GMMA 1F6AB 2AERT 1XR8A 4TTGA 2NY1D 2YZ1A 2OL3B 5J4MA 5I76B 2HLFC 3BX7C 3ARFA 3NPSB 4O4YH 3IJSB 2DD8L 3DHMA 5D7KE 3K4ZA 5JW4N 2GJJA 5E7FA 1FIGL 1T1XA 4XCFH 4JM2F 1QBMH 1QKZH 4XAKD 4XGZB 3QUML 5IMKB 3U4BL 1BZ9B 4P3DB 4XH2A 4DKAA 1HWGB 3GMLA 1FZMB 3PWVA 1EVTC 4MCZA 1MHHA 3MOBH 4K7PL 3VFTA 1A2YB 1KEMH 1O5DT 4PLJC 2XZCL 4L5FL 1G7IA 4JKWA 4HCRA 4U1JB 4G6KL 1FVDA 2VJXA 2P1YA 1UWGL 5J1TC 4POUB 3HC4H 3BJLA 4TSBH 4HUXB 3RDTB 4GRWF 2VXTH 4OZ4B 4A6YA 3RWIA 5EZOH 1B0WA 1T21A 4FQLL 4KK6D 4ODTH 4F7MA 5MP6L 2HFEB 2IAND 4Z0BH 4LOUD 4OTXL 1KXVC 4JFEE 3MRPA 2I60L 3S96B 5DHVB 1ZT7A 4LLDA 5GGVL 4F15C 2WNGA 3BGMB 1RK1A 4Y2DD 3BMVA 1ZE3C 3HNVH 4YDVB 1NFIA 4ZFOL 2K1MA 5HGDA 1OM3H 1TQBB 3BKML 4NC1E 2QJDA 1PY4A 3CLEH 3O45A 1Q0XL 4A2MA 4BH7B 3RVWC 3DROA 4ALAL 4HMCA 4U1SB 1FN4A 4JM2C 3RIAF 4C55A 4MNGA 2WM0A 15C8L 1K9TA 1YDPB 4TNVF 1J05A 5JPMA 2YS4A 1W0VA 1SYVB 4JCMA 1A9EA 4OQTL 4WV1C 3CU7A 4XVTH 4PGCA 2X44D 4QTHB 3SKOB 4HDIB 4NRYA 4WNQB 5BS0E 5D8JL 1VADA 2ESVB 5HD8D 3V5KA 2IPTH 1BEYL 1SY6L 3MV8E 2X89D 4ZTPL 1Q9KB 4OZFA 2VLJD 3QQ4B 5T5NG 4HX1B 2BSSB 4PS4L 4JFOA 4JO1L 3MODL 2EIBA 4S1SL 2VRAA 2HH0L 3S4SG 4KROD 4H5SA 2D3VA 2A6JA 4DFHA 4KK9C 3MMEA 2AK4A 2ARJQ 2W65B 4OKVA 2A73B 2CRMA 4PJ5D 1A3QA 5J11B 3WCYA 3TJEH 3EIFA 5I2IA 1HXMB 3QXTA 4PYGA 1K4CB 1ZANH 2R39A 3T8XB 5JIIA 2VQ1A 1T6WA 1BGXH 3CSYA 4HS6B 2FR4B 4PRAB 1KTLB 4Z18A 3MV7B 2Y5TA 4V1DB 3LKSB 5ANME 4M00A 1P69B 2Q76B 4U1GB 5F3HA 4PB0H 4JE4B 3CSGA 4E41A 1IARB 3PDOA 3SKMA 5MHSD 4KFZC 4M3KB 5HHOA 4NQCB 5EORL 3GSWA 4HG4J 3X11A 1D9KB 4Z76A 4FXGB 1P4BL 2XZAL 3G5ZA 3RY4A 1TITA 4NUGL 1QFWH 3QFJE 3RU8H 1OW0C 4D9QD 4B50A 3FTGA 3VFPA 2QADD 5HYJB 3NN8B 1G7PA 4KHXL 2A6IB 5CUSL 1P9MA 3AVEA 4JVUA 1MCIA 1KEGL 1C7TA 1K85A 1XMWA 3ZT5A 1CXHA 3PL6D 1QFWI 4XRCA 2HKHL 1PY9A 4QT5A 1IT9H 4K23H 2RFXA 5DJ8B 1EUUA 2DYPD 3QBTB 3UZQA 2NTFA 1ORQB 4HCRL 1R3LB 4L8SA 2HRLA 3BQUA 4YHKH 2L7UA 3V95A 5IB2B 4LSRL 4HZLA 4GG6A 3KPLA 1U3HA 1UJ3A 1OT1A 3NCCB 5IF0A 3T77A 4F7TA 3STZA 3BUTA 4YLQT 5C9JB 1UG9A 5ITBH 5KJRL 4LQFH 4JFFB 4JJ5B 5E1HB 5IB5B 3IETA 4L8BA 4MA8H 1RVFH 1ZLSH 3NZHH 2DQUL 4EXPX 4R8WH 3B9KC 2V2XB 4P46C 3RX5A 3C09B 4XVUC 5ISZD 1E4XL 3GSUA 4RMSA 4OI9A 1BOGB 1HH9A 5EOCL 3SN6N 4TVPL 4HWEH 3PWNA 5SX4I 3KYMB 1E0OB 3F7YA 5I8CA 2IPUG 5AWNL 3SDDB 2Q86A 1JWMA 3AS0A 3ULSB 5BMFH 2FD6H 4TUJB 1BHGA 1FBIL 1XF4B 1WIOA 2FIRT 4YHOL 1DANU 4DKFH 4P9MH 3S34L 1QEWB 2VDKL 3TO2A 5IBLC 5D7LE 5C0BE 3VXMB 5C07A 3S88H 1BQLL 5C08A 3LQMA 5LQBH 1KBGH 4YXKH 4P2RE 3LEVL 2ZUSA 5LAXB 1NDMB 4RGOL 1QSEE 2DJSA 4M8QA 5LBSH 4NO0B 1QLRA 1OB1A 3KXFE 5J3HD 1YY8A 4JFDA 2BSTB 1IC1A 2WBWB 5HTSA 12E8L 3NFSL 1ZGLP 4K7PX 1K4DA 2AV1B 2FDBP 4G80A 2YPLA 2J6EL 1JWUB 2X1PA 4Y5YA 1N6QL 2BOCB 4KDTC 3GSVB 3HE6C 2M8XA 1JGDB 4H20L 5MERA 3CVIH 1S7XA 4PLKC 5B39B 3VXPB 4KQ3H 4J8RA 5E2VL 1OGAB 1CTNA 3UTQA 5ENWA 3UJJH 4ZXBD 1QRNB 2W9LA 1GHFH 4HBCL 2B0SH 4X6EB 1A6UH 5D2NC 4M48L 1JNNH 2FZ3A 3MLPA 1YMHA 4JPWH 4R4BB 3AREB 4ZFFA 2FYYB 2DOCA 4CL7A 5C8JB 3ILPA 5F7DB 4UZGA 4Z77B 3DV4A 5DMKA 4FABL 1U93B 2OL3H 1TZGL 2A6KB 3ALWA 2AJ3A 2X1WL 5D2LA 4PJGF 4YBLB 5C0FA 8FABA 4N8CH 2FLRT 3DSNA 4L8DA 4ERSH 1TJGL 2YZ8A 3G08B 4P4KC 1EFXA 3MJ9H 3QXAB 3GNMH 3RZCC 4ELMB 3WKMH 3KPRB 3QIBC 4PREA 1DBML 1BQUA 5I1DA 2BCKA 1R3JB 1INDH 2ADGB 1CICB 3KPMA 2CK0L 2Q8AH 5HGHA 1N2RB 1NFDA 4HIXH 1FNGA 4UAOB 5ICXB 3D2UB 4KVNL 4MB5A 1E4KC 3T0BA 1UXWA 3FB7B 3HZKB 2BVPB 1G9NL 4C57C 5ICYA 1AO7D 1V05A 2DBLL 4J1UA 4N9OB 43C9A 3JWOL 4NBXB 3PNWA 5FHBH 4ODWA 4KMTL 4EKXA 1A5FL 1EHAA 4G8EB 2VTFA 1P84K 4NWTL 5TDPA 3UBXG 3BKJL 2PO6C 5ESVA 5INDB 3QO1A 3G9VA 3OGCA 4M7LT 2Y07H 3TO4D 5E2UL 5BZWB 1TPXC 4L29A 1WBZB 3GJFB 3RWGB 2AJSL 5IW3A 2MQ3A 4PJIF 4MNHB 3VA2C 5B8CC 1P53A 1LO2L 4JN1L 3GSOA 2IQAA 3ZTNL 3HUJB 1YEIL 4G8IA 4FQQA 4MMZC 5AD0A 3O6KH 1EHXA 3OSKA 5DJ2B 5BV7C 2VNCA 1ZLWK 5A1AA 4GRMB 3WFBL 2P44B 4WFEE 1PGRB 4IRJB 4PPTA 1U8JB 1BBDH 2ZPKL 1JPSH 4LLUB 3ULVD 1LEKA 3FO9B 5FGCB 2DQGH 2GEEA 3CFBB 4DVRH 4JFEA 5JQHC 1HILA 1NCUA 1HHJB 3L3JA 3W11D 1D3CA 1PVHA 3E2HC 1PEWA 4PJGE 2IQ9L 1MIEL 4KRMB 4RFEB 4FHBD 2OR8A 2UZYB 1JK8A 5IFAH 1KB5A 1UYWL 1AFVL 3X3GL 3H3BC 3PUCA 3ZKNC 3U7YL 3ALPA 5DVMA 1C08A 4CMHC 4QEGA 4JN2B 1F02I 5DWUL 2OX5A 2OS7A 3IFOA 3PP4H 5F1KC 1WCBB 4P57A 1AIFA 2JJUA 4AM0A 3AY4C 3D18B 4NCDA 3M8OL 3IXAA 2X4UA 4U0QB 5BS0A 4LLMA 2ADIB 5MI0B 1K2DB 1CGTA 4NKOA 2OSLA 3S36H 5HGAA 2IBZX 5IKCA 1QHPA 1MFAL 5C0IA 3QI9B 4M5ZL 2VSCA 4WFHD 1U3JA 3O3BB 3FHAA 1ODAA 1JHKL 3ARDA 2FIKB 4FG6D 4FP8H 4P23C 2FRGP 4UB0H 1VERA 2R1XA 5AZEH 1TJHL 5AEAA 3U36A 4PRHB 2IALB 1KB9J 5DURD 1LE9B 4JM2A 5E9DD 5DMGC 4HUUA 4EVNA 5E8EB 2WINB 3B9VA 2OR7A 4NIKB 3MRQB 1IGJA 4I0PC 5EOTB 1MCPL 4HF5H 1JV5A 5GSRA 4LBEA 4WV1A 2YK1L 3L95A 4N9GB 3UTZA 1CFTA 1GGYA 2CLVA 1NKRA 3PHQB 1NBVH 1QFWM 3QIWD 5ANMA 1KT2B 1U92B 4KUCF 1GYAA 5MEND 4ONHA 1KPVA 3G5VA 2E7HA 1VHPA 3O6FC 4Y19E 7FABL 5FGBA 2WUCL 3RL1B 3F12B 1M05B 4Y4KA 2P49B 1J0KA 4KJQD 2R1YB 2VE6B 3TN0D 5JNYB 2DF3A 1BD2E 3EDEA 3MLUL 5JIKA 3MYJB 1MIML 3EFDH 1BAFH 3QFJA 2BNUA 4XCEA 3TA3A 1RFDH 3RHWK 2V5SA 3AM8A 1P4LA 4QHUA 2NLJA 5JQ6H 1F8TH 3HR5B 3FN3A 4POYA 5C0AB 1J8HE 3EO0B 3MRHA 1I7ZB 1IC4H 1S7RB 4I18B 1UCBH 3U0TB 4BK4A 4X4YB 3TT3L 1CLZL 4X9IA 4CVZB 2ED9A 5EUKA 4PG9B 3LHPL 3MFFA 3UZVB 2PTTA 4KPHH 3C6LB 1HDMA 4WCYH 5ECJE 3H2WA 4NHUA 3H7BB 4JY6B 4MMXC 3OKDB 4X98B 2I24N 5EOCJ 2F8VA 5EU6B 2BVQB 4Q9RL 4YAQB 1X5XA 2QSCH 4APQD 4UILH 4L9LC 3WNMA 1N5AB 5DSCA 4Q74A 4ZUTB 2HT2C 1JYXA 4GXUM 1YYLL 1RU9L 1MCKA 2ZCLH 4QGTA 1OW0A 1PFCA 4OLUH 4CNIA 4UIKL 3MBEC 1AD9A 3X12A 2EEAA 3HPLB 1IGTA 2VDPL 4QRRD 2HKFL 4NM8H 3EZ8A 5DK0A 4LF3A 1HNFA 1KB5L 1Y6NR 3WDHA 4OGYL 1ZA6B 3PWUB 5K33A 3KDMB 1DR9A 4Q9CA 4L4JA 4I3SH 1QVOB 3BD5A 4K8RD 2A6DA 2JLLA 1FNAA 4EBQH 4JFPA 1QG3A 3L3KA 5FEBA 4PUBL 2A74A 3V7AE 5I6XB 2X4OB 4DUWA 5H2BB 2AXGA 3L9RB 4LEOA 1F3DH 5D7LA 4J3WA 5C0BA 3C60C 3BP4B 4U3HA 4LHUA 4PJEE 1UH3A 3TZVB 5FB8A 2PR4L 4P2RA 1FL5A 1AQKL 2CH8A 4HK3N 2ZWLT 3MCKA 1HI6A 5FM4A 1QSEA 1IQWH 5BRZE 2AAVA 2DQDL 5KANI 3KXFA 3DMMA 3I9GL 3B9KA 2MMXA 2NX5E 2BVTA 4WTXA 3WFHB 1R5IB 4WWKB 2IAMD 5E5RB 4M7LH 4HIIB 4LVHB 4MS8C 1QFHA 3VD4A 3JV0A 3SOBH 5F72S 3BPLB 2AQ3A 1NGPL 3QEUB 3I6KB 2EKSA 4UUJA 4MAUL 5GZOD 4P5TB 5J1AB 4MXVE 3ZDZF 5TF0A 5FUZH 1B88A 3OX8B 5EH1A 3NOIA 5EDXA 3CIQA 4LARH 5GGQH 4U1HA 1S7TA 4ONGH 4ENED 2DQFA 5FYKH 4HJ0D 1F5WA 4UU9A 1F2QA 4HH9B 3D25A 4EI5B 2A2QT 3QIUD 4ORGB 4X6DE 3SGDH 1I3UA 4MGXA 4D8PA 1N3NB 3VI3E 4C83A 1ZMYA 3L1OH 1IGFL 1OSPL 3AB0C 4PBWD 2EDTA 5D7SL 1XGTA 3QHZH 1G6RB 2WANA 4C56E 3P4OB 1DQML 4OF8A 4NQXA 3KPSE 2Q3AA 5TDNB 5D1ZB 1H3GA 2C3GA 3FO2B 3GJFH 4L1DA 4YC2B 5T1LA 5CIPA 1ITCA 3ARGB 5BVJA 5BVPH 1YEEH 3C2AH 3SEPA 5LWYL 3F58L 4Z7VF 3CXDH 3VFGH 4KJPD 4O5LH 3OKKB 1ZHLB 5MEOA 4G9DB 1IKNC 3MLWH 1OTSC 1U8PB 6CGTA 1S8DB 2YUWA 3BISA 3P30L 2W9DL 1I85A 1I1FA 4JPIA 4R90H 4QHKJ 2HFFA 3QA3B 4EUPB 4QRQA 5DYOB 1TCMA 3VG0H 3Q6GL 1G0XA 4LLWB 1BFTA 4ODHH 4OM1H 2HT4C 3T4YA 1OAZL 3GUTA 1WFOA 2P8LB 2QR0A 5TQ0L 3FL7A 3VFNB 4N0RA 4WU7A 5EBGA 4FQ1L 1KCVH 3UP1A 1MQ8A 2C1PB 2HJKA 2DQCH 5FUCC 2JF1A 1H0DA 3VH8G 1PKQB 3BT2H 1OLLA 4YHZH 2EC8A 2K7PA 2DWEB 4PY8J 1EMTL 3ZDZE 5L2JB 3UROR 3RZCA 3LQAL 3A0OA 1AGEB 4XB7A 5J9PA 3IU3B 5E1AA 3NCEB 3DYMA 3SDAC 3L3OB 5KTEL 1I1AB 5CP3H 3DUSB 4LSQL 3H9HB 1UACL 4PTUA 5HGBA 2R1WA 2DI8A 3P4NB 4NHCH 2X4PB 4S2SA 3K8KA 2EIZA 2OMBA 4LPWA 3BP6B 1P7QD 4OCNC 3B3IA 3VJ6A 5D7JC 2CK2A 2IFFL 3BPCB 4ZAKC 4P2CG 1XIWB 2BDNH 1FL3B 2C7UB 2E9JA 4G8GD 1C5DA 3VXRD 3LQZB 4U6VH 5F1IB 2GFBB 3AS1A 2PO6A 4WVRA 1MHCB 4TSAL 4Z8FH 4PJGA 5CMAA 5I19L 5IHZA 1Y6MR 3Q6FA 4M61A 3PQYD 3Q5OA 1NAKL 4QHLB 5EU4B 5TE4L 2A0LD 3CDFA 5KN5B 3RKPA 4NN6B 3T0XA 3DETD 1RJYA 4PP2A 5B8CA 1PBYA 3MJ8A 1BVLA 4UV7L 4G8FB 3MO1A 5D70L 3WN5A 2XWJA 2PXYC 1XZ0B 1I75A 3OXRA 4OD2A 4Z7VE 1HHGA 5DJ6A 3T3PF 4Y5XB 1AY1H 4RRPG 1S7WA 1I4FA 3WIHA 4JRYB 3GRWA 5IMMB 4IRSA 4OCYH 4F58L 5BJTB 2AGJH 1IVLA 3PGDB 5KOMC 3PGFL 3PJSB 1QBAA 3MRJB 5F88A 1XR9B 1MOEA 5L2KB 3GMRB 3GSQA 4HJGA 3IVKA 4RWYL 2ATKA 4PRDB 5D71H 1OD9A 3VMNA 1CG9A 5E6IB 3WNNA 3FN9A 5TPWH 1N5YL 4NQVA 1NLDH 4JRWA 4M7ZC 3MJ7B 2APVA 2CDEA 2KH2B 1S9KC 4WEBH 2AJUH 4PRIB 3PABA 1D5BB 4PJIA 4XNMB 3DX6A 4RFOL 4YEEA 4NSKB 3SO5A 3AY4A 4HD9A 4X7SH 2DLGA 4R0LC 5EN2B 1K3ZA 5J89A 3SCMC 2VDOH 4Y19A 4G6FB 1RZ7H 2JJWA 3BDBA 3NCJH 2MCG1 4DN3L 1P2CA 2PYFB 5IR1A 3N0PB 4MSWA 2C26A 3GMQB 3O8XC 4FZEL 4JO3H 1BD2A 1DQDH 2BERA 2JJVA 3QUKA 4NBZB 1KN4H 3L7EB 3C5JA 3LKNA 5K9OA 3DV6B 5GRZA 4EN3B 4TNWK 5E4IA 5HHPA 3ZE2E 5J1SC 1WSST 1ND0B 1R24B 1HSAB 3MLXH 3OV6A 4D3CL 5FA3B 3A6CL 4M1GH 3HI1A 1LDPL 1J8HA 1YPZB 2XQBH 2VXSL 4QHMB 1I8MA 1T22A 3IJHA 2K3TA 4TUKH 4GW4A 4X6BB 4HEPG 1ORSB 3S5LB 3U0PB 1KJVB 2DM7A 2OZ4L 1Z9SA 2FECL 3F6IA 3NIDF 1CI5A 3V0WH 3GJFK 5IHUH 3MCLL 4HS3A 1BFVL 1CLYH 4KHTL 4XNUL 2HLAA 4MAYB 3O6FA 5T1KA 4Z78B 4C59B 2Z92B 3HG1D 1MFCH 5FECB 4MD5B 2QKIB 1AGBB 4OSUL 4WDIA 2Z4QA 1F4AA 2Q87A 2VH5H 1FG9C 4U1KA 3WMSA 3X17A 3O4OB 1EEYB 2XTJE 4NYLA 3BDXA 3Q3GA 1N4XH 3TBYB 4YHYB 1A02N 2FJGB 3QDME 5KVEL 4OFIA 3MLZL 5F9DC 4LPTA 5CEZD 4ZO8A 1EUTA 5HHMD 1IL1A 4NGHL 3PWPE 2QQKH 4AENB 3HB3D 1A4KA 2DL9A 3BDYL 3RHWF 5D1QD 2HFGH 3GSNB 4TQEL 5HVWA 1I7UB 2LE9A 5F71A 1BVKB 4WTWA 1FFPB 4P5KA 5KSAA 2P7TA 1FFOA 3VFUA 5DMYA 3KYNB 2Q8BH 4L4VE 4PTTB 1JNHB 4ZOAA 3WIHL 3GRWL 2F54B 1I3GL 2HLFD 3TV3L 4L9LA 1T7XA 4PJEA 4WO4B 3REWB 3PG2A 2IBBA 4YFDB 3QDJE 3QQNA 5ERWA 1MI5D 1QQDB 4E42B 5BRZA 4ISVA 1KJ2A 3D69A 4Y4FA 4R7NB 3VFOB 1IC7L 2NX5A 3EDJA 1TNMA 4OBRA 2QL1A 3QQ3A 1MRCL 1T2JA 2IH3B 2W0PA 1G6RH 2W07A 2A9ML 1NUDA 1QBLL 1RD6A 1NBZA 4FQXC 5DTFA 1X4ZA 2MTPA 3GMOA 5DJ0B 4KTYA 1TLKA 1HHIA 4OJFH 3AAZB 5F7LB 5F1OB 4O00A 1BBJB 1S7VB 3QHFL 3QJFB 5DS8B 3X14A 1YEHH 2V7NB 1MCFA 4S0TD 1MCWW 3INUL 2EDNA 4EOWL 3NIDE 5C09B 5D6CA 3KPNB 3TLRA 1II4E 1RUQH 2ZCHH 5C2BH 3ZMRA 4GRLA 3V5DA 5DFTA 3UPAA 4DK6A 1CWVA 1F45A 1VFAB 2YA2A 3NPSC 2P5EE 2O61A 3CD4A 4KGJA 1FGVH 3Q48A 4RAUB 4F57H 3RVWD 3ZT6A 5IM7B 3P0YL 4JZNB 5CZXD 4BQ6A 4I13B 3NMEA 4OLZH 1D5ZA 1ZHNB 1F90L 4KRPB 4OGXL 2OJZH 1M1SA 3DUUA 4LSVH 1NMAH 5T5FH 4ZTOH 5DUPH 3LZFL 2OP4L 4OLWH 4QOKE 4C56A 5JXAL 4NNPH 1EXUB 1FNSL 3TNNA 1HN1A 4I5BA 3KPSA 2XRAL 4LPUA 1IAOB 2VO5A 5ALCH 2XY1A 1QSZA 4AIZB 3TIDA 2BXYA 3HAEG 3ULVL 2BY3A 4NWUH 3PHOB 2HT3D 2O5ZL 3KLAA 5ACZB 3BRDA 5LVEA 1OAQL 2VXUH 4G6MH 3L5JA 5FIEA 4X5XB 4H1LG 5FYJU 2CKNA 1C12A 2NNAB 4KK9D 3QXDA 4NC0B 3QWRA 1AQDA 2WP3O 3RVXC 3NIGF 4IS6A 1R3IL 2XZZA 4LLQB 2D7TH 1JF6A 3QUYB 3QG6B 1Q94A 1HIML 4XPTH 4XX1G 5HHNA 3QDGD 2ZG2A 2BHZA 3RX8A 2B8OT 4GKSA 1UCTA 4NP4L 3M07A 2F53B 1R3HB 1LK3H 3F7PC 5FUOL 4NNYA 3CFKA 3GO1H 3SJVB 3DTXB 3MRKA 2VXVH 4DKEL 1RMFL 1DE4B 1RURL 2C3WA 4BZ2H 3VFWB 4WI2A 1ZLUH 1KELH 3D0VA 3JTTA 5C0GA 2DLFH 5ESQB 3THML 3GKWH 3VXNA 2X09A 1YEDA 5IJKC 5I71B 3FO0L 4PG2C 2CUHA 3LH2L 2C4FU 3MBXL 3ESVF 1ZVYA 3H8NA 3E0GA 4O58H 4U4BA 3QEHA 4FQIH 2D0GA 4L4TE 2D9QB 1MFDH 3EYUL 3O9WD 1Z9MA 4LKXA 4OCWH 4QCIB 1JPFB 3MRRA 4JEGB 4HMDA 4KUZH 3TBTA 5IWLC 5J11C 4RZCB 1GRWA 1KJ2L 3FO1B 4Y16D 2WUBL 1IFHH 5IVZB 3U48A 4PGBB 4FA8A 5I17A 5I1GH 3RP1A 4J7RA 4KKAC 5CP7A 1IMHC 1B0GA 3CC5A 3ZT7A 3F7QA 3FT4A 1ZT4B 3LN5B 4U1GC 3CDCA 4X9GA 1N7MH 3V6OE 3MGTB 1IM9A 3K2UH 4GKZB 1CL7L 3D3VE 2OTUB 3NACH 1KCRH 1A9BB 3CMOH 2G9HA 1K8DB 5IOPA 1V7ML 3ZYJA 1DCLA 4OZIB 2XXMB 3SDAA 4FMFA 2XNAB 5IVNA 3VWKC 2FL5B 4Z7VA 1RHHB 1RAMA 5E8PA 2J4WL 4P46D 1YNTA 3RGVB 1Z9LA 1T20B 5FF6A 1A6VL 3ZE1F 3L3GB 4G5ZH 2N4IA 2H32B 5EOQH 5AZ2H 1DBJL 5HHQA 4MD0A 5DEFB 2ZUTA 1NQBA 2EDWA 2BVUA 4Z7OF 1JN6B 2FX9L 3MRGA 3WHE0 1T3FA 4YUEH 3AMLA 2GITB 5IB4A 3U1SH 4FFYL 3MNZB 4XNQB 1KF9B 2XKNB 3GDBA 3SDCD 1OTUC 4UMGA 3BI9X 5JMOC 1Q72L 1MLCA 3MV7E 4U1MA 4V1DE 5EC2A 4J3OC 5IBLD 2W59A 4ZFZA 3MSPA 3GI8L 2RCSL 2EYRA 4FXKA 4MXQC 1DQJA 4R96A 4NQCE 4IMLB 1LO5A 2ZUYA 2X40A 4MNQB 4KY1L 4E0RB 4JZOA 5IQ9A 3VGGA 4U6XA 3QZWA 4JZJA 1A7NL 1U58A 1TVHA 4M1CC 4M5YH 1WBXB 3U82B 1YN6B 3SGKC 4LLVA 1CFNB 4XVJL 5HYJE 3F65A 5BQ7A 3RX7A 4JM4L 4K7PY 2MOVA 1U8KA 3V6BR 5FO7B 3P9MA 1A6WH 1FVCA 1CT8B 1NGWA 1FYTB 3TYFA 2Z93A 4R9HA 3D85A 4U6TA 4WI3A 5J8OA 1KCUH 1Q0YH 2BY2A 3HE6D 5JHDD 5B39G 1INEL 3LN4A 2ADJB 43CAB 3GBNH 5CJQL 3SDDC 1J5OH 2VDLL 4DFIA 3D9AL 2R2HA 4FN0A 1FO0B 1SEQH 5GGVY 5JXEC 3W0WD 3TVMB 3KLHC 1PAMA 3B2VL 4J4PC 3C9NB 3VE0B 3GSNH 3T04D 3CZFB 5A2JH 4UDUB 3DGGA 3V0VB 4MA1B 1AXIB 5IJVA 3WS6C 1UKTA 2PKDA 4NKIL 1MJ7L 1WIPA 4NZUL 5A2IH 4QXUH 2FCBA 4R0LA 3MX0A 3NPZB 3DBXA 3B9AA 1OWRM 3BP7B 3QUXA 3TEUA 4ESKA 2Q3ZA 3MNVA 2CGRL 2RAMA 4JDZB 3TFKC 2F5BL 2VLRD 4V2CB 5IMLA 4PLOB 3O8XA 4OFKA 1H8OA 4Z7OE 5I1EH 5BXFB 1I8IB 4P4KD 3ULUH 4NRXA 3K46A 5GRUH 3WUWA 4Z5RA 2QSVA 3C8KA 1BX2B 2D2OA 3QDMA 3IAPA 3QIBD 3VXME 1NJ9A 1X5HA 2NZ9D 4I48A 4Y1AB 1FN4B 2VXTL 5HHVL 3PWPA 4RWHA 4MNGB 5EBMA 3HNSH 4KI5D 5GGSA 3U9PL 4CVXA 4DTGH 2OJEA 3FAXA 1T2QH 1WQVT 4Z0BL 4P9HH 1V8HA 2Y1VA 4KQ4L 3AREC 1ETZB 4OFYA 1ZLUK 5K9QG 2P8PA 4Q9BA 5JOPE 4YIQA 1KULA 4ZPVB 3SE8L 4L4VA 4Q0XH 2XXCB 3IKCB 3CLEL 4LSSH 4WUKH 2X4QB 3OBAA 3SY0A 3U7AA 3QDJA 2DQHL 5E2JA 4JFOB 1BP3B 4OLXH 1DFBL 4U3CA 4EDXB 1T04B 2A6JB 3P4MB 1OGAE 4HIEB 3RWJB 1U8IB 1CE1H 3HUJF 3CX2A 1BJ1J 3SE4A 3BFOA 3NIFF 3OZ9L 1JMXA 2UYLA 3B8YA 2CLRA 1Y0LB 5KS9E 3BD4A 4MX7A 1GZPA 3UYPA 3QYCA 3SKNB 1CICC 3FOMB 3HZYA 1H5BB 3EOTH 1XGPA 3REVA 4K7FB 5TQ2L 4UAOC 3GJEA 3O2WL 5ESAA 4FQ2H 3MOAL 4U49A 1NC4B 1YC7A 1WBYA 2VZOA 3W2DL 4CN1A 5LG1A 3UJIL 3FT2A 4I8DA 2P5EA 1T0PB 3TJEL 3IDMB 4PJDB 3RA7L 1G1YA 4PFEA 5JORA 3HE7B 3M1BB 4ZUSA 3NGBB 4O2EB 1HCFX 3RI5K 2NY6D 4ELME 1A0QH 3RNQB 2GJ6B 2H2PC 3OKOA 3CDGB 2C1OA 3KPRE 4LPVA 1SBSL 4CADA 3BYTA 5I75C 1HH6A 4XRCB 2P8MA 4FQXA 4D0BA 4OLVL 1U8HA 5FYKE 4QOKA 5EZJA 3QUMH 3DWTA 1GCFA 5GGUB 4GUPA 1JZ5A 3IDGA 4Z7UB 2IBZY 4ZOEA 4K7PH 5KVDL 1F6AA 1ZEAH 1K3IA 2J7LA 4L5FH 3FOLB 4G6KH 5I9QC 1UWGH 2OL3A 1FLTX 4P23D 5I76A 3MLSL 4XBEL 3IJSA 4HG4K 1D5XA 5D1XB 1E27B 3DI2B 4XGZA 3HPJB 5IMKA 1BZ9A 3C8HA 4P3DA 1RHFA 4FQLH 5MP6H 3ZKQD 4N8VB 2EC9T 4OTXH 1A2YA 4I0PD 5GGVH 4LMQE 4U1JA 3HUJE 2LAGB 1UGNA 2E9BA 3PWNB 1Q0XH 4N1CA 4X7FC 3RDTA 4D9RE 1MWAL 3MUGB 3X13B 5CSGA 4LQFL 2LQRA 5FDYA 4HS8L 5HY9A 3VXOB 15C8H 4PJAE 4AL8L 5FGCE 3MRMB 4OZHB 5DZNA 3QI9C 2EDDA 3N1PC 3S96A 5DHVA 3BGMA 1QSFD 5C07B 4NQDB 2C4XA 4YDVA 3IDUA 1F6LL 4XMLL 2JJSA 4PJ8C 4L4TA 3K1DA 5DZOA 4HWEL 4WUUB 2B4CL 2H32H 4BH7A 1BEYH 1SY6H 4U1SA 4ZTPH 1J9CT 1YY8B 1CD0A 1X7QB 2FD6L 1DVFC 5H35B 4DJMA 4PS4H 25C8L 4S1SH 4ZOCA 2CDFB 4DKFL 3FQTB 1SYVA 2E6QA 4G80B 4X4ME 4PJFF 3VWJB 2WP3T 3S8WA 1KBGL 3MYZA 4QTHA 3SKOA 4HDIA 4WNQA 1KJMB 5MERB 5LBSL 2F58L 2LAAA 4GAGH 4KUCD 4PG2A 3V6OA 1Q9KA 2BOBB 3QQ4A 3D3VA 2X9XA 4HX1A 2BSSA 4OUOA 4AIXA 3CFCL 2GSGB 1ZT1B 4MVBD 3MBED 4WI6A 2W65A 4NJAL 2A73A 3ARTA 2VISA 4PRHE 1CQKA 1YMHB 5F93C 5LJYH 4ZG1A 1XH3B 5ICZB 4OV6F 5EORH 3WJLC 2V6HA 4HPOL 2MNUA 1HXMA 3OGOE 1Z6JT 1P4BH 2XZAH 1FH5H 1VCAA 1NC2D 5FO9B 2CRYA 3U9UB 3UJJL 1J12A 5CBAA 3N50A 1FO0H 2FR4A 4HS6A 1ZSDB 4R4NC 4PRAA 1A6UL 1KTLA 4LVNB 5HPMB 3MV7A 4LPCA 4V1DA 3LKSA 5DUML 5C0FB 2Z8SA 3OF6A 3KPPB 2Q76A 1IZKA 1KEGH 3TPKA 4GMTL 1OP5K 2HKHH 3GGWB 1I8LC 3C60D 3GM8A 4RMWA 3OR7B 3T0AA 1OVZA 4NQCA 4K3EH 4JQIL 5TFSL 3ARRA 3IFLL 2VZUA 1D9KA 1H9VA 2MJWA 3T0EB 2D4FA 4FXGA 5CJXC 4YJZL 3MRLB 1KCSH 2OL3L 2V5MA 3QDHA 3DX8A 4LSRH 3NAAL 4MB4A 5HYJA 3NN8A 4PJ9A 3IAGC 2A6IA 1KENH 1AXTH 2NXZB 4N8CL 4QRSA 5C0AE 3CCHB 4HPYH 3IDXL 1NFDB 1OL0A 4ERSL 3AC0A 3O2DA 1KGCD 3DXAB 1CXLA 5DJ8A 4KKLC 3GSRB 5ICYB 1T7ZA 1ORQA 1MCHA 3MV01 3ORJA 1CCZA 3WKML 1R3LA 4MA3B 2J5LC 3U46B 1X3DA 5IB2A 4JDVB 1E4XH 5GS1C 5EU6E 4DN4L 3FB5B 4HIXL 4S11A 4OV5B 4DGIL 3TZVC 2HVJB 5CEYB 2EH8H 3WIFB 2H2SC 5C9JA 4O2CA 1GPOL 4J12A 1FRGL 4JFFA 3WYRA 1FBIH 1QNZH 2FJFB 4YHOH 5IB5A 5F7MC 2V2XA 2VDKH 5JIPA 1TNNA 4LCCC 1P4IL 1TZIB 2FGWH 1HYSC 5E8NB 1BOGA 1PZ5A 4JKPL 3DVIA 5CKAA 4LVHC 3O2VL 1B0RB 2IJ0C 1CIUA 3IDIB 3SDDA 5F6IB 3ULSA 1JWSB 1HILB 4TUJA 1LNUB 1XF4A 2OTPA 12E8H 3NFSH 2ATPB 5HBBA 2J6EH 3TC9A 3VXMA 4NN5C 4DW2L 1C5BL 5LAXA 3MFGB 1BBDL 3BGFC 1NDMA 3OQ3B 5D5MF 4H20H 4X7CC 2DQGL 3FB8B 3DSFL 1LK3L 4LSTL 4NO0A 4NO2B 3VRLF 1RUAL 2X7LB 1MSPA 5D93B 3LSOA 1IC5L 1K8IB 1MRDL 1N8ZA 5E2VH 5CLTA 2BSTA 2AXHA 4LASL 2D31B 4O2FB 2HT4D 3QXWA 4HBCH 3DO3A 3JVGA 1BZQK 2AV1A 3IB4A 3VD7A 1RIUL 2ICWB 4KGLA 4M48H 3O3DB 4J3VA 3MV8B 2BOCA 4P2OD 2NPLX 2NYYD 4W4OA 2XYCA 1JGDA 2WQ8A 3VFSB 3EJZC 2ITCB 5D1ZC 4HXBL 2X9YA 5B39A 3VXPA 2EECA 4YC2C 1OGAA 3ARGC 2YOCA 4FABH 4XNZB 2CRIA 5JLZA 4KJWC 1P1ZB 5ABDE 5GGTH 2F74B 3GM0A 4X6EA 3QHTC 5SWSD 3I6LD 2PETA 4EVNB 5JMRA 3BYYA 4XCYB 2VWEC 4G9FB 3PXHA 1BM3L 1TJGH 3O3EB 2XWBB 3T1FB 4R4BA 3N1QC 2D4DA 1RZFL 3AREA 3HMXH 4LKCB 2FYYA 4Q6IB 1CFTB 5F7DA 4FP8L 4Z77A 3L3IB 2PYED 5D7JD 4ZAKD 5I1HH 1U93A 2HVKB 4ODVL 2YEZB 2A6KA 5AZEL 3LIZH 2YA0A 3O2DL 1JHTB 1VPOH 4DEPB 2YPVL 2I27N 2CK0H 4XAWH 3MQIA 1UFUA 3F5WB 1R5WB 2VLKD 3G08A 2YWYA 3S6CA 1G9NH 2R0KL 5F9AC 3QXAA 2VDML 1EJ6A 5C1MB 4ELMA 2CDGB 5KAQG 5DGQA 1AGFB 3KPRA 2PXYD 4KMTH 1A5FH 1LP9B 3RRQA 1HEZB 4NWTH 3ARVA 1PG7W 2ADGA 3BKJH 3QEGL 1CICA 3ELAT 5DQ9A 1N2RA 5JDJA 1REIA 5ICXA 1CDYA 2AJZB 3D2UA 4Q97A 2AJSH 3STBA 1PYWB 3LPGA 3VRLE 1OF2B 1BAFL 1XF5B 3EFDL 3FB7A 3HZKA 2IANB 1LO2H 2BVPA 4JN1H 1OGTB 4UIMB 4X4ZA 5T3ZH 3ZTNH 1F8TL 2QQNL 5EU7C 5CHNB 4WFGD 4UOW1 4OQ1A 3U0WH 4G8EA 4QHKI 3K81A 3N85L 2UY7A 5I1CL 2Z35B 3WFBH 1KPRB 1JF5A 2IF7A 5INDA 4JPVL 1PKQE 1UCBL 2ZPKH 3BEVB 2DQEH 5BZWA 1X5AA 4NNXB 1WBZA 3V4UL 2OCFD 3S4SB 3MLTB 4NN6C 1CGWA 3E6HB 1KYOJ 1AD9B 3IDJB 4WCYL 4MNHA 5ID1B 4NZJA 5HYSG 1FYHB 1MCSA 1U8OB 2HTKC 5HYEA 4XCNB 3HUJA 4E5XB 3RJDA 1A21A 4GS7B 3FAWA 4Y5XC 5DJ2A 2B20A 4PY8I 2IQ9H 1MIEH 4GRMA 2B1HH 3SCMD 1G9ML 4KTDL 4IRJA 3X3GH 1U8JA 1AFVH 1UYWH 2DI9A 4LLUA 1A7OL 2VLJB 3L3KB 4PJAA 1VEPA 3FO9A 3U7YH 3U79A 3WNKA 3CFBA 3S98A 1CU4L 2WIIA 4KROB 3SPVA 1UB6B 2FX7H 1G7HA 1HHJA 2PTVA 2BNQD 2X6MA 5TE6L 3KR3L 3T09A 3PV6B 4NM8L 1M6OB 4PJ5B 3M8OH 3QNXB 3MRCB 1YPZF 1QSEB 5E6IC 4RFEA 4OB5H 4QRUB 3KJ6L 5DRXB 3CMGA 2KQNA 1MFAH 4HAFA 1DBBH 4M5ZH 3QEQD 1N64L 2UZIL 2WBJD 4OCLC 1JHKH 1A64A 4JN2A 4GBXD 1SYSB 4G6AC 2K7QA 1JE6A 1WCBA 2PYEE 4X4MA 1NKOA 2DIAA 1LWRA 1TJHH 4NQED 4JRYE 3D18A 4IHOB 3LS4H 2ICES 4X0KB 3I3BA 1IQWL 1O7VA 3ZSTA 3QAZC 1MCPH 4N1HB 3GK8L 1U8NB 2VAJA 2YK1H 4U1HB 3O3BA 5IV2B 2FIKA 4GG8B 2DQFB 4M7LL 2GY5A 2QADB 1FIEA 3SOBL 4EN3C 1MCJA 4PRHA 2IALA 1FZKB 3PL6B 2WUCH 1ZHBB 2YBRA 1LE9A 1TMCB 5JUEH 4JDTH 3C5ZD 5KVMC 3FFCD 1GOFA 5E8EA 2DYPB 2WINA 5FUZL 3MRQA 1JVKA 1CR9L 1ZWIB 3MLUH 4HT1L 4PJXB 2W9EL 4PRIE 5EOTA 4M7JL 4MZ3A 2QTEA 4LARL 4N9GA 2DLTA 5EWIH 4XP4L 5FM5M 4F9LA 4ONGL 3PHQA 5FYKL 3W82A 2VLMD 1KT2A 3EGSB 2VUOA 5DC4B 1VDGA 2ZUQB 2AQ2A 3RL1A 3F12A 1M05A 2O5XH 2R1YA 2VE6A 4JFXA 3TT3H 2EDJA 2XKUA 5JNYA 1L4IA 1H3UA 3LHPH 3GBLA 2CUMA 4UT9L 1MELA 3L1OL 3MYJA 3ULUF 3MRIB 3H9SD 3CGTA 2F19L 4J23A 3EAKA 5GQBA 5ISZB 3HR5A 4Q9RH 4YHYC 1YEKL 4JLRB 5C0AA 3EO0A 4FTVD 3JV4B 1I7ZA 4N5EC 4XMPH 2V17L 2M1KA 3IDNB 1S7RA 4I18A 3S36X 3U0TA 4X4YA 2DI7A 3C2AL 1RU9H 4CVZA 3BAEL 4PG9A 1J0ZA 2YWZA 3C6LA 4UIKH 4MWFB 1FZJB 2CO6B 3P2TA 5D9SB 3BJ91 3H7BA 4JY6A 4CU7A 3OKDA 2VDPH 4X98A 2KKQA 4XP9L 2EE3A 5EU6A 1I8LA 2BVQA 1H0DB 5J6GB 1U2CA 2YD1A 1XF2B 4UT7L 1NEZG 3RUGB 3MA9L 1N5AA 1UWXH 3UAJD 4ZUTA 1IGIL 1G6VK 2X1OA 5DQDL 4Y4HC 1U95B 4PJ7B 2Y6SD 5HGBB 4TOYL 1HINL 3ULUC 1PD6A 1CFSB 2PR4H 1RULL 2H8PB 1JTTA 3KNBB 5HI3C 3QSKB 1AQKH 4CU8A 5DI8B 1ZA6A 3PWUA 3VJ6B 3KDMA 1PX3A 1QVOA 2YXMA 5DK2A 3I9GH 1X5IA 1Z5LB 2Q6WB 4P9HC 3PV7A 1L6XA 3QPXL 4ZXBB 3RTQD 2X4OA 2OK0L 5JA8B 3SGEH 3L9RA 4JVPA 3WBDA 2VB5A 1IAKB 1CXIA 3FQXB 2DQIH 3BP4A 1NGPH 5FGRA 3TZVA 2APFA 3MPCA 1DDHB 1EHLL 4NJ9H 4PP2B 3UTTD 4BFIB 3MJ8B 5I1AB 1KJ3L 1JGVH 3SGEI 3NA4A 4OFDA 1FQ9C 1ED3B 4OD2B 5DJ6B 1BLNB 3ULUE 3WFHA 2RGSA 4WWKA 2MCPL 4IRSB 4HIIA 3CXHJ 4C54A 1FSKB 3BSZL 2FWOB 1EAPB 3QEUA 3I6KA 3GSXB 5JHLL 4PV9B 4P5TA 4NFBA 5J1AA 2VIRB 2I26N 5DJDB 2ESVD 4UTAH 5JW3H 1AY1L 3OX8A 1IGFH 2C3VB 5C09E 3OB0H 4O02H 1QLEL 5CZVL 4OF7A 4MJ4A 3UBXB 2X1QA 1DQMH 5GIRB 3SE3C 4RMRA 1TIUA 1I8KB 2JELL 4QXTB 3H42H 3ARBC 4RIRB 4EI5A 4M8VA 5CGMA 3L5IA 4F7PB 5IEKB 4ORGA 3B43A 3RKDC 5CJBA 2JCCF 5LWYH 1N3NA 1U8LB 3N1MC 3F58H 4HQQL 4KKAD 3VXSD 3AU1B 2YR3A 1G6RA 3P4OA 5B21A 5DUBB 5AAMA 4XC3L 1NLDL 1RK0B 5CEXB 3P30H 1A1OB 2NXYD 2X4NB 1EH9A 5TDNA 5L0QB 5D1ZA 1SJXA 1OD7A 4MQSB 3TO4B 3FO2A 2DLIA 3Q6GH 4YQXL 3ARGA 3N9GL 1BFOB 1NGZB 3V0AC 5I71C 4OZIF 3QXVA 1MFEH 3IFPB 4X7SL 4FQ1H 4JHBA 4MJ6B 3VWKD 3OKKA 5FGSA 3QG7L 1I8MB 3JWDL 1YZZA 1ZHLA 1U8PA 1S8DA 1SJVA 3L7FB 4MJ5A 3WJJC 2WQRA 1UVQB 4UQ2B 1EMTH 3QA3A 4Y8DC 3CPLB 5DYOA 4EUPA 4JKKA 3LQAH 2F53E 4LFHD 5GRJL 5JZ7C 1F58L 4LLWA 3SJVE 4D9LH 3FZUC 1WK0A 3K0WA 3RIFK 2P8LA 2GTWA 1DBKL 3FONB 4D94A 3OKMB 3QUZA 4WW2B 2B5IB 4LSQH 1UACH 4XWGH 1U36A 5SWZD 2C1PA 3AFLA 1HOCB 3SGJC 4TUKL 2AV7B 1E6OL 4TRPL 4CAGA 1HHHB 1PKQA 4MXQD 1JUFB 5DJZB 2DWEA 3SQBA 1QA9B 2IFFH 4WHDA 3MUJA 4JFHD 4YK4C 3V0WL 3EHBD 1HE7A 2VITB 4LFHG 1AGEA 3IU3A 4M1CD 1CGXA 2X2YA 3DOSA 4ZOBA 1VKXB 5EO0B 3L3OA 2G5BB 3EJJX 4RNRB 1IGCL 1I1AA 3DUSA 1GC1L 3H9HA 4TSAH 2ERJB 3P4NA 5DFVD 1IKFL 5DMIH 1NAKH 3D0LB 4WI4A 1MAKA 2X4PA 4FFWC 3BP6A 4P5KB 4OF5A 3AGVA 3CU1A 1A7RL 3PE9A 3E6FB 1H3VA 5C0CD 5EO1B 1NGYB 5D70H 1F3DJ 1N4XL 1XIWA 1UWXK 4HJJL 1FL3A 2C7UA 1LO4L 1AR1C 1NMCB 4R7DB 3LQZA 4Z7WE 5F1IA 1BIHA 2GFBA 2QQKL 1MHCA 4F58H 5D72L 5DURB 4AYFA 5JXED 2J2ZA 4RDQF 2HFGL 3RPIB 5EU4A 4QHLA 3KLHD 3PGFH 5KN5A 1T5WB 1KJ2B 4J4PD 5EIQA 3S35H 2D03H 3LRSB 1F97A 3QQ3B 3UEZA 3UPRB 1VEOA 5DJYB 4PBVC 2ITDB 4RWYH 1XZ0A 1F11B 4YBHA 4Y5XA 1J10A 4KKBD 3QIWB 2RHEA 5MENB 3V2AR 1J87A 3FQNB 4JRYA 5IMMA 1N5YH 4LEXH 5BJTA 4XBPB 3NA9L 3TN0B 3PGDA 5D7IB 4E9LA 2EEBA 4PJCB 3PJSA 3TFKD 4Q9QL 3BN9C 1WCQA 3MRJA 5IIEB 1XR9A 5HDBE 2NZIA 4RFOH 5L2KA 1PZUB 1NBYB 3GMRA 1WT5A 1G6RL 2DQJL 4NO5B 3ARFC 4PRDA 2E3VA 1OAXH 1QRND 4LGPB 4OJFL 3FRUB 3TPUB 4X6DB 4DN3H 4MNQE 3TVMC 2VL5B 5CZKA 1TETL 4RGND 5E8DL 1YEHL 4RAHA 5GRYA 2IH1B 5IESL 4FZEH 4PRIA 3QJHA 1KLFA 1FC1A 4MLIA 1D5BA 4XNMA 2ZCHL 4NDMB 3VXUD 4MA1C 4NSKA 5T33L 1MH5B 4D3CH 1BJ8A 1J0IA 3A6CH 5EN2A 4FQHB 4B7IA 3OB0K 1IAIL 4APQB 4EDWL 1JMZA 3GMPB 3EDDA 4MHHI 3OJDB 2PYFA 1IRAY 2IC2A 1UM4L 2A83B 3MLRL 2IEPA 3GMQA 5KANG 1J1PH 4IIQB 1T83A 4TVSa 3RIAK 2OZ4H 4RISL 5ADOL 3L7EA 3AUVA 4JQXA 3MCLH 3DV6A 4EN3A 1BFVH 5DGRA 4OLWL 1AQDB 4KHTH 4OZGE 4XNUH 4HLJA 3ZTJG 4NNPL 1R24A 4XPAL 2HTLD 5HYFA 1HSAA 4QRRB 4ODUB 5FA3A 2PTUA 1QBBA 1JYWA 4QRPD 2FECI 5T3XD 4QHMA 4OSUH 2DWDA 4X6BA 4ONFL 3VXQB 4KK8D 4D0CB 3VD3A 1Y18B 4TTDC 1ORSA 5HHXH 3S5LA 1LMKA 3U0PA 1KJVA 1XAUA 2VXUL 4WTZG 3MJ6A 3RVUC 3ILQC 2IPKB 1CDBA 4MAYA 1QFUL 5F7KC 3GHEL 1O0VA 2E8YA 2RQ8A 1WFNA 3T1WA 5DD3H 4PJDF 2Z92A 1WLHA 4LK4A 3L5HA 3BDYH 5FECA 2R23B 4MD5A 2QKIA 1AGBA 4TQEH 5FYLD 3O41B 5DRWB 1JYNA 2XN9D 3HS0B 1EEYA 3GO1L 4M62L 3NTCL 1BREA 2VXVL 4HWZB 4NN7C 3TBYA 2H2PD 4Y5VB 4BZ2L 2FJGA 3WIHH 1I3GH 4LKXB 3LB6C 3R06B 1R5VB 3TV3H 4QRTB 1AD0B 4Y1AE 1CGUA 3VXTA 5F7HA 3SO3C 3GKWL 4WRLA 4AENA 4PR5B 1T4KB 1X5KA 4LCWD 5F9JA 3GSNA 4Z7UF 5I17B 4BZ1H 1A8JH 2CPCA 1BVKA 4WWID 2BP3A 2EICA 3BPOB 5CP7B 5IB1B 2HWZH 1XF3B 4MQXD 4ZODA 3WLWC 4XXDB 4FQIL 3KYNA 4PTTA 3B83A 5F8RC 4PJBE 3S9DB 3SDYL 1V7NL 5IMOB 1IM9B 1E4WL 4S1DC 4WO4A 3REWA 3NH7H 3LPFA 1QQDA 3QHFH 3OKEB 3HE7C 4E42A 1JPGB 3VFOA 2ZOKB 3INUH 2BNRD 3LN9A 2Q1EA 4XNXL 2RR3A 4TSCH 2IH3A 1JNJA 2DTMH 2Z31A 2EO1A 1P9MC 3CFDA 2NR6D 1ZKAA 2FSEB 2XWTB 4KRNA 2VSDA 4MD0B 3ISWA 3K2UL 3MRGB 5DJ0A 4WFFE 1Q9OB 1KCRL 1ONQB 3AAZA 3ZL4L 5E08L 1N59B 2FJHA 1S7VA 4OZHF 1F90H 2NQCA 3QJFA 5DS8A 3ZZ1A 2V7NA 4U1MB 4L8SC 4I3GA 5IT2L 3JUYA 4BQCA 3QI9D 5C09A 1KTDB 1U3HC 3O0RH 1I3VA 2OP4H 4PRPD 5JXAH 3MRFB 1L6ZA 1DQJB 1VFAA 5AZ2L 1FNSH 1LO5B 1YECL 1JTOA 1YN7B 3VH8B 4PJ8D 4PJDE 3K2MC 2H6PB 4RAUA 5D1XC 1NUGA 1A47A 4JQVA 3ULVH 5KVGH 5IM7A 4JZNA 4RX4D 1XGUA 2W0FB 2O5ZH 1ZHNA 1DVFD 5BQ7B 2GJ6E 2IPUK 1U8KB 3K3QA 1VESA 1G9NC 4XBGB 1I9IL 4BA8A 3TYFB 1KLGA 3KPQB 3JWOC 1R3IH 1EXUA 1IEAB 4PJHB 4HHAB 4DCQB 1SJEB 1M71B 1IAOA 1L7IL 4ZUVA 1GGUA 3LN4B 4AIZA 1ACZA 2YD3A 4X9FA 4NP4H 3WLBB 3PHOA 5FUOH 2FH8A 4AJ0A 5ACZA 3CX5J 3G04B 1YJDL 2AJYL 2E5EA 4S1QL 1FDLH 1RMFH 3LY6A 4HW6A 3SE3A 4X5XA 1U42A 2NNAA 3T2NL 1HKFA 2YPKB 4LLQA 1Q0YL 4AG4L 3QUYA 3EYFB 3QG6A 2VN4A 1AKJD 2DQTH 3SKUD 3FCTA 4U33A 1P7QB 2ZNXA 3GBNL 3LH2H 2G60H 2F53A 2ZZUT 3MBXH 1R3HA 5L88L 3TWCL 3SJVA 3VW3L 5D2LF 4G8GB 4CMMB 3HNTL 3DTXA 2VKXA 4JO2L 4HGMA 2BFVL 1DE4A 1OP3K 3VXRB 3VFWA 1QHOA 3EYUH 4D2NA 2PF6A 3T2PA 1RJLB 1QO3A 1JZ2A 5ESQA 2OTWB 1KJ2H 1J88A 2WUBH 2XTJB 1I1YB 4XI5D 5L6YL 2CLZB 3BW9B 4OZHE 3ZYOA 1TTGA 1LHZA 1BWWA 5T3ZE 3X3FL 4NQDE 5CWSB 4I48B 4ONOA 2LVEA 4H8WH 5EBMB 5GGSB 5FKPB 4J6RL 1NFDF 2FGZA 3WJJA 4WUUE 4QCIA 1JPFA 4H26B 1MWAB 4BFBD 1CL7H 2B7DT 4LVOB 3FO1A 5JOFA 3SQOH 3CK0L 4J3SA 4YIQB 5IVZA 4PGBA 5L9DH 4M6OL 4Z6AT 1CL7I 4HK3J 4AEFA 2E9IA 1A6VH 4Z7WA 3ZO0A 4EJ1C 1ZT4A 1NDGB 3LN5A 4KWUA 1KXQE 4PV8A 2AK1L 2UWEB 3MGTA 4WHCA 4GKZA 2GKIA 2BVOB 2H2SD 2OTUA 1A9BA 1GGBH 1A22B 4ELKB 3AROA 4FFYH 4JREB 3MNWB 3JZ7A 3LDBB 4OZIA 3T0EC 1MVUB 1Q72H 4PD4J 3DX9B 2XNAA 2GTZB 1RHHA 1A6AB 4YGVB 3RGVA 1T20A 3GI8H 2RCSH 4OIBA 3L3GA 4P2QD 2NXZC 1DL7H 3UTPD 2H32A 2JIXD 1RV6X 5IW1B 4KY1H 5DEFA 5C0EB 1JN6A 1Q38A 1YC8A 1A7NH 5JPNB 1JHLL 1I9JL 1CE1L 3MNZA 4XNQA 2XKNA 3J8F7 2AEQH 4O9HL 4XVJH 3RWCB 1YY9C 3I02B 4IMLA 5LCVH 4MNQA 1AHWB 1KC5H 3OXSB 2Z0BA 4E0RA 1INEH 2ICEB 5I1JL 5CJQH 2VDLH 4U6HB 1WBXA 1YN6A 3GIZL 2O5YL 4I9WE 3DUHA 1CFNA 3O81A 5EZJB 4K3DL 1YQ2A 1MJJA 5FO7A 3I75B 4X8XA 3B2VH 1ZXQA 3HG1B 2NY7H 3DXAE 4AY0A 1R0AL 2DMKA 5GGSY 1V3KA 5J13B 4KK5C 1VGEL 3MRBB 1A0QL 2ADJA 3KPOB 43CAA 4A2LA 2NY4C 1MJ7H 4NKIH 1M7IB 4NZUH 1FO0A 1D5XB 3HZMB 1URLA 1UT9A 4KKCD 4OZGA 4DQOL 5F1SA 4NC1C 5HHMB 2CGRH 3TVMA 3QFDB 1EV2E 2F5BH 3C9NA 3VE0A 3P9WB 5D1QB 3NCMA 1ZEAL 2FX8L 3CZFA 4UDUA 4MJID 3V0VA 3QWOB 3WFDL 2IBGA 4AIOA 1RIVL 2EDKA 3GIVB 1MFBH 1FG2B 1MY5A 1U3ZA 3BP7A 5HHVH 3U9PH 5HY9B 1PQZB 3CFEB 4JDZA 5ILTL 1MI5B 5KVFH 1S9VB 4WEMB 1C8PA 4FFVD 4FRWA 1CFVH 4KQ4H 5BXFA 1ADQA 4ZPTB 1I8IA 3ARDC 3MZTA 2J3SA 1UKSA 1Z0MA 3SE8H 1EAJA 1JGEB 4L4TB 1BX2A 5EIVA 1CDUA 3ARWA 3KVQA 3BKCH 1QTYT 4WU5B 4Y1AA 3R8BB 5E0QA 2DQHH 1IZJA 4LAQL 2XQYK 1QPPA 1DFBH 4LIQE 3WUZA 2EE9A 3DVFA 1ETZA 5EBWB 5I8KH 3ARZA 3JTSB 3O11A 4I77H 1NMBL 3RBGA 4ZPVA 4YDJB 1KNOB 4S1RL 3OZ9H 2VZ3A 3IKCA 4PJBA 4XP1L 3HRPA 2WZPD 5GS0L 2X4QA 5FGBC 3DIFB 1OSZB 5EC1B 4Y4KC 2UV3A 3H3PL 3HAEB 5JW4Q 3D3VB 4HXAL 1OWWA 4ZO6A 5T5NF 1S7UB 1W0WA 2R2BB 4OF0A 5TQ2H 4HKXB 4EDXA 1T04A 3JWNC 1T5XB 3P4MA 4HIEA 1N0XL 3O2WH 2QEJA 3RWJA 3TA3C 3MOAH 3AM8C 1U8IA 4H1LB 2VISB 3H9ZA 3W2DH 5GRVL 3UJIH 2J6EA 1B6DA 1F4YH 1DQTA 1Y0LA 2FBJL 4G9FE 3RA7H 3MV9E 4GAGL 3RWDB 2DIJA 3TBVA 3SKNA 3FOMA 5CBAB 1H5BA 3V9FA 4K7FA 2P5WD 4MCYB 2HMIC 1MEXL 2Y06L 4KK6C 1DQQB 4TN9A 1SBSH 4K9EL 1YMMD 4AEHL 4OLVH 1NC4A 5HDQH 5I74B 5I0DA 4XAKE 4IOSD 2CXKA 3IDMA 4PJDA 5MEQA 5C86A 5E6ID 3HE7A 3M1BA 1FH5L 5IVXB 2R15A 4HLZG 5KVDH 4O2EA 3DX8B 1MHEA 1FO0L 4UQ3A 2XZQL 4PJ9B 3RNQA 1TJIH 2GJ6A 3CDGA 4QRSB 3OAUH 4G6AD 3Q5TA 5EO9B 4YXLL 3MLSH 5GGTA 4XBEH 1LP9E 4GS7C 2Q7YB 2GI7A 1MREH 4K3EL 3RAJL 4MJ2A 1NCAH 5GGUA 3N06B 2A9NL 3HMXA 5IGXL 4Z7UA 1KCSL 1Y6KR 3H0TB 2IANE 1JZ4A 4K3JL 3FOLA 1OPGH 3LQAC 5SX5K 1PSKL 4NRZB 1KENL 1AXTL 3IF1B 4KROC 4HPYL 1AXSB 1RI8A 3O9WB 1VACB 5D1XA 1E27A 4O2CB 1MWAH 3BZFA 3HPJA 2CR3A 4HS8H 1VFUA 1YEFL 3VGEA 3D5OF 1ADQL 4AL8H 5EBLB 4LCYA 4Y16B 4PJXF 4N8VA 3DMMC 2H45A 3HZVB 4AQ1B 5FYKU 1JNLL 1VENA 1PZ5B 4X6CB 4XMLH 3HN3A 2F8XC 2B4CH 2WWMC 1EIBA 4WI9A 4GOSA 2EH8L 5I15L 1FFQA 4POZC 3MUGA 4ZS7L 3X13A 2E27H 1B4JL 1KIRA 2DDQL 1AGCB 2EYSB 2VLJE 1QNZL 3VXOA 2K9UA 25C8H 3MRMA 3MV11 4GAYB 4OZHA 2WSKA 2BX5A 4XXCA 1DP0A 3T65B 5F3BB 2XA8L 4NQDA 2FGWL 1AGDB 1F4XH 3PHSA 4P46B 2EYTB 4U7KA 2R69L 4PJ5E 2QADC 4N0UB 4WUUA 5E70A 2F58H 5I8OL 5EA0H 4CGTA 1UKQA 3LSOB 1N8ZB 1T66C 4PB9L 1X7QA 4OT1H 1L7TL 5H35A 5BZDA 2CDFA 3FQTA 3CFCH 3SDCB 4R97B 2FHBA 3EW3B 1L0XA 3VWJA 1MCWM 4NJAH 3HA0A 1LE5A 2CIKB 3BXNB 4URTB 1KJMA 4JY4B 5MHSE 2F54D 3RUGF 4IMKC 3SBWA 4FQCL 4HPOH 2ZUQC 4K07A 1YNKH 3PWJB 2BOBA 5JLZB 5ITFB 1JP5A 4PJ7F 5DJXB 4L3ED 1JCKA 2DKSA 4P5MB 4Y4HD 1NL0H 4D9QE 4F3FB 2GSGA 1ZT1A 1ZV5A 5DUMH 5IBUG 4AT6B 2AKRB 5KS9B 3TT1L 1JZ3A 4GMTH 5JW5A 2G75A 3ALXA 1RZ8B 1MNUL 1XH3A 4QWWD 5BW7A 5ICZA 3STLB 1I85C 4JQIH 5TFSH 3IFLH 2XG4A 5ALBH 2GQHA 5EB9A 3HE6B 5JHDB 5E5MB 4PJXE 3VMOA 4BUGA 1W2KT 5FO9A 1CYGA 1WTGT 3U9UA 5GGTL 5EZIH 1BQHG 1ZSDA 3NAAH 2VDQH 4UBDC 4HH8A 1YEJL 5HPMA 4XTRD 3U4AA 3KPPA 4HKBB 4WEUD 2W0KA 3IDXH 3MROA 3U6RB 2H41A 3GGWA 3W0WB 3WSQL 2VDRL 4IOIB 3OR7A 3HMXL 3KPTA 2HFTA 1N6VA 3VRIB 1WEJL 4JHAL 3T0EA 5I1HL 2V9QA 3MRLA 2BY1A 5CGYC 4HKJB 3FKUS 4YFEA 1S7QB 1ZAGA 3LIZL 1ES0B 5ISZE 2BSRB 4DN4H 5H37G 1VPOL 3FHQA 3EYVB 4Q2ZB 4QLRA 4XAWL 3CCHA 5DQ9B 5C0RH 3U7WL 1CDJA 1JI1A 4DGIH 1GAFL 1RQ5A 3DXAA 2VLRB 4RFNC 3GSRA 1GPOH 5JDSB 1ZGLB 1FRGH 5DHVH 5E95B 1J7VR 4UV4H 3WXVH 5GGRB 4MA3A 1BECA 1SMOA 4P49A 3U46A 2VYRE 5B38G 4DGVL 3AXLB 3D39D 4JDVA 2VDNL 3DO7B 1P4IH 3QIBB 4ZXBC 4JKPH 3FB5A 2YD9A 1T6VN 1Z0NA 4B41A 4YBQD 3UYRL 3RUGE 4OV5A 3O4LD 3O2VH 2PW1B 2HVJA 3ARBD 5CEYA 4TUOB 3WIFA 5DD1L 3T2OA 4U1LB 2DJUA 5A2LH 1A6ZB 4CJ0A 2B1AL 3RKDD 5T3ZL 2FJFA 2NY5L 4PJ7E 3WN5C 3QP3A 2A1WL 3U0WL 3RZWA 1GXEA 1TZIA 5E2WL 4DW2H 2FEDC 1C5BH 5E8NA 4IRSC 1A7PH 5F7FA 5AUMB 1QUNA 2DQEL 3HAEH 1FSKC 1AC0A 4PJAB 3NCBB 4UINL 2VZ1A 1B0RA 3DSFH 4LSTH 3UTSD 2WIIB 1RUAH 3SPVB 1IC5H 3IDIA 1MRDH 1JWSA 1G7HB 4LASH 1LNUA 4ETQB 3ZHLA 4OM0L 4YHNB 4H1LH 1TQCC 2ATPA 1RIUH 3FQUB 4MDIA 2B1HL 3IJYA 1KYOK 4YX2L 1FL6B 1GOHA 1FJ1B 5DD0H 3BH8B 4OI7A 4NM4L 3ULVF 3FB8A 4HXBH 4PBXA 3FT3B 2VZVA 4NO2A 2X7LA 2DS4A 1K8IA 2FX7L 2D31A 4PGDB 4O2FA 3TIEB 3IFNL 3FZUD 4WW2F 2P24B 3I50L 1J86A 2ICWA 5GRWA 3E2HB 2YUXA 4OB5L 5J06A 3O3DA 3K4AA 4GKOA 1BM3H 3MV8A 2FATH 1DBBL 1RZFH 3OR6B 2FEEL 3VFSA 2YRPA 2ITCA 5L0QC 3CAFA 3TO4C 1NLBL 1LQSR 5DVOA 2NY6B 5F89B 5J7CC 1P1ZA 4ODVH 4U1NB 2F74A 4YEFA 3RVVD 3I85A 3O2DH 2YBRB 3LS4L 3E8UL 2YPVH 5EIIB 1LDSA 5CSZB 5JW4R 4XCYA 1WICA 4G9FA 3MV9A 3O3EA 2XWBA 3LEYL 4TULL 3GMNB 1X5GA 3T1FA 4JRXD 4LKCA 3KGRA 1B2WL 2R0KH 3GEWB 4Q6IA 3ULVC 2VDMH 2CKBL 1AO7E 3L3IA 4ZUWB 1DLHB 2ZCKL 1MRFL 4XWOC 3HTLX 2HVKA 2ZKHH 5M7QA 4KZEL 1AR1D 2YEZA 4H0HB 4PJEF 4GAJL 1JHTA 3QEGH 5JUEL 2V2TB 2CSPA 4JDTL 2B5IC 1D5IL 2JTDA 5GISH 4JFXB 3F5WA 4X5LA 2AJVH 2WWKO 1R5WA 4LU5L 5FYJD 2X05A 2X42A 3R8QA 2MSPA 4XMKL 5EWIL 2VZTA 4I0PB 4HWBA 2QQNH 2CDGA 2EDYA 1AGFA 2Y25A 4KAQL 2COQA 1LP9A 3N85H 1HEZA 4IRZL 3WNPA 3WO4B 5I1CH 1OOAA 5FOBB 2O5XL 3C08L 5DO2C 4JPVH 2ERJC 4MXVF 5DFWH 4Z0XB 2FO4B 5D7IF 1FYTD 4PJCF 3ULVE 3V4UH 2AJZA 4GW1B 1PYWA 1OF2A 1XF5A 3PGCB 3BN9D 2IANA 3F7VB 5KSAC 1OGTA 4UIMA 1OY3B 1QSFB 4Y2DA 5CHNA 4F8TA 4FG6C 3ARFD 3IDYB 1UZ8B 4EQ3A 4XMPL 2G5RA 2Z35A 3BHBB 1KPRA 5DVNA 1G9MH 1F13A 3K7UA 4KTDH 4X6DF 2NY0D 1U91A 3BEVA 3OWEA 1A7OH 1P7KB 4NNXA 2DIBA 3VI3F 2NMSA 3S4SA 2Q20A 3MLTA 2P47B 3E6HA 4Y4FC 1CU4H 3IDJA 2O26U 4IBLT 5ID1A 1IBGH 5HXMA 1U8OA 5TE6H 3KR3H 1DEDA 4XCNA 1FFRA 4E5XA 1W72L 4M4RA 2JJTC 2FB4H 4XVSL 3QIWC 4Z95L 3KJ6H 3VGBA 5IEHB 5DK2B 4LIQL 4YHML 2X89A 5EU5B 1UM6L 1N64H 2ZUUA 2VLJA 3WFEL 3VDCA 2UZIH 4WFHE 4KJQC 3F62A 5IROA 1R3KB 5A3IC 5D4QA 4GLRH 1H3XA 4K55A 2MHAB 3QPQC 1UB6A 5F7NC 4JAMB 2FHFA 3CSBA 3MBEB 1Q8MA 1TZHB 4GRLC 3PV6A 4HC1L 3S3JA 1M6OA 4PJ5A 3QNXA 3MRCA 2A38A 5E9DE 5HVHB 4NQTA 1DZBA 4QRUA 4XP6L 3V4VH 5DRXA 1G0DA 5SWQB 4FNLH 3GK8H 4TVPD 4NFCA 1NC2B 1SYSA 5E03A 3O3UN 4JB9H 5GZNC 3MCG1 3BPNC 1ZVHA 2DQIL 1WIUA 3RVUD 3ILQD 5MENE 5CLWA 4NJ9L 2JK5B 4IHOA 4X0KA 1RZKL 1A1NA 3UYOD 1JGVL 2N7AA 2R9HC 4GO6B 1JL8A 3C2SA 4N0FB 5D7IE 4PJCE 4APQC 3C87A 1CR9H 3QNZB 4HT1H 2W9EH 2XV6B 4X9HA 5F7EH 2XI9A 1U8NA 4M7JH 5FYJE 3B2UD 5IV2A 2YD2A 2YMXL 4N0YH 4XP4H 1HQ4B 4GG8A 4BH8A 5GJTL 1WC7B 4MXWH 2ZSVB 3LRHA 2AK4D 3QRGH 3DARA 3LB6D 5FO8B 2ICCA 1FZKA 3PL6A 1ZHBA 4OCXL 2JB5H 3RJQB 5J6HB 1T80A 2YSSA 1CGYA 3FFDB 2GK0B 2DYPA 4HWBL 4UTAL 1OTTD 4UT9H 1ZWIA 4PJXA 5JW3L 4XPGH 3CXHK 4OZFG 4O02L 3ARXA 3DURB 3SGDI 1NGQL 2F19H 2AI0L 3QB7C 3WLWD 1H15B 1YEKH 2GY7B 3MLYH 1ZS8B 3H42L 3TM6A 4IMKA 3EGSA 1ZA3B 4OIIH 3CFIC 4E41D 2V17H 4S1DD 5CJOH 5HHOD 2CR6A 4JKMA 2HJFB 3BAEH 2LU7A 3Q1SL 3UDWA 1KFAH 3MRIA 4BFEA 1JTPA 1OARL 4NQSB 4U1IB 1LVEA 1G7JB 5FA4B 4XP9H 5ISZA 4JJHA 3AB0B 4QRRE 4MJ5B 1C5CL 4LMQI 4JLRA 4C4KO 3T2QA 1MJ8L 4UT7H 5JW4M 3JV4A 2AP2A 2AQ1A 3MA9H 3EO1A 3SHSA 1IGIH 3IDNA 5DJAB 3ROOB 1I1RA 3T4AA 1VEMA 5DQDH 1MFEL 2GTWB 4WENB 4LRIC 4MWFA 3QUZB 1FZJA 1A6PA 5D9SA 4TOYH 3BQUD 1HINH 1R6VA 5I1LA 1U3HD 1RULH 5J6GA 1GZQB 1EFQA 4HK0B 1XF2A 2YD8A 2MFNA 2B2XH 3RUGA 3ZKXC 1RJZB 4FZ8H 4YPGB 5IBTL 4KXZH 4D9LL 3BZ4B 1FHGA 5TF1L 3JBG7 1EEZB 3EOAB 1L9MA 3P73A 2JKXA 3TBWB 1U95A 4PJ7A 2LU3A 1Q1JL 3QPXH 4MA7L 2OZ4A 5M95B 2OK0H 2ZUXA 4XWGL 4KXZI 3BO8B 1T1ZB 3P3YA 3VFMB 1IEHA 1CFSA 2H8PA 3KNBA 4PJHF 1EHLH 4OF3A 5ID0B 4R2GD 3VRJB 4P2OB 1HZHL 5DI8A 1MPAH 1KJ3H 2ED8A 1OAUH 5DC0A 5CILL 4G43B 2CRZA 5M94B 1Z5LA 3L3HB 2Q6WA 3ZE2F 3LKOA 1X5YA 4ZXBA 1BQHA 2MCPH 4K3HA 1BPVA 4L3CB 3NCYP 4JGMA 4RQQB 5SWSB 1IAKA 5DMIL 3FQXA 3BSZH 5C07D 5C08D 2BMKA 4GW5B 2BSED 1DDHA 5JHLH 1FNHA 4BFIA 5I1AA 1NCBL 4X8JB 4KDWA 4K71C 2VR9A 2OQJB 1S9WB 1ED3A 2IG2H 4JZJC 1BLNA 4JFDD 2ZP0T 2PYEB 5F7UA 5D7JB 1RJCA 4K94L 4ZAKB 1QLEH 5CZVH 4I0KA 2KDGA 2EO9A 4R26H 2NW3B 4ODSH 2JELH 1G7LB 2YPLD 5TGBB 1DBAL 4P3WA 2VR4A 2FWOA 1EAPA 1NGXB 3GSXA 3OMZA 1LD9B 3S35L 2D03L 4PV9A 2VLKB 4HULB 2VIRA 3BZDA 5DJDA 5DRNA 1A4JB 1JFQL 4HQQH 2C3VA 4HGWB 5I18L 5F96L 2PXYB 3BP5B 3ECBB 2E7BA 2ADFL 3UBXA 5GIRA 5F9OL 4LEXL 3KHQA 1I8KA 1Z9OA 4XC3H 3C5SB 4QXTA 4RIRA 5CD5C 1NCDH 5IG7A 2GCYB 2VXQH 4F7PA 5C3LD 4LGRB 5IEKA 3QJHB 4YQXH 5T1MB 2EDBA 3N9GH 1A7BA 5HYSB 1NANH 1IEBB 5E8OB 1U8LA 1AO7A 3HFML 3WFZA 1WFTA 4GXVL 5HSFA 4F7EB 4U0RB 3TP4A 1OAXL 1WITA 3AU1A 3QG7H 4YE4L 3JWDH 3E3QC 1NANI 3QUXC 5DUBA 4NOFA 4PJHE 1RK0A 5CEXA 1BJMA 1A1OA 2X4NA 2UWEF 5K9JL 3TO4A 3WXWL 4M7ZB 4EI6B 5GRJH 1F58H 1BFOA 3EDFA 1EFXD 2XTJC 1NGZA 3IFPA 1IQDB 1DBKH 4X99B 2FLBT 4MJ6A 1MCOL 3MRDB 1JF1A 2DWDB 1RZJH 1E6OH 4RA0C 2RB8A 4OLEA 3L7FA 4TRPH 3SCMB 1UVQA 4OUUB 4UQ2A 1J1PL 4EXKA 4GXUN 3HMWH 3CPLA 1FNFA 1W0YT 2E7LC 4FFZH 1FGNL 1SMAA 4G8GE 1HWHB 1DLFL 3E3QE 3WD5L 2BNQB 1IGCH 3FONA 3VXRE 3OKMA 4WW2A 1GC1H 4HFUL 5INCB 4M03A 2BXZA 3ARPA 5D7KD 1IKFH 2YN3A 1HOCA 3GHBL 1YY9D 2AV7A 3PQYE 1PW3A 5LGHH 2B4CC 1HHHA 5FOJA 1JUFA 5HHXL 4LDEB 1A7RH 5DJZA 3QEQB 1QA9A 2DM4A 2WIMA 2WBJB 1T03H 2ICWJ 4GBXB 4HJJH 3BH9B 2R0WL 4RMQA 1UJTA 1LO4H 2VITA 2D7PA 4JREC 3SE4C 1VKXA 4DZBB 2NY3C 3LDBC 5EO0A 3VXTB 2G5BA 4RNRA 3FJTA 3BVNB 2UVFA 5DD3L 4MZ2A 5D72H 3IRZA 5F9JB 5F6HJ 3D0LA 2YPLE 1FORL 3LCYA 1MQKH 3BIKB 3O6LH 4RCAA 3RWHB 1P6AB 4UT6H 3JV6A 4DVBB 2P45B 3E6FA 4KK5D 3L6FB 5EO1A 1NGYA 2D7QA 4LDOB 2NY4D 2M26A 4JFED 5F21B 4M93B 5I73B 1IE5A 5I1KH 4L8CB 4R7DA 4JFZL 3TBSB 4HUMB 4NQUA 4BSJA 5E9DA 2UWEE 3C5ZB 5F44A 3NA9H 3FFCB 3MOQA 4OCRL 3RPIA 4BZ1L 3P11L 1DN0B 2ZOLB 4LCIL 4Q9QH 1T5WA 4YFLI 2YA1A 4LHQB 3LRSA 2HWZL 2GJZB 5C2UB 4PLJD 5LGKA 2NY2C 3UPRA 3DI3B 5DJYA 2ITDA 2Z31B 2DQJH 3CFDB 1F11A 2JJTA 1QSVA 4G42B 3RY5A 4ODBD 3QIWA 4P3CL 5MENA 3FQNA 3NH7L 5BS0D 1T7YA 4ZNCD 2FJHB 4N68A 5FK9B 4XBPA 1TETH 1ZOXA 5E8DH 3TN0A 5D7IA 2M2DA 4GKNA 4OLYH 4PJCA 5MEPB 2XA3A 3OKYA 5IESH 4ZD3L 1XGYH 5BO1L 5IIEA 1I7RB 2Y4SA 3BKYL 2ORBL 4TSCL 3SKJL 1NBYA 3VDBA 1QZ1A 2GYSA 3H9SB 3ARDD 4LRNL 5T33H 2DTML 2VC2L 5F1NB 4NO5A 1GVIA 4M43L 3UO1L 4RBPH 5DHYB 2MQCA 1NEZB 1IAIH 4EDWH 5K59F 4EUPH 3FRUA 4R3SB 4JM2D 3TPUA 4KJYA 4X6DA 1XGUB 2VL5A 3IT8D 3G6AB 1UM4H 2DM3A 2VKWA 3MLRH 1SVCP 2IH1A 5D1QC 1IAII 2YD5A 3K8LA 4RISH 5ADOH 4CU6A 1KLGB 4NDMA 4XP5H 3O0RL 2VAAB 4YDIL 1MH5A 4XPAH 4G7YL 1QFPA 1P6FA 3NABH 3JV5A 2EKJA 4FQHA 3VA6A 3V8OA 4ZUVB 2OR9L 1XCQB 2QSTA 3HG1E 3RDTC 2QQQA 4APQA 5KVGL 4ONFH 4M6ML 4Y4KD 3GMPA 2X5PA 3OJDA 3ZHDA 2A83A 4WHYG 4OAWB 3TESA 3S35X 4HFWB 4IIQA 5A2KH 1KOAA 4JPKL 1CLCA 1DN2A 3QFJD 1JJUA 3TA3D 1QFUH 5CEZE 2JJSC 3GHEH 1TQBC 4ODUA 4QRRA 3LS5H 5HHME 3OHXB 3P77B 5DR5L 3CVHL 3LEXB 4NKMB 3FCTB 3RWFB 3RPKA 1T1WB 1EA9C 1Z3GL 2R2CA 3VXQA 4FQPA 1C16B 4D0CA 4M62H 3NTCH 5DHXB 1Y18A 3R4DA 2HMID 1FDLL 4KU1A 1VFBB 1CD1B 1OAYH 3RTQB 1CE6B 2IPKA 4UOW0 1QO3B 2VERN 1YNLL 3CX5K 2DQTL 4LSPL 2R23A 3UTTB 4YZFF 1YQVL 1MI5E 5IVXF 3T0WA 3V6OC 5F7YC 4NCC2 1CXKA 2NW2B 3O41A 2G60L 5DRWA 1UQSB 2WLZA 3HS0A 3GKZA 3NFNB 4U2YA 4NPYB 5CZXC 3DRQB 4HWZA 5E7BA 2ZUVA 1RSFA 2ARJB 4Y5VA 2IAMA 4KTEL 3SDYH 1V7NH 3R06A 1R5VA 4QRTA 1AD0A 2BY0A 1E4WH 4JFQB 3F6LA 5K59E 5AG8A 4PR5A 5JOFB 1T4KA 1NAML 2I5YL 5E5UB 1F4WL 4LRIA 3MUZ1 5IB1A 4P48A 2KUTA 1XF3A 4YHLL 4XNXH 4YDLB 1AE6H 2HT3C 4YR6B 4XXDA 4Z7WB 1BOYA 4H8WL 4PRBA 4C4KT 3BIBX 2KBGA 5HJ3B 4R4FH 5LGJB 4XPBH 1UZ6F 4PV8B 4B0MM 1AP2B 5D7LD 5IMOA 4AQOA 5C0BD 3MACH 4LHUD 5I74C 4P2RD 1CXEA 2KPNA 3BIAX 4NZTL 4RAVB 3SQOL 3ZL4H 3ZLQC 5E08H 1D9KC 1HHKB 1QSED 3QIUA 5FYJL 3OKEA 5IHLB 1JPGA 3JSSA 5FV2A 4M9OA 5L9DL 2BHUA 3DMMD 3KXFD 2ZOKA 5IT2H 3B9KD 5TE7L 1LEIB 4YDKH 4XVUD 5DRZB 4PJ9C 4X6CF 3VXSB 3V4PL 3U2SB 4OD3H 1YECH 2FSEA 2AXJA 2XWTA 2YD7A 2I9LB 3WEXB 1FE8L 4XX1E 2NXYB 2WWMD 1IM3A 4LHUG 1Q9OA 4POZD 1GGBL 1ONQA 1N59A 4GRWE 3MR9B 2Z8WC 1I9IH 2XIDA 3BZEB 4LSDA 1KTDA 1TCRB 3VWKB 1J0JA 1UH2A 32C2B 3HC3L 1DL7L 4G7VL 3MRFA 3ZYIA 1JPST 1YN7A 3VH8A 2HAZA 1L7IH 2YXFA 4XPHL 3O9WC 2H6PA 4PD4K 4YZFE 3QDGE 5IVXE 2H1PL 1T66D 2W0FA 2AEQL 4Y16C 2EXWC