4WI3A

Structural mapping of the human igg1 binding site for fcrn: hu3s193 fc mutation i253a
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Structural and functional mapping of human IgG1 binding site for FcRn in vivo using human FcRn transgenic mice
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi3A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi3A01
4HZLA 3D3VD 3STLA 1CFBA 5EO0A 5EFIA 3R4DA 3JWOH 1OAYH 1IKNA 5GJTL 1FFOA 4R26H 1BHGA 4MXQD 4YXHH 3FQNB 5IB3B 5I0ZA 4CRPA 3AXLB 1HYSD 4EI5C 3V4VL 5HVFB 3O45B 4F9LA 4X6CF 1H5BC 1S7WA 1FG2B 2COQA 4ODWA 2BMKB 4P23C 4POZD 5DFVD 5JW3H 4PLKD 1X5IA 5JOFB 4XMLH 4JN2A 4ODTH 4PRHE 1NGXA 2DDQL 3C5JA 1I9RL 4K3DL 3FB5B 4R2GB 3NABL 2V2XB 3QO1A 4PV9A 4PJHB 4MAUH 1OF2B 1P5VA 1FCGA 6CGTA 4B7IA 3MSPA 4H8WH 4I2XA 3QZWG 2FB4L 4JFEA 4OZFG 2XWJA 1JNLL 1T7XA 2I25N 4OZGF 5D93B 3DXAA 2YA2A 4K8RL 1EA9C 4O4YH 2YMXH 1K8IA 4DK6A 2HVKA 4JPKL 2H2SC 4IDLA 4NQED 3BPOB 4YWGH 1AQKH 1CXLA 4G6MH 4EN3B 1G7PB 2VDKL 3RL1A 3D2UA 2CMRL 5B22A 3LEXA 2NY0D 5MI0C 1IT9H 3ZYZA 2G5BB 2CLRA 3D1MC 4NSKB 1CFTA 4WI3A 5FO9A 1TCRA 5E8EA 4HZLB 4Z7OE 3STLB 3MFFA 2E3VA 4KKLD 1MAKA 4D9QE 2JLLA 2XZAL 1FFOB 2YPLE 3QWRD 2EDOA 3WLBA 1U3ZA 3TN0A 5C2BL 4RGOH 4KK6D 3HKFA 5EIIB 5T1MB 1S7WB 3BT2L 4QY8B 2OS7A 3KYMA 1Q94A 4UOW1 5H94B 5DWUL 1NGXB 2LU4A 3C5JB 4OCYH 5I9QC 5FYLH 5FA3A 3PP4L 1CK0L 5EWIL 3HG1A 1XR9A 3DI3B 3IDYB 2ZUVA 4U0RC 1C08A 2NLJA 3ARDA 4JFEB 1MRFH 2XWJB 4JRXA 1BPVA 3OR6B 3MLRL 3OJDA 3B5TA 4W70A 3DXAB 1QSFE 2X44D 4PS4H 1E4KC 1I1YA 3GBNH 3P4NA 5IM7B 7FABH 5EO1B 2LAGB 4PY8I 2CRIA 3MV8E 4P0DA 1GGBH 3RL1B 1GSMA 5ACLA 1YEJH 3UJJL 2D0HA 1UJ3C 2CLRB 2RIKA 4IJ3B 2F5BL 3NFSH 2JIXD 1TCRB 2PR4H 4PJCE 2Q7YA 5IF0B 1ZT4B 1I9JH 3H0TA 5D7SL 5JR1L 2OYPA 3LZFH 3WLBB 3TN0B 4MA3B 3QEHA 5HYFA 3N1PC 2Q76A 3EIFA 3JUYA 4XC1L 5DJDA 3RI5F 3T77B 3FFCB 1OP5H 2HT3C 3IDXH 3KYMB 1CE1H 1Q94B 2VZSA 2BY0A 1UM5L 5HHOA 4GW5B 5J9PA 2FD6H 2GYSA 1HHHA 4KJYA 5JW4M 2DI7A 2YS4A 3LKQB 5D7JB 3HG1B 3SHSA 3NOIA 2C3VA 1CFSA 1FHGA 2JCCA 3B4NA 4LRNL 2NLJB 3IRPX 4JRXB 1M05A 2NXZD 5CSBA 2CR6A 4LNVA 3OJDB 4X8JA 4I5BA 4XNQB 3ZZ1A 1J86A 3MMEA 5I1KL 3GSQA 3KPQA 4KV5E 3SDXB 4OF8A 1T04A 1MIMH 1ZEAH 4UAOC 4HKJA 1JYNA 1C5CL 4JZNB 4PJFE 3NZHL 1G7QA 2WWKO 3CMGA 3V2AR 4LDEB 1WK0A 3DARA 1G9MC 1A4JB 3PV6B 5C0EA 5B38A 3EJYC 4NC1E 3RVXD 4GKZA 2EE6A 4YFLF 3K1DA 5JHDD 3SJVE 4OGXL 4YX2L 1JTPA 4N8VG 5FHBL 5HHMD 5ESQA 3DYPA 3QEHB 2Q76B 5DJDB 1OD7A 2PXYA 4DZBA 5GRZA 3OJVC 1MPAH 2E7BA 5J9PB 4FQXA 4KJYB 4P5MA 2YN3A 1UM4L 5T1LA 4JDTH 2C3VB 1AKJB 1CFSB 4ZPVA 3QDHA 2JCCB 5E2WH 2N7BA 3CZJA 1JK8A 5C0AD 3LKSA 1AHWC 4PGCA 4I5BB 4WFHD 4X8JB 3MMEB 5ITFA 3KPQB 2MKLC 2VQTA 3DNKA 1T04B 4Y5VC 4HKJB 2HWZL 3LDBB 3EO1A 1A7NL 4P46D 2NY7L 1A6WL 4PBXA 4PJ9C 4YIQA 2YD9A 3QFJD 3U82B 1G7QB 3ZTJH 3QAZB 1ETZA 3KPRE 1KB5A 3QDGA 3GRWA 2PYEE 3FN3A 1R3KA 3O3UN 4PREA 4XI5C 2YRLA 4LASH 3D69A 1X5HA 2YWYA 2VL5A 3MV9E 5I1HL 1QFWL 5SX4H 2OZ4L 4WHYG 2IQ9L 2RCSH 5E03A 3ULVH 2R29H 5ESQB 4J6RH 4L4TA 5GIRA 4WUUE 2ZOLB 2R1WB 2X4RA 3VMOA 2OJZL 4BQ6A 4GRMA 4DZBB 1F90H 4LLYB 1WQVT 4DUXA 1S9VB 5MEOB 1YEEL 3DRTA 5EPMA 1LE5A 3H9SA 4K2UH 3E3QC 4CVXA 1MCWM 1IGIH 2IBBA 5E70A 3L3DA 4OZHA 1HXYA 3VH8A 4LHUB 5C0BE 4C56B 3K4ZA 1JK8B 2CKBL 5I8OH 4OGYL 4NOBA 4F57H 1TPXC 3LB6C 3EYOB 4PGCB 4ZUSB 1TNNA 2VDNH 1QA9A 4NUGL 3FQXA 1QSEA 3UYRH 3IU4H 1G0YR 5EBWA 4GAJH 4HJGA 4O5LH 4S0SD 2FECI 3S35L 3EO1B 4QCIA 4YH6A 4X9IA 4NKIL 1YMHB 3ET9F 3FOLA 4Y2DD 3HNVL 4IMLA 1KB5B 5E99L 2N7AA 1CGXA 2Y07H 1GOHA 4UILH 1R3KB 1RJLB 2YXFA 4PREB 3V6OA 3TH3T 1WTGT 5CGYD 2A9ML 1PDKA 4AQOA 3FQWA 2G9HA 1AR1D 4JCMA 3EYFA 2ILLA 4UUJA 3HC3H 2MJWA 5GIRB 5I1EL 3RUGA 4NNXA 4RMSA 3GMLA 5GSRA 5EOCJ 5DT1L 4PD4K 5EZLA 3GMPA 5IT2H 3BGFB 4PRPB 3MGAA 1QBAA 5KBNC 2VLMD 3VD7A 3MBXL 1LE5B 2CGRL 4G9DA 2D4DA 4FQ2L 2GUOA 4CVXB 5ACZB 2VLJA 2CDEA 3VRLF 5D2LA 3L3DB 4F7EA 1DN0A 3RGVA 2P4AB 1TITA 1ZOXA 4WEBL 4HF5L 5IBLC 3FZUD 4V2CB 1VB9A 1FORH 4DJMA 1FYTB 1NDGA 2QSCH 5T33H 2IPUG 5SX5K 4XPAH 5I8EB 2I24N 5AZ2H 1C5BH 1G6RH 3OKNA 4FQXD 5CJQH 2BVEA 2HYMA 1QRKA 4IMLB 4U1NA 3RWGA 4UB0L 4UT7L 5JMRA 5F71A 1PX3A 4LDOB 2AABH 2G9HB 3WXWL 3EYFB 5D7KD 3ARQA 2OX5A 3MNZB 3T0EA 2EH8L 4PBVC 5FYLE 3RVTD 5GSRB 5EZLB 3IFNH 3GMPB 2XQBH 4M7LH 5I76A 1EV2E 1REIA 4QOKA 1CICD 4ZAKC 4MAYA 5F72S 2NY1B 1HH6A 1XGUA 1SMOA 1ZVYA 4G9DB 5IOPA 1DFBL 1BLNA 1BFOA 1Q72L 2VLJB 2CDEB 5T3XD 5D2LB 5DF0A 1ACYH 5F97E 1DN0B 3RGVB 5EOTA 3INUL 2Y36H 3VGEA 4BJLA 1RUQL 1MFAL 1NEUA 2A73A 5CJOH 1B0WA 3OJ2C 1NC2D 3MLUH 4X6FA 3OKNB 1X6LA 4LRIC 2V2TA 1F8TH 3H9SD 3WFBH 1IZKA 1GAFL 5FCUL 1YUHA 2Z9TA 3RIAK 3RWGB 4BA8A 1NANI 1ZLVK 4KI5D 3G6JA 1OAKL 5CWSA 3QRGL 3I6LE 4X4ZA 4OZGB 3CDFA 1PZ5A 3TYFA 3W9EA 3K2UL 3DIFB 4NZRH 3I50L 4TQEH 5ICXA 1OAUL 1ORSB 3T0EB 3RAJL 4Z76B 5FEBA 5IEKA 5FKPA 1MWAA 1QNZH 4IMKA 1OCWH 3O9WA 4RGNC 5I76B 1MF2L 1VFMA 4LVHC 3W39A 4QOKB 3FB6A 3PJSA 4MAYB 1ZK9A 3IDJA 1S9XA 4HK3N 1HH6B 4HBQA 3N0PB 1OWRM 3MODH 1MH5A 4XMPL 4H0IA 1S7TB 3VGAB 3HNSH 3VGBA 1BFOB 2DB8A 4HUWB 4Z7WA 4JAMA 3MOAH 3IJYA 5GRUH 4DCQA 3D18A 4MJ4A 3RTQD 3DX9A 1DE4A 2R0ZH 2C1OA 1DVFD 4RFOH 4G3YL 4JVPA 4X9BA 2A73B 4AG4L 1J0KA 3Q5OA 2IANE 1A14H 1L6XA 4TOYL 3RVVC 1N6QH 4UIKL 5HVGB 5SWZA 3QXDA 4MDJB 3UBXB 5C9KA 3PWPD 3HA0A 2CO7B 1YUHB 4JHAL 2VB5A 3WE6A 3FO0H 3TCLA 4APQC 5CWSB 4S1SL 4M00A 3VGFA 3KJ4B 1BMGA 1U8PA 2V7NA 3TYFB 3HB3D 1FN4A 5J3HD 5GQBA 1ZA3A 4KTEH 3UO1L 3T2OA 4QTHA 5ICXB 5D5MA 5FK9B 2NY6B 3ULUD 5DMGD 2I9TA 3O9WB 2DQHH 1QLEL 3ZDXF 4Z95L 1U2CA 1T0MA 3PL6B 5DD0L 3TIEA 2GJZA 1WCBA 1FZJB 4GG6E 3ILPB 4C58B 4D9LH 1SY6A 4Z7WB 4JAMB 3KPPB 1XCQB 2PYFA 4TSAH 1FO0L 1RD6A 2NY3D 2RB8A 3IJYB 5DO2D 4DCQB 1LGVA 1ED3A 1BM3L 2M1KA 3D18B 1J10A 1J88A 3HUJA 4IRJD 4YDIH 5FGCE 1I3RA 5F7NC 5IBTH 5FO8B 1QQDA 1WBXB 2R56H 1AXTL 5A2LH 4RISH 2OP4H 2BNQD 5SWZB 3CSGA 3QXDB 5IVXA 1EAPA 5CLWA 3T4YA 3WE6B 1RZKC 2J8UE 3THML 3ULVE 3TCLB 1WC7A 4OSUL 3DI2B 3ROOA 1U8PB 2V7NB 1O0VA 5LWYL 1FN4B 2EDTA 1IAKA 4S1RH 3HC4L 4EI5D 2EDNA 1NCWH 4QTHB 2DQTH 4P23D 1JPGA 1G7LB 2LTQC 3GHEL 4KZDH 1T0MB 4W68A 3RZWA 2AQ2A 3ZE1E 3TIEB 2BC4A 1WCBB 1WICA 1QYGL 5FUOH 2BSTA 2AJSH 4U2ZA 5ALCL 4XCEB 2PYFB 3MRHA 1UWXK 3UTPD 2VDML 4JM2A 3T1FA 4QHKI 3HUJB 1ZHNA 2H2SD 5ISZA 1I3RB 5F6IB 2M26A 4QHMB 5DA4A 1Z5LB 3MOBH 4OFVA 2ATPA 1TIUA 1I3GL 1QQDB 2YN5A 3BQUB 3PWUB 5F6HI 3GJFA 4MJIE 2F54E 2EEAA 5HGAA 2VH5H 3H7BA 5E0QA 1V3LA 4LPXA 3S96A 4PJGE 5IVXB 2MKWA 1N8ZA 3PQYA 5D93C 4P9MH 3QO0A 3GHBL 3BPNB 3TLRA 2J5LB 2W9EL 4GUPA 1TJHH 1TQBB 2OQJA 4KRMB 5EUOF 2VLKB 4QRRE 4K9EC 1IAKB 4LCWB 3WFHB 3UJIL 3D3VE 4LKXA 3P0VL 1JPGB 3T2NL 3QHZL 4G8EA 4YHLH 3FQTB 5FDWB 5C92A 3MUHL 1TJIL 4CW1A 2BC4B 4V1DD 5C09B 3U4BL 4JKPL 4GS7B 1ZGLP 5HHPA 5JPMB 2ADGB 5E8NA 4ZXBB 2BSTB 5JDSA 4CN6A 1H0DA 4RCAA 1DL7H 3MRHB 2VDRL 4DKFL 4XCCL 4CVUA 1Y6KR 5EU4A 1W72L 2VISB 25C8L 2DQEL 2WAHA 2ZUSA 4DW2L 3AAZA 5IIEB 2ATPB 15C8H 3T3PE 4ELMF 2H45A 2ZJSL 4P2QB 3QCTL 3BI9X 1HHIB 2DD8L 4OFYD 3FHQA 4LHQB 5F7UA 3H7BB 3KWWB 4R8WH 3S96B 3L3KB 4ZTPL 4NQEE 4JZJC 1N8ZB 3PQYB 4Q6IA 3ZKNC 3QO0B 2ICWJ 4LEXL 1RUAH 4TNVK 2VUYA 4GUPB 4PJEA 1UWGH 2OQJB 5E8DL 3CZFA 5E2VH 4E41A 1CCZA 1G7JB 2LAAA 1A02N 1UXSA 5JOEA 4LCIH 1LNUB 2JELH 4YUEL 3S4SA 4LKXB 3WJLA 2HT3D 2OR7A 4PJIF 1E6OH 4X98A 1JPTH 5CEYA 4HPOL 4ZD3L 3KS0J 2E6PA 5GZNC 4CW1B 1WAAF 4PRNA 1W0YT 4H0HB 2K9UA 3DRQA 3DX6A 3UC0L 4OZIE 4FFWC 4CVWA 4PV8A 5EU6D 1OTSC 4JM4H 4QXGL 2WZPD 1IGMH 5JDSB 5C08D 4FQLL 4HEPG 3OR7A 1J1OL 4ODHL 1G6VK 4TSBL 3QXVA 3NACL 5EU4B 1UFUA 3EJZC 1JI2A 1XGPA 4K3HA 1KB5H 5KSBA 3AAZB 5HPOA 3VA2C 3GRWH 4Y1AD 4GMSL 5KN5A 2DJSA 3HZMB 4HKZA 5D7JC 3O4LE 4WTWA 3BDBA 3L1OL 3IDGA 3QNXA 2OR8A 3CCHB 3LS4H 3U1SL 4P2RD 3OXRA 2VXTL 4Q6IB 3WUWG 1T5XB 4PJEB 1YEHH 3ARRA 1J11A 3DX8A 5ISZD 2EIDA 5B3NA 2AVGA 4TNWF 1LO2H 4MSWB 4Z78A 2PUQT 3SE3C 3O3BA 3S4SB 1P7KB 3W0WA 1JNHA 2X1WL 5A2IH 5CEYB 1T89A 4FFZH 5GISL 2MCPL 4BH8A 1X4ZA 2EXWC 4GH7B 1MCEA 1NUNB 4QRPA 4Q9QH 3DX6B 3JWOL 1OAYL 3FFDB 3CFJA 1UVQB 2NX5D 4K3JH 4PPTA 4R26L 4YXHL 4XNUH 3S3JA 1K3ZA 1WWCA 4KXZI 4X5WB 2P8PA 1XGPB 3IKCA 5JW3L 5GGQH 3O3AA 2FRGP 4NQDA 5KSBB 5BCAA 4XMLL 3JBG7 4PJ9D 4ODTL 5KN5B 4KHTH 5E8OB 5TDNB 1PSKL 4X7TA 4DOHE 1K9TA 3IDGB 4MAUL 2VDOH 5MENA 3QNXB 4WENB 1JGLH 5DRXA 4XI5D 2PF6A 1HKLL 2NNAB 1SBBA 3HE6A 3KYOA 4R97C 4GAFB 4O4YL 5DJCB 1KCLA 1IARB 2YMXL 3LDBC 2FH8A 1KC5H 4L9LB 1RIUH 2OBGA 4MB5A 4YWGL 1AQKL 4I2XE 4Z78B 4G6KH 4G6ML 4RAHA 1F45A 3O3BB 3V0WH 3QAZC 2ZNXA 3G5ZA 3W0WB 2HLFC 1JNHB 1HE7A 1IT9L 3VXTB 3LKPB 1T22A 2R39A 4BH8B 1LD9B 3HE7A 2RQ8A 4QRPB 3GSUB 3O11A 3CFJB 1ZAGA 3BN9C 5DMIH 4MLSA 5DXWA 2ZP0T 3MRIB 4E41D 3X14A 4J4PA 4RGOL 2IPKA 5HDBE 5FO7A 4CDHA 3ARBA 1D5MB 3EDDA 2EO1A 3JV4B 2P8PB 3IKCB 1D6EB 4NQDB 1K2DA 3T3MF 1KACB 4OCYL 5C0AE 5FYLL 4PP1C 3DJ9A 4X7TB 1A8JH 5FUCC 2NZ9C 4KDTC 5MENB 5CEZD 3PABA 1N2RA 5DRXB 1MRFL 4FQHA 1TXKA 3HE6B 1ZWIB 4PS4L 4ZSOB 2NR6C 1KB9K 1U91B 4FTVD 2DBJA 1F6LL 4Y8AA 4AT6A 5DMYA 3GBNL 2PKDA 4L8BA 7FABL 2PO6A 2APVA 4O2CB 3C8DA 3LQAC 2P1YA 4JRXE 2BRRL 4ZG1A 4R7NA 1GGBL 1YPZA 1EXUB 2X42A 5CBAA 4OCWH 1YEJL 2BOCA 3LHPH 3NFSL 1T22B 2EO9A 4KC3B 4LPVA 3VXUB 1KIQA 1YY8B 2PR4L 3O11B 2XA3A 2EXYC 1I9JL 4MGXA 4RDQG 4XVUC 2FH6A 2R2BA 3LZFL 5F88A 4Z0BH 3IDUA 4NT6A 5D6CA 2IPKB 3ARBB 1AE6H 2CSPA 5GGSY 4WO4C 1S8DA 3F7VA 4RA3A 3IDXL 1CE1L 2P46B 1K2DB 3SY0B 5DVLA 2FD6L 2CUHA 2F58H 1IAII 3D0LA 5DLMH 4JGMA 1VADA 3DVNA 2P45B 1JZ6A 3CAFA 5KG9A 5DEZA 3O2DA 1N2RB 3BJ91 1HCVA 1U95A 2VJXA 5HHOE 1CLZH 4HW6A 3REVB 2P5ED 1MWAH 2H41A 3C6LA 1H3PH 2QSTA 3G6AA 1MIML 1ZEAL 4AT6B 1U8MB 4L8BB 3EW3B 5JXEC 3RWEA 5TDPA 2C4FT 4U1SB 5CUSH 5DVKA 5CBAB 1B6DA 1X5FA 2BOCB 4ZAKD 4PRDB 4O2FB 2D0GA 5FGSA 1T1ZA 3D85D 4JFDA 1KIQB 1NGYB 3L6FA 1NCCH 3KPMA 5DK3A 2CRZA 2DWDA 4JFFA 1MEXH 2R2BB 3UJTH 1YEKH 5EULV 1JCKA 5F88B 2ICES 1MY5A 3DX7A 3NCEB 1S7UA 2ERJB 4A2LA 1NC4A 4UNTA 1PZUB 1HHKB 1QBLH 1MPAL 3CFKB 3F7VB 1IEBB 4KRPC 1YMMA 2NY1C 2ZKHH 5EDXA 4PJDA 4OD3H 3Q2CA 3SCMB 1BF2A 2D03L 5HGGS 4JDTL 5KG9B 2DIJA 5LGJA 1TVBA 3K81A 3V8OA 5K9KA 4XXCA 5E2WL 4NQCD 5FM5M 1E6JH 5I74C 1U95B 3MO1A 3T2QA 4KRNA 1J9CT 3C6LB 1CT8A 3G6AB 1OTTC 4ZMAT 1X7QA 3I6GA 1CF8L 3D9AH 4RSVA 3DV4A 2VDLH 2V17H 2YD4A 4RGND 3MREA 1SY6H 5DD3H 2K3TA 5E94A 1ZLWH 4HGKC 1T1ZB 3QNZB 3WEXA 3IFLH 3L6FB 4DAGL 1XH3A 5E7FA 3MBEC 3FO2B 3PWJA 3MLTA 2YC1B 4JFFB 5KOMC 4ZS7L 5EUOB 2RCSL 3ULVL 1ND0B 2PO6D 2R29L 3DX7B 3QDGE 4J6RL 4OM1H 1OP5K 2VITB 1KIUA 1XGYH 3CX5K 3OMZA 5IQ9A 1KSRA 3GK8H 2IF7A 5C70A 1F90L 5T3XE 2XN9A 2AV7A 2AKRA 5T5FL 3RVVD 1YMMB 5FYJU 4DZ8A 1S5HB 4AEIH 4PJDB 2ARJB 3GNMH 3BO8B 4K2UL 4L4TE 1EFXA 4KROB 3RDTC 1A9EB 1CXIA 1IGIL 3VW3H 4W6WB 4APQD 5I8OL 3WIIH 3MO1B 4J8RB 1CIUA 3C2AH 3U0TA 4F57L 1IE5A 2H26B 2VDNL 4WV1A 3UYRL 3H9SE 3IU4L 5HXMA 3MYZA 4GAJL 1MJ7H 4O5LL 1KJ2A 2XPGA 3BRGC 5EZOH 4OZHE 3I6GB 1VCAA 1AD0A 3EFDH 1JNNH 3DV4B 3P4LA 5EBLB 5I1AB 3MREB 5DYOA 1QSEE 1NMCC 3RWDA 4PR5A 5E94B 4BFEA 4HBCH 2Y07L 3WNNA 4UILL 4WFGD 3KJ4C 1NKRA 2KH2B 1LO0H 2EIZA 5L2KA 3PWJB 3MLTB 4Z7UA 4OLVH 3C60A 5MEPA 2HT2D 4EJ1C 5I1DA 3ARYA 4MD5A 3HNTH 2DQFA 2GQHA 3GJFH 3V5HB 4U2YA 3O6LH 5H35B 4MDIA 5BQ7A 3PL6C 5IQ9B 1MELA 2UZXB 2XN9B 3SQBA 4GMTL 4EI6A 4PJIB 1MCPH 3GKZA 3AMKA 2J6EA 3F5WA 3EGSB 4GOSA 4LLQB 2R8SL 3B9KC 2P24B 3RUGE 3GM8A 1L6ZA 4J7RA 2PNDA 4JO3L 5IMLA 4Y19D 2D7QA 1ZLUH 1MCSA 3U0TB 3KPSA 4WV1B 4JFHE 4I1NB 1FORL 5JW4Q 4XCNA 2QSCL 2NTFB 5T33L 1CD0A 1SYVB 1AFVH 4XPAL 3RIFK 3NGBB 1T80A 3RWIA 5AZ2L 3QDMA 1C5BL 1G6RL 4MA7H 3S9DB 4P2YA 5CJQL 3QIUA 4HLJA 1JFQH 5CKGA 3QI9C 1E28B 2UYLA 3RWDB 4PR5B 5L0QC 3I6KA 4RDQF 4P3DA 1RZGA 1G9NC 4GG8A 2EIZB 5L2KB 4ERSL 2Z31A 2Y23A 3UPAA 4Z7UB 1XGQA 3T2PA 2AABL 3C60B 4LQFH 5MEPB 4MD5B 3V52H 2DQFB 5CJXA 2FJGA 4MDIB 5GS3A 3TT3H 3DBXA 3IFNL 2XQBL 4D0DA 4M7LL 4ZFOL 3IB4A 3ROLA 2IADB 1Q9KA 2HVJA 1U6AL 1OAXH 4OCXH 3RPIA 1IEHA 5IMLB 1A47A 1ACYL 3MLPA 3EKCA 4HIHA 4H0GA 1S7SA 2HMIC 2YA1A 1KYOJ 2BNQE 5FECA 5CP7A 1HXMA 3BQUC 1NCDH 4G42A 5CJOL 5IEHA 4XCNB 3BPCB 4N90E 3MLUL 3RWIB 3QDMB 2DQIH 2DLTA 1VSCA 3Q6FA 4OAWA 2XWBA 5HVHC 1F8TL 1L4IA 1QLRA 3WFBL 4MWFA 1I3VA 3NBNA 5GGSA 4JCLA 3LPWA 2ESVB 1EEZA 4WI6A 5F1OB 2W91A 4P3DB 1QFPA 2A2QT 1MCBA 5LAXA 4OBSA 4LIQH 3BXNA 3DPBA 4HS8H 3ZKSD 3W81A 3ZT5A 2ZUXA 5IHUL 1EGJA 4RRPG 3MRGB 1QEWA 4NZRL 1EAJA 4TQEL 3RZCB 2G2RA 3PHQA 4M1DH 2O5XH 1HHGA 3G6JE 2FJGB 1QNZL 2UV3A 1OCWL 3C5ZA 2XY2A 2GIYA 4EUPA 1UB5B 5D7IE 1G7IB 5ADPL 3TVMA 1U41A 3UTPE 2GTZA 4GS7C 3ROLB 4F37K 4JLRB 3BD5A 1Q9KB 2HVJB 5GGTA 1X6NA 1BVZA 4TVPD 4ZXBC 3QUZB 3HNSL 3GSOA 3ZKND 3V4PH 1RUMH 1MCOH 4Z6AT 2QSQA 5T1KA 4HIHB 3VD4A 5J6HA 1NEZG 1LP9A 1S7SB 2DYPB 4NZTH 3VG9B 2R0ZL 4UQ3A 1HXMB 4RFOL 1JWSB 4G42B 3KR3H 1A14L 1T4KA 3A67H 3L7EB 1N6QL 2EIEA 2XWBB 1MCNA 4BELD 1GC1H 3HFMH 5ID1B 1QLRB 2AERT 1A1MA 4MWFB 3BKJH 5GGSB 4BSJA 3DO7A 1FFRA 1P6FA 5GZND 3FO0L 2R2HB 3WFEH 3ZSSA 5FGBC 4FFWD 1KFAH 3BXNB 3I9GH 3MQIA 1OTSD 2FIRT 4OZ4A 4U49A 3LKOA 1D9KA 4HJJH 5F7EH 4KTEL 1DN2A 5ICZA 4IOSD 2YD6A 3BYTA 3JWDH 3PHQB 1OM3H 3EJZD 2WIIA 1HHGB 1LO3H 2DQHL 4EUPB 5D7JD 2H9GB 1NCTA 2EDWA 3TVMB 1C1EL 4MNQA 2GTZB 5HI3C 3RWCB 1WEJH 3BD4A 5D5ME 5HYJA 4D9LL 4X0KA 4HWUA 3GSOB 5C7XH 1H8OA 5GGVY 4QXTB 4TSAL 1FRGH 2QEJA 1LP9B 2FECL 1I85A 4YDIL 4UQ3B 3GO1H 3U2SA 2Y5TB 5IBTL 4P2OC 1X44A 1X3DA 2R56L 2D9CA 5ILTH 1KJVA 4RISL 2OP4L 1A7QH 3BX7C 4YAQA 2V5TA 4GRWF 4MD4A 1ZHBA 3GIZH 3ZL4L 3DO7B 5I1LA 4GKOA 1A0QH 1F5WA 5MP6H 1LEGA 5FYKU 4OZ4B 2XKNA 5DK0B 2EKJA 3QNYA 5FA4A 3L3HA 3LRHA 1AGFB 4X7FC 4S1RL 3P11H 4H1LA 1JZ8A 4BFGA 4ETQA 1FJ1B 1NCWL 2WIIB 4PJAA 5EU6E 4KZDL 5E6YA 4KK9C 5I71B 2X10A 2VRAA 5BRZA 3SKJL 1AKJD 4MNQB 1N64H 1P9MA 1QSVA 1TZHB 2EECA 4NQVA 5HYJB 2AJSL 1DBBH 3ARGC 1QUNA 1XIWC 2RHEA 1U8NA 4G7VH 3M8OH 1HHJA 4NKDA 4N0CC 5ANME 3WBDA 3C5ZD 3D39A 3MOBL 4KGJA 2ED9A 1RZ7H 4P2RE 3TBTA 1FCCA 3KPOA 3FT2A 1KJVB 1JMZA 3RIAF 2HLFD 3SE9H 2VH5L 5CEXB 4MD4B 1ZHBB 1FIEA 5ISZE 1X5XA 5IW6A 3HHRB 4P9ML 2QL1A 5T1KD 1LEGB 5DC0A 1Q9OB 3BN9D 3MGTB 2DICA 1WZMA 2EZ0C 2XKNB 4QHLB 4DQOH 3QNYB 1TJHL 4ISVA 3LKRA 5L88H 2W38A 3L3HB 1AGCB 4H1LB 3K8LA 4I18C 4KKCD 2R0KL 4QRTB 2X4SA 4LL9A 4PJAB 4EEEA 2Q86A 5C0JA 4R90H 4YHLL 1J1XH 3O2DH 4NKOA 1U3HB 1IQWH 5BRZB 4PP1D 2NZ9D 2A6JB 3CU7A 4LHUD 4C56D 2AS5M 1I7UA 5D1QA 3ARFA 5HD8D 3S88H 5DJ2A 1DL7L 2W9LA 3STZA 1YJDC 2NR6D 3PHOA 4JO2H 1MNUH 5HSFA 2CDGA 4O02H 3AREC 2NTSP 5KZCD 4NKDB 4QNPE 2AW2A 4X4XA 5HGBA 3TO2B 15C8L 2N1KA 4F33B 3FT2B 5F9JB 2ZSVB 4JPIA 1CGUA 1U8LA 1F2XK 2XKUA 3TBVA 4WWKA 4RX4A 1MFBH 1NMAH 3G08B 1MCRA 2HG5B 2DTMH 5IESH 1RUAL 1EIBA 5ICYA 1NBYA 2EXYD 3DUHA 4MLIA 4NO3A 4XVUD 1UWGL 2A74A 2ICCA 3B9DA 4KAQH 3AROA 2BSSB 4JRYA 5AUMB 1UA6H 1UXWB 3LKRB 5E2VL 3FB8B 4I3GA 1A3QA 1WITA 1MLCB 4ORGB 4LCIL 4WO4D 1UH3A 4XVJH 4EOWH 2JELL 4KUCF 4PRPD 3ZHDA 3P30H 1KOAA 1SMAA 3WKMH 2WBJA 4J3SA 1RZFH 4I3RL 1E6OL 1NLBH 5C0JB 1YQVH 1JPTL 5DVMA 4U1GC 2HTKC 4NKOB 5FM4A 4N0UE 4E41E 1CQYA 3BN3B 4Q9CA 1EJOH 1MUJA 1I7UB 5LKNA 1HWGB 3ARFB 1IGML 1EERB 4YFEA 4XVTH 3MRJB 5DJYA 3STZB 5CKAA 1FYTD 2RFXA 4HIJA 2ED8A 3PHOB 1HILA 2CDGB 5FF6A 2KKQA 3U0WH 1T1XA 4X4XB 5HGBB 1KB5L 1MFEH 3BPLB 4KJPC 4LLUA 2BJMH 4IM8A 5D2NA 3GRWL 5JXED 4XB8A 2XA8H 5GS2D 1NMBH 3LEVH 5D8JH 5E6IA 2FL5A 3TPUA 1BVKB 1CYGA 2CIIA 4FTVE 1U8LB 3JSSA 3LS4L 5DS8B 4WWKB 3TBVB 3MA7A 1BVLA 1CGWA 3B9KA 4U1KA 4HIIB 5ICYB 1NBYB 4M43H 4NQXB 5I66A 3EDFA 1YEHL 4D2NA 2A74B 4OB5H 3RVUC 1INQA 2HLAB 1LO2L 3ZHLA 1J05A 4XNZC 4L3CB 3NIFE 4KRPD 2NY1D 3HR5B 1AY1H 1IZJA 4M48H 4ZQKA 4XMKL 1GRWA 1ZS8A 1BJMA 4FFZL 3MRBB 4U31A 2OCFD 3QI9A 4IOIA 4Q9QL 4LK4A 3IU3A 1INDH 1EJ6A 5DC9B 4K3JL 1MUJB 3DVFA 4FXGA 5KOVC 2R69H 4MA1B 1KJ2H 2ERJC 4AH2A 1FVEB 4XNUL 4DUVA 3K8KA 2RFXB 2IBGA 4HIJB 1HILB 1OTTD 1WWWX 3LD8B 4QRPE 5DJ0A 1JF5A 5D2NB 3VXPA 5LGHH 3SCMC 3OAZH 4TVPH 5HHNB 2FL5B 3LIZH 2P5EE 2VDOL 3QG7H 2GI7A 4WEMB 1ZMYA 5DFWH 1JGLL 3NIDF 3MA7B 4QHUB 1BVLB 1P7QB 4PYGA 3RVWC 1PAMA 3MBED 5SWSA 4JFQA 2HFEA 1WIUA 5I66B 2FYYA 2GJ6D 1KC5L 3GSXB 3DHJA 1JWMA 4TUJA 1GGYA 5TE7H 4G6KL 2J6EH 3K80A 1DDHA 4P59H 2IPTH 3V0WL 3ZLQC 5ENWA 3C2SA 3ZE0F 4FZEH 3CXHK 3O3EA 1QR1B 4ZQKB 2I26N 3BKMH 1AH1A 4L3EB 4FQIH 4Z7QF 4U3XA 5J1AB 3RDTD 2QR0B 3IU3B 1QD0A 4XRCA 5E00A 2MHAA 3PP3H 4WU7B 3RWHA 2EE3A 4FXGB 3MJ9A 3B8YA 5DMIL 5FB8A 1HIMH 4AH2B 5F7YC 4J3VA 3RJQB 4KHXH 4QRUA 4Z7VA 4WTXA 1S78C 3FQUA 4NQCE 3VXPB 1R3JA 3KNBA 4WIQA 4PY7A 5AYQA 1A6TA 1FIGH 4TNVF 4Y4HB 4NJ9H 4EXKA 3MV7B 2E9IA 4TSCH 1ZHLA 1U2HA 5SWSB 4QEGA 4I0CC 1ONQA 5ESAA 5I75C 1I9EA 2HFEB 4RGNE 3EAKA 3ARZA 4TUJB 4UI2A 1DDHB 3UPCA 4QLRA 1J0ZA 4UV4H 3PL6D 4AK1A 5ENWB 3FT4B 5AG8A 3QZWA 5E9DA 3SKMA 1DQLH 4OCWL 4OZFA 3KG5A 3LHPL 1CZ8H 3MUGB 3B9KD 3P9MA 4LPTA 4Q2ZA 1UEMA 4XRCB 4G8FB 2MHAB 1IJ9A 5ETUA 1YPZE 1I9IH 1AO7A 5FB8B 4WGVB 2EEDA 3ECBA 4Z0BL 2J2ZA 5FYJH 4I13B 2KQMA 1AE6L 4Z7VB 3FQUB 4PJ5A 2F58L 4LAQH 3HAEG 3KNBB 1AIFB 4PY7B 5DLML 2ATKA 3QI9D 1A6TB 4NO5A 4MB3A 1R5VA 1EGJH 4ONHA 4M6OH 2YK1H 5EC1B 4O51A 2X2YA 4XX1E 1QZ1A 1CLZL 5LGKA 4YEEA 1MWAL 1ONQB 5ESAB 1KPVA 1H3PL 2VZ3A 2DM4A 3NGBC 4EUPH 2GY5A 3TPKA 5IB2A 2JJSA 1RZIA 2IMMA 4WFGE 3L3IA 2JB6A 1NAMA 3P9WB 5I18H 3A0OA 5GGTH 5CUSL 3VWKC 1R0AL 1QBMH 5E9DB 3UMTA 4OZFB 2WP3T 1JWUA 4KJWC 2AEWA 4M6MH 1WVZA 2MQCA 4UTAH 4UDTA 3P9MB 1GZPB 1VKXA 1NCCL 3K2MC 3TH4T 1WT5C 4OUUB 3V5KB 4PG9B 3GB7A 5IQ7H 1MEXL 3UJTL 1AO7B 5HYEA 1KTRL 4LSQH 3ECBB 2HMID 3ARTA 1FZKA 2FWOB 3CH1A 2PETA 3BQUD 4JFDE 5D96B 1QBLL 1BD2B 3GGWA 5CHNA 3MJ7A 1XGTA 5IHBA 3SDCC 4M5ZL 3DGCR 4Y19E 4HZAA 4PJ5B 2ZKHL 4OM0L 4XCFH 4OD3L 1MI5A 2ATKB 3O81A 1KTLA 1R5VB 3O6KH 3V4UH 5F70A 4Y4KA 1DR9A 2IGFH 5F1NB 1E6JL 5F9WC 4PJBA 2VLKD 5KSAC 2X4TA 3DROB 3W5MA 4LCWD 4I0PC 2ITDA 5E2TH 2VLLA 2DM2A 1PG7X 5IB2B 2E27H 2R2CA 3MRMA 3H2WA 3MACH 1RZIB 4QWWD 3D9AL 3L3IB 2JB6B 3F58H 1FP5A 5KTEH 4HWEH 2V17L 4XPGH 4MX7A 5C2UB 1SY6L 4M3JA 5DD3L 1Y6MR 2F9BT 2VN4A 5C09D 2VZVA 5DRWA 2X4UB 1A4KB 4ZXBD 3IFLL 1VKXB 1ZT7A 3QIWB 5IFJA 1OW0C 3SDDB 3U7AA 3RZCC 4YC2B 4YLQT 4F80A 1ZA6A 1GGUA 2DQCH 2NXYB 2QQNL 1A22B 1LDPH 5D1XA 4OM1L 2YXMA 1P84J 1FZKB 3CH1B 1XGYL 4MJ5B 3MZTA 3GK8L 4P2QD 3IVKA 4I18A 3N1QC 4FNLH 2B1AH 4LLAA 3FAXA 4AMKH 2E7HA 2UWEF 3SGJC 4AEIL 1OOAA 3I3DA 3QUZC 1MI5B 2B4CH 2J4WH 3GNML 2YRZA 5F9OH 1MHCB 3OKDA 1KTLB 3MRFB 4N8VA 1ZVSA 3VW3L 4H1LH 4PJXA 2IJ0C 4Y4KB 5L7XH 4GXUN 3VG9C 3WIIL 3C2AL 4RWYH 3Q5TA 5DUMH 1OQOA 3P2TA 4NO0A 5F1KC 5TDOA 1MJ7L 1NBVH 3QEQB 4MD0A 4IHOA 4Z0XB 2F74A 5EZOL 3NCMA 1KCKA 5AD0A 3EFDL 1JNNL 3H3PH 5IV2A 1UKSA 4NRZA 3VXSA 5IGXL 4XP6H 2B0SH 1MRCH 2VXQL 4HBCL 3NFPB 5HI3D 3HPLA 1OPGH 5E5RB 4PP2A 3LN4A 1LO0L 3TBWA 1KB9J 1ZT7B 3BP5A 5GRXG 5IFJB 1QRNA 1U8KB 1JVKA 5ACMA 4OLVL 4CMMA 1ZA6B 2Q87A 3HNTL 5D1XB 4J3OC 3O6LL 3LKNA 5ADOH 5CINH 4P2OD 4TVPE 4KKBC 3IVKB 1L7IH 4YQXH 5T5NG 3CFIC 1QPPA 1MCPL 1T0NA 1T83C 1OSZA 4K7PX 3T0VA 4NCC2 3OKMB 5JORA 1A3LH 3HS0A 3OKDB 4N8VB 5KSVA 1ZVSB 3MUZ1 3X13A 1XCTA 3L3OB 4M9PA 1FH5H 4JQVA 4NO0B 3FO9A 5TDOB 4OFDA 1AFVL 4IHOB 1JTOA 2F74B 1Z0MA 4GQPH 3IJHB 4LNRA 1H3VA 3GBMH 4J1UA 4MA7L 4RGMB 3RWJB 5BJTA 4YHNB 1MHEA 5HYSB 1JFQL 4NRZB 1S9WA 3VXSB 3KPSE 5TPWH 4KK9D 1ZLWK 1PYWA 1WZLA 2C4XA 3IRZA 3HPLB 2Y72A 5DJ6A 4PP2B 3LN4B 3TBWB 3BP5B 1QRNB 3L3GA 4L4JA 3RU8H 1WISA 1BGXH 3ARGD 1XIWD 4PGBA 5DHYB 3F62A 3GMQA 4CMMB 3TH2T 5HDLA 5CZXC 4G8GD 1NCAL 1XFPA 5E8PB 4N0CD 5IMKB 3TT3L 4HIEB 4C4KT 2EDXA 1CDIA 3UTSD 3C5SA 5DSCA 3PDDA 1OSZB 5HJ3B 1MCWW 1OAXL 1SQ2N 2AEPH 2P8MA 5F7KC 4OCXL 1FQ9C 3H42H 5KSVB 2XRAH 2J8OA 4AL8H 1XCTB 1S9YA 1KENH 3H9HA 5DD5H 4HGWA 2APWA 2EZ0D 4YO0A 3WS3B 3O2WH 4KMQA 5KVFH 3FO9B 3MXVH 2BOBB 1NCDL 2XZAH 3GJEA 1Q9LA 3HI6H 4YHZH 3FRUA 3TV3H 4PRHB 3JZ7A 4JFOA 2DQIL 5F7WC 5CMAA 4J1UB 5BJTB 2V9QA 1MHEB 5FYKH 5HGHA 5JLZB 1S9WB 4NYLA 2H3NA 5A3IC 1PYWB 4WW2B 1WWAX 2KUTA 4J3TA 3LN9A 1OP3H 1QSFA 3K4DA 5FYJE 1EEQA 4HS8L 3SDAA 4DEPB 4U1HA 3L3GB 3P9LB 3GJFK 3GMQB 3FQRA 5HVWA 3ARED 1B0RB 1FG9C 3MV8A 4L4VD 4M1DL 2O5XL 4MCYA 4JO1H 2QADC 4X6BB 4I48A 4HIXH 2YUWA 3M1BA 4Y88A 2R0LH 4HGMA 1FO0B 4X5XA 3A6OA 4YPGA 3ZDYE 2JTDA 2BNUA 1ZLUK 2YPLB 3MRLA 5DA0B 1T7WA 3V4PL 1RUML 1MCOL 2EDEA 3H9HB 4A2MA 4HGWB 4RMUA 4NZTL 2DQUH 2AJZA 1MLBB 5IW1A 3KR3L 1NLDH 5J8OA 3GJEB 1BJ1J 5D7SH 3A67L 4WY7H 3IAGC 2D7OA 1LP9E 1F42A 1GC1L 3HFML 5HGHB 1KEMH 4NYLB 3BKJL 2H3NB 2HTKD 3VXUD 3T8XA 5DMKA 3TO4B 5DRZA 3WFEL 3L5IA 4U1JA 3WO4B 2ICWA 1QSFB 1KFAL 3I9GL 4U1HB 1AC6A 1TLKA 3EFFA 4HJJL 1E4WH 1ZANH 4NKMB 5F7EL 1J0YA 3BH9A 3IJSB 4PJ8B 3JWDL 4PJFA 2HJKA 3MV8B 1LO3L 4CADA 4MCYB 4KJPD 2FX8H 1BF8A 4OFKA 4L3AA 5CZVH 3QSKB 1IKFH 1FNSH 4I48B 2QQQA 4M7ZB 4GG6F 1WEJL 1U42A 5MHSD 4PJCB 2NY2B 1YNLH 1W72A 3SJVA 2WUBH 3TM6A 1UQSA 3MRLB 4YBQC 5C7XL 5GGVH 1G9EA 4UBDC 4X99A 1FRGL 3GDBA 3RIFF 4JPVH 1A5FH 3RVUD 3FRPG 5IW1B 3GO1L 5I8KH 3KXFA 4NN5C 4HS6B 3VGGA 1KLGB 1SJHA 2OTPA 4A6YA 4YX2H 5ILTL 2VSDA 1QFOA 4BSVB 1S7QA 3GIZL 5EU7C 1M7DA 3MJ9H 4IIQC 3VI4E 1L0QA 5BW7A 4P4RA 3T8XB 4R7DB 5DMKB 5DRZB 5DJZB 2EE9A 4JFZH 3ULVF 3QJHA 1A0QL 3TZVC 4ETYA 1UM4H 4OF7A 4PRAA 5E5MA 2Y6SC 3P11L 4PGJA 1T66C 3WIHA 5T3ZD 3BH9B 1AGBA 4PJFB 4CADB 3LOWA 1MJJA 3SCMD 3ZE2F 3ZE1F 3OKOA 2PYEA 2P7TA 3MA9H 3BW9B 4MXVE 1N64L 2JJTA 3SGKC 5C0NC 4MA1C 4OBRA 3SDAD 1W72B 1FFNB 3SJVB 4NC2B 1DBBL 3JV6B 5LCVL 2BHZA 4G7VL 5BRZE 4X99B 5KVMC 3M8OL 1DUYB 3FONA 2X40A 3UTTA 4OZFH 3CFDA 4H26A 3BP4A 1YEGH 1KGCE 3EO0B 2OSLB 1RZ7L 1SJHB 1U92B 5C0RH 5HY9A 2M8XA 4U6TA 3VWJC 1UWEH 3SE9L 1M71A 4Y16B 3MUY1 4X6DF 4KKNA 4P4RB 3D39E 1T2QH 4K55A 4UIMA 2ZSWA 3G9AB 4DQOL 4UOJA 1FL5B 4MZ2A 5EOCH 3Q3GA 1ZVHA 5L88L 5E5MB 4GKNA 2FGZA 3IGAA 1AGBB 2X70A 4LPWA 4JGUA 1S78D 1LO4H 3EYSH 4F37F 2J12B 4R90L 2Y7QA 1MJJB 3KPRB 1J1XL 5F3BB 3O2DL 1RZ8A 1IQWL 3OKOB 2PYEB 3GSWA 1OT2A 2EYSA 4WI4A 3BIKA 2ENYA 1MHHA 5IWLC 2H1PH 2DL9A 1TTFA 1UYWH 3MV9B 3MYJA 3N1MC 3S88L 2CLVA 2W0KA 4L1DA 1JZ3A 2QHRH 5D71H 1NAMH 4WUUB 5IB1A 1MNUL 4O02L 1EUTA 3CFDB 3BP4B 2O5ZH 4P5TA 1I75A 2Y5EA 4YBLB 3ZKXB 4ZOEA 1B9ZA 4ZUWB 3WNPA 3QH3A 3NCFB 4DVBB 1KG0B 4Y4HC 3WCYA 2GJ6E 1SJXA 3VXMA 1MFBL 1NMAL 4B50A 5C0BB 2DTML 5IESL 1T20B 1KIRA 1HSAA 4HLZG 2XTLA 3TT1L 1QVOA 1FLRH 4KAQL 1YC7A 2Z92A 1UA6L 4GKNB 4G80B 4PTUB 4LU5H 4LBEA 2X70B 4XVJL 1HQ4B 4EOWL 5E56A 4D0BA 3P30L 4UOW0 3WKML 2VIRA 1NLBL 1YQVL 3D0VB 3W5NA 1RZ8B 4JRYE 1M4KA 3GSWB 1XZ0B 3IF1A 2KZ1B 3IS1X 5E6ZA 1MHHB 4XP4H 2W1NA 5CP3A 1EJOL 4L8SA 3MYJB 5B8CB 4XVTL 2CLVB 4WFFD 5EIVA 3MTRA 1OAZH 5IB1B 3IXTA 2ZWLT 3QG6A 4OD2A 1AXSA 4POYA 3AC0A 4Y5XB 3U0WL 2FEEI 1MFEL 1Z9LA 2BJML 1F02I 2DRUA 3ES6A 2XA8L 1NMBL 3LEVL 5TE4L 1B88A 2BXZA 3VWKD 3QH3B 3T4AA 3LY6A 5D8JL 1TVDA 4KJWD 2X9XA 1DBJH 2Y4SA 5HBBA 2GSGA 3G6DH 3DGGB 2ICWI 4YJZL 1KJ3H 2AEIT 1PGRB 1KPRB 4IRSA 4OFIA 4M43L 3R0MA 3ETBF 4OB5L 4KPHH 4QXWA 5BV7C 1TVHB 3KPLA 1FYHB 1XF1A 3WFDH 1ZV5A 4LDLB 2IFGA 3SDCD 1RUQH 2VIRB 1JV5A 1AY1L 4LHUG 1K8DB 1P5UA 4HUVA 4H88H 3IF1B 1YEDB 5CSZA 3I3BA 1INDL 4HX1A 1TTGA 2R69L 1KJ2L 2IAMC 4PGEB 4C83B 5KSAD 4X5LA 3G5VB 1WIPA 1KCVL 5D96C 3VRIA 3PGDA 4I0PD 3IXTB 1H3XA 3QG6B 3U7WH 3DUSA 1DEEA 4TUOA 3CDGA 4MHHG 3QDJA 3OKKA 4RZCB 5LGHL 1ZLSH 1IC1A 5F89A 1O7SA 1H3TA 3ES6B 2ESVD 3T4AB 4TVPL 3LIZL 1DBAH 4AIZA 3G04B 5K9OB 2HJFA 4RWHA 3QG7L 5J12B 2GSGB 2A6KA 1EK3A 5A2FA 3L5HA 3L5WB 3S5LB 3RZCD 1PJ9A 5TH2A 2HTLC 3UXFA 3WL9A 3WD5H 3KPLB 2IANA 1RJYB 5TE7L 1YDPA 2J6EL 2YBRB 4P59L 2IPTL 3W9DA 3DSFH 4P3CH 5HI4C 4WHYH 4FZEL 4WTZG 5IHZB 4HUVB 4G3YH 2ZUQC 4P4KA 1A3RH 4U3HA 2AK4A 3QUZD 4F3FA 5C6WH 1KCUH 1XR8B 3BKML 3BE1H 3JTSA 3QIWC 4QYOB 3SDDC 3WUWA 4FQIL 4UINH 5CSZB 3BEWB 1G1YA 5DDHA 1MCIA 2DYPD 4HX1B 1JZ2A 4K23H 1HIML 3MFGB 4OCSH 2FX7H 3JV5A 4HV8B 3UZVB 3HZYA 4WU5A 2F5AH 3IDIA 3DUSB 4FP8H 3DVGA 1EO8H 4LLVB 3CDGB 1IL1B 2C3GA 4NBXB 2APXA 1U58A 3PG2A 1RHHA 3VJ6B 4FA8A 2HJLB 2DQGH 4AIZB 1FIGL 3NPZB 2A6KB 4LSPH 4G6FB 4NJ9L 3U30C 1BIIA 2A83A 2R1XA 5DURB 4TSCL 1U8JA 1PBYA 3MRQA 4OJFH 4XBGA 2DLHA 2OXHA 4FRWA 4F7PA 3WL9B 1KPUA 2IANB 1CIDA 1YDPB 3BGMA 3HLAA 4R4BA 4UV4L 4KKBD 5DR5H 4U33A 2BERA 3SDXF 1DQLL 5D1ZB 3NFNA 1V3MA 2QSVA 3CLEH 2GJJA 3DHMA 4P4KB 2AK4B 1CZ8L 2J8UA 3TA3C 3CPLB 4FQ1H 3PHSA 5DDHB 1I9IL 3KDMA 3AVEA 1X4XA 4CJ0A 1IAMA 1MJ8L 4WHDA 5FYJL 4G8IA 1CE6A 1SBSH 3HZYB 4JJ5A 4YDLB 3THMH 3IDIB 1I4FB 3DVGB 4KKAC 3O41B 4NN6C 5GJSH 3OAZK 5C9JB 1U58B 4NC0B 1RHHB 1SYSA 3BZFA 2XV6B 4LAQL 4YR6A 3ZT6A 4GG6B 3MXWH 1RZJH 3WNLA 1EGJL 3O0RH 4HUXA 4M6OL 2YK1L 3C9NA 5LBSH 5DQJA 1U8JB 3AM8C 3MRQB 2OJEA 4XBGB 5FGCB 3BP7A 2A0LC 4NRXA 1QYGH 2JCCF 1DLHB 1A2YA 3QDJD 1D7FA 5ALCH 4CN1A 3BGMB 3HLAB 4R4BB 3TNMB 4JDZA 3SE4C 4MJIA 3WN5A 3BEVA 5I18L 5GGTL 2YOCA 2ZCHH 1QBML 4PJGA 1QO3A 4M6ML 3NFNB 1Z3GH 2YD8A 5TQ0H 5A1AA 3MLVH 4UTAL 3TESA 4CMHC 2J8UB 3PP3K 4XHJC 1FZOA 1MRDH 3RX7A 5HPMB 2AXGA 1MCHA 1I1AC 3KDMB 3V5DA 4HXBH 5IQ7L 3BD3A 4QRRA 1EHAA 1AD9A 4LSQL 2BXYA 2UY7A 4LCCC 4OGAC 3QUMA 4X6EA 4JJ5B 3UBXG 1F58H 3VRLE 3HMWH 4FQJH 3QCVH 2W9EH 2X05A 2ZG2A 3O8XC 3MR9A 3QQ4A 2NY5C 4W4NA 3TWCL 1SYSB 3BZFB 2E7LC 2ZCKL 4XCFL 4M3KB 2NY4D 4LGSB 1IQDB 4NJAL 3VU2A 3ZKMD 3EOAB 3O6KL 3CVIH 3V4UL 2IGFL 3C9NB 5J0BA 2AJ3A 3PV7A 2KPNA 2E9WA 1BQSA 2J7LA 4NUJA 5E2TL 1N5AA 4NRXB 5B39G 2VNCA 2E27L 1SHMA 1K4DA 3MACL 2QADD 3KS0H 4MJIB 3BEVB 3WN5B 4PJBE 4XCCH 2F54B 5KTEL 2E6JA 2YR3A 4HWEL 4XPGL 2DL2A 1W72H 2D3VA 4PJGB 1QO3B 3DV6B 4NQEA 4DW2H 2Z91B 3MROB 4G8GE 1UH2A 3KHOA 2AXGB 3H9YA 3V5DB 2DQCL 4QRRB 1AD9B 4A6YH 5DHVA 2R23A 3UTSE 3D3VB 4OCLC 3ZSTA 1XF2B 1CL7I 1A1OA 1VFAB 3CXHJ 3L3JB 3EYQD 5BMFH 4FNLL 4ZYKA 2B1AL 3QWRA 1I1CA 3MR9B 4ONFH 4AMKL 2XOTA 5I30H 3DMMC 2I07B 2B4CL 2J4WL 5JMOC 2ZUWA 4YUEH 4OZIA 5F9OL 5L8KB 3D48R 3WIHH 5GS1A 5L7XL 3KPNA 1YQ2A 4K07A 4RWYL 1BZQK 1G6RB 5DUML 3N06B 4NUJB 1N5AB 1NBVL 4OZHF 3QPXH 1K4DB 3DTXA 4PJXE 2FDBP 3V79C 2FJFA 3H3PL 5IW3A 5CD3B 1RVFH 4XP6L 2B0SL 3TO4C 2GK0B 3VGDA 1MRCL 5J13B 3V6FA 1HK6A 4NQEB 1OPGL 1KXVC 5J4MA 2G5RA 5IG7A 4GMSH 3VCLB 3LV3A 4L4VE 5JNYA 4FMKA 4YBQD 5E4EC 3BKYH 3L95A 2NY0B 4UBDD 2C1PA 4PJ8C 5EORH 4D8PA 4Q97A 2Q3AA 43CAB 2X4OB 2JIXA 4D0CA 2XQYG 3DUUB 4JY6B 4EVNB 5CZKA 2VZTA 1FVDB 5ADOL 2APBA 3BUYB 5CINL 5K9JH 2ITCA 1L7IL 2X4PA 4DGYH 3IYLW 1V05A 1YNTA 2AK1H 2K1MA 2HT4C 3RUGF 2MPAH 5JIHA 4OLUH 4OZIB 1A3LL 5ID0A 4LVOB 4Y4FB 3TZVD 4M1CC 4YGVA 4LLMA 4Z77A 5BS0A 2E9JA 5TQ2H 1FH5L 4RFNB 3NA9L 1R3HA 1CFNA 2OTUA 1T66D 4LKCB 4OLZH 5D2LF 4OI8A 1G0DA 3QRFM 4BH7A 3QBTB 3DTXB 3QIBB 4O00A 4AIXA 3GBML 3O4LB 5DD6A 1GHFH 2FJFB 4NRYA 5F96H 1DQTA 5TPWL 1E4JA 3JVGC 4ZFFA 4MQ7A 1RV6X 5JPNB 5IG7B 2ZCLH 5C0ND 4IEFB 2WBKA 5JNYB 1GOGA 1PSKH 3ZDXE 4U6YA 1IRAY 2XT1B 3RU8L 1BGXL 2LU3A 4CL7A 5I1GL 3L95B 2EDJA 5I16A 1B90A 4D8PB 4XNMA 1S5IH 2X5PA 3OSKA 4Q0XL 3VXRA 5GS0C 2JIXB 4D0CB 2KQNA 1HKLH 5T1DH 4WI2A 2JB5L 5JHDA 2VC2H 5MHSE 1T7YA 3AS3A 2X4PB 4ALAL 4KGLA 3VWJD 1HDMA 2BY3A 1NUFA 2AEPL 1P7QD 3H42L 4JREB 4HPYH 2XRAL 5ID0B 4AL8L 1RURH 4EDXB 1KENL 5DD5L 4YGVB 1LDSA 4LLMB 2YD5A 4Z77B 3LQZA 5EO0B 3O2WL 2WINA 4L1HA 5EFIB 5KVFL 3MXVL 1NBQA 1CFNB 2OTUB 5EBMA 1C7TA 3HI6L 4YHZL 3TV3L 1S7RA 5JQ6H 4XP5H 4BH7B 5C0AA 4Y16C 4DOHB 5DD6B 4JQXA 4NRYB 5FYKL 5CP3H 4L3ED 5DC4B 4W4OC 4ODWB 4ZFFB 4WDIA 5CCKH 4MQ7B 3GMOA 4NNPH 5T3ZE 4JN2B 4OI9A 4P46A 4QO1A 5A16A 5C0CD 3QFJA 2CQVA 3QO1B 4JB9H 2PCPA 4U6YB 4PV9B 2VLRD 1JP5A 4OIIH 3AFLA 2P44B 3CVHA 4I2XB 3AS0A 3G6JF 5IK3A 4LF3A 5JHDB 4JO1L 2LV4A 2Y9RT 1CDHA 1K8IB 4RMVA 2HVKB 3FCTA 2HRLA 5L8JB 4W6YB 2FSEA 4HIXL 1RFDH 4XWOC 3TIDA 2CXKA 2R0LL 3N1GC 4Y4HD 3VFMA 2BRRH 1N6UA 2WWMC 4RQQA 4HK3J 3D2UB 3WKNA 3VFRA 4O58H 3LEXB 4XCYA 3P4MA 1PX4A 4Y5YC 1CFTB 3S37H 4F8QA 5FO9B 5E8EB 2DQUL 3MFFB 3WDHA 43C9A 3VRJA 3ZKXC 2HRPH 4Z7WF 1NLDL 4RFEA 1S7RB 1L7TH 4WY7L 5C0AB 1ZSDA 1ERNA 3G5XA 1AC0A 5IJKC 1F4HA 2FJHA 1KEML 3NIGF 4HQQH 1B2WH 2H32A 1QPXA 3KLHC 4KI1A 1FZMA 3MCLH 4AM0A 4P46B 4KDWA 4HKBA 3K7UA 5BS0D 3V6ZA 3QFJB 5FA3B 2PCPB 1NBZA 1TDQA 1TQCC 1V3KA 5F7HA 1XR9B 1E4WL 4Y2DA 1CL7H 1ZANL 2DTSA 4MCZA 4MYWB 4CKVX 1C08B 2YD3A 3ARDB 3MLSH 3LPFA 3JWOC 2FX8L 1X4YA 5CZVL 2Z93A 3FCTB 4OF6A 1IKFL 3FO1A 1FNSL 1I1YB 3P4NB 5D5MF 3PWLA 3OGCA 3VFMB 5B8CC 4M5YL 4RRPA 1YNLL 1BP3B 2WUBL 4ELME 3VFRB 3TA3A 1HKFA 4XCYB 5GGVL 5FUZH 3P4MB 5HYIA 4JHWH 3RNQA 4PG2A 1OAQH 4X4ME 3VXRD 4LARH 4JPVL 5D7LD 1A5FL 3D87B 2NZIA 3VRJB 5I8KL 4H8WC 1NCUA 2Q7YB 3B2VH 3H0TB 1UZ8A 1ZSDB 1G7HA 3G5XB 4G5ZH 3HUJF 1P4BH 4M7LT 2BK8A 3RPKA 2FJHB 2H32B 3MJ9L 1OP3K 2EYTA 1NEZA 3PIQA 4CDGC 3KXFE 5IUSA 1URLA 4JFZL 1FZMB 5HHOB 4AM0B 4HKBB 4ONGL 1HHHB 1LK3H 3V6ZB 1NJ9A 2D03H 5IROC 5IVXF 2IAMD 4Y2DB 3SOBL 1NSNH 1BZ7A 1Q0XH 1WAAE 4WW1A 1HCFX 5BXFA 3IKKA 4MNHA 2W92A 4DTGH 1M05B 2YSSA 1JF6A 2ED7A 4YK4B 3T65A 3QR2A 3GSQB 2Z93B 1BOGA 3WNOA 3B8SA 4OLYH 5I6XB 1R3IH 2AV1A 3FO1B 2D9QB 4WFFE 3HR6A 3MA9L 3O4OB 1WBYA 4TRPH 1A7PH 2VDPH 1CF8H 4P99A 4L5FH 4G6JL 3WJJC 2GW5A 5C0EB 1CICA 5J1TC 2UVFA 5B38B 3O6MH 3QUXC 4WFEE 1I8MA 1HZHH 4GKZB 2HTLD 2P47B 4BK5A 4DAGH 4XBPA 1YEGL 1FL3A 4FXLA 4CAGA 4HH9A 4ZS7H 2BHYA 5HI4D 4JM2F 5C0RL 1UWEL 5J12C 2DIAA 1WCQA 4FXKA 2BY2A 3QA3A 2PXYB 3R8BB 2E7LA 2CH8A 3UTTE 1NEZB 4CUCA 3QIWD 3PIQB 3SDDD 1NC2A 5T5FH 1OL0A 4WUKH 1J8KA 1T2QL 3HI1A 1MFDH 3JUZA 4FQXB 2WQ8A 1NJ9B 2IQAA 4P5MB 5EOCL 3QUKA 5T1LB 3GSRA 3Q48A 1S3KH 4ZPVB 5BXFB 1PEZA 3CJJA 4MNHB 1IGFH 3LKSB 2YEZA 3UTQA 3SBWA 4TTDC 1LO4L 5ITFB 3EYSL 1R6VA 5AYUH 1BOGB 2AV1B 1I3UA 1XF3A 2H1PL 1UYWL 4YIQB 1U3YA 2MQ3A 2EC9U 1ETZB 1CICB 2QHRL 3QDGB 5D71L 1NAML 2BNRD 3MX0A 3QEQD 4JE4B 4YHPA 4QNPF 4QTIL 2E7CA 5B3JF 5C07D 3WXVH 4XBPB 3D69B 1FL3B 3KYAA 1DBKH 2O5ZL 2VL5B 3TBYA 3P77A 1YYMH 4ODSH 3OXSA 1H3UA 3E2HB 1JGUH 3RTQA 2OR9H 4L4TB 3LAFA 4I4WA 4FXKB 3QA3B 2X4RB 2C3WA 1DVFA 4P9HH 1N59A 4GRMB 3TA3D 4GMTH 1JZ4A 5J57B 3QUMH 3OG4B 5KVEH 3DRTB 1NGZA 5DFTA 5EPMB 4I0KA 3BZ4A 3H9SB 1FLRL 3PWPA 2R8SH 2IQAB 3QUKB 2E9BA 4RAVA 3O6FC 3IAQA 4GRLC 4JO3H 4B0MM 4KUCD 3B6SA 4LU5L 4OZHB 3VXME 1HXYB 3VH8B 4ZNCD 4QF1A 2XG5A 5L2JA 3RY6A 4KKAD 1PFCA 1JMXA 5D1ZC 2YEZB 5J11B 4OQTA 1A6PA 5DEGA 2BVTA 4PJEF 5JHLL 1KLFA 1QA9B 3FQXB 1QSEB 1K85A 2P42B 4HS3A 5EBWB 2ZG1A 3QQNA 4HJGB 4OD1H 4N5UA 4YHMH 2Z4QA 4QCIB 2O26U 4XP4L 4YGAB 3T3ME 2EEBA 2F15A 3FOLB 4OUOA 1DCLA 1BREA 3CFBA 4ZPTA 2OI9B 4LPUA 1OAZL 4R0LC 2A0LD 4YHPB 4MJ2A 4F9PC 4XBEH 4ERSH 5IVZA 2VAAA 3FQWB 3P77B 3IFOA 3OXSB 1CQKA 4IRJA 4UUJB 3RTQB 1W8OA 3QUYC 3CFEA 5E95B 3RUGB 1DBJL 4NNXB 1DVFB 3GMLB 3G6DL 4GT7A 5KSBF 4XHJD 5DHVH 1KJ3L 1ITBB 2W59A 2QQKH 2BNQA 4RAUA 5TE6H 1I1AD 4M93B 2G75A 2VZOA 3BZ4B 3EYUH 1U6AH 4KPHL 1GL4B 2GUOB 4OGAD 1CXHA 3BZDA 3B6SB 1H8SA 4RMWA 4GW4A 4F7EB 3ABZA 2YD1A 3NIFF 5L2JB 2BRQA 1YNKH 3WFDL 1TENA 1KXTB 2R2EA 3O8XD 5HHQA 3FMGH 3QYCA 4HS3B 3UROR 3ULVC 1NDGB 1KNOA 4RNRA 4EI5A 4H88L 4HWBA 2Z4QB 1H5BA 2DAVA 4D3CL 2EDYA 4P23A 1YJDL 4PRID 1N4XH 3ILQC 4Z8FH 4ZPTB 4U1NB 3REWA 3U9UA 1WFTA 1C16A 2HKFH 3U7WL 3QEGL 3EDEA 2IH1A 4MMXC 4PRHD 1G1CA 5K33A 5IVZB 4NDMA 5D7IA 2VAAB 1ZLSL 5IHUH 3H8NA 4BUGA 4NIKB 2I5YH 2NY3B 1D6VH 3GMMA 4IRJB 1DBAL 3JWNC 5CBEA 1RY7B 5IR1A 4FS0A 2R4RH 3QDJE 4JKKA 5ADPH 4U6VH 4HDIA 1HQRA 2XTJC 2BNQB 4RAUB 5AWNH 1XGUB 1ODAA 1OTUD 3K8MA 3WD5L 5IOPB 5JOPD 1BLNB 4JY4A 1U8HA 5HI5C 2LVCA 1FNHA 1RI8A 4GW4B 4M6AA 5EOTB 3DSFL 4P3CL 5F9DC 2R2EB 6FABH 2DKMA 3KVQA 3MCG1 4PRBA 3GUTA 3DMMD 3MLYH 1A3RL 1KCUL 4EI5B 3BE1L 3M17A 2YPLD 4X6FB 4UINL 4LP4A 4LVNC 1CU4H 4P23B 4R96A 4IDJH 2V2TB 2AXJA 3OF6D 4K23L 3BISA 4OCSL 4OCRH 2FX7L 3S37X 4H5SA 1CXKA 1V7NH 3REWB 3RHWK 2AK4E 4YHIA 3U9UB 1GCFA 4V1DA 2F5AL 5GSVA 3G6JB 4FP8L 5KAQF 4YFDB 1DZBA 2IH1B 1EO8L 2H8PA 3MRRA 2BVPA 1PZ5B 2DS4A 3W9EB 4NDMB 5D7IB 3LCYA 1E4KA 2DQGL 1M7IA 2BZDA 5IEKB 5FKPB 1MWAB 1UADC 2CIKA 4LSPL 4R4FH 1U8QA 1KN4H 1WBZA 3W39B 4OJFL 4HDIB 3FB6B 3PJSB 5JUEH 1C1EH 2JJUA 4OFYA 3IDJB 1S9XB 5MI0B 1MH5B 4PJ8D 1UJ3A 2Z8RA 4JY4B 1FGVH 1U8HB 5DZNA 2YUXA 1NFIA 5A2JH 4GO6B 1IILE 1U36A 2FHFA 5DEFA 2YUVA 3VFPA 3VFUA 1WIOA 4NZUH 5DR5L 5FM8A 2ICEA 1MCKA 2UZIH 3DX9B 1DE4B 2C1OB 3CLEL 4PRBB 3GUTB 4JJHA 3VGHA 2HT4D 3B9VA 1T21A 1P4IH 1FL6A 4O9HH 3M17B 3B3IA 3WYRA 1YPZF 2RJMA 4FQ1L 4R96B 1U93A 4M1CD 3QFDA 2HA1A 3ZL4H 2QKIA 4H5SB 1SBSL 1YZZA 4YHIB 3C87A 4GBXC 5GSVB 3X12A 4U0RB 5I19H 5EU6A 3MRRB 5GJSL 2BVPB 4G9FD 5C08A 1VGKA 1EBPA 4HUNB 3BSZH 3DURA 1H9VA 1ZA3B 1CVSC 4G6AC 1PW3A 1JN6A 1LEKA 3SGDI 3U79A 3MXWL 3BVNA 1M7IB 4LVOC 4Y4FC 5D5MB 1RZJL 1P6AB 3O0RL 1U8QB 2I9TB 5LBSL 3CVHH 4Y1AA 1UC6A 3SKJH 2V5MA 2GTWA 2GJZB 3OWEA 5ANMA 2DQJH 1UJ3B 3QIBC 5GS0D 4P2RA 3NCBB 3HRPA 5DEFB 3VFPB 1VEOA 3VFUB 1Q38A 1ED3B 3NTCH 2ZCHL 2ICEB 1Z3GL 5TQ0L 1I8LC 1T21B 3MLVL 4R2GC 4HG4J 1FL6B 1T1YA 4XWGH 4HC1A 1MRDL 5DJAA 1MJUH 1J8HD 3OB8A 1SJVA 4F58H 4HXBL 3QFDB 1EAPB 1J1PH 2FEEL 3T4YB 1BQLH 2IEPA 1F58L 5EU7E 3UTOA 3HMWL 3QQ3A 4FQJL 3QCVL 2NX5A 2H32H 3U83A 3NN8A 5EU6B 1WC7B 3BPOC 3ROOB 1NCNA 4NCDA 4Y16D 1VGKB 5KS9A 4EN3C 1AHWA 5D4QA 3TJEH 3PXHA 3V95A 2QHLA 2R0KH 1JN6B 1LEKB 4Y5VA 2F53A 1BJ8A 3CSYA 3BDYH 3T0AA 3CVIL 3WS6C 1BAFH 2PTVA 5EU5A 4PJ9A 4PJDF 1PKOA 1VEPA 3WJJA 4ZNEE 3AU1A 1IKNC 5ANMB 1UCBH 3MCKA 4YHKL 3QUXA 1BQUA 4P2RB 3PF2A 3HAEA 4MNGE 1CI5A 1W0VA 4F9LC 4JM2B 3T1FB 2FIKA 2VR9A 1ZHNB 3GMNA 5ISZB 4XWOD 4OIBA 1LO5A 2VAJA 3MV9D 5JW4R 1T1YB 2WWMD 3GJFB 5DJAB 5TF1H 4R9HA 1NANH 3IDYC 5HGAB 3U9PH 1IM9D 3EZJB 2VZ1A 3I75A 5DTFA 4QT5A 4A6YL 1FNFA 4NNYA 4NPYA 3VI3E 1NQBA 4XC3H 2I9LA 2BCKA 4LSUH 2FX9H 3HRZA 3V8CA 1FNEA 1L0XA 4XPTH 3QP3A 5BMFL 4K7FA 3NN8B 4S10A 2B2XH 1UZ6F 4ONFL 1NUDA 4N0UA 2A77H 5KS9B 5I30L 3CU1A 3DSNA 2IPUK 3MJGX 4XP1H 1NFDA 4I8DA 3OJMB 5C0BD 1NKOA 4Y5VB 3KLHD 4IJ3C 4I3RH 3M07A 4G8EB 3WIHL 5EU5B 4PJ9B 3WUZA 3AU1B 2QJDA 2DN7A 3GSNA 3K4AA 5HHPB 3QPXL 3TN0C 5E8NB 3HAEB 3N85H 1H0DB 4XNXH 3VFNA 1W0VB 2PTTA 5C0CE 1RVFL 3QCUH 4BKLA 4FTVA 1XGRA 2VLRE 1DQDH 3GMNB 2DWEA 4M62L 5I2IA 1LO5B 2AJYH 3UZEA 1JGEA 2GHWB 3LMJH 1TJGH 1R24A 4K7PY 3BKYL 5T3XH 3I2CH 3ARDC 1BZ9A 5EORL 3EJYD 4NPYB 1CWVA 2I9LB 3QT2A 1R5IA 5CJBA 3MLWL 1U8OA 3O6FA 4Z7UF 5K9JL 4JR9H 2CKNA 4DGYL 5MEQA 1UWXH 5SWQA 2AK1L 4MS8C 3CZFB 4N0UB 4E41B 2OL3L 1UXSB 2MPAL 4OLUL 1NAKH 4PJ7A 4WJ5A 1VA9A 3LSOA 3CUPA 4X98B 4XMKH 2R1YA 1JHTA 1JI1A 4P5KA 5TQ2L 1I8IA 4C59B 4PRNB 2D4FA 3QXUA 4X4YA 3DRQB 4OLZL 1QHOA 2FR4A 4R0LA 4PV8B 1Q0YH 1BOYA 3D6GA 3CDCA 1KN2H 5JO5A 1GHFL 3OR7B 5F96L 2PTTB 3VD5A 5BS0E 2P5EA 4BKLB 4FTVB 1PG7W 1XGRB 1P1ZA 2F53D 4X83A 3FAWA 4HEME 4XH2A 1KEGH 5I2IB 1DBMH 2ZCLL 4HKZB 1JGEB 1DQQA 2GEEA 1OHQA 1N26A 1X5ZA 1BZ9B 3TP4A 4ZAKA 3S8WA 1S5IL 3QUXD 2O61A 2W9DH 3OXRB 5J1SC 3BRFA 4OGZA 3D85A 4PLOB 4YK4C 5T1DL 2AGJH 1HN1A 1U8OB 2VC2L 2FLBT 2VDQH 5MEQB 2E8YA 3SGDH 5DRNA 4ZTOH 3ESVF 3DX8B 4FQPA 4DVRH 3P4OA 3W11C 5AZEH 3VXRE 4EIZC 5D7LE 2VMFA 5JHDE 1HSBA 4HPYL 4F8TA 4WJ5B 1IBGH 1L9MA 1MY7A 1E4XI 3LSOB 3CUPB 1RURL 2R1YB 1F2QA 3F12A 4LRIA 4ZFGH 5HHME 4P5KB 1KLUA 4OQTH 1I8IB 3CMOL 4KJQC 4X4YB 4G43A 1JF1A 4NQCA 4AZ8A 2EDKA 5JQ6L 4XP5L 5DJ8A 3RL2A 3LB6D 4TTDD 5JO5B 3EOTH 2PXYC 2W0FA 3FZUC 4NFCA 2P5EB 1PVHA 3ULUH 4WI5A 5CCKL 1RAMA 1JHKH 3O3AB 5JQHC 2OK0L 4NNPL 4FQXC 5KJRH 1OGAD 4K94H 2LQRA 4KY1H 12E8H 4JB9L 3WHE1 4WFHE 5C6TH 3QWOA 1QFUL 4OIIL 2O61B 2D7TH 3U36A 3F65A 5ECJE 3KYOB 3QFJE 5I0DA 2A6IA 2JK5A 4BM7A 2JF1A 1K4CA 3H3BC 1RFDL 3P4OB 4LSVH 3ZDYF 4X6DA 5K93A 5F9AC 3PE9A 3VFGH 4DFHA 1HSBB 3G5ZB 4O58L 1UCTA 2M2DA 5FKAA 4KQ4H 3S37L 1KLUB 3HE7B 4N1CA 2HRPL 3GKWH 3O6FD 4XP9H 4GRLD 4XAWH 4G43B 4S2SA 5DHXB 3HI5H 1JF1B 4NQCB 3E2HC 4NQUA 3ARSA 4APQA 2PW2A 1L7TL 4CBPA 4HWBH 3ZKQD 1LP9F 3RL2B 4F7MA 4CGTA 3X14B 1VGEH 2P5WA 4KH2A 1INEH 2W0FB 5IBLD 5FO7B 4HQQL 1B2WL 3CC5A 1NGWA 3BGFC 4QRQA 5D6DC 3MCLL 2NCMA 4ZO7A 2FHCA 3SKNA 1QFWM 4XPHH 2BP3A 1RU9H 1MCQA 3AMLA 4RGNB 1RIVH 1CL7L 4LVHB 3QWOB 2CD0A 4YDVA 3PABB 4D94A 2QBWA 1SJEA 3MLSL 4FQHB 3U36B 3QJFA 2WNGA 3ALWA 4XGZA 2XI9A 2ADJA 2JK5B 1AXIB 3VXQA 1RUPH 1YEIH 5GGRA 2PO6B 3QUYD 2BNRE 1IC5H 4WWID 4R7NB 1YPZB 5C07E 1R0AH 2OI9C 5FKAB 5IVOA 5FUZL 4JHWL 3V6OC 1OAQL 3QHFH 4LARL 2VO5A 4HHAA 2Q8BH 3BJLA 3B2VL 2XZCH 3EYVA 4S2SB 2LVEA 4Y19A 3OZ9H 4APQB 2E8ZA 2VLME 4G5ZL 1P4BL 4NT6B 5D6CB 2XICA 1H15A 3QQ9C 4PTTA 4WCYH 1S8DB 2YHGA 4OFPA 4M5ZH 4Y2OA 2X89D 4M93C 3SKNB 1MIEH 4OM0H 1LK3L 3D0LB 1YA5A 3N1FC 1VADB 3DVNB 3QEUA 1NSNL 3RGVC 4Q9RH 4JPWH 4Y0GA 1Q0XL 4YDVB 3JV0A 4DTGL 1A6VH 1SJEB 3FQNA 1AJ7H 3QJFB 1EHNA 3AXLA 3IDNA 2ADJB 4OLYL 1P4LA 1R3IL 5DK2A 2G60H 1FG2A 5H2BA 1UENA 2BMKA 4RA0C 1IGCH 1FGNH 4TRPL 2LFGA 1D5XA 1C8PA 1A7PL 2VDPL 2ZG3A 3WV0A 2A9NH 3CK0H 4PJAF 1MSPA 4L5FL 3RWEB 5TDPB 2EH7H 1RULH 2ADIA 1EPFA 4PJHA 2XTJD 1OF2A 2DMBA 2ZNWA 1XF4A 4X7EC 5D7KE 3O6ML 1QP1A 2AJUH 1HZHL 4JFDB 5CGTA 5EUKA 4U0QB 1H3GA 1KELL 4NWTH 5HI5D 3VFTA 3KPMB 4KXZH 4Y19B 2DWDB 2QQNH 5CJ5A 1A21A 4TUKH 3T0EC 1FNLA 1Z0NA 1S7UB 4HT1H 4X9HA 1CGSH 1NC4B 2Z0BA 3DOSA 1H15B 4PTTB 1G7PA 4WUKL 2DIBA 4MAYC 3FRPA 4GXUM 1MFDL 3VGAC 5A43C 2MOVA 4ZO6A 3QEUB 4DGIH 1QKZH 5LGJB 1TVBB 1S3KL 4AEHH 5K9KB 3ARXA 1IGFL 1L9NA 2F8OA 2P5WD 1LVEA 5AYUL 3IDNB 1CT8B 1WTLA 1P4LB 4NFBA 2B20A 4PRIE 5SX4I 5DK2B 5T1MA 5EIIA 4QY8A 5H2BB 1X7QB 1D5XB 1E4XH 1JPSH 5HTSA 3SO3B 4KI5E 1G9MH 5H94A 1BFVH 2ADIB 2RR3A 5IGXH 2VXQH 4UNVA 1XF4B 3VFWA 4LLWA 1VFOA 1MREH 3WEXB 2C7UA 5EUKB 3OR6A 4LSDA 3NIDE 1XH3B 1XEDA 3WXVL 4JZJA 3VFTB 1DBKL 1YYML 4ODSL 2FBJH 2NY6C 1JGUL 4HC1H 2OR9L 2YWZA 5IM7A 4IMKC 5EO1A 3P40A 3O9WC 4P9HL 3SDYH 1WV7T 5JOPE 2AV7B 2VKXA 2AKRB 1V8HA 4O2EA 3QUML 1F3JA 1CLOL 4DZ8B 3ZE0E 3OB0H 5KVEL 1JGVH 3SEPA 2FO4A 4LQ1A 3H9ZA 1EFXB 1NGPH 5GRWA 2HAZA 2APFA 4Z7QE 5IF0A 1ZT4A 4GBXD 4NHCH 4GXVH 1F3DH 1X5AA 3QXTA 1BBDH 4MA3A 3H6JA 3PWPE 3RKDC 2DLEA 3T77A 4EKXA 4G6AD 4OD1L 1KJ2B 2XPGB 4YHML 3FFCA 1C12A 4LP5A 4Y4FD 4FG6C 5KSUA 3Q1SH 1AD0B 4GW5A 4ZOAA 2MMXA 1GOFA 2CPCA 1UEYA 3ARWA 3LKQA 5DYOB 3AY4C 5D7JA 3HAEH 1N6VA 3VFWB 4LLWB 2E7MA 5KW9L 4XBEL 1J0HA 1MCCA 4F7CA 2C7UB 3QIBD 1QSZA 3O4LD 4JZJB 4XXDA 3ULUE 4LSRH 4XNQA 3KYNA 3OKLA 3QXWA 5GHWH 3SDXA 5I1DB 3OBAA 1NCAH 4JZNA 4BFIA 4EZMA 5BQ7B 1IAIH 5CFHA 4R2GD 1CD9B 5EIQA 4EI6B 4GKSA 3SE3A 3GBLA 4O2EB 3T1WA 1A4JA 1F3JB 4K3EL 3PV6A 2QQKL 5TE6L 3F5WB 2FO4B 2BVYA 1ZKAA 3EYUL 2YZ1A 2CRMA 2N4IA 4N9GA 1YNKL 5F6IC 3KPSB 4MVBC 3SE8H 1I7TA 4B5EA 3FMGL 4R6UA 1QBBA 3BH8A 4EN3D 2HN7A 4XNYH 3AB0B 1C12B 1GXEA 5KSUB 3GSNH 3QIUB 5CEZH 3WMSA 4JFYA 4OV6F 4JFPA 5IFHH 5DQ9A 2VR5A 4G9FE 1N4XL 2UYLB 3RNKA 4Z8FL 3ZDZE 3I6KB 1BJ1H 1AKJA 4GFTB 4ACPA 3BPNC 1RZGB 2J5LC 2HKFL 4GG8B 4F7CB 4LFHD 1TQBC 2Z31B 4XXDB 1IC7H 1XGQB 1LMKA 3KYNB 2ARJQ 4Q6YA 2I5YL 3OKLB 8FABA 1D6VL 3AS2A 3EBAA 4OF3A 1SM3H 4BFIB 4NKQB 2R4RL 2AI0H 3DYOA 3DBXB 4D0DB 2WM0A 4GKSB 4U6VL 3T0DA 1WFNA 1X5KA 4UU9A 4KK8C 4C55A 4JFED 5AWNL 3RPIB 3DXAD 4FFYH 5BZDA 1ROWA 3B5HA 4JM2C 1OY3B 5FIEA 4N9GB 3EHBC 4H25A 5KANI 1J8HE 1U9KA 6FABL 5FECB 5K9QG 1I7TB 5CP7B 2B1HH 2ZOLA 3BH8B 2R1WA 2HN7B 3MLYL 5IEHB 2CUIA 1KYOK 3D2UD 5A2KH 3U48A 4LLYA 5BVJA 2FCBA 5EB9A 3BMWA 1CU4L 3Q6FB 1S9VA 4IDJL 4OAWB 5MEOA 3VE0A 4UT9H 4JFYB 4JFPB 5DQ9B 2X1OA 3RNKB 3I02A 4OCRL 1EEZB 2J3SA 1V7NL 4X8XA 5HYSG 3WDIA 4KDTA 5LAXB 4LHUA 4C56A 3TN0D 4KZEH 4ODVH 5C86A 2ENSA 1G0XA 3EYOA 4YHOH 4ZUSA 1QEWB 4R97B 8FABB 3FFCD 2G2RB 1YN7A 4Z7VF 4V1DE 4R4FL 3C5ZB 4HULB 3MRKA 1YMHA 1KN4L 3HG1D 5JUEL 5BV7L 2CO6B 4UU9B 1FAIH 3ARDD 4FQCH 4JRXD 1RJLA 4CN4A 4J3XA 5FOBA 1FGVL 5BZDB 5T1KB 5J6HB 4H25B 4NZUL 1IEAA 1F3RB 2UZIL 4PD4J 2WK2A 4MS8D 1HNFA 3ZYIA 1KTDA 1P4IL 4O9HL 1T4KB 5BVJB 4WO4A 4PRPA 5E24E 3NMEA 5D6DA 1P53A 1NH6A 1QTYT 3VE0B 3BDXA 1A1MB 2UWEE 2ZUTA 4J12A 4Q6IC 3I02B 3CGTA 4LLDA 5ACZA 2EXWD 4WTZA 5I19L 3LKOB 1A7RH 1D9KB 1ACZA 4HJ0C 3MJ6A 1I8KA 4M02A 4POUB 3BSZL 5ICZB 1FYTA 3WJLC 2IG2H 5I8EA 1YN7B 2CXGA 5KZCB 5HHOD 5L6YH 3B9EA 3QULA 3UP1A 3MRKB 3CVHL 5JXEA 5C08E 3MC0A 4PLJC 5FOJA 1LK2A 2DQJL 4X0KB 5FOBB 5LCVH 3WDJA 4Y1AE 1CDBA 1EX0A 4PYHA 2VXUH 3PUCA 3NTCL 1IEAB 3K1KC 3MNZA 4MMZC 5ELIA 4TN9A 3VG0H 3U2SB 3W11D 1KTDB 4XWGL 1K6QL 4WO4B 1MJUL 4YAQB 2H2PC 5GRYA 2MNUA 4F58L 1ADQA 1D5IL 1J1PL 1BFSA 4LLDB 1BQLL 2YRPA 2C26A 5I1LB 4KJQD 4HUMB 4OLXH 2GKIA 4L9LC 1WFUA 5D70H 2WUCH 1NDMA 1I8KB 5FA4B 1PG7H 4MQXC 2DBLH 2PXYD 4X6CA 5FHAL 3TJEL 4ETQB 4KQ3L 4ZUTA 3HC0A 3BDYL 2NX5E 1T89C 3QULB 1BAFL 5M95B 1CXFA 4YDKH 2L0DA 5T1LD 1EBAA 1QR4A 4U05A 5KS9E 1GC1C 1F4YL 1KF9B 1N7MH 1LK2B 1V3JA 1UCBL 4NQVB 2F53E 4OZGA 2Y06H 4PJBF 1CDGA 1CDCA 5BOZG 3MBEA 1U8NB 3DIFA 4FABH 2MTPA 1HHJB 1ORSA 2GJ6A 4Z76A 3D39B 2ZOKA 3TBTB 3ZTNH 3KPOB 3JWDC 5D72H 4OTXH 1BQHG 1YC8A 5TF1L 5DI8A 3RHWF 3QDGD 4KRPB 3U9PL 3CX2A 1GGIH 1RZKH 3VDAA 3FN0H 1S7TA 5IW6B 4XC3L 3HE6C 5IHLB 4HUWA 4LSUL 2FX9L 3OL2A 3RDTA 1CFQA 4XPTL 2Q8AH 1EFQA 3B83A 1H3WM 3TT1H 2B2XL 1UACH 1IC4H 4L4TD 2NW2A 1NDMB 4ISVB 1CS6A 5I74B 2A77L 1EHLH 4X6CB 4XP1L 4B41A 2X4SB 4ZUTB 1Z2KA 2YD2A 3E3QE 3PXJA 3HC0B 1KUMA 2Q86B 1CGVA 2WP3O 3MLZH 2WWKT 4MDJA 3UBXA 3HE7C 3UTZA 1NFDE 1F6FB 4YZFE 4KTDH 4GAGH 2Q20A 4PJXF 5D1QB 4M6NL 1ZGLA 3N85L 4JG0H 3VXNA 5BVPH 5DJ2B 4J4PC 4XNXL 1OGAE 1QSED 4AENA 1WJ3A 3ARBC 3MBEB 5IB5A 3GI9H 3QCUL 1DQDL 5FGRA 2GJ6B 5FK9A 5CEZE 3R1GH 2ZOKB 3OX8A 4WI9A 2AJYL 5JXAH 5B21A 1B3JA 5TE4H 2FO1A 3PL6A 5B39A 3LMJL 1TJGL 2Z8WC