4WI5A

Structural mapping of the human igg1 binding site for fcrn: hu3s193 fc mutation h310a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
208
structure length
208
Chain Sequence
b'GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLAQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
molecule tags Immune system
source organism Homo sapiens
publication title Structural and functional mapping of human IgG1 binding site for FcRn in vivo using human FcRn transgenic mice
rcsb
total genus 32
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi5A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi5A01
2ENYA 2F74A 1BVLA 1I1AA 3G6DH 4F9PC 2ZG3A 2HJLB 3N0PB 4WTZA 5L7XL 2GCYB 1RUKH 5IMOA 3TFKD 4PJIE 3TCLA 4YXKL 5T3ZL 1H8OA 3MNVA 4RRPG 3WIHA 3QDJE 1UVQB 3BRDA 4FFYL 2Z35A 1A7RL 4XPAL 5ALBH 5DVNA 3ETBF 4OM1H 4ZFGL 5HHMD 3LVEA 4KH2A 4TUKH 5T5FH 4J4PA 3IF1A 5E5MB 2B4CL 2GY5A 1B0RB 2YC1B 3EYQC 1FFQA 3C87A 1RPQA 4UV4H 3ARRA 3RVVD 1T04B 3BXNA 1EO7A 5BOZG 1I3UA 5INDB 3DSFL 2ADFL 4TOYH 2IPUG 4LHUA 1X9QA 3P4MB 1XIWA 5CEYA 2H1PL 4X99B 2LTQC 3VFMA 2HH0L 5HYIA 4U6YA 4RGOH 4RMUA 5GJSL 4HJ0C 3MRNB 3BGAA 4BJLA 3BYYA 5EZIL 1FNEB 2X1XR 3G5ZB 1K8IA 1EIBA 1R3IH 4OFDA 5TE4L 4P49A 3F6IA 4Q9CA 4KMQA 5J13C 1KB5H 1JV5A 1MFBH 4R26L 5HHVL 3Q1SH 4TVSa 4YGAB 4WO4B 1DLFH 3MNWA 4YHMH 1HIMH 2XN9D 4Z7VA 3UPRA 25C8L 4L9LC 1F00I 2H45A 1B2WH 3D69A 3L95A 3L1OL 3VXNA 5SWZE 4XPBL 4PJ7E 2DQGH 4Q7DA 4WWKD 1UB5A 4ZUTA 1K5NB 5FK9A 1BX2A 4Z77A 1BFOA 2XPGB 2VZUA 4K23H 4R4ND 1KPVB 3U9PL 5E4EC 4G9FA 2JLLA 3S36H 5EC2B 1CXEA 4YX2L 3HG1D 4U6XB 5J6HB 1JE6A 2X4QB 2IANE 2JELH 3D39B 4GW1A 3ZLQC 3RNQA 5FCUH 5ADOH 3AB0C 4RIRB 3WFBL 2B4CC 1T22A 1J88A 4NCC1 2DMCA 1G7IA 2PTUA 5CUSH 2UWEF 1KN2H 4HJJH 4FP8H 5FAAA 4KKAD 3S88L 1TXKA 3N1PC 2IH3B 4HUVA 4L5FL 3MLVH 3FONB 4PB9H 2EDWA 1LGVA 4WFHE 4KVNL 1NLDL 3RIFF 4KFZC 4KZEL 2KKQA 1NFDF 2G60L 1ONQA 4POZC 5C0AE 1D9KA 4HS8L 1P6FA 3ALXA 4AIZA 2E7CA 1CFQB 4XP6L 3D3VD 4D9RD 4CU6A 5I75B 2W59A 3N85H 4Z0XB 4LKXB 3U0TA 4CVXB 1VDGA 3RZWA 3KPLA 3V6BR 4S0SD 4OB5L 1Q9LA 2HRPH 5I76A 4Z76B 1X5AA 1B0GA 4P2RE 3REVA 4U6HA 3H3PL 4YR6B 1NLBH 2AAVA 1RZJC 4HD9A 1FAIL 3QP3A 3BIKA 5K9QG 3VRIA 4R8WH 4RWHA 1PEZA 4V1DB 2GW5A 4PLOB 4R6UA 5HVGB 1GOGA 5IB4A 4XVUC 3U4BL 4HH9B 3Q6GL 3KNBB 4V1DE 5E9DD 3GUTB 5GS1A 4JG0H 1JPST 5K59F 5T3ZE 4KK6C 4AG4L 1U93B 4Z18A 4JDZA 1NGPH 2NXZC 4Z7NE 3VFRB 5I8KH 3F62A 2EDXA 1ZAGA 4LCCC 4PJIA 3PXJA 3DMMB 1GXEA 3GBMH 2G2RA 4IRJC 4Q0XH 1GHFL 3WD5H 2HN7A 2JE8A 1PKOA 4UIMB 3T2NL 3MCKA 2AJYL 1DE4A 3ZE1E 4G6AC 2V7HA 1MRDL 3O2VH 2JK5B 2F15A 1MVFA 1S7TB 4GLRI 3TWCH 2FD6H 2YXFA 32C2A 5IK3A 5IUSA 1MCRA 2CGRL 5ACZB 5I16A 1YEDB 1CGTA 1U0QA 3FB7B 5K9KA 4Z7UB 3ROLA 2MTPA 3JZ7A 4LSPL 4OFKA 1T6WA 1REIA 4YHYC 2EDYA 4WI6A 1DUYA 1Q1JL 3PWJB 3G9VA 1X7QA 3DGCR 5GRJL 4NBYB 2D7MA 3X12A 3L5WA 4CNIA 4I18B 3OKEA 1DVFA 2C3VB 4JVWA 1MJUH 1SVZA 3OR7A 3RBSA 2GK0B 1UCBL 1NFDA 1WBZA 4QRPB 4S1SL 3PL6B 4WEBL 4JRYA 1GZPA 4RMQA 4JGUA 1AHWC 3VJ6B 1IAIL 3DUSB 3QWRA 4WUUD 3UZVB 3IJSA 1T3FB 1F3JB 4LCWB 5GGSA 2MCPL 1E6OH 3RVTC 5LBSL 5LAXB 5IOPB 1G9NC 3HE7D 5HHPB 3EJZC 1AGEB 1AIFB 1DBAH 2X70B 1A3RL 2APFA 3AM8A 1UKQA 4HKJB 2Q3AA 1JYWA 3UTTE 5MHSD 2EYTA 3SKOA 5GGQL 4KAQL 5JHLH 2XQBH 3ALPA 3HPJA 3HE6C 4PS4L 3E8UL 1E28B 3WFDL 4NRYB 1EA9C 2OMNA 1BF2A 5HHOA 43CAB 5CEZL 3E6FB 4BFBD 3O3BB 3P0YH 4B0MM 4RQQA 4KDWA 1CDJA 2ZSVA 2LU4A 2DJUA 5JPNB 4LHUD 1KXTB 4BM7A 5B4MD 3S37X 5L2JB 4V2CB 5FV1L 4PGZA 1T7WA 2XG5A 2XTJC 3A6CL 1DEEA 4X5WA 1EZVY 3CMOL 5AWNL 2YD4A 3HNSH 1LDSA 4G8IA 4LBEB 4L4JA 5FYJD 4S11A 4OBRA 5FYLH 4QRTB 2A0LD 4RAUB 5GIRB 1J87A 3HMXA 4K8RD 3RTQB 4HZLA 3BZEA 1C5CH 5FUOH 1IFHH 3MLSL 3PNWB 3WYRA 2BXZA 3BAEL 2Q20A 3QUYC 3U2SB 1AO7A 4GS7B 2D0GA 5E2TH 1H9VA 4UQ3B 1FGVL 5E5MA 1CG9A 2BNQD 3ARVA 3QUMB 2NX5E 4LKCA 4PJDB 1B0RA 1HK6A 1AJ7H 2R0WL 1S5IH 3BKML 3LS4L 5EU3B 4WI8A 4G6ML 2BHZA 1S7SB 3LN9A 1FN4B 3A67H 1A1OA 4WHYH 4JFFB 5FM5O 4R4BA 3ARFB 1HEZB 1XIWB 4MD4A 5CEYB 3ZDZF 1CFBA 3ZTNL 3GMPB 4Y1AE 4I1NB 3RTQC 5DRZB 1SJHB 4I8DA 4KRLB 1JGUL 2NY1C 3KLHD 5D7IE 3UBXI 5H2BB 2C1OB 5C0BD 2DTSA 3REWB 1K8IB 5D7JB 3TZVA 3TF7C 2XY1A 3ALWA 2QBWA 3I9GL 5FUCE 4NN6C 1ZVHA 2ZUWA 2W9EH 1R6VA 1WAAA 3VWKB 4DUVA 5I8KL 2GK2A 5HHXH 2C7UA 2VIRA 1LMKA 3NFPA 4OI9A 4DJMA 4MA7H 5CD5C 4AG4H 2AXJA 5HPOA 2EDDA 1RULH 4C58B 5EU6B 2JCCE 4PJAF 3BN3B 1VHPA 1D6EA 3TLRA 4FMKA 2OQJB 3TESA 3ULUC 5F7KC 2BJMH 4AK1A 1E4XL 3SKUD 5D1QC 4XVSH 1HHKA 4K7PX 5FIEA 4XNXH 1LWRA 5FGBC 2VLKE 5EU7E 2N1KA 2NY1D 4PD4K 4U6XA 5TF0A 5J6HA 2NW3B 2GSIA 2DIAA 3CVHB 4HLZG 1SVCP 3IFOA 3RTQD 4OI7A 4GBXC 5DHVA 3IU3A 4HULB 1H0DB 4HS8H 3U0PB 1J0ZA 2G75B 1I8IB 2YD2A 5E8NA 4G6KL 3RFZC 1KCRH 4EKXA 3L3JB 35C8L 3MLZL 1W0VA 3RVXC 1BF8A 4M7KL 3O9WC 5HYJA 4PY7A 1EV2E 5C7XH 3CPLA 4FP8L 1KELH 4HJJL 5E8PA 4RCAA 4XI5C 2MCG1 1ZV5A 1KB5B 3QIWB 3VFPB 4YHYB 4EUPA 1OVZA 4P2OC 5GGTH 3WFBH 2FJGB 3ZDYF 5I8EA 2ZUYA 2B7DT 2JELL 4P4KA 1TVDA 4D9QE 3BWAB 1Y18A 3X13A 4YPGB 3LKSA 3EGSA 3L5XL 4ISVB 5LCVL 4KMLB 4YJZL 5BQ7A 3BOVA 1AGFA 5C08A 2H41A 3KPTA 3O81A 3U9PH 3BIKB 3PV7A 1EUTA 1I7RB 2WNGA 2FIRT 4MD5B 1MCHA 3DBXA 3HMWH 4UDTB 5JLZB 4GKZB 5ILTL 2JB5L 4OIBA 1F02I 2GQHA 1KJ3L 1NCWL 5IBTL 1MNUL 5HI5D 2HVJB 4HCRL 4HH9A 1JZ8A 5E2VH 2EDBA 1IJ9A 4B7IA 4P2RD 3ARGC 5HGHB 4OM0L 4LPCA 3NCJL 3T09A 2GY7B 3Q5OA 1ORQA 2O5YH 4P9HH 3FO9A 4N0UB 2Q7NA 4CBPA 2HN7B 4HK0B 4V1DD 3D25A 4WUUA 4DKFH 5AAWA 1KULA 2CRIA 2HT2D 2Y6SC 1R3IL 1MJJA 4OGXL 2I24N 3RKPA 5J1AB 1S7TA 5EZIH 1M7IB 3MA9H 1A9BA 3UJTL 3B6SB 4IJ3C 3EYOB 1OWRM 4XT1C 3FB7A 3E6HA 3JV0A 1XF3B 3OZ9H 5KVEH 5HY9A 1ZT1A 1U8JB 4OLVH 1CDYA 3VGBA 4YEFA 4U0RB 3CFDA 2ADFH 3AXLA 1P7KB 4P99A 3BPCB 3L7FB 1MCDA 1AO7D 5E5UB 1BFSA 4PP1D 2PTTB 5EU7C 4NC2B 2A6IA 4LFHG 5FO7B 4CNIB 2IC2A 3KPMA 4MYWB 1NFDB 3STZA 4PGBB 5DZNA 1F58L 2DJSA 4M6AA 2P5EE 5DHYA 4KPHL 4NC0B 2R0ZH 3SKMB 3QXUA 4TSCL 3PDDA 3P4OB 2Z35B 2VLRD 3VJ6A 5H37G 1X5XA 2XV6B 1T3FA 4U1IB 1IM3B 1Q9KB 2FATH 1OLLA 3QDJB 4XVTL 1ES0B 1OAQL 5HHQA 2EKJA 1YNLH 3DSNA 5HHPA 3H7BA 3MOQA 4LSRH 4PV8A 3U48A 4KZDL 2PYEB 2MPAH 3UROR 2XWTA 1HXMA 2C3WA 4UT9H 1CD0A 1XZ0A 2DQUL 4R0LC 5INDA 4M1DL 3P30H 3LKQB 1XGYH 2F53D 2EYTB 3SKOB 3NZHL 3MRCA 5BMFL 2XZAH 1E28A 3HKFA 3DPBA 3WL9A 4Z5RB 5IROA 3BD4A 5DURB 4RMTA 4XHJC 5F1OB 5DJZA 1OGAA 3OJDB 4P23C 5I1JL 5JW4Q 1A7PL 3H3BC 5F1KC 2NY0C 2CK2A 2IH1B 2ADGB 5IG7B 3EDDA 3IDXH 4Z7VB 4RGNC 4NQTA 5BRZE 1D5XB 3TP4A 3S4SB 1T83A 1BMGA 2IAMB 3WEXA 3MUY1 3QG6B 1FV1B 1EAPB 1M6OA 3VRJB 3QDGA 4QGTA 2ICWJ 43C9A 3RTQA 3V5KA 5GXBB 4MNQE 4XAKD 1BQHG 2I9TB 1Q72L 2Q86B 2Y5TA 1AO7B 3UTOA 5KS9E 1T1WB 3QUMA 4JHWL 3BEVB 5F6IC 2E27H 1ZT4A 3O4LD 4CAGA 4LHJB 2FBJL 2IBGA 5C0FB 5GZND 1BLNA 4S0TD 2X6MA 4PJBE 1A1OB 2L7UA 4WIQA 4QT5A 3TIDB 1MCNA 1QR1A 1CFVL 1Q94B 1UH2A 1Q0YL 4YHLH 1C7SA 5MEQA 1P53A 3NZ8A 2FCBA 3SGKC 1MCPH 1L9MA 3EOAA 2C1PB 2EDNA 1W8NA 3FB8A 1FLTX 1SBSH 3FONA 3GKWL 4BK4A 2NR6C 3MRFB 4ZTPL 4RMVA 3KJ6H 1YDPB 4LEXH 1FE8L 5HDBF 4Y2DB 4O02L 1QBLL 4G9FE 1UYWL 2FYYB 5FOJA 5EIIB 3QUZD 3ZSTA 4I18C 3BZFA 2DQJH 4Q9RL 4OF8A 4YUEL 1Q9OB 4ZOCA 2J5LC 4K8RH 1U58A 4OFYD 3FFCE 4GO6B 1A4KB 3EJZD 4UILH 1HSAA 3VGEA 4Z7WF 5CJBA 4R90L 4U4BA 3A6BL 4PBVC 2BRQA 5BV7C 1NGZB 3C9NB 5FFLA 3MLRH 3ISWA 4KROC 5SWQA 4R9HA 3ARFC 1ZTXL 3NFNA 4AEHH 1Z2KA 1P1ZA 4MXVF 5INCB 4TYUA 4L4TD 3KNBA 4MA8H 5IMMA 4NWUH 2VDPL 4O9HH 3S96B 3OX8B 3KXFD 4AT6B 5I2IA 3DMMC 5I1IL 4LCCB 4PJHF 2HJLA 2UUDH 1RZ7H 2X4RA 3IRZA 3TBVB 1LO3H 2VDQH 4NCC2 3RVVC 3PABB 5AD0B 3R1GH 3C60C 4KKCD 3SDDA 3KGRA 1GSMA 3WO3B 5DVMA 4KTEL 2MQ3A 5ACZA 1EEUA 1QPXA 5IP4A 1IQWL 1FC1A 2FSEB 4OUUB 1RZGB 1F4XH 4RNRA 1S9YA 1A1NB 1INDH 4FQJL 3SDXB 4RISH 1WWAX 5DFWH 3MRLB 1NEZG 3VFGH 1CLYH 1ZWIB 3TFKC 5H35B 3HFMH 5DHVH 1ADQA 4HG4J 5EOCH 3QPXH 2I5YL 2MNUA 4XP5L 3RHWF 3OKEB 1Z9LA 5D7KE 3VWKD 4HAFA 3IDJA 1S7XA 4X99A 4MAUH 4MA1B 1JFQL 5FA3B 3WO4C 3VFTB 2FEEI 4KUZL 5DUPL 1AGFB 4JANA 3FZUD 4MZ2A 2AJ3B 2ATKB 4WWID 4DGYH 1EHLH 3QIBC 2EDEA 5C08E 4MXQC 5JMRA 2F53A 4D9QD 1RJZB 3S98A 2HLAA 4D94A 3WFCL 4C83A 4HS6B 3K81A 4P4KD 4JO4L 5CINL 4EN3A 4MJIA 1FYTA 5I1AB 3BP7B 3EBAA 3QSKB 4KU1A 1N5AB 1QFUL 3GSWA 3MPCA 3UPRB 4E9LA 2VH5L 4P5TD 4APQB 4D9LL 1V3LA 7FABL 5KN5A 3TV3H 1U8NB 3WHE0 2QADD 3MFFA 3JTTA 3N1MC 4POZD 1FQ9C 5D5ME 1UB5B 5EB9A 1R24B 1N5YL 1WF5A 3MMEB 1BFOB 1C16B 3ECBA 4K7FA 4PJHA 4P57A 3K2UL 4HUWA 1P9MA 2F8OA 4H1LH 1JNNH 5TE6H 5DK0B 4RQQB 1L7TL 1S3KL 3OAYH 4H20H 1A14H 3AMLA 1IKFH 4KTYA 4LLAA 4LSSL 3NH7H 4YGVB 4RIRA 4XBPB 1K6QH 1RJYA 4JO2H 4DVRL 4NDMA 3QI9B 4YDVB 2WW8A 2F5AH 3ZT5A 1BVZA 1RUQL 1KUMA 3FMGH 3GSNH 4NFDA 2WUBL 4EOWL 1MEXH 3P2TA 1Z9SA 3PGCB 3LQZB 1JWMA 5E94A 1MY7A 1K8DA 3I6GB 2DM2A 1AHWA 3TVMD 3EKCA 1CL7L 1KCKA 2C4FU 1AKJD 2XY2A 5L2KD 3BESR 3QDJA 1I1YA 2CXKA 3U9UA 3VW3H 3RWHB 4EUPG 1GPOH 3ZE2F 5AYQA 2Q8AH 5EIQA 1BJMA 2AEWA 5LVEA 3WLWD 1NCBH 2Y7QA 4QOKB 3OTTA 4ZUSA 1OWWA 5J57B 4YHPA 1RZIB 1KNOA 1MSPA 4R4BB 3ARFA 4LGRB 4CMMA 3GMPA 4ZG1A 3MV8B 3RUGB 1HQRA 1P84K 5F1NA 4PJ9A 4IHOB 5T3XD 4KJQC 1IZJA 1MQKL 3NA9L 4HJ0D 1VERA 3SBWC 2J8UA 5FYJU 3F58L 2KZWA 1NCCH 3QRGL 1MFAL 3FOLB 5I1HL 5GS1B 5B39A 3RGVD 5F3BA 3AREC 3WLWC 1IARB 2NMSA 4L8SB 5D2LE 3O6FA 3CD4A 4PLJD 2P4AB 4L4TA 4XBEH 3MUGB 3TNNB 1Z0MA 2XKNA 5BO1H 4JQIL 1FO0L 4KUCD 3L6FB 2AJSL 2KUTA 4UT7H 3HPLB 2IALA 5KW9H 2D7PA 1ZVSA 2EXWC 3BFOA 5F7YC 5GJTL 1UG9A 3BQUC 3BQUA 3IDIA 3SKJL 2L4OA 4HKZB 4NNXB 5AYUH 2Z4QA 5BV7B 3RWDA 2Q8BH 1IBGL 3N9GL 2VAJA 5FYKE 4PJFF 1HHGA 4OD1H 1IL1A 3OGCB 4LSUL 4TNVK 3PWJA 5DVOA 1BLNB 2F74B 2NY4D 3HC0A 1QVOB 2C3VA 3ARBA 4NJAH 3EDKA 1HWHB 4GUPA 3DX8B 3OGOE 1GCFA 3QEQA 4WW2A 5IMOB 1WBZB 3VE0B 1A2YB 1CDHA 1VADB 2V2WB 4G8EB 1MI5B 3O4LE 2R9HD 5HYJB 4U7KA 1TJHL 1NAMB 4BZ2H 1KJMA 1F3JA 1RUQH 3FMGL 1U8LB 2EDJA 3OAZK 2JJTC 3WDHA 1K6QL 4LVOC 1SJXA 1U8HB 1T04A 2ITCB 3AREB 1LEGB 3PWUB 4TVPD 4YZFE 2HLFC 1FJ1B 4NPYA 4S2SB 5BS0A 4MHHG 5F6IB 5C0BA 5HHOD 5TE7H 1GIGL 4JO3H 5CLWA 1QBMH 5CBAB 1DN0B 4KMTH 4I0PD 3HI1B 5IQ9A 4PJEB 3WNNA 4ONHB 4Y2OA 2NYYD 1N0LA 2BY2A 1A3LH 1U8MB 5KVFL 4YHIB 4RSVA 1EK3A 5DQJA 5TPWH 1U3HA 5HYJE 1MREL 4GRLA 2C26A 3KJ4C 3SDAC 1YZZA 1A64A 1MIEL 1OAUH 1ZLVH 5HPMB 4AT6A 4N8VA 3ZO0A 2VH5H 4JJ5B 1YMME 4N0CD 3HCVB 3PF2A 2WBJC 4GKSA 3PQYE 5CINH 4JO4H 4LHQB 5F7MC 5IW1A 2F9BT 4RAUA 2WWKT 3V4PL 4MCZB 4P9MH 3BIBX 1JHTB 3BZEB 1H3GA 2GFBB 4NO5B 1I85C 2IADB 3B6SA 3WDJA 4XXDB 4YBQC 2H2SD 5F96L 1HWGB 1FIGL 5MENB 2NPLX 3WIFB 4H5SB 3DETC 3VFVA 5FOBB 2GYSA 4XX1G 4ZXBD 4Z7OE 4O2CA 4ZFOL 4TTGA 2BSRA 3BKYH 4KHXH 1HEZA 4MD4B 1P7QD 3IDJB 5FA3A 1F4XL 3WIHL 4GBXA 3U1SH 3SKMA 1IQWH 2Q6WB 2NW2A 1QBML 2Q3ZA 4X6DB 1F4YH 1BAFH 5D7JA 5TE7L 3R1GL 3GKZA 3WN5C 5ISZB 2BRRL 3RI5F 4HS6A 4NSKB 3BP7A 2E9JA 3TJHC 2EDQA 4PV8B 2I26N 5F6HJ 5BV7H 3JV4B 4AIOA 2XWTB 5C08D 5I17A 2BC4A 5T33H 4O9HL 1DBJH 1HKLL 3QCUL 5C70A 1AR1C 3RUGF 2WSKA 4U1GB 1J5OL 2XXMB 2X4TB 1C16A 1N8ZA 4HT1H 4HT1L 3KYMB 2A77L 5DEFA 3QJHA 2ZUVA 5F7EH 5DJXA 3GNMH 3UX9B 1DCLA 4ELMB 5IVOA 1TFHA 2HT3D 4OIIH 3QCUH 5GZNC 4YFEA 2Y06L 5T33L 3QFJE 4K8RL 1CXLA 3BSZL 3S4SA 5EBMA 4NO2B 4PJIB 3QG7L 2RQ8A 3NOIA 4ORZC 1JN6A 3TA3A 4O02H 1B88A 4A2LA 1G9NH 3CSYA 5C0IA 4LEXL 2LVCA 3NGBC 5D96C 4JFOB 5JIHA 4R7DA 3NFSL 1DL7L 4PY7B 4PRDA 4ZOAA 2DQHL 4Z78A 3U1SL 1MCPL 3W5MA 5CP7A 3U36A 3VXPB 1FO0H 4Y5VC 4P5MB 4MMXC 1EHNA 1JYVA 3MSPA 3ROLB 1TLKA 5DWUH 3CDFA 1ZT4B 4N1HB 1OAZL 1LO2L 1T0MA 4P4KB 2H32A 2IPTH 4QT5B 3TIDA 1NCCL 3QRGH 3KLDA 4JFHD 1Q94A 3KG5A 4TRPL 3DIFA 1MQKH 2UUDK 3NA9H 5IVXE 4NOFA 5BQ7B 5IFAH 1QSEE 4ZDHB 4JRYB 1G7QB 5F96H 4Z9KB 4CDGC 5GRUH 1UKTA 3FQUB 2BERA 4QHKI 1TNNA 4YFLF 5JW4M 2PTVA 5DMYA 2K3TA 4H88H 2HVJA 2DYPB 3STLA 2FYYA 5CAYB 1NCBL 2DBLL 4IMKA 4YBLC 4RAVB 4B41A 5IBLD 3O6FB 4UNUA 2ZSWA 4K3HA 4HIIB 1A7BA 4L8CA 3PGDB 3VH8G 1KFAH 1OAUL 1A4KA 2M2DA 2QADC 4G9DA 3I75B 1HZHH 2FHFA 1HDMB 3NACL 1JUFB 1VFMA 2E3VA 2ICCA 1HQ4B 3HPJB 3ARBC 5C2BH 4OCXL 3HB3D 3UTSD 2NY5H 3GSNL 2O61A 5IFJA 4NNYB 3HA0A 4NT6A 5FECB 1RIVL 4BUHA 5KSBF 5JPNA 3RVUC 4Y19E 5F3HB 1F8TL 3GGWA 4KDTA 5E7FA 5I2IB 5JQ6L 4LSSH 3QJFB 1EFXA 3ZKNC 5DO2C 4UI2A 5E00B 4H20L 3MXWL 2XQYK 3AU1B 2X1PA 5KVGL 3BUYA 3RWFA 1JNNL 2QSQA 2C3HA 3LB6D 3WN5A 2ZJSH 2F19H 1VADA 3PABA 4WDIA 5AD0A 5B8CA 3FO0L 4ZFFA 4YK4C 4XNQA 1LP9E 1GGBH 4HGWA 4KPHH 1FGNH 4DN4L 3CIQA 1MFDH 4GLRH 1CG9B 4F15C 4K3JL 3VA2C 5J11B 3TV3L 4P23B 4JZOA 4NJAL 3SDXA 1T80A 2JTDA 3B9KD 4GRWB 3UP1A 3VXQA 1ZWIA 1QFUH 2H8PA 4LDEB 3RWGB 1JMZA 1O0VA 3MRIA 5HI4D 4K07A 3WFCH 5DD5L 2EIZA 4ODWB 1IBGH 3N9GH 3HI5L 1YN7B 4X4ZA 5I1GH 1NBQA 1A6AA 3DX7B 4FNLH 3WL9B 1I7UB 2FEDD 4ONHA 2A1WL 1K9TA 2D7TL 3P11H 4HIEA 3TZVB 5GRZA 4NQUA 3K4DA 4OFVA 4Q9QL 3KAAA 4WTWA 1IQDA 4JQIH 1EJ6A 1MFNA 3ESUF 1IAOA 3P73B 4P9HL 5F8QC 3ULVC 2HG5B 4M1GH 2BSSB 3BKJL 4GKSB 1M6OB 1NGQH 1OF2A 2EH7L 1QQDA 4MJ6B 2NY4B 4YO0A 4KTEH 3RQ3A 1RK1B 5CHNA 5AAMA 1VEPA 3HMWL 2IADA 2Z9TA 4OD3L 4Z0BH 4H26B 2VUOA 3QDAA 4X5XA 5FEBA 2EICA 5FUZH 1S7WA 5FGCB 3PQYD 3T2OA 5C0EA 2F54A 4ZPTA 3GIVB 4J7RA 5HDLA 3WIFA 5C9KA 3MYJA 1KIUA 1PX4A 3AVEA 2NW3A 5IESL 5DUBA 5J7CC 3CFBA 4EVNA 4MA8L 5ECJE 2Y5EA 5J56B 4KI1A 2DWEA 5ANMB 2Q8AL 4NDMB 5D1QD 1G84A 4NM8L 3V95A 8CGTA 5J11C 3IDUA 2P42B 1KELL 5DJ2B 5DHXB 2NW2B 2Y4SA 3GI9L 4GH7B 2J8HA 1AHWB 3B2VH 3MLZH 4R90H 4KK5C 4MCYB 1KCRL 4KDTC 4OIAA 1CLOL 1LNUB 2VZTA 5JW4R 5DJAB 4Q9RH 3IFPA 3ZYOA 3BZFB 2X4PA 3HC4H 3ARGB 3WJLC 3IDGB 1LO5B 1NFIB 4WHCA 3JV6B 1S7VB 4P5KA 4Z7WA 5ID1B 4XNXL 3WV0A 4QOKE 1L7TH 3ILQC 4AENB 2E5EA 1J86A 1OP3K 4RZCB 3GKWH 4X6DE 1G7MA 1CF8L 3WS3B 1T20B 3TNMB 3PWVA 2X4SA 5DQ9B 4XWOC 3VDCA 2L0DA 1WEJH 1Q0YH 4PRIE 1AD9B 4Z7UF 3VGAC 2IF7A 5EG6C 4ELMA 3RIAK 4Y4KB 4KJYB 5I6XB 3HI6H 2NY3D 2FBJH 7FABH 5HHXL 3I02A 4HWNA 5CD3B 2DM7A 2QQKH 4CUCA 4OCMC 1VSCA 3VD5A 3I3DA 3NMEA 4JHWH 4WENB 3FZUC 3V6OE 1IEHA 3QNZA 4X4MA 1NQBA 5ID0B 4LCYB 1WC7A 3IJHA 3CSYB 4F57L 3TBSB 4Z7VF 5CJ8A 3WCYA 2KPNA 1FFOB 4PRDB 3KYNA 4F7TB 1EHLL 3S35H 4LVNC 5IQ7L 4Z78B 3LPWA 3LOWA 3HAEA 4KUZH 1RZGA 5DUPH 4ELKA 5BZWB 3VD9A 3DX6B 1LO4H 1FL3A 4NRZA 1S9YB 4F58L 3JVGC 5KJRL 3CFDB 4JY4A 1ORSB 3QPXL 4LF3A 1LO0L 1IM9A 3KPRB 3FRUB 1JZ4A 1YNTB 2VDNL 3C2AH 4JFDA 1T0MB 1XR9A 2AV7A 4G5ZH 4JKMA 5E03A 3VFGL 4WFHD 4UBDC 4U2ZA 2GJ6E 3GJFB 4RISL 3ARBB 1AJ7L 5I30H 1TNMA 1EVUA 3SPVB 2B1AH 4M5YL 3SE8L 1AKJA 4P5TB 2W60B 4APQD 5IJKA 1RURH 3ZT6A 4WY7H 5D6CB 1ZT7A 3CX2A 5DFTA 2DI9A 3RA7L 4D9RE 2VNCA 2F53B 1NAMA 1C5CL 1SHMA 4PPTA 5E2UL 1NJ9B 3P30L 4M1DH 2WK2A 4JFHE 1I9IL 3STLB 3HNSL 4RAVA 4KZDH 3E0GA 2HT2C 3VXMA 5I1IH 3A6CH 4I5BB 1PG7X 1NC2B 5GRXG 3QCTL 3RVTD 1PG7W 1IC7H 3LY6A 3RP1A 4HSQA 2VDPH 3MFGB 3DOSA 3LD8C 4L4VB 4LPTA 4NIKB 4D0BB 1D7FA 1D9KC 1R24A 3NPSC 4JZNB 3ECBB 3B9KA 4TUOA 1MCSA 3MOBL 3O8XD 3O3EB 3VCLA 3LHPH 2ZG1A 1QP1A 2WINB 3CFEA 5CSBA 3L3DA 3EOYG 5F3HA 5EO9B 2EIDA 1EHAA 3FO1B 2IH1A 2X89A 2NR6D 1NC4A 2R69H 4HWEL 2RAMA 5AEAA 1W8OA 4O2EA 2OXHA 3WS6A 1S78C 4LOUD 5A2LH 5E99L 4FA8A 5E70A 4IRSB 4RBPH 4WO4C 3WEXB 3T8XB 1UYWH 4GRMB 4K94L 1FE8H 4MCZA 3WN5B 4X4ME 3V5KB 3KJ6L 1WWCA 1JHTA 2BNRD 3MA9L 2ZCLH 1SBSL 3QO0A 2BVOA 5EWIH 4XTRD 4NO0A 3U9UB 1I1YB 2OR9H 5HGDA 5MENA 3QWQB 4PJGA 3KYOA 2QHRL 2YC1A 5KOVC 1PZ5B 5I1KL 4PJCA 1OSPH 1HXYA 1VFBB 3CSGA 5D9SB 2CMRH 3NCEB 3PL6D 3C6LD 2IPUK 2APTA 3DXAD 4M3JA 4YHPB 4AQ1B 4HCRH 5GSRB 5D1XA 2FX8H 1HHJA 4HIHA 2EKSB 1KTRL 2J7LA 3VFMB 2NY2C 1IGTB 3VMPA 3MLTA 5CZVH 5FCSH 5DZLA 3BW9A 1BZ7B 5FHAH 4WI4A 4IHOA 5DGQA 4LASL 3TWCL 1YEIL 4LSVH 1NMBL 3BGFB 3O2VL 4CRPA 4X6CE 3MBEB 4TVPL 5IMKB 3H9SB 2DLHA 2YPKB 1EMTL 3R06B 4PJ8B 4Q0XL 2PW1A 3H42L 2K9UA 1IGYA 1OHQA 4FRWA 4L4TB 3QZWA 2VQTA 5F9OH 4OV5B 3DO7B 4YBHA 5IMLB 1BJ8A 2YD7A 1OF2B 4EI5B 2R2BB 4PG9B 2EYSA 4U33A 5F21B 1WICA 1ETZA 1YA5A 3O2DH 2X4TA 1BX2B 3T4YB 4E5XB 5SWQB 5D1ZD 1L7IH 1DVFD 3DGGB 5E8DH 5K9JH 4X5XB 4WFFD 1R3KB 2ARJQ 2XZAL 3IDIB 4DW2H 2V5RA 1WT5C 3AAZB 5INCA 5FM5M 2HFGL 1T2XA 3GIVA 1XGYL 4IRZL 2FB4H 3CFKB 1ACYL 1UB6A 4PJDF 2X4QA 4Y19B 4NC1C 1I3VA 2WP3O 4I3SH 3STBA 2W91A 3SDXE 1ODAA 4HS3B 1UWXH 3KPSA 2DWEB 4PGCB 5DQDL 5ANMA 5F1SA 1EEQA 5DA0B 1NDGA 4XP4H 3DX8A 1CFSB 2LAGB 4GUPB 2BNQE 3WNKA 4KZEH 2BJML 2ADIA 1A2YA 4HWBL 1RIHL 5C0IB 2V2WA 4G8EA 3OBAA 3DUHA 1H8NA 4PJAE 4KI5E 4PP1C 3QIUD 4X0KA 3JUYA 3QUML 4NC1E 4OCRH 1QACA 4Y1AD 4UOJA 1OCWH 1AP2A 4BH7B 3QO1B 2XZZA 1HNFA 4Y5XB 2W65A 2VAAB 3H42H 4K8RC 1UXWA 2Z92B 4KWUA 3EAKA 3C5ZB 4LKXA 3GJEB 3CSPA 3I9GH 2Y6SD 1QFHA 1DLHA 1G7HA 5C0BB 1Q9LB 5D7JD 4AENA 3DRTB 1NGYB 4M7LH 5KVEL 4LSVL 1YEIH 4D0DA 3NCYP 5IQ9B 3TYGL 4PJ8D 1T20A 3TNMA 5BVJB 1JGUH 3PHOB 5HHNA 5CZVL 3N1GC 2I25N 1U2HA 5DQJB 4OGXH 1GVIA 5E4EB 4PRHB 4C83B 4GRLB 1EEYA 1TQBC 4WTXA 4GG6A 4XPBH 2DQTH 1KACB 2BK8A 4HCRA 4QHNB 4GJTB 1PW3A 5HPMA 3BKMH 5EU6D 5I1KH 2W92A 2Z31B 3V9FA 4G7YL 4LVEA 3MRHA 1D5MA 4B7LA 3MFFB 5E2VL 4R26H 3EZ8A 5EWIL 1MNUH 1QFWI 3MCKB 5TE4H 5F1IA 3QH3A 1FFOA 5FUOL 3VI3F 2CDEA 3CMGA 4CADA 2CQVA 3S4SG 3QFDA 4FQXC 5D7IA 4IOIA 5LCVH 2H1PH 4C55A 3X3FL 4N0FB 3BH8B 3L5XH 2N4IA 5DMIL 3QXAB 4JY4B 3DSFH 4PBXA 4JKLA 3SN6N 1YNTA 1JPGA 4M6MH 2AV1B 4UV4L 3SCMB 3O2DA 4XBPA 2FHCA 4XNYH 3BT2L 5GGTL 2OL3L 2A83B 3BEWB 1OCWL 4LU5H 2XN9B 2YN3A 4OCRL 3PL6A 5SWZB 1I85A 1A7RH 4XPAH 5E94B 3I6KB 1BJ1J 3GK8L 4NFBA 3VFSA 5KAQG 5JHLL 5C0GB 3IDYC 1ZGLA 2X09A 1IM9D 4YH6A 1NJ9A 4HWBH 3BJLA 4ZAKB 2QQNH 4XP4L 1VESA 3D9AH 5FYJL 4G6AD 1MRFH 3I85A 1C8PA 1IGCL 3VXQB 2NZ9C 4I3SL 5I17B 5CJ5A 1I9IH 1MCFA 2ITDA 5LBSH 1ACYH 3U6RB 3CUPA 2VR4A 1U2CA 4IRZH 4HC1A 2XWBA 5GSVB 3RA7H 3PDOA 5JUEL 1NFDE 1HQRB 3OPZH 3S5LG 5CEZD 1L7IL 3F8UB 3IS1X 1T89A 1C12A 1CICB 3SE8H 3L3GB 2LTQB 4D3CH 4QY8A 5I30L 3LDBC 4EIGB 3KPRE 1UM6L 4PRIB 3MGOA 4GQPH 3WHXA 3LKRB 1JP5A 3C2AL 2R4RH 1Q1JH 4NQCA 4CVZB 4EJ1C 1S7RA 3SDXF 2VN7A 5EBMB 3MUGA 2CIIB 2YD9A 1PLGL 3B9AA 3T8XA 3PIQA 1EMTH 4BKLB 3TA3B 2B0SH 5IQ7H 5F7FA 4J23A 1T4KB 4ZOBA 5MERB 1V3JA 4NN5B 4HZLB 2FD6L 4Z7OF 1NMBH 4JFOA 5TGBA 1HH6B 1TETL 2VL4A 3IETA 2BY1A 3MJ8A 2B0SL 2E9BA 3ULSA 5CP7B 3LS5L 3DUUA 3T2PA 3ZTNH 4D0CA 3KYOB 4TUJA 2V2XB 3NAAL 3SGKA 4KY1L 4JG0L 5EOCJ 5IVZA 4UU9B 1YEHL 5GRYA 1WEJL 4NUGL 2NNAA 2WWMD 3LKPB 1FGVH 1SJHA 2QQLH 3ZYZA 1MI5A 3OPZL 4DEPC 3H3PH 2XTJD 2ZCLL 2X10A 2ZOKB 4ONFL 1NBVH 1SYVB 4C56D 3I3BA 3QDMD 4U0QB 5FYLL 4R4NC 4HKXB 3R06A 4PJ8A 5EUOB 1HYSC 3UO1L 3FCTA 5DJAA 5ELIA 1IGCH 3CMOH 2YK1H 1MRFL 1MOEA 3AREA 1LO5A 1NFIA 1JHKH 2YUVA 2QQNL 1P84J 1S7VA 4P5KB 1X3DA 1FLRH 3B2VL 4HAGA 5E8OB 5H94A 1MELA 3LHPL 4G80B 3O9WA 1G7MB 1FIEA 1QLRA 2E7LC 5CEZH 1EAJA 2X4SB 4K9EC 3DGGA 5DQ9A 1WITA 1U8MA 4LGSB 1J8HE 3AM8C 4EN3C 1RK0A 4NNYA 3KHQA 4KK5D 4GAFB 1WLHA 2OL3H 1J1XL 2R0LL 4M6ML 2DLTA 4MNQD 3VD4A 3QJFA 2G5BA 3IFOB 4YFLI 2VTFA 3ZKXB 1DBAL 5FA4B 4LLVA 4EZMA 3WNPA 4CN6A 4HFWA 3C09C 3TBWA 1E6OL 3F7PC 5ICXA 4NZRL 1CN4A 3TCLB 5B8CB 2K7PA 4WDIB 3RWIA 1MCLA 3QRFM 2WQRA 5A2JH 2BFVL 5C6PB 4ZFFB 4Y89A 3LEVL 1F90H 4JREB 3CDYA 3T2QA 3V4UL 2EH7H 3EIFA 4MNHA 4WEBH 5BZWA 5SX5H 3BKJH 2IGFH 4G7YH 1UCBH 4M1GL 2H2PD 1T7YA 1KLUB 3V0AC 1ORSA 4P2OA 1T5XA 4G5ZL 5GRJH 2NX5A 3JUZA 3QI9C 2DQTL 1FC2D 5K33A 1F45A 3VXTB 4CMHC 1KB5L 1MFBL 4ISVA 1DLHB 3ZL4L 4F58H 1D9KD 3I6LE 3P11L 2D7TH 4PG2C 3QDMB 4PRAB 4OFYA 4RGNE 4X9IA 5T1MA 1L0XA 2A1WH 5IBUB 4P2YA 5C08B 2A6DB 4E0RB 3S35L 3CX5K 2CGRH 3ARTA 4AJ0A 2HH0H 2YWYA 2YXMA 5K9OA 2AJYH 1BQUA 3QNXA 1EEYB 3GMNB 3L3KB 1GHFH 4HIXL 3WD5L 5F8RC 4H0GA 4WO4A 2Y9RT 1QG3A 3M1BA 3ULUE 3IU4L 5EBGA 4HUUA 3AROA 3UTQA 5D71L 5CS7A 1FGNL 4NCDA 3AS0A 3FQRB 3U4BH 1GGBL 2A6JB 5EUKB 4ZUTB 4YO0B 2E6QA 4YHZL 3FO0H 3KXFE 2AK4B 2APWA 4BSWB 4CL7A 4R8WL 5EU6E 2A74B 2ZJSL 2MKLC 1FAIH 1RIHH 4PJ8C 3QFDB 2R1XA 3SDDD 2F8VA 5DJXB 2YWZA 3CFEB 5HY9B 2P7TB 5L7XH 4NBXB 3MOAL 2HRPL 4Y5YB 4R0LB 3N85L 1VACB 3O0RH 4M93B 1X6NA 2LQRA 3HC4L 4XP6H 2M8XA 1X5FA 2HFGH 1UZ6F 1T2JA 1Y6KR 4RBPK 2NY5L 5E8DL 5FM4A 4R97C 5K9JL 4OCXH 3X3GL 3PWNB 5CSZA 4LL9A 2IAMC 4PB9L 5HI3D 3MLVL 2JCCB 4FFZH 3VG0L 1A6WL 2BVOB 3NACH 3V4VL 1ZGLB 3O11B 3U36B 1KN2L 3VXPA 5HGDB 5D2LF 1SJVA 1E4KC 2EE2A 3HB3C 4QKXB 3LV3B 5HVWA 3ARBD 4G3YH 4S1QH 5DYOA 1C7TA 4AM0B 2DBLH 3GSQB 2IPKA 1XZ0B 4X80L 5E6IC 4X4XB 2P44B 5I76B 4XPTH 4ZDHA 4LASH 3MROA 3VXSB 5GRUL 3R0NA 3MNZB 3DX9A 5C09D 3NCBB 4HUXA 1PD6A 5JTWA 3BWUC 5DJZB 4TRPH 3VXUA 2FX8L 2VUYA 3DVIA 4IOSD 2CKNA 5JO5A 3WSQH 3ZE2E 1V8HA 1GGYA 4RA3A 3I02B 2OX5A 1IGYB 3EFFB 2QHRH 4KV5E 3HAEH 1FSKC 4YHML 4FZEL 2CIIA 2BVYA 2OR9L 3KPRD 5E9DE 2B8OT 2YRLA 1NBYB 2V7HB 1HQ4A 4XVJL 5C0ND 5H8DA 4OGZA 1WFTA 3F7YA 1KB9K 3IETB 2AJVH 4LPYA 4X8JA 7CGTA 1FVEA 3ULSB 4UTBL 5CJQL 1TZHA 2AKRA 3OKDB 3VFUA 4NT6B 3MR9A 1MCQA 4W68A 4NFCA 1TQCC 3LPGA 3FAXA 4P3CL 1A6VL 1TTUA 3INUH 2DTMH 2XQYG 1IM9B 2P24A 4YXHL 1UB6B 3T0EB 1R3JB 1SEQL 5KG9A 4JFDB 5EPMA 2D03L 1IT9H 1NAMH 1DANT 4JO1H 5E00A 4XNMB 4HIJA 3DTXB 3AU1A 1CFSA 1J12A 5F7EL 1YPZA 3QIWC 4K3JH 2HP4A 3MOBH 1AKJB 1MWAL 4P5TA 3MUZ1 5T5FL 3S37H 3EOAB 5D5MA 3SQOH 3FAWA 4JE4B 1J5OH 4AL8H 1TCRA 1GZQB 3ARDC 3P4NB 1AGBB 4X0KB 1YDPA 1KCUL 4ZNEE 1DSFL 3MV7A 4HQQL 4ZUVA 5SV3A 1JBJA 1JL8A 3QCTH 4RGMC 1AP2B 5SWSD 3FCTB 1FH5H 2FWOB 2ICWB 3HUJB 3W0WB 2XKUA 2W65B 3NA4A 4QRRE 3TZVD 4I5BA 1CD1B 3D5OF 5T3XE 5C09B 4WUUE 3U7WH 4LHUB 1OP3H 5DD3H 1U8OA 4L4VA 5E2UH 4KRNA 4CN1A 1TZGH 2WLZA 4Y4KC 1YN7A 1RUAL 2LV4A 3Q5TA 2FO4A 4K2UH 4JZNA 4I0CC 4WY7L 3WIHH 2GT9A 4F33A 1FNEA 3MBEC 4HWUA 2B1AL 4M5YH 1P1ZB 5MHSE 1YEFH 4LVHC 4RDQF 1HZHL 1NUDA 4Z7VE 4UNVA 4HKBA 1CFNB 1KFAL 5JDSA 4OLEA 2VJXA 4YDIL 3P73A 5DR5H 5FA4A 5F9JA 4BK5A 1J8HD 2HG5A 2NY7L 1A8JH 4Z7QF 2P5EA 1FG2B 4YZFF 5DC9B 3MODH 4WGWB 5FYKD 4LQ1A 4JJHA 4G6FD 4AH2A 4I3RL 4UIKH 1SY6A 4ZXBC 2XPGA 3QYCA 3BI9X 3SE9L 4X98B 1A9EB 4OUUA 5EC2A 3O4OC 1T03H 3BGMB 5GRVK 3NIFE 4C57C 3MYJB 2QQKL 1DJSA 3CZJA 1FZOA 4DOHE 3VGAB 3RHWK 3UBXB 1S5HA 3H9YA 3CDCA 5I74C 3QEGL 1OAZH 1MIEH 2NY0B 3BDBA 3HI6L 2HJKB 1S8DB 1NAKL 1HHJB 2NTFA 4Y4FB 2H9GB 1S7XB 1ZA6B 2R4SH 2XN9A 1I7TA 5DC4B 1XGPB 4KHTL 1JGLL 5FXCH 4NHCH 8FABB 4LRNL 2DQHH 3VXUE 2ZCHH 4QXGH 1DL7H 2IH3A 4U7SA 3VFSB 4TVPE 4LLDB 4TSAH 2IBZX 1BFTA 5E08L 4NGHL 3H9SA 1FFNB 1NCNA 4TNWF 1UJ3A 5EO1B 1N7MH 4W6XB 1QRNB 1MCWW 5KS9B 5C0CD 1D9KB 4PGDA 2JIXD 3E3QC 3NBNA 4ZYKA 1RJLB 1YJDC 3ME0A 3K3QA 4OIIL 2NY1B 3G08B 4BZ2L 2HLFD 3FQRA 1SBBA 4Z76A 4NN7C 3GNML 1RUPL 1UADC 5IIEA 1UH4A 2DLEA 2K7QA 5CIPB 3T4YA 4DAGH 2VRAA 5F7DB 2LU7A 4OBSA 1WISA 1I9EA 4V1DA 1I8LC 5DK0A 4IRSC 3ILQD 3QHZH 4L9LA 2EEBA 3LN4A 4MSWA 2XXCB 4OGAD 5EC1A 3QWOB 4PV9A 3LRSA 3QUYB 3U0PA 1CQKA 4PGCA 3KPSB 4YIQA 3BPNB 3SKJH 2NY4C 4FQIH 1QYGH 1ITCA 2R8SL 5E6IA 1F4YL 4X6FA 4JGMA 4I77H 3BP4A 3JV5A 5HYQA 4AY0A 3CZFB 3IGAA 32C2B 4IDJL 1LHZA 1UT9A 3MJ8B 4N8PA 4OGAC 2AJSH 5ETUB 5GS0C 4ZFOB 4PJHE 5ITFB 3DUUB 4D0CB 3OKOA 4MA3A 3CGTA 3QO1A 3KPRA 5DYOB 3MLXL 3V7MA 3TPUA 3VXRE 3QEQE 2I27N 1CI5A 3LKSB 2CLRB 4UU9A 4X4XA 4N8CH 1OARH 2G9HB 3TC9A 2OP4L 4J3TA 4Z6AT 4QRPA 2W60A 3RUGA 4DTGH 2FR4A 4M6NH 4FNLL 3TO4D 3WMSA 4XMKL 3OHXA 1A6PA 3DBXB 5I1GL 1DTUA 1HH9A 3MRBA 1ZOXA 3BZ4A 4P9ML 3HI5H 4FQQB 1VB9A 4GG6B 3PWLA 4NNPH 5IOPA 1T7ZA 3AS1A 2VN4A 4LIQH 1WQVT 4L8SA 4OLYH 4EXKA 1ZEAH 3ULVD 3HS0B 4HHAB 3OR6B 12E8L 4HLJA 2IWGA 4Q74A 1J9CT 2FLBT 1CWVA 4HK0A 4XPHH 2BSED 3L6FA 4U6TA 1MREH 2WWKO 1YMHB 3QFJD 2BVUA 5IVXB 3T4AA 3F7YB 5L88H 3OKMB 5JOFA 2XOTA 3PV6A 3E6HB 3O3EA 5KVGH 3MACH 4J3VA 1JJUA 1TIUA 2MFNA 5F70A 4PB0H 1ZT1B 1BHGA 3MXWH 1K85A 4XC3H 2DWDB 1KN4L 4PUBL 5EO9A 3QXAA 3B3IA 3MCLH 1IVLA 4OF0A 2P24B 4TULH 3DI3B 3QA3A 2G5BB 5EPMB 1HKFA 3P9MB 3MCLL 1J7VR 3MA7B 3TN0D 1RIVH 4GAGL 4LSTL 3MACL 3STZB 3VE0A 3O6KH 3ZKSD 5GIRA 3MX0A 1Z0NA 4PJ7A 3K8KA 1TJHH 3T0EC 2GAZA 4IRJB 4OZFA 3K0WA 2DM3A 1CXIA 3P4NA 1MF2L 2YPLD 1KIQB 1PKQA 4U1IA 4EI6B 2VZSA 4JN1H 3F5WB 5C1MB 4PJGB 2WP3T 4ONOA 2DQCL 1ZKAA 2P5ED 1J10A 1PZ5A 1EJOH 5DURD 3VI4E 4ODUA 5EO0B 6CGTA 2PYEA 1FYHB 2PN5A 3MBED 4NO3A 5DO2D 4LSUH 2VLRE 4FXGA 5DF0A 4UZGA 4OD1L 4QYOA 4H88L 5DJYB 3P0VL 1U8OB 1QNZH 1N64H 3RL2B 1VFAA 3RVUD 3QWRD 2FH6A 2NY6D 2XTJB 4HIHB 5KSUB 1F4AA 3RKDC 2DYPD 1DN0A 4Z95H 4FQ2H 4ODXB 2JJSC 5CP3A 5ERWB 3PE9A 4Y1AB 2JF1A 5IFAL 3CU1A 4FABH 4BQ6A 1F11B 4MAUL 1OGAB 3OJDA 4UT7L 5C0AB 4KJPC 1KXQE 1EHXA 4PRIA 2IPTL 3HZVB 4MXQD 4GRWH 4PRPB 5T1LA 2PR4H 4Z7QE 5DT1L 3BRFA 4P3DB 3ARDD 3QQ4A 1FYTD 2IAMA 4OV5A 4ZOEA 3GIZL 4MB3A 2DI8A 5I1HH 4AIXA 2HFEA 4GS7C 4JVPA 4Y19D 1CTOA 1JZ3A 2ED7A 4KK9C 1ETZB 4JFEB 5E1HB 3NFSH 4CGTA 4URTB 1HILB 3LN5B 1VGEH 2J3SA 1MHCA 3PGFH 5KSBE 2NY5C 3QDHA 2AI0H 2OJEB 3LAFA 1LO3L 1NSNL 4W4OA 1RZ7L 2VQUA 4MNGA 1P4BL 3KPQA 4UQ2A 3BEVA 3QG7H 1QSFE 2BDNH 1FHGA 1EEZB 3GI8L 2CLZA 1E4WL 3BSZH 3IDNA 5TQ2H 1EBPA 4R0LA 1VACA 3VD7A 4OTXH 2H2PC 4R97B 2MHAA 5LGJA 3FQWB 5IFHH 1IEBB 5EZLA 1I8IA 2EXWD 1QR1B 2GUOA 3EFDH 3NN8A 1WIPA 1MI5E 4L3EE 2A2QT 2ZUQB 4C56A 4PJFB 1NKOA 4DAGL 2C1PA 4LVHB 3NIFF 2QHLA 1T0NA 2ICES 2R2EB 1RUPH 4Z7UE 5B21A 1DP0A 4M4PA 2FJHB 3WKMH 2OLDA 3G6JF 1PSKL 5ISZA 3D0VA 3ARED 4WW2C 4HKXA 2MJWA 4NSKA 3F7RA 1CK0H 3SJVB 4DVRH 5EIIA 4JO2L 4KROD 2DQJL 3LV3A 1MY5A 1UXWB 5CZXC 1JNHA 4ZYKB 1M05A 2A73B 1OAXL 1U58B 3ZKMC 1QBLH 2X4OA 1A1MA 5DD1L 2BRRH 1IKFL 4MJID 2N56A 3Q3GA 2YHGA 4DZBB 4BQBA 1S3KH 4TSAL 4LLQA 1BAFL 2WBJB 3ZDZE 1J8HB 4YAQB 1TTFA 5MEPB 4L9DA 3MROB 4MDIA 5C0CE 4ZAKD 3C8DA 2R1WB 4LRNH 4M61A 3RZCD 5JA8B 3NFNB 1JGLH 4KHTH 4YHLL 4NWTH 1Z9MA 3VFOB 2BMKB 3MJ7A 4I3GA 1AGCB 1A7OH 3RIAF 3BKYL 3VH8B 3P9WB 1YUHB 3SKNA 5C07D 4CMHB 4QHNA 2EC8A 5IF0A 3IAPA 1A7QL 5CIPH 5HGAB 4LLVB 1T03L 4PIRF 3MRHB 1MAML 1D5MB 2IQ9H 3BDYH 1FIGH 4TSBL 3RPIB 1Y0LA 3D2UA 5HYSA 2X9YA 4LLUB 4Z8FH 3PQYB 4J4PC 4B50A 5ICZB 3SDDB 4X6FB 1V3MA 1M7IA 3QQ9D 3RX7A 4Q6IA 5CJOH 3ELAT 5JOPE 5EU4B 3V4PH 4LRIC 1H3TA 3VGDA 1XF3A 3MODL 3UCRA 4P5MA 1MHHA 1U8JA 2VXQL 5DR5L 3MRLA 5EOCL 3J7HA 1JPGB 1P4LA 3QFJA 2CLRA 1A7PH 2R15A 3BEWA 1G0YR 2FJFB 5GHWH 4PGBA 2YUWA 4OLUL 2W38A 4JANB 1G7QA 5CSGA 2QTEA 4M43L 2H2SC 4K2UL 4KMTL 5DUMH 3VXRD 5L9DH 3NZHH 3QEQD 1WSST 1TZGL 4G8GB 1AGBA 5F7UA 1IM3A 5D7KD 4U1NA 1CE1H 2DYPA 2DQUH 4QOKD 4EN3B 4P4KC 1KTLA 5IR1A 2VABB 2MPAL 3TGXA 2ZPKH 4M7ZC 1OLZA 1CD1A 5J89A 3UTQB 3BKCL 4PRID 5C09A 3TCXA 3OSKA 2NZIA 4RWYH 4JPVL 1I7ZB 1TDQA 1KCLA 3EHBD 1X5KA 2CR3A 5I1LB 4AEHL 2NY3B 1V5JA 5IVXA 4TSCH 4Z5RA 4K7FB 4PJHB 1Z5LB 3S37L 2QQQA 3S3SA 3CXDL 3QI9D 1MWAH 3HG1B 4GG8A 3CXHK 5IFJB 4JFYA 3A6BH 4J3OC 2VLJE 1ZSDA 3VD3A 2NZ9D 4UILL 4Y5YA 1SMAA 2OM5A 1EH9A 3B3IB 2QR0B 3G5XB 1KGCE 1SEQH 3TVMB 5JDSB 1EGJH 3GBNL 4YXHH 4YGVA 4UB0H 2EDTA 3VFNA 4TTDD 4OLVL 2XACC 3QPQC 3QG6A 5I1EL 2HTKD 2XNAB 1KJVB 3BPOC 4HGMA 5AZ2H 3LMJH 5GJTH 4ZTPH 5I1CH 3MRMA 3GDBA 4XVJH 1JWMB 1HH6A 1WFNA 3ARUA 2UYLB 2PYFB 4OCSL 4Y4HC 1FRGH 4EI6A 1BOYA 3ARDA 3BGMA 2DICA 4TUJB 3D6GA 5L0QB 2HRLA 4U2YA 1ADQL 3WSQL 4MQSB 3VXOA 4FQXD 1MFAH 3HN3A 3F58H 2NTFB 4Y4FA 1X5GA 1ZA6A 2H9GA 2RCSL 1RZFH 4XGZA 1T1XB 1TPXC 4JRXD 2F5BH 1DZBA 4HPOL 4O51A 5C6WH 1B3JA 2W9DL 1BZ9A 2VITA 5GQBA 3ILPA 4P2RA 3PWPA 3MRFA 2ZOKA 1PVHA 3QAZC 3QUZC 3DURA 1WBXB 2VZOA 1Z6JT 4JDTL 1J1OL 1KC5L 4Y0GA 5CP3H 5EUOA 3SGDI 4FXKA 3KR3H 1CDUA 2JB6A 4HXAL 1HOCB 4QEGA 3E3QE 3KPOB 5C6TL 3CFCL 5HSFA 1T0PB 4OZIF 3PP3H 1TPXB 3IDXL 3GJFH 4WNQA 3MV8E 1JTTA 3CK0L 1J1PL 3G08A 4KVCH 3S5LB 3ZTJH 5I1JH 2DF3A 3L7EB 3TN0B 1LP9B 1ZVSB 5ALCH 1QFPA 3DWTA 5C92A 1F3RB 2F5AL 4YDJA 4NZDA 5D2LB 1NKRA 3D3VA 1DQQA 5EH1A 1RFDL 5DGRA 3KLAA 3IDNB 5CGYC 4UT9L 5L8JB 1FNHA 3FFDA 3RI5K 3SGJA 1YC7A 4ETQA 2YOCA 4TPRL 5DUBB 2NXYC 3H7LA 1RHHB 3IFNL 4LSRL 3MOAH 1QSEA 2WQ8A 2X4RB 3W0WD 2Z8WC 4XVTH 2RIKA 1JWUB 2FATL 4F7CB 1P5VA 4IOFC 3LQAL 1RSFA 1ZGLM 3IVKB 1AR2A 4NQED 4MNHB 5JZ7C 4ZFOA 2B2XH 2DAVA 1XCQB 5D71H 3SE4C 3KDMA 4PRPE 2CUIA 2Z91B 5KS9F 2YPVH 2GIYA 2CJUL 1MWAA 3H0TA 2X4PB 2NX5B 4PJDE 3IDGA 2HMID 2GTZA 3VXTA 2Y1VA 2P45B 5JOEA 5CD5D 5IB1A 5GRVL 4GRLC 4LLQB 4JQVA 4KC3B 3UTPE 4PRAA 5T1MB 3OZ9L 3B8SA 3H9SD 2DBJA 2A6DA 5AUMA 3MTRA 3PWVB 3HAEG 2R1WA 4WU5B 4OZIA 3UJTH 4KROB 4GXVL 3G5YB 1C1EH 1ZLWH 3WNLA 4QF1A 4MAYD 1ERNA 2BMKA 3G6AB 1CVSC 2I5YH 4XP5H 2AK4D 4RFNB 3MJ9A 4NRXB 1CLYL 3T3MF 1S5IL 4UT6H 5ESAB 1INDL 2J6EL 1M7DA 5BW7A 1H3WM 2BY3A 4ERSH 1DEDA 2AP2A 1H8SA 2AEPL 1B0WA 1UM5L 1WC7B 3D2UB 5HYSB 1H15B 1A02N 1NCWH 2A6JA 1KJ3H 4PR5B 3TBSA 5C07E 5ILTH 3HC3L 2BFVH 3I84A 4Y5XC 2A74A 4XXDA 1F2XK 4JY6A 1YMMD 5HGBA 4LP4A 3GBLA 5T1DL 4ELKB 3TBYA 4R96B 1ZLWK 5KSAA 2P7TA 3C6LC 5FOBA 2JKXA 3UBXA 2P48B 4XMPL 4KI5D 2ZNWA 5HJ3B 3MV01 5JQHC 2ATPB 5IT2H 4A6YA 1RJYB 2UVEA 5GRWA 4R7NA 4P2QA 2FJFA 1OGTA 2BOCA 3QI9A 4YDVA 4JY5L 2CDGB 1IEAB 8FABA 1GRWA 4OZGE 5J06A 3PWNA 5CSZB 1F6AB 3MLRL 5J6GB 4BZ1L 4FQXA 1CGSL 4JHAH 2EECA 4M7KH 2DRUA 2D9QB 4KAQH 1CYGA 3RY4A 4LLWB 4TNVF 2R2HB 3ARGD 3VXSD 1A7NL 4XNZB 4FQ1L 3HUJF 5FDWB 2GEEA 1QRNA 2IEPA 4YUEH 2VABA 1EGJA 2HKFL 2YK1L 3EO1A 4Q97A 2BC4B 3UO1H 3BH9A 4FXGB 1UA6H 2YR3A 1RZIA 4HEME 3MRPB 1NBVL 3VXRA 5MEOB 5KSUA 4H1LA 1MUJB 2XFXA 2DD8H 4WEMB 5F1NB 4EN3D 5D2NC 5F7DA 3KPSD 3PHSA 1Z5LA 5ERWA 3MYZA 3KYMA 4OZGB 3MRKA 1AE6L 2ZOLB 3EUUA 1MJUL 2WINA 2Z31D 1SMOA 5B39B 5F3BB 3LN4B 4MSWB 4OZHA 3TVMA 3WXWH 3WUWA 3NAAH 2A6KB 4NZUH 3QWOA 4PV9B 3O9WD 3QULB 5IV2A 5F7NC 2DQIL 3PWPD 5E5RB 3FO2A 3GSRB 1NBYA 5DMGC 1Q72H 3TM6A 2PW2B 4QRSB 3BP4B 2IAND 1MRDH 5BCAA 1BBJB 2VDLL 1KT2A 1CXHA 1EBAA 2OJEA 4F80A 4HKZA 4NNXA 3CU7A 4MD0B 2XWJB 3LSOA 2AQ3A 3OKOB 5B3JE 4G8GD 5F89B 4C54A 1JYXA 3LH2H 3S36X 3K2MC 3T0EA 2K1MA 2F54D 1I3RB 5GS2D 3LS4H 3FQWA 5IEHB 4HIJB 3V2AR 4EIZC 2I07B 2GUOB 3F65A 1RJCA 5I8CA 5FM8A 2DQFA 2EDKA 2MWCA 1SJEB 3MLTB 3C6SB 3H6JA 5GGSY 5JUEH 4ZFZB 1FZMA 3ILPB 4ELME 3V0WL 1GZQA 1IFHL 3NPSB 5SX5K 1IAMA 4RFEB 1IC5L 4E41E 3LD8B 3PWLB 5F9AC 3GMOB 1OW0A 1QSED 2FWOA 2ICWA 3UTSB 5BXFB 4WTZG 4UUJA 1JNHB 3DVGB 1LEGA 1YNLL 3EYFB 3QZWB 5FB8A 4WNQB 4HLZH 2JCCF 1X5LA 4M7JH 4PY8J 1R0AH 3Q3GB 4JRYE 4ESKA 3SEPA 1NLDH 4NQEA 5J12C 3RZCC 5DJ0A 4PG9A 2EYSB 1KPRA 3GK8H 2FO4B 4MDIB 2H6PA 4XHJD 4HWZA 3T4AB 2IMNA 4M61B 3IKCA 2P8MB 4Y2DC 4GG6E 5JIIA 2BOBB 1F58H 4N5EC 5D2NE 5CUSL 4LU5L 3GSNB 3MJ7B 1MCOH 1N26A 5JHDA 3BT2H 4XNYL 1NDMB 1UWEH 4LHUG 4WFGD 5DC0A 5F9JB 4HS3A 1AXTL 1EERB 2BCKB 3MJ6A 4ZUUB 3S36L 3H9HA 2A9MH 2A0LC 3CVHL 3WS6C 4AH2B 3O3AB 1PQZB 3A6OA 4MNGE 1HSBA 1UM4L 4KQ4L 1S78D 4LOUC 5EU4A 4YK4B 2PYED 3FT3A 4S1SH 3G04A 3KDMB 1CT8B 1E0OB 3DXAB 3ZDYE 4BH7A 3N06B 5D1XC 2O5YL 2VAAA 25C8H 1FZKA 1MWAB 4GFTB 5D7SH 3BXNB 3NCJH 5GS2H 4OM0H 2XTJE 3WJJA 2J2ZA 4C56E 3FOMA 4XX1E 4LSPH 1M71B 1G7HB 1ZHNA 3AFLA 4GKNB 1NMAL 2JB5H 1YY9C 2DKSA 2E8ZA 1I9JL 4M48L 1OQXA 5GJSH 1XGQB 4YQXH 5CBEB 2Q6WA 3TYGH 3QB7C 2WANA 4ZTOH 3DRQA 4N68A 1NPUA 4M7LL 2XA8H 1Q8MA 3UTTD 4TOYL 4U1NB 4K7PL 1A5FH 3RDTB 3UTPD 1G0DA 1Z9OA 2LAAA 4N0UE 3BJ91 2FEDC 4ODHH 4NRXA 5EFIA 5A16A 5EZOL 3IXAA 1NGPL 3DVNB 3K8MA 5HXMA 4OSUH 3RZCB 1AGDB 3Q6GH 4HUNB 5J12B 4G42A 4PR5A 3EW3B 1K5NA 2UY7A 5CIPA 1L0QA 1B9ZA 5GGRY 2V17L 3QH3B 1IGIL 1SYSA 3L3IB 5JNYA 3B9KC 3T3PE 4JY6B 3TIEB 4WI7A 4PG2A 1KPVA 1GC1C 2EDHA 3HG1A 4GG8B 3EYSH 2WBWB 4G6KH 4P48A 4HJGA 3GSXB 2W0KA 4OQTH 4BFIB 4ALAH 3D39A 2FB4L 4EBQH 1D5BB 3CFBB 4EVNB 5DRXB 4F9PA 2O5XL 3BPNC 1LE9B 4R7NB 4UAOC 4OD2A 1E4XH 1NC4D 2NX5D 4DW2L 4ODSH 3W82A 2KH2B 2XNAA 1C08B 3G5VA 1EXUB 4KVNH 5LGKA 5DJ2A 1QBBA 1F6AA 5FGCE 4WV1B 5DS8B 1LE5B 3O2DL 2UYLA 2PYFA 4FFWD 2V5YA 1RULL 3I6LD 5BRZA 2AXHA 4MA7L 3K7UA 4X7SL 2V7NB 5GGVH 1PKQE 3W11C 5A43C 4NN6B 5EBLA 3JWNC 2QEJA 3QDGD 4KV5F 1T6VN 4GBXD 5FCUL 2W9EL 1FVCA 2X4OB 3FQXA 4R2GD 4YX2H 1ZHBB 1K4DA 4DUWA 4DZBA 1H5BA 2GTWA 1IGFH 3VXRB 5MEOA 3VXSE 3DIFB 4RZCA 1MUJA 3RU8H 2Y36L 2FR4B 3MREA 1H3VA 3SDYH 2VSDA 3ULUD 4MJ4A 1O5DT 4H25B 4GOSA 1NUFA 3FQUA 5IJVA 1MH5B 5IB4B 1QFWL 4PJXB 1I8MB 4PJXF 3A67L 5CILL 5IBLC 4PJBA 3SDCC 4XPFH 2CMRL 3ABZA 4U3HA 5EN2A 4L4VD 4RFOL 1BBDH 2WV3A 3D18A 1OSPL 1UACL 5EBWA 3W39B 2JJTA 4N8VG 3ARQA 5HHVH 5ID0A 5F6HI 4KQ3H 4KDVA 4LLUA 4C59B 4NJ9H 3BAEH 5TGBB 5JZ7D 1AFVL 4Q6IB 2Q87A 1Q38A 4K94H 4WFEE 3T1FB 1JF6A 4YDJB 2YS4A 3DX6A 2R0KH 2LE9A 3PWPE 2HWZH 5D1ZA 5AWNH 5E99H 3QXDA 5JPMA 4WI3A 5TDOA 3CNKA 1QHPA 1UZ6E 4ZSOE 2R69L 4HWEH 5LWYL 3FFDB 2OTWA 1DDHA 1XR9B 2AV7B 1P4LB 2R29L 3PL6C 4OF3A 3SGEI 4HXBL 1BVLB 1I1AB 4ZNCD 1F5WA 5IVZB 3OR7B 2B4CH 3P0YL 1E6JH 3CVIH 1QHOA 2OXGA 1HINH 2VC2H 4G8GE 1BFVH 1GZPB 2D4FA 4OM1L 2VLME 3WFDH 3BO8A 2ERJC 3E8UH 1BD2D 3EOTH 3OG6B 1UVQA 3MLYL 4PJEF 4DVBA 1G0XA 1P2CB 5F97E 1LEKA 1ZLVK 5GGQH 4YXKH 5T3ZH 5JR1H 3IF1B 1ZMYA 4LCWA 3VMOA 5GGSB 2N7BA 1XGRB 2H3NB 3IYLW 4DN3L 3ULUL 2QADB 3UTSA 5BS0E 3H0TB 1CDGA 5C09E 4JREC 2HT3C 1U8PA 2J8OA 3LKOB 4NO3B 1HCFX 3O6FC 4OAWB 1CR9L 1K2DB 5EA0L 5IBUG 4F37K 1DUZB 1F6LL 4YWGL 2W0LA 3RL2A 2GITA 4OQTA 1YEKH 5IB1B 2GI7A 5JXED 1IAIH 3R8QA 2DKUA 3O9WB 5IVXF 3UBXG 1CS6A 3W9EB 3KS0H 3QHFH 5SX4I 2QSVA 1YECL 1TJIL 1FDLH 3U30B 4LLMA 5MI0C 5K9QI 4HIEB 4TN9A 1F11A 4N1CA 3LQMA 3GSNA 2X4UA 2AABH 2ZSVB 2DOCA 4JFED 1ZSDB 3EYQD 1IQDB 3HZVA 1R3LA 1NDMA 5JHDE 4EDWH 5MP6L 2VDNH 1GH7A 3C5SB 1QSFB 4X5LA 1DEEB 4FG6C 3VFNB 5ESAA 5GGUB 3GSUB 1V7NH 2BSSA 3T0EE 2VXVH 1U6AL 2ESVB 1OOAA 3OV6A 5ICXB 2DQDH 4MB5A 5I75C 5DZOA 3RWIB 5DJ6A 3O3AA 1ZHKA 3M45A 3MJGX 1AO7E 2ICEA 1L4IA 3TT1L 4WFGE 1NFKA 1G9MH 2I60H 5D96B 1FNFA 1HN1A 2AQ1A 4ZD3L 1S7WB 4Y5VB 3GBML 3SOBL 1EEZA 4PJCB 3MGTB 1VFBA 3MV7D 2KQNA 3DETD 1Q9WA 2MHAB 2BVEA 4DEPB 5EOTB 4OT1H 5IGXH 1CLZH 1M71A 1QKZH 2J12B 4UTAL 2XIDA 2VXSL 4N0CC 1IGTA 3WNOA 3SO3C 4O5LL 3I50H 1IRAY 3OAUH 1NLBL 1S7UB 3C5JB 2WUCL 5H2BA 1T0NB 1VPOL 3DXAE 4JZJC 2BSTB 2FJHA 4OB5H 5EUOE 5IHLB 3QNXB 1F13A 5C71A 4P46D 4JFXA 2FGWL 3BE1H 4HK3N 4MQTB 3W9DA 5I73C 1EO8H 3VWJB 4HC1L 3VGHA 1INEH 4X7TB 2UZYB 1EZVX 1CFQA 2C7UB 2VIRB 1M05B 2DLFH 2G60H 5FYLE 4OCYH 1U91A 4JM2D 3BH9B 4HUUB 2NXZD 4S1RL 5C3TA 1OTTC 5CGTA 1CIDA 3MRPA 4KK6D 1JNLL 1VENA 1CIUA 2MQCA 3KPLB 1FL6A 1UWGL 6FABH 3GI9H 1J8HA 2XFXB 1B4RA 1IKNA 2ZP0T 3QZWG 4YR6A 5BRZD 3O41B 2ADJA 3S88H 1IGMH 1V3KA 5ADPL 1KBGL 4DGIL 4OZGA 4JQVC 1PYWB 5J13B 1BIHA 4A2MA 5F9WB 4KJYA 1AGCA 1DQQB 3W5NA 5IHUH 4JPIA 1FPTL 2M26A 4OZHB 3BD5A 4K71C 2R9HC 3QIUB 3NTCH 3QBTB 4XAKE 4ETQB 4JR9L 5F7WC 2NXYB 3HRPA 3O2WL 5IVNA 4PJ9D 4I4WB 3DMMA 2G75A 2UV3A 3BE1L 1A4JA 2XZCH 5D70L 4DFIA 1Y0LB 4AEIH 1JGEB 1DQML 1C5BL 3L3JA 2AW2A 3PQYA 5GS3A 3HZMA 2JK5A 4NQDD 3C5ZD 2VDKH 2P47B 1U36A 4M00A 3RX8A 4O5LH 1NGQL 1XCQA 4NKIH 5I19L 3L1OH 4MD0A 2Z8VC 2VXSH 3P9LA 5HD8C 2HKHH 4W70A 1N4XL 4FG6D 1ZHLA 1KTKE 3ARXA 5F89A 1CLZL 3VGFA 3GHEL 4OT1L 3FRUA 1HIML 4AM0A 4MAYB 1JTPA 3Q2CA 1ZE3C 3D48R 3Q1SL 5HHME 3X12B 4PBWD 3GJFA 3GJEA 1J05B 3V5DA 3DRTA 2DQFB 2EXYC 4P46B 4D0DB 1BGXH 1W2KT 2PCPA 3VXSA 5D6CA 4RGOL 5BVJA 2R23B 1N6QH 3VWJD 5FDYA 3NCMA 1MCWM 1F6FB 4PLNC 5DD5H 2YA1A 4G7VH 3FT2B 5ICYB 2DQDL 4KKNA 4CKVX 4BSJA 4W4NA 4X6CB 4KJQD 1KPUB 4MX7A 2VXVL 1KTLB 1RMFL 4RMWA 3RGHA 4RFNC 4OZGF 3D18B 4UUJB 2ZKHH 1H3PH 1YJDH 1X5ZA 2X70A 1UH3A 4X6BB 4KRPC 2GJZB 1L6XA 1MFDL 2DDQL 3DROB 4TUKL 5DJ0B 1IILE 4PJAB 1XF4B 1BEYL 1TMCB 4HH8A 1EPFA 4FFYH 5ALBL 3MJ9H 1YECH 4PJXE 2XT1B 5HGBB 1FVEB 3T1FA 4H0HB 3E6FA 1ZLSH 5E6ID 1RUKL 5D7IB 3RAJH 3TBYB 3MR9B 4C4KO 3S3JA 4RMRA 3VWJC 3UEZA 4F7EA 3AXLB 1IC1A 4MA1C 3WO4B 5HTSA 4E42A 2W0FB 4X5WB 4YBQD 2AV1A 1OM3H 5DMKA 2ATPA 3AY4A 4XNMA 4M6OH 4IRSA 2A83A 4P2QB 3EZJB 4F8QA 2B1HH 2JIXA 4KRMB 4O4YH 1KJVA 1FNLA 4OI8A 2AEQL 5I8OL 3MRMB 4FQXB 2JJUA 3MLYH 3JVGA 1MJ8L 1BFVL 4NHUA 2UZXB 2OZ4L 3RPKA 5J4MA 1E6JL 4R4FH 5TQ0H 5F88A 4G43B 2VLMD 3HRZB 5C8JA 4OAWA 2EZ0D 4HF5L 1NGXB 2APXA 3RBGA 1Y6MR 3SDDC 3BDXA 5DK2B 4OZFH 4MLIA 5C86A 4LPVA 4YDLC 4PJEE 5HYSG 2ORBH 1KYOJ 1SQ2N 3R4DA 3K8LA 3CDGB 5DRZA 3MRCB 3O6LL 3BN9C 1D5ZB 1UJTA 3BW9B 4OJFL 1G6VK 1QR4A 3D3VE 2O93L 1C12B 1CICA 3QCVL 3MRKB 4K7PY 4NJ9L 3V52L 4N5UA 5GISL 5KZCD 1BP3B 4KRPB 1FNSL 3JWOL 4HKBB 1R3LB 3U0WL 3R8BB 2ADGA 5IG7A 4CVWA 1WCQA 3BP5A 1LO2H 4PD4J 3W11D 4JB9L 3LDBB 4XXCC 5MI0B 2V9RA 4XB7A 9CGTA 4XPFL 3NABH 5KANI 5KVDH 4JFEE 4EI5C 3VRJA 2CO7B 2OSLA 5T3ZD 4GXUM 2PW2A 2ICEB 5F71A 1D6EB 4M03A 1BBJA 1IAKA 1P4IH 1G9NL 2KBGA 2X89D 3UJIH 3T0ED 1J0HA 2FDBP 1IGFL 4KI5F 2MQ0A 3GRWA 3GMQA 3B4NA 5LXGL 3OKNA 4I48A 1UXSB 4BFIA 1CE6B 2Y06H 2VLKA 4KKCC 2OL3A 4U1SA 5T5NG 1RU9L 1RHHA 4ZQKB 5DRXA 3V5HB 5GGVL 5L2KE 5DVLA 4OD2B 3X14A 5IHBA 1YYLH 4X7DC 3MV7E 2FL5A 5AG9A 3MRJB 1WBYB 4MWFB 1XGUA 3SE3C 3F12B 4MQ7A 3WUZA 2EEAA 4J6RH 5AZEH 1UZ8B 1FFNA 3MV9A 1V7ML 1KB5A 3QIWA 3VFPA 3TJEL 3W9DB 2YEZB 5LGHH 5IB5A 1L6ZA 3GB7B 1S9XB 3CFIC 4PGDB 5JXAH 1KJ2A 2VISA 2FJGA 2Z92A 4K71B 1QLFB 1RJLA 2ESVE 1AXIB 1IGJA 2GTZB 4QRPE 4U1MA 3FHAA 4PREB 5FB8B 3FQXB 4QXTB 2Y72A 3EGSB 1PZUB 1H5BB 2GTWB 1CGUA 1X4ZA 3TH3T 5IIEB 3ES6B 1XGTA 1NGZA 3C9NA 1T66D 4QHLB 2IFFH 1G6RB 3PHOA 5HHNB 4YDLB 4H25A 3BGFC 5JW3H 3CX5J 4YNYA 2YA0A 3U46B 3T1WA 4B5EA 4IMLA 1J0YA 4L8BB 3DVFA 2EXYD 5IMMB 4EEEA 4JG1H 3S34L 2VLJA 4GT7A 5E1AB 4CVUA 5EN2B 1T89C 1W0WB 4YE4L 2W0PA 5M7QA 1TQBB 1B6DA 4JEGB 5EC1B 4S1DD 1OTSD 1M7DB 3DNKA 2BNRA 3SO3B 3TBWB 3H9HB 1OP5H 4QHMA 1U8KB 3D25B 4K7PH 4JZJB 2ZZUT 2C4XA 2DL2A 2FX7L 1PQZA 5JORA 3ARPA 1A6UH 2CDEB 3Q6FB 4UMGA 4ZO9A 4YQXL 4AMKL 1AI1L 1I9JH 3C5ZC 4M48H 1QRNE 4R96A 5ITFA 4L1DA 3KVQA 4N0FA 4KJWC 1YEEL 3QXDB 5JPMB 1ZHLB 3OJMB 1YN6B 4M4RA 1FZKB 4NQDE 4H8WL 4EQ2A 2PTTA 2XG4A 3LIZH 3SJVE 3L5IA 3LEYL 2GJJA 2VXUL 5D7SL 2GSGB 4JHZA 3SCMA 2CK0L 4P59L 1C5DA 2FIKA 1J05A 1I9RL 3V6ZB 2E7LA 1GC1H 2G9HA 3QUXC 1IEAA 5T3XL 3UTTA 4GSDL 1XGQA 5JMOC 5IHZB 5GS1C 1UM4H 3MRGA 2CKBH 1BQHB 1JRHL 1YYMH 1JI1A 4UV7H 2PUQT 1GIGH 3L9RB 1N2RA 4MJIE 5KSBA 5TF1L 1Q9KA 3VXME 1SM3H 4MJIB 2VDRH 4G6JH 4RGND 4YHOL 3QXTA 3H7BB 1N5AA 3GSWB 4M7LT 2WBJD 3UJJL 3OR6A 2P5WE 4P23D 1A21A 3HE7B 3GM8A 1DUZA 2GJZA 3LKQA 3OKKB 2GITB 3RVWC 4H1LB 1KLFA 4YDKL 3MC0A 2QSCH 1YMHA 3CH1B 3PDOB 3OB0H 1SYSB 1S9KC 4P57B 1D6VL 5JOFB 2QV2A 2J88H 1UEMA 1OD7A 3D39D 2AJXH 4XXCA 3T3PF 3C8HA 1OL0A 2Z93A 1HHIA 3FN9A 3MGOB 5TFSL 3WHXB 3GSXA 1DBBL 3CAFA 1XT5A 5JDJA 3GM0A 3WUWB 3GMMA 3QA3B 1LK2B 2DQEH 2CUMA 5DMKB 5FUCC 2Q8BL 4JFZL 3UDWA 1CGYA 1T5WB 2R1YA 4R2GC 4WI2A 1FV1A 5DLMH 3C60D 4RAHA 3CSBA 3M17B 1P5UA 2JIXB 1C08A 3G5VB 2VLKD 1T21B 1DBML 4QRSA 4XCCH 2GAZB 4IRJA 4OZFB 3V0WH 2I9TA 5KW9L 2XRAL 1A6TB 2PXYB 3GHBH 1VKXA 1RVFL 5BO1L 3WIIL 2DS4A 2V2XA 3I2CL 2V7NA 3MGTA 4OCWH 3V8CA 3VG9C 1QLEH 5C8JB 1MFCH 4ODVL 5C0FA 2Y7QB 3B2UC 1I3RA 4QOKA 4ZUSB 2Y07H 4DQOL 5EOTA 1FL5B 5IROC 1WAAE 1JGDA 1ZHBA 4QYOB 5DJYA 5M95B 3HZYB 4NM4H 1MHEA 4MDJA 4CMMB 3WBDA 2E8YA 1R5WB 2GJ6B 3PP3K 2AS5M 5CJXA 4HG4K 3C5JA 1S7UA 2VDLH 2OI9B 3V6FB 1AY1L 3B5TA 5I15L 3SGJC 4PGJA 1UC6A 4NZTL 5C0AA 2IBZY 3K4AA 4O58L 4PJXA 2YKLL 1A6ZA 4RFEA 4G8FA 4JFXB 5JO5B 4HX1A 5I73B 3BP5B 5TH2B 2FEEL 3V6OA 3FQNA 4X7TA 4K9EH 3EFFA 5EBWB 5DI8B 3TNNA 1GPOL 5CWSA 1CTNA 5F9DC 5ITBL 1FL6B 2HFEB 4BFEA 1S9WB 5H94B 1KPRB 4JFEA 1KGCD 2BNUB 4WJ5A 1MEXL 3O41A 1MHCB 4FFVC 2AJZA 2WUBH 5D7JC 1NL0H 4M62L 4XZUA 1RK0B 3WJJC 2ZCKH 1PYWA 2BHYA 1WGOA 4QRUB 1RZKH 4UNTA 4KI5C 4F3FA 5TDOB 3C60B 3OKNB 4I48B 1IL1B 3NH7L 2DMKA 1S7QA 1H3UA 2VLKB 4U1SB 2BNQA 2C5DC 4HFUL 4XI5D 4G6FB 5LGJB 4NZJA 2BCKA 5SWSB 3MO1B 2UWEA 4GAJH 1A7NH 3TBVA 3AGVA 1YPZB 5TE6L 4HBCL 1YMMA 4L8DA 4XWGH 3K2UH 2LABA 4PJFA 4LCWD 5D5MB 4N9GB 1YY8B 3LRHA 3E1F1 4JHAL 1TCRB 4DVBB 5LQBH 4OLZL 3F6LA 3A0OA 4RNRB 1U8LA 1XGRA 3QT2A 1KENL 1KYOK 2NY0D 3JWDH 1WWBX 3GEWB 4GQ9H 4NKMB 2YMXL 2APBA 3GB7A 3PP4H 5IT2L 1DANU 1JYNA 1CU4H 3FN0L 1SEBA 1OW0C 5H35A 4QNPF 3ZTJG 1A0QH 1KIPB 4U1MB 5EZJA 4X6DF 1FJ1A 3RDTD 5JW4N 2EDRA 5ESQA 1DBKL 2WBJA 4K55A 1FBIL 2OCFD 3QDMA 1N3NB 3SDAA 5MEPA 2PCPB 1F42A 1X6LA 3MUJA 1LD9B 4DGYL 4E0RA 5CBEA 4JAMB 1WZ1L 2R23A 2ESVD 1OT1A 2VLLB 2O5ZH 4OLWL 4QRPD 4WCYL 3JSSA 4X6EA 3RDTC 1FVDA 1VEOA 4OKDA 3VH8A 3HFML 1CFNA 4R2GB 4DGVH 5KTEH 4ERSL 1I8KB 1U95A 2YPLB 3M1BB 1FFPA 5HGAA 4YLQT 4X4YA 4JJ5A 4FQJH 3WDIA 1RIUL 1VEMA 4P5TC 4I9WD 4NYLB 5KTEL 1U8NA 4PGEB 5I74B 1PEWA 2P5EB 3JTTB 5JA9A 4NBZB 1JHLL 3B9EA 1DQLL 1LQSR 5DJ6B 4WVRA 2XTLA 3O4OB 4A6YH 2O5ZL 3CC5B 3L3IA 1HNGA 3Q6FA 1OPGL 4X98A 3QIBD 2VDQL 4JFQA 3DECA 3RJQB 3HUJE 3W0WE 2QKIA 1AQKH 2NXYD 1GGIH 4EUPH 3QUYD 3VWKC 4XNZC 1FZOB 3MV9E 1Q9WB 2P1YA 2VYRE 4F7MB 4NWUL 2RJMA 3H8NA 2HJKA 1L9NA 2DIBA 2IG2H 1DQJB 1V05A 4PRPD 1ZVYA 1I7TB 4AQOA 3P4LA 4FQLL 4GBXB 4QTIH 3L3OB 3VFWA 4AYFA 4F37F 1GAFH 4FTVA 4U49A 4JQXC 4WV1A 5DS8A 4ETYA 5EOQH 1LE5A 4N9OB 5DEGB 4L3EA 4X6DA 4LLDA 1I1FB 4G8GA 1D3CA 2YZ1A 4UOW1 5E56A 4DK6A 3EJYC 5CGMA 3CCHA 4GAJL 4XCFH 1NCDL 4K3EH 1HHHA 4E41A 2YUZA 4G43A 3IFNH 3U82B 5DD0L 2KDGA 3KPNB 5FYKH 2EIEA 1FVCB 1YEGL 2AK1L 4QRRB 1NGXA 4XNUH 1KNOB 3OKKA 5L8LB 1OTUC 3N1QC 2Q7YB 3RL1B 1NL0L 3IRPX 3KPPB 3ARFD 1ZS8B 2CKBA 3HE7C 1XIWD 4EQ3A 3OKLB 5DEFB 4HUXB 3OAYK 2ENSA 2P5WD 3FFCD 5ESVB 1CFVH 3MBXL 5IJVB 4NQCE 5DD6B 3P77B 4PJCF 1I8MA 5KANG 3MLUL 3CK0H 1PG7H 4M9PA 1CLCA 4GG6F 1II4E 4PJBB 1JZ5A 1NBZB 3KYKL 4O00A 2E27L 4JKWA 2CUHA 4NO2A 1YY9D 4KGJA 4ZUWB 2EO1A 4JDTH 1JGEA 3SE3A 3U83A 3QUXB 3HPLA 1JPSH 5E6IB 3WFZA 3HZMB 5HYQB 1KCSL 4GMSH 4LEOB 3FB5B 3ZKQD 1TZHB 4WW2F 1PX3A 1QEWA 2VQ1A 5DA4A 1RZFL 2RCSH 4X9BA 2D7QA 4JFPA 1KCVH 5ENWB 3GMQB 1RV6X 2YD1A 4U1JB 5DFVC 1UXSA 3OGCA 4MAYA 4HMCA 4MJ5B 4ODVH 2OL3B 3PXHA 1LEIB 1PG7L 4NN7B 2X7LB 5A2FA 4ZQKA 4OCWL 2OYPA 3UPCA 3V6OC 4OF5A 4IRJD 2EC9U 5DRNA 4TQEL 1VGKB 5CCKH 3ULVL 1TENA 3DV4B 1U41A 3VG9B 2J8UE 4ONGL 4X6CF 4LCIH 1XH3A 3G6JE 5BMFH 4P2RB 5I1CL