4WILA

Crystal structure of dcoh2 s51t
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
100
structure length
100
Chain Sequence
DAQWLTAEERDQLIPGLKAAGWSELSERDAIYKEFSFKNFNQAFGFMTRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGGLTKRDVKLAQFIEKAAASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions with the Bifunctional Interface of the Transcriptional Coactivator DCoH1 Are Kinetically Regulated.
pubmed doi rcsb
source organism Mus musculus
molecule tags Lyase
molecule keywords Pterin-4-alpha-carbinolamine dehydratase 2
total genus 34
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2014-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 4wilA00
1DCHA 2EBBA 3HXAA 2V6UA 1F93A 4C45A 2V6TA 1DCOA 4LOWA 2V6SA 4WILA 1DCPA 3JSTA 1RU0A 1USMA 1USOA
chains in the Genus database with same CATH superfamily
2VUMA 1PJ7A 3S16C 3QX3A 3PO3C 2Y0SD 3JSTA 4PAAA 4AYBD 1EFWA 2PA8L 3S17C 1WOPA 4OIOA 3AQPA 2V6SA 1DD5A 3GTQA 1J6VA 4KM9A 2JA5K 4A3DC 5IOSA 3H3VL 1HI9A 3PO2C 1WQFA 3CAGA 4KARA 5EGHA 5IP7K 3ADAC 4X6AK 2XCRB 1UV7A 2JA7A 2CFAB 3L4KA 1XZPA 3LAPA 3AD9C 3TFIA 3BP3A 2RGRA 5TJ3A 3I4MK 4KAWX 3T00A 4C3JC 5C4JC 1K83K 1IL2A 5M3MK 1VLOA 1XXCA 1VJEA 1TWHA 4G7OA 1J6WA 3S1RK 4LJZA 2JH3A 4KC6A 4LR2A 3CQZA 3N0BA 3SZZA 1VGXA 4G0UA 3HOUK 3H3VD 1IW7A 2FQOA 1GE9A 2JA5A 3AD8C 3GTPC 3HOXC 1L0WA 1JQWA 1WIHA 4A3JK 3HOZK 3PO2K 2BE5A 4A3JC 3HOZC 4AH6A 2V6TA 3S16K 4GTAA 4A3CK 3GTKA 2PHCB 2O5JA 4BLBA 3GTMA 5IOQA 4C3IK 1KQ4A 3S1RC 5TMFA 5FLMK 3GTLA 3FKIK 1K83A 5EGEA 4A3KC 1TWFA 3S1NK 1WSVA 3GTOK 3TFHA 4KN7A 3H0GC 2P5MA 2A6EA 2R92A 4YFNA 1I50K 3IPJA 2JA7K 1YNJA 4J3NA 1F7UA 3RZOC 1O27A 1TWCC 2NVXK 1WCMK 1TWGK 1Y1WK 1TWFK 3EQLA 3GTJA 4ZH4A 3HOWC 5FJ8K 4G7ZA 3GTGA 3GTQC 3CQZC 4A93K 4A3EC 3I4NK 3PO3K 5L46A 5IYBK 5IYCK 3A8KA 1V5VA 4A3MC 4GTDA 1O24A 4OIPA 4LK1A 1IQ0A 5IYCC 4XSXA 2B63K 1TWGA 1O26A 2R7ZC 3M4OK 1SFOC 2KWAA 1RU0A 4RMFA 3HOYK 1XPPA 1WORA 3FOFA 4KB2A 4OINA 1R9TK 3S2HK 3GEHA 3OPFA 4A3LC 3FHZA 2E2JC 5C4XC 4KMDA 2YU9C 2O5IA 2PA8D 1TWFC 2XCQA 1XZQB 1Y1WA 1WCMC 3HKZL 2E2HC 1I3QC 1BS2A 3NUHA 5C4XK 1WQHA 4P5AA 4G0VA 1C0AA 4BY7C 1AB4A 2A6HA 1Y1VA 2R93K 3H0GA 1O29A 4BBSK 4OIQA 1XXBA 2R7ZK 3BUEA 2E2IA 5M5XK 3A8IA 2E2IC 1R9TC 3S2HC 1BGWA 3S14K 1X31C 3GTKC 1PJ5A 5C44C 1SFOK 3GTMK 2CFAA 4OIRA 4KMHA 2PMZL 1XZQA 1WOOA 4YFXA 1YCLA 2WAQD 3GTJK 1Y1WC 3FOEA 1TWCK 2NVXC 2A68A 4LK0A 4GT9A 2JA7C 1B4BA 4KMUA 1I6HC 3VA7A 3HOVK 2NVQK 5IP9K 5JVOA 2PPBA 1JOEA 4WJ3M 4QJVB 1O28A 4GTEA 1EH1A 5FLMC 2D6FC 2JA6K 3OEPA 4Y52K 3Q3QA 4A3FC 5M3FK 3S2DC 3M4OC 4GTFA 1O2FB 4KM8A 1G51A 3LAJA 3S1NC 3ERED 4A3CC 5M5YK 3FKIC 4GTCA 3T02A 4GZYA 4MQ9A 4C3HK 3I4NC 2WB1L 4NOIA 5E68A 4DDQA 2NVTC 3BP8C 4FZBA 4G7HA 3HOWK 1ISEA 2ZFZA 3A8JA 2ZUEA 2NVTK 1TWGC 1XZPB 1ZBSA 3GTGK 4A3IK 2E2HK 1K83C 3TTGA 5C3EC 1I50A 5C4JK 3HOUC 1I50C 5HL8A 2GSOA 2Y3PA 2EBBA 4LQYA 4A3BC 1O2BA 3S0XA 2NVXA 4PABA 3RZDK 1DCPA 4A3KK 3RZDC 4X6AC 1TWCA 2PMZD 2NVQC 3S1MK 3HOVC 4LOWA 4C3IC 4Y7NK 3I4MC 4FM9A 4ILDA 3GSIA 5TMCA 1I6HK 1TWAA 1F9NA 4A3DK 4GFQA 5C3EK 4KB4A 4QIWL 4GTLA 4XCHA 4P5BA 1B4AA 3GTLK 2A69A 1ZVUA 1XXAA 3V4GA 4GTBA 2Y0SL 1F93A 3GTLC 3GTPK 4WILA 2JA5C 3N3YA 2RH6A 1USOA 1WSRA 5JFEA 5CJ9A 2GAHC 1BDFA 3S17K 5M5WK 2NVYK 2ZUFA 3HKZD 4Y7NC 3S15C 3S14C 2FQTA 2JA6C 4XLNA 3LPXA 2JA6A 3S1QC 1EQRA 3G4CA 4C3JK 2YU9A 3S2DK 3GDZA 1SMYA 1YNNA 1HQMA 2XCOA 3K7AC 1TWAC 1J6XA 3OREA 4Y52C 1YX2A 1Y1VK 2R93A 4O2DA 4KDDA 3GTGC 1DCHA 1I6VA 3AQOA 4G0WA 1I3QK 3MMLB 1ZYRA 5IP7C 3N0CA 4YFKA 3GIRA 3FKIA 2NVYA 4C2MK 2VUMC 1R9TA 4QIWD 4XLPA 3T01A 1ZXOA 4BY1C 3GTKK 2WAQL 4C3HC 1SFOA 3GTJC 2P8TA 1VH2A 3AH5A 4BBSC 4A3FK 4A3EK 3M3YC 4KATA 2R93C 1I3QA 1VRQC 1ZQ1C 2CW0A 3CQZK 1DCOA 3GEEA 4A93C 1USMA 1JVIA 4C2MC 1EK8A 5IORA 1IS1A 1TWHK 4BBRK 4BKWA 5IYDC 2VUMK 5IP9C 2R92C 1IE0A 4BLAA 4LLGA 3GTOA 4XSZA 4BY7K 4BBRC 2JA8K 4BXXK 4KN4A 3SZYA 5IOTA 1EI6A 4Q5SA 4MEYA 1INNA 4A3GC 1F7VA 1PJ6A 4M1XA 3K7AK 1O25A 4Q4ZA 2V6UA 5D4DA 2GSUA 4MEXA 2E2HA 1WOSA 3S1QK 3HXAA 3GTPA 4A3MK 2GAGC 4C45A 2W7VA 5IYBC 3GTMC 3DXJA 3M3YK 5C44K 2B63A 2NVYC 2B63C 3GTQK 3AD7C 1J98A 2E2IK 4YG2A 4KMAA 2R7ZA 4JK1A 3WODA 3GEIA 3L4JA 4P9SA 4BY1K 4A3GK 4WJ4A 3TFJA 3HOXK 5CHPA 4AYBL 2JA8C 4BXXC 2WB1D 1WQGA 1WCMA 1TWAK 2GSNA 1IBAA 3H0GK 3S1MC 2R92K 1TWHC 2YU9K 5IYDK 3RZOK 2E2JK 4A3LK 1Y1VC 4A3BK 3S15K 4KASA 3HOYC 4QJVA 1O2AA 1BJTA 3GTOC 4A3IC 3G4AA
chains in the Genus database with same CATH topology
1DCHA 2EBBA 3HXAA 2V6UA 1F93A 4C45A 2V6TA 1DCOA 4LOWA 2V6SA 4WILA 1DCPA 3JSTA 1RU0A 1USMA 1USOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCH A;  2EBB A;  3HXA A;  2V6U A;  1F93 A;  4C45 A;  2V6T A;  1DCO A;  4LOW A;  2V6S A;  4WIL A;  1DCP A;  3JST A;  1RU0 A;  1USM A;  1USO A; 
#chains in the Genus database with same CATH topology
 2VUM A;  1PJ7 A;  3S16 C;  3QX3 A;  3PO3 C;  2Y0S D;  3JST A;  4PAA A;  4AYB D;  1EFW A;  2PA8 L;  3S17 C;  1WOP A;  4OIO A;  3AQP A;  2V6S A;  1DD5 A;  3GTQ A;  1J6V A;  4KM9 A;  2JA5 K;  4A3D C;  5IOS A;  3H3V L;  1HI9 A;  3PO2 C;  1WQF A;  3CAG A;  4KAR A;  5EGH A;  5IP7 K;  3ADA C;  4X6A K;  2XCR B;  1UV7 A;  2JA7 A;  2CFA B;  3L4K A;  1XZP A;  3LAP A;  3AD9 C;  3TFI A;  3BP3 A;  2RGR A;  5TJ3 A;  3I4M K;  4KAW X;  3T00 A;  4C3J C;  5C4J C;  1K83 K;  1IL2 A;  5M3M K;  1VLO A;  1XXC A;  1VJE A;  1TWH A;  4G7O A;  1J6W A;  3S1R K;  4LJZ A;  2JH3 A;  4KC6 A;  4LR2 A;  3CQZ A;  3N0B A;  3SZZ A;  1VGX A;  4G0U A;  3HOU K;  3H3V D;  1IW7 A;  2FQO A;  1GE9 A;  2JA5 A;  3AD8 C;  3GTP C;  3HOX C;  1L0W A;  1JQW A;  1WIH A;  4A3J K;  3HOZ K;  3PO2 K;  2BE5 A;  4A3J C;  3HOZ C;  4AH6 A;  2V6T A;  3S16 K;  4GTA A;  4A3C K;  3GTK A;  2PHC B;  2O5J A;  4BLB A;  3GTM A;  5IOQ A;  4C3I K;  1KQ4 A;  3S1R C;  5TMF A;  5FLM K;  3GTL A;  3FKI K;  1K83 A;  5EGE A;  4A3K C;  1TWF A;  3S1N K;  1WSV A;  3GTO K;  3TFH A;  4KN7 A;  3H0G C;  2P5M A;  2A6E A;  2R92 A;  4YFN A;  1I50 K;  3IPJ A;  2JA7 K;  1YNJ A;  4J3N A;  1F7U A;  3RZO C;  1O27 A;  1TWC C;  2NVX K;  1WCM K;  1TWG K;  1Y1W K;  1TWF K;  3EQL A;  3GTJ A;  4ZH4 A;  3HOW C;  5FJ8 K;  4G7Z A;  3GTG A;  3GTQ C;  3CQZ C;  4A93 K;  4A3E C;  3I4N K;  3PO3 K;  5L46 A;  5IYB K;  5IYC K;  3A8K A;  1V5V A;  4A3M C;  4GTD A;  1O24 A;  4OIP A;  4LK1 A;  1IQ0 A;  5IYC C;  4XSX A;  2B63 K;  1TWG A;  1O26 A;  2R7Z C;  3M4O K;  1SFO C;  2KWA A;  1RU0 A;  4RMF A;  3HOY K;  1XPP A;  1WOR A;  3FOF A;  4KB2 A;  4OIN A;  1R9T K;  3S2H K;  3GEH A;  3OPF A;  4A3L C;  3FHZ A;  2E2J C;  5C4X C;  4KMD A;  2YU9 C;  2O5I A;  2PA8 D;  1TWF C;  2XCQ A;  1XZQ B;  1Y1W A;  1WCM C;  3HKZ L;  2E2H C;  1I3Q C;  1BS2 A;  3NUH A;  5C4X K;  1WQH A;  4P5A A;  4G0V A;  1C0A A;  4BY7 C;  1AB4 A;  2A6H A;  1Y1V A;  2R93 K;  3H0G A;  1O29 A;  4BBS K;  4OIQ A;  1XXB A;  2R7Z K;  3BUE A;  2E2I A;  5M5X K;  3A8I A;  2E2I C;  1R9T C;  3S2H C;  1BGW A;  3S14 K;  1X31 C;  3GTK C;  1PJ5 A;  5C44 C;  1SFO K;  3GTM K;  2CFA A;  4OIR A;  4KMH A;  2PMZ L;  1XZQ A;  1WOO A;  4YFX A;  1YCL A;  2WAQ D;  3GTJ K;  1Y1W C;  3FOE A;  1TWC K;  2NVX C;  2A68 A;  4LK0 A;  4GT9 A;  2JA7 C;  1B4B A;  4KMU A;  1I6H C;  3VA7 A;  3HOV K;  2NVQ K;  5IP9 K;  5JVO A;  2PPB A;  1JOE A;  4WJ3 M;  4QJV B;  1O28 A;  4GTE A;  1EH1 A;  5FLM C;  2D6F C;  2JA6 K;  3OEP A;  4Y52 K;  3Q3Q A;  4A3F C;  5M3F K;  3S2D C;  3M4O C;  4GTF A;  1O2F B;  4KM8 A;  1G51 A;  3LAJ A;  3S1N C;  3ERE D;  4A3C C;  5M5Y K;  3FKI C;  4GTC A;  3T02 A;  4GZY A;  4MQ9 A;  4C3H K;  3I4N C;  2WB1 L;  4NOI A;  5E68 A;  4DDQ A;  2NVT C;  3BP8 C;  4FZB A;  4G7H A;  3HOW K;  1ISE A;  2ZFZ A;  3A8J A;  2ZUE A;  2NVT K;  1TWG C;  1XZP B;  1ZBS A;  3GTG K;  4A3I K;  2E2H K;  1K83 C;  3TTG A;  5C3E C;  1I50 A;  5C4J K;  3HOU C;  1I50 C;  5HL8 A;  2GSO A;  2Y3P A;  2EBB A;  4LQY A;  4A3B C;  1O2B A;  3S0X A;  2NVX A;  4PAB A;  3RZD K;  1DCP A;  4A3K K;  3RZD C;  4X6A C;  1TWC A;  2PMZ D;  2NVQ C;  3S1M K;  3HOV C;  4LOW A;  4C3I C;  4Y7N K;  3I4M C;  4FM9 A;  4ILD A;  3GSI A;  5TMC A;  1I6H K;  1TWA A;  1F9N A;  4A3D K;  4GFQ A;  5C3E K;  4KB4 A;  4QIW L;  4GTL A;  4XCH A;  4P5B A;  1B4A A;  3GTL K;  2A69 A;  1ZVU A;  1XXA A;  3V4G A;  4GTB A;  2Y0S L;  1F93 A;  3GTL C;  3GTP K;  4WIL A;  2JA5 C;  3N3Y A;  2RH6 A;  1USO A;  1WSR A;  5JFE A;  5CJ9 A;  2GAH C;  1BDF A;  3S17 K;  5M5W K;  2NVY K;  2ZUF A;  3HKZ D;  4Y7N C;  3S15 C;  3S14 C;  2FQT A;  2JA6 C;  4XLN A;  3LPX A;  2JA6 A;  3S1Q C;  1EQR A;  3G4C A;  4C3J K;  2YU9 A;  3S2D K;  3GDZ A;  1SMY A;  1YNN A;  1HQM A;  2XCO A;  3K7A C;  1TWA C;  1J6X A;  3ORE A;  4Y52 C;  1YX2 A;  1Y1V K;  2R93 A;  4O2D A;  4KDD A;  3GTG C;  1DCH A;  1I6V A;  3AQO A;  4G0W A;  1I3Q K;  3MML B;  1ZYR A;  5IP7 C;  3N0C A;  4YFK A;  3GIR A;  3FKI A;  2NVY A;  4C2M K;  2VUM C;  1R9T A;  4QIW D;  4XLP A;  3T01 A;  1ZXO A;  4BY1 C;  3GTK K;  2WAQ L;  4C3H C;  1SFO A;  3GTJ C;  2P8T A;  1VH2 A;  3AH5 A;  4BBS C;  4A3F K;  4A3E K;  3M3Y C;  4KAT A;  2R93 C;  1I3Q A;  1VRQ C;  1ZQ1 C;  2CW0 A;  3CQZ K;  1DCO A;  3GEE A;  4A93 C;  1USM A;  1JVI A;  4C2M C;  1EK8 A;  5IOR A;  1IS1 A;  1TWH K;  4BBR K;  4BKW A;  5IYD C;  2VUM K;  5IP9 C;  2R92 C;  1IE0 A;  4BLA A;  4LLG A;  3GTO A;  4XSZ A;  4BY7 K;  4BBR C;  2JA8 K;  4BXX K;  4KN4 A;  3SZY A;  5IOT A;  1EI6 A;  4Q5S A;  4MEY A;  1INN A;  4A3G C;  1F7V A;  1PJ6 A;  4M1X A;  3K7A K;  1O25 A;  4Q4Z A;  2V6U A;  5D4D A;  2GSU A;  4MEX A;  2E2H A;  1WOS A;  3S1Q K;  3HXA A;  3GTP A;  4A3M K;  2GAG C;  4C45 A;  2W7V A;  5IYB C;  3GTM C;  3DXJ A;  3M3Y K;  5C44 K;  2B63 A;  2NVY C;  2B63 C;  3GTQ K;  3AD7 C;  1J98 A;  2E2I K;  4YG2 A;  4KMA A;  2R7Z A;  4JK1 A;  3WOD A;  3GEI A;  3L4J A;  4P9S A;  4BY1 K;  4A3G K;  4WJ4 A;  3TFJ A;  3HOX K;  5CHP A;  4AYB L;  2JA8 C;  4BXX C;  2WB1 D;  1WQG A;  1WCM A;  1TWA K;  2GSN A;  1IBA A;  3H0G K;  3S1M C;  2R92 K;  1TWH C;  2YU9 K;  5IYD K;  3RZO K;  2E2J K;  4A3L K;  1Y1V C;  4A3B K;  3S15 K;  4KAS A;  3HOY C;  4QJV A;  1O2A A;  1BJT A;  3GTO C;  4A3I C;  3G4A A; 
#chains in the Genus database with same CATH homology
 1DCH A;  2EBB A;  3HXA A;  2V6U A;  1F93 A;  4C45 A;  2V6T A;  1DCO A;  4LOW A;  2V6S A;  4WIL A;  1DCP A;  3JST A;  1RU0 A;  1USM A;  1USO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...