4WILA

Crystal structure of dcoh2 s51t
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
100
structure length
100
Chain Sequence
DAQWLTAEERDQLIPGLKAAGWSELSERDAIYKEFSFKNFNQAFGFMTRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGGLTKRDVKLAQFIEKAAASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions with the Bifunctional Interface of the Transcriptional Coactivator DCoH1 Are Kinetically Regulated.
pubmed doi rcsb
source organism Mus musculus
molecule tags Lyase
molecule keywords Pterin-4-alpha-carbinolamine dehydratase 2
total genus 34
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2014-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 4wilA00
1DCOA 3HXAA 1DCHA 2V6TA 2V6UA 4LOWA 1USMA 2V6SA 3JSTA 1F93A 4WILA 1USOA 4C45A 1RU0A 1DCPA 2EBBA
chains in the Genus database with same CATH superfamily
2NVQC 4MQ9A 1WQHA 1JQWA 4QIWD 1TWGC 1SFOA 3AQOA 1R9TC 3PO2C 4BKWA 4ZH4A 1WOOA 5D4DA 3S14K 3V4GA 3BUEA 4WJ4A 5M5XK 5IP9C 2GSOA 1INNA 3GEHA 2A6HA 3WODA 4Y7NK 4KMUA 1WQFA 1TWGK 2NVYC 1WOPA 4YFXA 3GTKA 3GEIA 3S17C 4C3JK 4YG2A 2NVXC 3M3YC 4AYBL 3A8IA 2JH3A 3N3YA 2KWAA 3T00A 2E2IA 3GTMK 1XXCA 1YNNA 1O27A 2R92K 1K83A 4XLNA 1WSRA 5C3EK 5IOQA 1VH2A 4A3IC 2CW0A 1K83K 1Y1WK 2RGRA 3FKIK 2B63C 4A3IK 3ADAC 3GTMA 4FZBA 5IOSA 4XLPA 4KB2A 3GTOC 4GZYA 3SZZA 3TFIA 4Q4ZA 2CFAB 3HOXC 1R9TA 2R93K 1WORA 4WILA 4BBRK 2VUMA 3GTKK 1I6HC 4A3FK 4A3JK 1UV7A 3AD7C 4A3CC 1ZQ1C 4BLBA 4OIRA 4A3BK 4A3FC 2R7ZA 1EQRA 3S2DK 2E2JC 1TWCA 3S16K 2GAHC 3MMLB 1O28A 2ZFZA 1SFOK 1YCLA 5L46A 3GTLC 2E2HC 4P9SA 4KN7A 1V5VA 4LJZA 1C0AA 3VA7A 5IYBC 1I6HK 2A68A 3GTPC 2NVXK 5JVOA 4GTLA 3HKZD 1BDFA 3CQZC 3OEPA 2PMZD 1PJ6A 2RH6A 4DDQA 1IW7A 2R92A 2P8TA 5EGHA 3FOEA 4A3KK 3RZDC 2BE5A 4BBSK 4C2MK 3GTPA 4AH6A 4KAWX 3QX3A 3S15K 1IBAA 5CHPA 1IQ0A 1F7UA 2W7VA 5C4XC 3HOUC 3S1NC 3SZYA 3TTGA 1DCPA 1VRQC 2PPBA 4C3IK 2R93C 2WB1D 5M3FK 4KN4A 2GSNA 5C4JK 4KM8A 3GIRA 4PAAA 1YNJA 4A93K 3DXJA 4OIQA 3FOFA 2FQTA 2WAQL 3HOZK 3N0BA 3GTQC 3T01A 1O2BA 4A3EC 1EFWA 4KMDA 5FLMC 1AB4A 4C3IC 2JA8K 1Y1VA 3I4NC 1JVIA 3FKIA 1IS1A 2E2IK 2P5MA 2JA5K 2R7ZC 4A3GK 3H3VL 4GT9A 2Y0SL 3S1QC 2V6TA 2EBBA 5JFEA 4G0WA 3M4OK 4YFKA 1DCHA 1Y1VC 2NVTK 4KM9A 1RU0A 1TWGA 1VLOA 1Y1VK 4OINA 3PO2K 3L4JA 4ILDA 2ZUEA 2NVXA 2JA8C 1TWFC 5IP7K 5IORA 4MEXA 3I4NK 4G7OA 1F7VA 3A8KA 3GTJK 4BY7K 3GTLA 1O2FB 1F9NA 4WJ3M 4XSXA 4G0VA 3K7AC 4LLGA 2V6UA 4GTEA 4A3LC 4FM9A 3NUHA 3K7AK 1XZPB 1I3QC 3LPXA 3T02A 1TWFA 1Y1WC 3S17K 4P5AA 4PABA 3GTOK 4J3NA 1WCMA 5TJ3A 2FQOA 3HXAA 2VUMC 1BGWA 1PJ5A 1Y1WA 1TWAK 1USMA 4BY7C 2E2HA 2PA8D 1TWAA 1IE0A 1WCMC 3Q3QA 4MEYA 3A8JA 3S2HC 1WCMK 4Y7NC 3G4AA 1O26A 3TFJA 3S2HK 5IYDC 4G0UA 1B4AA 4KATA 2YU9C 4P5BA 3HOVC 3GTGC 4LK0A 3I4MK 4XSZA 3AD8C 1VGXA 3CQZA 1TWFK 1XPPA 4GTAA 4KARA 3S1QK 2R92C 1GE9A 5E68A 4A3MK 3S1MK 3GTLK 1YX2A 4YFNA 3S1RK 1XZQA 2WB1L 5IYBK 3HOVK 3G4CA 1ZYRA 5C4XK 3N0CA 4KASA 2JA7A 2JA5A 5C44C 1XZQB 4KDDA 3IPJA 1PJ7A 2JA6C 5C4JC 1TWAC 4OIOA 4BXXK 4A3LK 1BS2A 1HQMA 3S0XA 5TMCA 4A93C 1WIHA 5C3EC 5EGEA 2NVYK 3GTQA 1O2AA 5M3MK 1L0WA 3FKIC 4LR2A 2XCQA 3ERED 1TWHK 4X6AC 4A3JC 3GTGA 3HOWC 1I3QA 1TWHC 2YU9K 4X6AK 2B63A 3HOYC 3GTMC 3HOWK 2O5JA 4G7ZA 2JA6K 3GTOA 4C45A 3CQZK 3S14C 4BXXC 3HOYK 2Y3PA 3S16C 5HL8A 3HOZC 4BY1K 1JOEA 4Y52K 2Y0SD 3RZOC 1DCOA 2B63K 3RZDK 4JK1A 3AQPA 5CJ9A 4GFQA 3RZOK 4Q5SA 2V6SA 2ZUFA 1I50K 2GSUA 1IL2A 3GTJA 1XXBA 5IYCK 1I50C 5TMFA 1F93A 4GTDA 3S1NK 4GTFA 1O29A 4KMAA 2PHCB 2JA5C 1I6VA 3GTPK 3OREA 4LK1A 3CAGA 4QJVB 1ZXOA 4GTCA 1ISEA 3S15C 1HI9A 3PO3C 4A3KC 5FJ8K 4G7HA 2XCOA 4C3JC 3S1RC 2XCRB 5IYCC 4A3EK 1J6WA 5IP7C 3LAJA 1EH1A 4AYBD 5IOTA 3HOUK 1XZPA 2JA6A 3GTKC 1X31C 2PA8L 3L4KA 1J6VA 4KC6A 1TWCK 1I3QK 2YU9A 4BBSC 1J6XA 3TFHA 1EI6A 4C2MC 1TWCC 1G51A 4KMHA 3PO3K 3LAPA 4Y52C 4BY1C 5FLMK 2PMZL 4QIWL 3FHZA 3GTQK 1DD5A 1SFOC 3BP3A 3H0GA 4BBRC 1R9TK 3OPFA 2CFAA 1WSVA 4A3CK 1WOSA 2NVYA 4O2DA 4A3BC 4KB4A 1O25A 1EK8A 1ZVUA 4RMFA 3GDZA 2E2JK 3H0GC 4LOWA 4A3DC 4BLAA 5IP9K 1USOA 1ZBSA 4XCHA 3BP8C 2A6EA 3S1MC 2JA7C 3H0GK 4A3DK 4OIPA 2E2HK 2JA7K 1B4BA 2NVTC 1I50A 2WAQD 3AH5A 3M3YK 5M5WK 2GAGC 1BJTA 3H3VD 1XXAA 3GSIA 4QJVA 2E2IC 5C44K 4A3MC 3AD9C 4NOIA 2R7ZK 4A3GC 1VJEA 3GTJC 1SMYA 3HKZL 3M4OC 4GTBA 1KQ4A 1O24A 2NVQK 2O5IA 4C3HC 5IYDK 4LQYA 2VUMK 3HOXK 1WQGA 4C3HK 5M5YK 3GTGK 3I4MC 2R93A 1TWHA 2A69A 3EQLA 1K83C 1J98A 3GEEA 3JSTA 2D6FC 3S2DC 4M1XA
chains in the Genus database with same CATH topology
1DCOA 3HXAA 1DCHA 2V6TA 2V6UA 4LOWA 1USMA 2V6SA 3JSTA 1F93A 4WILA 1USOA 4C45A 1RU0A 1DCPA 2EBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCO A;  3HXA A;  1DCH A;  2V6T A;  2V6U A;  4LOW A;  1USM A;  2V6S A;  3JST A;  1F93 A;  4WIL A;  1USO A;  4C45 A;  1RU0 A;  1DCP A;  2EBB A; 
#chains in the Genus database with same CATH topology
 2NVQ C;  4MQ9 A;  1WQH A;  1JQW A;  4QIW D;  1TWG C;  1SFO A;  3AQO A;  1R9T C;  3PO2 C;  4BKW A;  4ZH4 A;  1WOO A;  5D4D A;  3S14 K;  3V4G A;  3BUE A;  4WJ4 A;  5M5X K;  5IP9 C;  2GSO A;  1INN A;  3GEH A;  2A6H A;  3WOD A;  4Y7N K;  4KMU A;  1WQF A;  1TWG K;  2NVY C;  1WOP A;  4YFX A;  3GTK A;  3GEI A;  3S17 C;  4C3J K;  4YG2 A;  2NVX C;  3M3Y C;  4AYB L;  3A8I A;  2JH3 A;  3N3Y A;  2KWA A;  3T00 A;  2E2I A;  3GTM K;  1XXC A;  1YNN A;  1O27 A;  2R92 K;  1K83 A;  4XLN A;  1WSR A;  5C3E K;  5IOQ A;  1VH2 A;  4A3I C;  2CW0 A;  1K83 K;  1Y1W K;  2RGR A;  3FKI K;  2B63 C;  4A3I K;  3ADA C;  3GTM A;  4FZB A;  5IOS A;  4XLP A;  4KB2 A;  3GTO C;  4GZY A;  3SZZ A;  3TFI A;  4Q4Z A;  2CFA B;  3HOX C;  1R9T A;  2R93 K;  1WOR A;  4WIL A;  4BBR K;  2VUM A;  3GTK K;  1I6H C;  4A3F K;  4A3J K;  1UV7 A;  3AD7 C;  4A3C C;  1ZQ1 C;  4BLB A;  4OIR A;  4A3B K;  4A3F C;  2R7Z A;  1EQR A;  3S2D K;  2E2J C;  1TWC A;  3S16 K;  2GAH C;  3MML B;  1O28 A;  2ZFZ A;  1SFO K;  1YCL A;  5L46 A;  3GTL C;  2E2H C;  4P9S A;  4KN7 A;  1V5V A;  4LJZ A;  1C0A A;  3VA7 A;  5IYB C;  1I6H K;  2A68 A;  3GTP C;  2NVX K;  5JVO A;  4GTL A;  3HKZ D;  1BDF A;  3CQZ C;  3OEP A;  2PMZ D;  1PJ6 A;  2RH6 A;  4DDQ A;  1IW7 A;  2R92 A;  2P8T A;  5EGH A;  3FOE A;  4A3K K;  3RZD C;  2BE5 A;  4BBS K;  4C2M K;  3GTP A;  4AH6 A;  4KAW X;  3QX3 A;  3S15 K;  1IBA A;  5CHP A;  1IQ0 A;  1F7U A;  2W7V A;  5C4X C;  3HOU C;  3S1N C;  3SZY A;  3TTG A;  1DCP A;  1VRQ C;  2PPB A;  4C3I K;  2R93 C;  2WB1 D;  5M3F K;  4KN4 A;  2GSN A;  5C4J K;  4KM8 A;  3GIR A;  4PAA A;  1YNJ A;  4A93 K;  3DXJ A;  4OIQ A;  3FOF A;  2FQT A;  2WAQ L;  3HOZ K;  3N0B A;  3GTQ C;  3T01 A;  1O2B A;  4A3E C;  1EFW A;  4KMD A;  5FLM C;  1AB4 A;  4C3I C;  2JA8 K;  1Y1V A;  3I4N C;  1JVI A;  3FKI A;  1IS1 A;  2E2I K;  2P5M A;  2JA5 K;  2R7Z C;  4A3G K;  3H3V L;  4GT9 A;  2Y0S L;  3S1Q C;  2V6T A;  2EBB A;  5JFE A;  4G0W A;  3M4O K;  4YFK A;  1DCH A;  1Y1V C;  2NVT K;  4KM9 A;  1RU0 A;  1TWG A;  1VLO A;  1Y1V K;  4OIN A;  3PO2 K;  3L4J A;  4ILD A;  2ZUE A;  2NVX A;  2JA8 C;  1TWF C;  5IP7 K;  5IOR A;  4MEX A;  3I4N K;  4G7O A;  1F7V A;  3A8K A;  3GTJ K;  4BY7 K;  3GTL A;  1O2F B;  1F9N A;  4WJ3 M;  4XSX A;  4G0V A;  3K7A C;  4LLG A;  2V6U A;  4GTE A;  4A3L C;  4FM9 A;  3NUH A;  3K7A K;  1XZP B;  1I3Q C;  3LPX A;  3T02 A;  1TWF A;  1Y1W C;  3S17 K;  4P5A A;  4PAB A;  3GTO K;  4J3N A;  1WCM A;  5TJ3 A;  2FQO A;  3HXA A;  2VUM C;  1BGW A;  1PJ5 A;  1Y1W A;  1TWA K;  1USM A;  4BY7 C;  2E2H A;  2PA8 D;  1TWA A;  1IE0 A;  1WCM C;  3Q3Q A;  4MEY A;  3A8J A;  3S2H C;  1WCM K;  4Y7N C;  3G4A A;  1O26 A;  3TFJ A;  3S2H K;  5IYD C;  4G0U A;  1B4A A;  4KAT A;  2YU9 C;  4P5B A;  3HOV C;  3GTG C;  4LK0 A;  3I4M K;  4XSZ A;  3AD8 C;  1VGX A;  3CQZ A;  1TWF K;  1XPP A;  4GTA A;  4KAR A;  3S1Q K;  2R92 C;  1GE9 A;  5E68 A;  4A3M K;  3S1M K;  3GTL K;  1YX2 A;  4YFN A;  3S1R K;  1XZQ A;  2WB1 L;  5IYB K;  3HOV K;  3G4C A;  1ZYR A;  5C4X K;  3N0C A;  4KAS A;  2JA7 A;  2JA5 A;  5C44 C;  1XZQ B;  4KDD A;  3IPJ A;  1PJ7 A;  2JA6 C;  5C4J C;  1TWA C;  4OIO A;  4BXX K;  4A3L K;  1BS2 A;  1HQM A;  3S0X A;  5TMC A;  4A93 C;  1WIH A;  5C3E C;  5EGE A;  2NVY K;  3GTQ A;  1O2A A;  5M3M K;  1L0W A;  3FKI C;  4LR2 A;  2XCQ A;  3ERE D;  1TWH K;  4X6A C;  4A3J C;  3GTG A;  3HOW C;  1I3Q A;  1TWH C;  2YU9 K;  4X6A K;  2B63 A;  3HOY C;  3GTM C;  3HOW K;  2O5J A;  4G7Z A;  2JA6 K;  3GTO A;  4C45 A;  3CQZ K;  3S14 C;  4BXX C;  3HOY K;  2Y3P A;  3S16 C;  5HL8 A;  3HOZ C;  4BY1 K;  1JOE A;  4Y52 K;  2Y0S D;  3RZO C;  1DCO A;  2B63 K;  3RZD K;  4JK1 A;  3AQP A;  5CJ9 A;  4GFQ A;  3RZO K;  4Q5S A;  2V6S A;  2ZUF A;  1I50 K;  2GSU A;  1IL2 A;  3GTJ A;  1XXB A;  5IYC K;  1I50 C;  5TMF A;  1F93 A;  4GTD A;  3S1N K;  4GTF A;  1O29 A;  4KMA A;  2PHC B;  2JA5 C;  1I6V A;  3GTP K;  3ORE A;  4LK1 A;  3CAG A;  4QJV B;  1ZXO A;  4GTC A;  1ISE A;  3S15 C;  1HI9 A;  3PO3 C;  4A3K C;  5FJ8 K;  4G7H A;  2XCO A;  4C3J C;  3S1R C;  2XCR B;  5IYC C;  4A3E K;  1J6W A;  5IP7 C;  3LAJ A;  1EH1 A;  4AYB D;  5IOT A;  3HOU K;  1XZP A;  2JA6 A;  3GTK C;  1X31 C;  2PA8 L;  3L4K A;  1J6V A;  4KC6 A;  1TWC K;  1I3Q K;  2YU9 A;  4BBS C;  1J6X A;  3TFH A;  1EI6 A;  4C2M C;  1TWC C;  1G51 A;  4KMH A;  3PO3 K;  3LAP A;  4Y52 C;  4BY1 C;  5FLM K;  2PMZ L;  4QIW L;  3FHZ A;  3GTQ K;  1DD5 A;  1SFO C;  3BP3 A;  3H0G A;  4BBR C;  1R9T K;  3OPF A;  2CFA A;  1WSV A;  4A3C K;  1WOS A;  2NVY A;  4O2D A;  4A3B C;  4KB4 A;  1O25 A;  1EK8 A;  1ZVU A;  4RMF A;  3GDZ A;  2E2J K;  3H0G C;  4LOW A;  4A3D C;  4BLA A;  5IP9 K;  1USO A;  1ZBS A;  4XCH A;  3BP8 C;  2A6E A;  3S1M C;  2JA7 C;  3H0G K;  4A3D K;  4OIP A;  2E2H K;  2JA7 K;  1B4B A;  2NVT C;  1I50 A;  2WAQ D;  3AH5 A;  3M3Y K;  5M5W K;  2GAG C;  1BJT A;  3H3V D;  1XXA A;  3GSI A;  4QJV A;  2E2I C;  5C44 K;  4A3M C;  3AD9 C;  4NOI A;  2R7Z K;  4A3G C;  1VJE A;  3GTJ C;  1SMY A;  3HKZ L;  3M4O C;  4GTB A;  1KQ4 A;  1O24 A;  2NVQ K;  2O5I A;  4C3H C;  5IYD K;  4LQY A;  2VUM K;  3HOX K;  1WQG A;  4C3H K;  5M5Y K;  3GTG K;  3I4M C;  2R93 A;  1TWH A;  2A69 A;  3EQL A;  1K83 C;  1J98 A;  3GEE A;  3JST A;  2D6F C;  3S2D C;  4M1X A; 
#chains in the Genus database with same CATH homology
 1DCO A;  3HXA A;  1DCH A;  2V6T A;  2V6U A;  4LOW A;  1USM A;  2V6S A;  3JST A;  1F93 A;  4WIL A;  1USO A;  4C45 A;  1RU0 A;  1DCP A;  2EBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...