4WILA

Crystal structure of dcoh2 s51t
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
100
structure length
100
Chain Sequence
b'DAQWLTAEERDQLIPGLKAAGWSELSERDAIYKEFSFKNFNQAFGFMTRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGGLTKRDVKLAQFIEKAAASL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pterin-4-alpha-carbinolamine dehydratase 2
publication title Interactions with the Bifunctional Interface of the Transcriptional Coactivator DCoH1 Are Kinetically Regulated.
pubmed doi rcsb
source organism Mus musculus
molecule tags Lyase
total genus 34
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2014-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 4wilA00
1DCPA 1USOA 2V6UA 2V6SA 2V6TA 1RU0A 2EBBA 4WILA 1DCHA 1USMA 3HXAA 4C45A 1DCOA 4LOWA 1F93A 3JSTA
chains in the Genus database with same CATH superfamily
3OREA 1K83C 3AD7C 3HOYK 2Y0SL 4Q4ZA 3GIRA 3G4AA 1XXAA 1TWCK 3NUHA 4C2MC 3HOXC 4A3EK 1HI9A 5IP9C 5C44K 5TMFA 1WSVA 2NVYA 3CQZC 5C4XK 4A3LK 1DCPA 1O28A 4GTAA 4A3JK 1WOSA 2Y3PA 1Y1VK 4LLGA 4AYBL 2E2JC 3HOUK 2FQOA 3S14K 1EFWA 4Y7NC 4A3DC 3AQOA 3GTJC 2E2IC 2R93C 1JQWA 3HOWC 4Y52K 3FKIK 1TWCA 4OIOA 2NVTK 3GTGC 4LQYA 1F7VA 4KMDA 4BBRK 4LK1A 3HKZL 3V4GA 3K7AC 1G51A 1XPPA 2BE5A 1Y1VA 3GTQC 1ZYRA 4ILDA 1O26A 4A3MC 4GTLA 4BY7C 2WAQD 4GTEA 1X31C 2EBBA 3FKIA 5CJ9A 3M3YC 1WQFA 1WOOA 2Y0SD 4O2DA 4AH6A 3S17C 4QIWL 1J6WA 4C45A 1O2BA 1YNNA 3S1MK 1IS1A 4PAAA 4BY1K 3S15C 1B4AA 4BLBA 2D6FC 1DD5A 1I50C 5IYCK 3EQLA 4BBSC 1USMA 4AYBD 3IPJA 4KAWX 3GTKK 3S1QK 4NOIA 2V6UA 4A3GK 1F9NA 3S2HK 1TWHC 1EH1A 4P5BA 4G7HA 1ZBSA 1WCMC 4QJVB 1F7UA 4KMUA 4DDQA 2E2HC 2CW0A 2A69A 2JA6C 3HKZD 5IP7K 5M3FK 4A3CC 3GEHA 5M3MK 2JA5K 3GTKA 1TWFK 4GTCA 1F93A 2E2IK 3HOZK 4G0VA 4BXXK 4KN7A 1O29A 3M4OC 1YX2A 4QIWD 2CFAB 4YFNA 1WOPA 2O5IA 5CHPA 3S2DC 2JA5A 2NVXC 1TWFA 2GSOA 3H0GK 3A8IA 3TFHA 4XCHA 3LPXA 1EI6A 5IYBK 5FLMK 3GTMK 3JSTA 3S1RK 3S16C 1HQMA 1WIHA 3I4NC 3S17K 2WB1L 3AH5A 1IBAA 2CFAA 2VUMK 1L0WA 4JK1A 4KARA 4A3KK 1SFOK 4Q5SA 3GEIA 3H0GA 3MMLB 2R92C 4KB4A 1R9TK 3GTOC 2FQTA 4A3IK 3GTMA 1IW7A 4GTDA 1I6HK 4A93K 4G0WA 4KB2A 4WJ3M 1IE0A 1O24A 2VUMA 3PO3C 3RZDC 2E2HK 1VH2A 4C3HK 1SFOA 1TWAK 3PO2C 4A3BK 1Y1WK 3Q3QA 2JA7C 2R7ZC 1BS2A 3HOVC 2NVQC 1R9TA 3RZOC 3FOEA 2RGRA 3CAGA 1DCHA 3GTLC 4C3JC 3N3YA 2B63K 4RMFA 1RU0A 4A3FC 2WB1D 1EQRA 4X6AK 3I4MC 1AB4A 2JA8K 1XXCA 3HXAA 2E2HA 1O2FB 1TWAA 4C3IC 2KWAA 1Y1WA 2YU9K 4ZH4A 5C4JC 4G7ZA 1DCOA 3S1NC 2NVXK 3GTPK 1I3QK 3SZZA 4WILA 3WODA 1GE9A 5M5WK 3AD9C 4WJ4A 2B63A 3S16K 1WSRA 4YFXA 1SMYA 1K83K 2NVYC 4P9SA 5C3EC 1IL2A 1EK8A 2YU9A 1XZPB 4KASA 1UV7A 1BDFA 3HOYC 4LJZA 2NVXA 3GTPA 1I3QA 4C2MK 3HOXK 4XLPA 5IP9K 4MEXA 3SZYA 5E68A 1PJ6A 5JFEA 1TWCC 3CQZK 4A3EC 2V6SA 5C44C 4BKWA 1J6XA 1XZQB 1K83A 5C4XC 2E2JK 4A3LC 4A3JC 4G0UA 4KC6A 5EGHA 1Y1VC 4Y7NK 1XZPA 4GT9A 4A3DK 3GTJK 3FOFA 2R93K 2GAGC 4BLAA 3VA7A 3HOUC 3HOWK 3S14C 5TJ3A 4QJVA 3GTGK 5FJ8K 2RH6A 3FKIC 4Y52C 2PPBA 3CQZA 3TFIA 1YNJA 3K7AK 2NVTC 1XZQA 4KMAA 3OPFA 5HL8A 3GTQK 1ZQ1C 4BBRC 3GTLK 4A3MK 4KATA 4BY7K 1WORA 4A3FK 4XLNA 3GTJA 2R93A 2E2IA 1INNA 3M3YK 4C3IK 3GTGA 2A68A 3L4JA 3S15K 3GTQA 2O5JA 3T00A 3S1MC 4KDDA 3L4KA 3S0XA 1I50K 3BP8C 4BY1C 4XSZA 2XCRB 3A8JA 2GAHC 4MEYA 4BBSK 4FM9A 4GTFA 3H3VL 5IYCC 4OIQA 2PA8L 4GFQA 4KM8A 3OEPA 1TWHK 4OIRA 3GTKC 3S1QC 1J6VA 2PHCB 3AD8C 4A3GC 2P5MA 1PJ7A 5IOQA 1WCMK 3S2HC 5IORA 5M5XK 1VJEA 4GZYA 2A6HA 1I50A 3AQPA 2JA6K 2XCOA 4A3CK 1O25A 5IOSA 2P8TA 4KN4A 3ADAC 3BP3A 5IP7C 4OINA 1KQ4A 2JA5C 1TWHA 1TWFC 3LAPA 4MQ9A 5JVOA 3N0BA 1WCMA 3M4OK 1TWGC 1VLOA 1O27A 3HOZC 4BXXC 1C0AA 2JA6A 1YCLA 4GTBA 2ZUEA 3S2DK 2V6TA 3A8KA 4KM9A 2ZFZA 4KMHA 3H0GC 5L46A 2PMZL 4YFKA 3T01A 3H3VD 3I4NK 5IYDC 1B4BA 3G4CA 2PA8D 2W7VA 5IYBC 5FLMC 1I6VA 5M5YK 3GTMC 1V5VA 3S1RC 4M1XA 3TFJA 4YG2A 1USOA 2XCQA 5EGEA 4LK0A 1ZVUA 2VUMC 4FZBA 2R92K 4J3NA 3TTGA 4OIPA 4P5AA 4A3KC 1SFOC 2A6EA 3GTOK 2ZUFA 4LOWA 1VRQC 3QX3A 3GSIA 5IOTA 5D4DA 1R9TC 4A3IC 4XSXA 1I6HC 3N0CA 3PO3K 4A93C 1O2AA 3DXJA 4LR2A 3RZDK 4PABA 3GDZA 3T02A 3PO2K 2R7ZK 2R92A 3LAJA 2JA7K 3HOVK 2NVQK 3RZOK 2GSNA 4C3HC 3GTOA 1TWAC 4A3BC 1Y1WC 1BJTA 1IQ0A 4C3JK 3BUEA 2PMZD 1TWGK 3GEEA 2B63C 3I4MK 2GSUA 3FHZA 2R7ZA 1JOEA 2JA7A 1J98A 5TMCA 5C4JK 4X6AC 2JA8C 3S1NK 1JVIA 1ZXOA 2YU9C 1PJ5A 1BGWA 1VGXA 3GTPC 3ERED 1I3QC 3GTLA 1ISEA 2JH3A 4G7OA 5IYDK 1WQHA 2NVYK 1TWGA 1XXBA 5C3EK 1WQGA 2WAQL
chains in the Genus database with same CATH topology
1DCPA 1USOA 2V6UA 2V6SA 2V6TA 1RU0A 2EBBA 4WILA 1DCHA 1USMA 3HXAA 4C45A 1DCOA 4LOWA 1F93A 3JSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCP A;  1USO A;  2V6U A;  2V6S A;  2V6T A;  1RU0 A;  2EBB A;  4WIL A;  1DCH A;  1USM A;  3HXA A;  4C45 A;  1DCO A;  4LOW A;  1F93 A;  3JST A; 
#chains in the Genus database with same CATH topology
 3ORE A;  1K83 C;  3AD7 C;  3HOY K;  2Y0S L;  4Q4Z A;  3GIR A;  3G4A A;  1XXA A;  1TWC K;  3NUH A;  4C2M C;  3HOX C;  4A3E K;  1HI9 A;  5IP9 C;  5C44 K;  5TMF A;  1WSV A;  2NVY A;  3CQZ C;  5C4X K;  4A3L K;  1DCP A;  1O28 A;  4GTA A;  4A3J K;  1WOS A;  2Y3P A;  1Y1V K;  4LLG A;  4AYB L;  2E2J C;  3HOU K;  2FQO A;  3S14 K;  1EFW A;  4Y7N C;  4A3D C;  3AQO A;  3GTJ C;  2E2I C;  2R93 C;  1JQW A;  3HOW C;  4Y52 K;  3FKI K;  1TWC A;  4OIO A;  2NVT K;  3GTG C;  4LQY A;  1F7V A;  4KMD A;  4BBR K;  4LK1 A;  3HKZ L;  3V4G A;  3K7A C;  1G51 A;  1XPP A;  2BE5 A;  1Y1V A;  3GTQ C;  1ZYR A;  4ILD A;  1O26 A;  4A3M C;  4GTL A;  4BY7 C;  2WAQ D;  4GTE A;  1X31 C;  2EBB A;  3FKI A;  5CJ9 A;  3M3Y C;  1WQF A;  1WOO A;  2Y0S D;  4O2D A;  4AH6 A;  3S17 C;  4QIW L;  1J6W A;  4C45 A;  1O2B A;  1YNN A;  3S1M K;  1IS1 A;  4PAA A;  4BY1 K;  3S15 C;  1B4A A;  4BLB A;  2D6F C;  1DD5 A;  1I50 C;  5IYC K;  3EQL A;  4BBS C;  1USM A;  4AYB D;  3IPJ A;  4KAW X;  3GTK K;  3S1Q K;  4NOI A;  2V6U A;  4A3G K;  1F9N A;  3S2H K;  1TWH C;  1EH1 A;  4P5B A;  4G7H A;  1ZBS A;  1WCM C;  4QJV B;  1F7U A;  4KMU A;  4DDQ A;  2E2H C;  2CW0 A;  2A69 A;  2JA6 C;  3HKZ D;  5IP7 K;  5M3F K;  4A3C C;  3GEH A;  5M3M K;  2JA5 K;  3GTK A;  1TWF K;  4GTC A;  1F93 A;  2E2I K;  3HOZ K;  4G0V A;  4BXX K;  4KN7 A;  1O29 A;  3M4O C;  1YX2 A;  4QIW D;  2CFA B;  4YFN A;  1WOP A;  2O5I A;  5CHP A;  3S2D C;  2JA5 A;  2NVX C;  1TWF A;  2GSO A;  3H0G K;  3A8I A;  3TFH A;  4XCH A;  3LPX A;  1EI6 A;  5IYB K;  5FLM K;  3GTM K;  3JST A;  3S1R K;  3S16 C;  1HQM A;  1WIH A;  3I4N C;  3S17 K;  2WB1 L;  3AH5 A;  1IBA A;  2CFA A;  2VUM K;  1L0W A;  4JK1 A;  4KAR A;  4A3K K;  1SFO K;  4Q5S A;  3GEI A;  3H0G A;  3MML B;  2R92 C;  4KB4 A;  1R9T K;  3GTO C;  2FQT A;  4A3I K;  3GTM A;  1IW7 A;  4GTD A;  1I6H K;  4A93 K;  4G0W A;  4KB2 A;  4WJ3 M;  1IE0 A;  1O24 A;  2VUM A;  3PO3 C;  3RZD C;  2E2H K;  1VH2 A;  4C3H K;  1SFO A;  1TWA K;  3PO2 C;  4A3B K;  1Y1W K;  3Q3Q A;  2JA7 C;  2R7Z C;  1BS2 A;  3HOV C;  2NVQ C;  1R9T A;  3RZO C;  3FOE A;  2RGR A;  3CAG A;  1DCH A;  3GTL C;  4C3J C;  3N3Y A;  2B63 K;  4RMF A;  1RU0 A;  4A3F C;  2WB1 D;  1EQR A;  4X6A K;  3I4M C;  1AB4 A;  2JA8 K;  1XXC A;  3HXA A;  2E2H A;  1O2F B;  1TWA A;  4C3I C;  2KWA A;  1Y1W A;  2YU9 K;  4ZH4 A;  5C4J C;  4G7Z A;  1DCO A;  3S1N C;  2NVX K;  3GTP K;  1I3Q K;  3SZZ A;  4WIL A;  3WOD A;  1GE9 A;  5M5W K;  3AD9 C;  4WJ4 A;  2B63 A;  3S16 K;  1WSR A;  4YFX A;  1SMY A;  1K83 K;  2NVY C;  4P9S A;  5C3E C;  1IL2 A;  1EK8 A;  2YU9 A;  1XZP B;  4KAS A;  1UV7 A;  1BDF A;  3HOY C;  4LJZ A;  2NVX A;  3GTP A;  1I3Q A;  4C2M K;  3HOX K;  4XLP A;  5IP9 K;  4MEX A;  3SZY A;  5E68 A;  1PJ6 A;  5JFE A;  1TWC C;  3CQZ K;  4A3E C;  2V6S A;  5C44 C;  4BKW A;  1J6X A;  1XZQ B;  1K83 A;  5C4X C;  2E2J K;  4A3L C;  4A3J C;  4G0U A;  4KC6 A;  5EGH A;  1Y1V C;  4Y7N K;  1XZP A;  4GT9 A;  4A3D K;  3GTJ K;  3FOF A;  2R93 K;  2GAG C;  4BLA A;  3VA7 A;  3HOU C;  3HOW K;  3S14 C;  5TJ3 A;  4QJV A;  3GTG K;  5FJ8 K;  2RH6 A;  3FKI C;  4Y52 C;  2PPB A;  3CQZ A;  3TFI A;  1YNJ A;  3K7A K;  2NVT C;  1XZQ A;  4KMA A;  3OPF A;  5HL8 A;  3GTQ K;  1ZQ1 C;  4BBR C;  3GTL K;  4A3M K;  4KAT A;  4BY7 K;  1WOR A;  4A3F K;  4XLN A;  3GTJ A;  2R93 A;  2E2I A;  1INN A;  3M3Y K;  4C3I K;  3GTG A;  2A68 A;  3L4J A;  3S15 K;  3GTQ A;  2O5J A;  3T00 A;  3S1M C;  4KDD A;  3L4K A;  3S0X A;  1I50 K;  3BP8 C;  4BY1 C;  4XSZ A;  2XCR B;  3A8J A;  2GAH C;  4MEY A;  4BBS K;  4FM9 A;  4GTF A;  3H3V L;  5IYC C;  4OIQ A;  2PA8 L;  4GFQ A;  4KM8 A;  3OEP A;  1TWH K;  4OIR A;  3GTK C;  3S1Q C;  1J6V A;  2PHC B;  3AD8 C;  4A3G C;  2P5M A;  1PJ7 A;  5IOQ A;  1WCM K;  3S2H C;  5IOR A;  5M5X K;  1VJE A;  4GZY A;  2A6H A;  1I50 A;  3AQP A;  2JA6 K;  2XCO A;  4A3C K;  1O25 A;  5IOS A;  2P8T A;  4KN4 A;  3ADA C;  3BP3 A;  5IP7 C;  4OIN A;  1KQ4 A;  2JA5 C;  1TWH A;  1TWF C;  3LAP A;  4MQ9 A;  5JVO A;  3N0B A;  1WCM A;  3M4O K;  1TWG C;  1VLO A;  1O27 A;  3HOZ C;  4BXX C;  1C0A A;  2JA6 A;  1YCL A;  4GTB A;  2ZUE A;  3S2D K;  2V6T A;  3A8K A;  4KM9 A;  2ZFZ A;  4KMH A;  3H0G C;  5L46 A;  2PMZ L;  4YFK A;  3T01 A;  3H3V D;  3I4N K;  5IYD C;  1B4B A;  3G4C A;  2PA8 D;  2W7V A;  5IYB C;  5FLM C;  1I6V A;  5M5Y K;  3GTM C;  1V5V A;  3S1R C;  4M1X A;  3TFJ A;  4YG2 A;  1USO A;  2XCQ A;  5EGE A;  4LK0 A;  1ZVU A;  2VUM C;  4FZB A;  2R92 K;  4J3N A;  3TTG A;  4OIP A;  4P5A A;  4A3K C;  1SFO C;  2A6E A;  3GTO K;  2ZUF A;  4LOW A;  1VRQ C;  3QX3 A;  3GSI A;  5IOT A;  5D4D A;  1R9T C;  4A3I C;  4XSX A;  1I6H C;  3N0C A;  3PO3 K;  4A93 C;  1O2A A;  3DXJ A;  4LR2 A;  3RZD K;  4PAB A;  3GDZ A;  3T02 A;  3PO2 K;  2R7Z K;  2R92 A;  3LAJ A;  2JA7 K;  3HOV K;  2NVQ K;  3RZO K;  2GSN A;  4C3H C;  3GTO A;  1TWA C;  4A3B C;  1Y1W C;  1BJT A;  1IQ0 A;  4C3J K;  3BUE A;  2PMZ D;  1TWG K;  3GEE A;  2B63 C;  3I4M K;  2GSU A;  3FHZ A;  2R7Z A;  1JOE A;  2JA7 A;  1J98 A;  5TMC A;  5C4J K;  4X6A C;  2JA8 C;  3S1N K;  1JVI A;  1ZXO A;  2YU9 C;  1PJ5 A;  1BGW A;  1VGX A;  3GTP C;  3ERE D;  1I3Q C;  3GTL A;  1ISE A;  2JH3 A;  4G7O A;  5IYD K;  1WQH A;  2NVY K;  1TWG A;  1XXB A;  5C3E K;  1WQG A;  2WAQ L; 
#chains in the Genus database with same CATH homology
 1DCP A;  1USO A;  2V6U A;  2V6S A;  2V6T A;  1RU0 A;  2EBB A;  4WIL A;  1DCH A;  1USM A;  3HXA A;  4C45 A;  1DCO A;  4LOW A;  1F93 A;  3JST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...