4WJ3C

Crystal structure of the asparagine transamidosome from pseudomonas aeruginosa
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
b'MALERSDVEKIAHLARLGLSEADLPRTTETLNNILGLIDQMQAVDTSGVEPLAHPLEATQRLRPDAVTETDHRDAYQTIAPAVEEGLYLVPKVIES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
molecule tags Ligase/rna
source organism Pseudomonas aeruginosa pao1
publication title Structure of the Pseudomonas aeruginosa transamidosome reveals unique aspects of bacterial tRNA-dependent asparagine biosynthesis
pubmed doi rcsb
total genus 15
structure length 96
sequence length 96
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02686 Glu-tRNAGln Glu-tRNAGln amidotransferase C subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.60 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wj3C01
3A1IA 2G5HC 2DQNC 3H0RC 2DF4C 3A1KA 2G5IC 3IP4C 2F2AC 3H0MC 3AL0C 4WJ3C 3KFUG 3H0LC
chains in the Genus database with same CATH superfamily
3KUYB 5B24C 1Z2CB 5GSUA 2NZDC 3A6ND 1P3PB 5B2JB 4R8PD 4CAYA 5CP6B 3AZJD 4KGCA 2FJ7D 1M18B 2NQBA 3AZMD 5E5AA 5B33A 5GXQC 5GT0A 1P3GD 5GSUB 3NQUB 4WU9D 4J8UA 5B33C 4KGCB 3X1SB 5C3IB 1P3BD 2Y2GA 3W96A 5B2JA 4JJND 2YFVA 3MGSD 3X1VC 4J8WC 3UTBC 3UTBD 3NQJB 5AVCC 4ZUXB 3X1VB 4J8WB 1B6WA 4YM6D 4WV4B 5KDMB 3VH5W 3REKB 1AOID 2AROB 5DNNA 5B33D 3WTPA 4KGCC 1P3AB 5B40C 4WU8D 1P34D 1BH8A 3AZKA 2LY8A 4J8VB 1P3LC 3B6GA 1P3OB 3F6TA 4Z5TA 4DRBA 2RVQD 5AV8B 3W96D 1BFMA 4ZBJB 3MGPB 4EO5C 3MGRA 3W96C 3MVDA 4H9OB 5B1LC 5AVCA 5JRGB 3AV1B 4YS3C 3TU4C 1ID3D 1P3PD 5AV8C 2Y2KA 2ZY5A 3H0RC 1KU5A 5CP6D 1P3OC 1P3LD 3TU4A 4YS3A 1T3UA 3AZHC 5GSUD 3V9RA 2DQNC 1P3AC 2YFWB 4XZQA 3AFAC 3MGQD 5AV9D 5AY8C 3WAAB 2AROC 2L5AA 4XUJA 3UTAD 1ZLAB 1BH9B 2Y2JA 2BG1A 3A1KA 3V9RB 3AZLC 5B32B 3X1UB 5AVCB 3REJD 5B31G 3MGSB 4KUDB 3KXBA 5GT0D 5B0ZA 1KX3B 1EQZD 3X1VD 2Y2HA 4X23D 3VH5T 1P3GC 2ZY3A 3B0CW 3R45A 3X1SC 4X23C 1P3BC 5B33B 2Y2OA 3O62C 4LD9D 2NZDD 4WU9C 3AZLD 5CPKB 3LJAA 1F66C 2XD1A 2BYKB 3AZMC 3KUYA 4AWLC 5B2JC 3AZJC 5B2ID 5B32A 3WA9D 2F8NA 3MGPD 4QLCC 5CPIC 5JA4A 4KUDA 3A6NC 1N1JA 3C1CA 3KUYC 5B0ZD 1HQ3D 3LZ0B 3WA9A 5B31B 5CPIA 5B0ZC 3REJA 5AV6B 5DNMB 3AV1D 5B40B 3W97B 5BS7C 3WA9C 3X1TA 5B1LD 1Q9CA 3B6FC 3X1SA 5AV5C 5B32G 3VH6W 2BYKA 5G49B 4Z2MG 3LJAC 5B0YA 3AV2A 1P3KA 1P3MB 4G92B 3WAAD 3UTAB 1WWIA 4H9RA 4H9QB 3KWQD 5B32D 4KUDD 1KX3D 3REIC 5AVBC 4XZQB 2FFFB 4WJ3C 3X1TD 3UTAC 1PZRA 4UUZA 5CHLB 5AY8D 5AV9C 1P3LA 4LD9B 3EPJA 2NZDB 3AYWD 3AZLB 1P3FD 2BYMA 3B0BA 3AZFA 1M19C 3LZ1A 3AN2A 2PYOD 3WA9B 1P3FA 2BYMB 5GXQD 2CV5B 2NZDA 1P3IC 5AV6D 5AVBA 1JFIA 3W97D 3R45B 5E5AC 3B0DC 3W99A 5B1LB 5B24D 3O62A 1M18D 3AZMB 1WWSA 1P3PA 4J8UC 3WTPD 2JSSA 3W99C 5B1MD 2ZY2A 4NFTA 5CPJC 3LZ1D 3MNNA 4J8XC 3AN2D 1B67A 4XUJB 3LELC 4Z2MH 3AZJA 4KGCD 2FJ7A 3C1BB 1P3BB 3AZEA 3KXBC 3A6NA 4R8PA 5B2IA 2F8NK 3UT9B 3MGSA 1AOIC 2YFVB 3KXBB 4UPKA 4CSRB 5G49A 2HIOB 4ZUXD 5CPJB 3MGSC 4J8WD 3RELB 4XZQD 3MGQA 1P3BA 5FUGB 2W8SA 4H9PA 1TAFA 2XD5A 3REKC 3X1TB 3B6FA 4CSRA 3REHD 5BO0B 1KX4C 5CP6A 4WU8B 3AZHA 3W98C 3B6GC 3C1BA 1P3IB 3REHA 5B0YD 3AZGD 3AV2D 1P3KD 5JA4B 3KSYA 3MGRD 1S32D 5AY8A 3H0MC 1KX5A 5GXQB 2CV5D 1HTAA 5BS7A 5BT1D 4WU8A 4H9SA 1KX3A 5JRGD 1ID3B 5GT3A 3AZIA 1KX5C 1P3GA 1HQ3A 2HIOC 5B24B 3C1CD 4DQYB 4J8VC 1P3LB 5GT3C 3AZIC 3WTPB 4XZQC 3AZFC 1M19A 3LZ1B 3AN2B 5F99A 4XUJD 1BH9A 4XUJC 5B24A 2Y2LA 1TZYB 3UTBA 4Z66D 3RELA 3UT9D 5F99C 1ZLAD 2G5HC 3NQUA 3X1UD 1R4VA 5GT0B 2HUEB 5CPJD 2IO5B 1ULYA 2Y2MA 1U35D 3AZEB 2CV5C 3AZKC 1TZYC 3WKJD 3REHB 2NQBC 5CPKD 5DNMC 5AV6C 3MNNC 4CAYB 1TZYA 3MGRC 5B0YB 3AZGC 3AV2B 1P3KB 1P3MA 4G91C 1S32B 3EPLA 5B2IB 5B31A 4QLCB 5CPIB 4HGAC 4NE6A 1P34A 1HQ3B 3LZ0D 5BNVB 3KWQA 5DNMD 5CPKC 2F8ND 2PYOA 3H0LC 3O62B 2NQBD 3LZ0A 1KX4A 3IP4C 3MGPA 3MVDD 3LELA 3AFAA 2ZY4A 5AV9A 5JRGA 3AZEC 3VH5A 4JJNA 5AVBD 2IO5C 1P3MD 3EG5B 2F8NG 3LELD 1KX4B 3VH6T 3AZGA 3LJAB 1TZYD 3WKJC 3AZKD 4Z5TC 5AV8A 2G5IC 3KWQB 2Y2IA 3B6FB 5DNND 3AFAB 4H9PB 1H3OA 4M6BA 4X23A 3WAAA 4H9RB 3W97C 1U35B 3AZHB 1M1AA 5GT3D 5AV5D 4H9NA 3AZID 3X1UA 3C1BC 3W97A 5B40A 1ZLAA 4J8XB 1M1AC 3TU4B 3AZLA 3AYWB 4YS3B 4ZUXA 5JRGC 3NQJA 4QLCA 1H3OB 3C1CC 2YFWA 3MNND 1F66B 4HGAB 5E5AB 4H9NB 5CPID 5B2IC 3B0CT 4G91B 2Y2PA 1P3GB 2F8NB 4J8VA 3B6GB 1P3OA 3O62D 1M18A 2CV5A 2NQBB 5BNXA 3X1SD 3X1UC 5B32C 3MVDB 4KUDC 1M19B 5AV6A 2CWEA 5B1MB 4WU9A 2HUEC 4ZUXC 1F66A 3RELC 2AROA 3UTBB 1KX4D 3C1BD 3X1VA 2DF4C 3REKD 2Y2NA 3UT9C 3KXBD 1AOIB 2AROD 4Z66C 4WZSB 5C3IC 2JE5A 3B6FD 5DNNB 2HIOD 5DNNC 3RELD 3UT9A 1KX5D 3WTPC 1N1JB 1TAFB 3AV1C 4J8UB 5GT3B 3AZIB 1M18C 1HQ3C 2HIOA 4J8VD 5CP6C 1P3OD 2J8PA 2Y2QA 4G92C 1S32A 3W96B 4H9QA 1P3MC 4EO5B 4YS3D 3TU4D 1ID3C 3AZMA 1P3ID 1U35A 5B0YC 3AZGB 3AV2C 3MVDC 3FDDA 3MGRB 3MNNB 1F66D 3W98D 5E5AD 1P3IA 3UTAA 2RVQC 2PYOC 4Z66A 3LZ0C 3EPKA 3REIA 3B6GD 2ZM5A 1M1AD 5AV5A 3MGQB 5AV9B 3C1CB 4J8XA 1M19D 3WKJA 3EPHA 3AL0C 5DNMA 5AVCD 3REJB 4UUZB 1AOIA 2UWXA 3REIB 1EQZB 3LZ1C 4X23B 3W99D 4Z66B 4J8WA 2VQRA 3AZNB 4Z5TD 1P3PC 1KX5B 3KWQC 5GXQA 5B1MC 5CPKA 5F99D 3AZED 4J8UD 1ZLAC 4NE5A 5BNXB 1JFIB 2FJ7C 3WKJB 4R8PC 3VH6A 4KHAB 3AZFD 1EQZA 5B0ZB 5CPJA 4NE3A 3KUYD 5B31D 1P3FC 5BO0A 3W98B 5BNVA 4WU8C 5B40D 4QLCD 1P34C 5KDMA 3A6NB 4E44A 5B2JD 4R8PB 4LD9A 4AWLB 3AZJB 2FJ7B 5BT1C 4KHAA 3X1TC 3AV1A 3W98A 4YM6C 4LD9C 3AYWC 5B1MA 4WU9B 4ZBJC 3MGPC 1M1AB 1S32C 4E45A 1P3KC 1A7WA 3P5JB 4DRAA 4YM6A 4JJNC 3AZNC 2F2AC 4JJNB 1U35C 5AVBB 1EQZC 4WNNB 3AZNA 3LELB 3REID 4H9OA 3REHC 3REJC 1KX3C 1BH8B 3LJAD 3AZKB 3W99B 4YM6B 2F8NH 5B1LA 3WTPE 3AZND 2RIQA 4Z5TB 4WNNA 3WAAC 3AFAD 3MGQC 3B0DB 5AY8B 5GT0C 1P3AD 1W2EA 3REKA 1P34B 4H9SC 3AZHD 5F99B 1P3FB 5AV5B 1ID3A 3AYWA 1P3AA 2JCHA 2PYOB 5AV8D 3A1IA 4J8XD 3AN2C 3AZFB 1F1EA 5GSUC 5B31C 3KFUG 5FUGA
chains in the Genus database with same CATH topology
3KUYB 5B24C 1Z2CB 5GSUA 2NZDC 3A6ND 1P3PB 5B2JB 4R8PD 4CAYA 5CP6B 3AZJD 4KGCA 2FJ7D 1M18B 2NQBA 3AZMD 5E5AA 5B33A 5GXQC 5GT0A 1P3GD 5GSUB 3NQUB 4WU9D 4J8UA 5B33C 4KGCB 3X1SB 5C3IB 1P3BD 2Y2GA 3W96A 5B2JA 4JJND 2YFVA 3MGSD 3X1VC 4J8WC 3UTBC 3UTBD 3NQJB 5AVCC 4ZUXB 3X1VB 4J8WB 1B6WA 4YM6D 4WV4B 5KDMB 3VH5W 3REKB 1AOID 2AROB 5DNNA 5B33D 3WTPA 4KGCC 1P3AB 5B40C 4WU8D 1P34D 1BH8A 3AZKA 2LY8A 4J8VB 1P3LC 3B6GA 1P3OB 3F6TA 4Z5TA 4DRBA 2RVQD 5AV8B 3W96D 1BFMA 4ZBJB 3MGPB 4EO5C 3MGRA 3W96C 3MVDA 4H9OB 5B1LC 5AVCA 5JRGB 3AV1B 4YS3C 3TU4C 1ID3D 1P3PD 5AV8C 2Y2KA 2ZY5A 3H0RC 1KU5A 5CP6D 1P3OC 1P3LD 3TU4A 4YS3A 1T3UA 3AZHC 5GSUD 3V9RA 2DQNC 1P3AC 2YFWB 4XZQA 3AFAC 3MGQD 5AV9D 5AY8C 3WAAB 2AROC 2L5AA 4XUJA 3UTAD 1ZLAB 1BH9B 2Y2JA 2BG1A 3A1KA 3V9RB 3AZLC 5B32B 3X1UB 5AVCB 3REJD 5B31G 3MGSB 4KUDB 3KXBA 5GT0D 5B0ZA 1KX3B 1EQZD 3X1VD 2Y2HA 4X23D 3VH5T 1P3GC 2ZY3A 3B0CW 3R45A 3X1SC 4X23C 1P3BC 5B33B 2Y2OA 3O62C 4LD9D 2NZDD 4WU9C 3AZLD 5CPKB 3LJAA 1F66C 2XD1A 2BYKB 3AZMC 3KUYA 4AWLC 5B2JC 3AZJC 5B2ID 5B32A 3WA9D 2F8NA 3MGPD 4QLCC 5CPIC 5JA4A 4KUDA 3A6NC 1N1JA 3C1CA 3KUYC 5B0ZD 1HQ3D 3LZ0B 3WA9A 5B31B 5CPIA 5B0ZC 3REJA 5AV6B 5DNMB 3AV1D 5B40B 3W97B 5BS7C 3WA9C 3X1TA 5B1LD 1Q9CA 3B6FC 3X1SA 5AV5C 5B32G 3VH6W 2BYKA 5G49B 4Z2MG 3LJAC 5B0YA 3AV2A 1P3KA 1P3MB 4G92B 3WAAD 3UTAB 1WWIA 4H9RA 4H9QB 3KWQD 5B32D 4KUDD 1KX3D 3REIC 5AVBC 4XZQB 2FFFB 4WJ3C 3X1TD 3UTAC 1PZRA 4UUZA 5CHLB 5AY8D 5AV9C 1P3LA 4LD9B 3EPJA 2NZDB 3AYWD 3AZLB 1P3FD 2BYMA 3B0BA 3AZFA 1M19C 3LZ1A 3AN2A 2PYOD 3WA9B 1P3FA 2BYMB 5GXQD 2CV5B 2NZDA 1P3IC 5AV6D 5AVBA 1JFIA 3W97D 3R45B 5E5AC 3B0DC 3W99A 5B1LB 5B24D 3O62A 1M18D 3AZMB 1WWSA 1P3PA 4J8UC 3WTPD 2JSSA 3W99C 5B1MD 2ZY2A 4NFTA 5CPJC 3LZ1D 3MNNA 4J8XC 3AN2D 1B67A 4XUJB 3LELC 4Z2MH 3AZJA 4KGCD 2FJ7A 3C1BB 1P3BB 3AZEA 3KXBC 3A6NA 4R8PA 5B2IA 2F8NK 3UT9B 3MGSA 1AOIC 2YFVB 3KXBB 4UPKA 4CSRB 5G49A 2HIOB 4ZUXD 5CPJB 3MGSC 4J8WD 3RELB 4XZQD 3MGQA 1P3BA 5FUGB 2W8SA 4H9PA 1TAFA 2XD5A 3REKC 3X1TB 3B6FA 4CSRA 3REHD 5BO0B 1KX4C 5CP6A 4WU8B 3AZHA 3W98C 3B6GC 3C1BA 1P3IB 3REHA 5B0YD 3AZGD 3AV2D 1P3KD 5JA4B 3KSYA 3MGRD 1S32D 5AY8A 3H0MC 1KX5A 5GXQB 2CV5D 1HTAA 5BS7A 5BT1D 4WU8A 4H9SA 1KX3A 5JRGD 1ID3B 5GT3A 3AZIA 1KX5C 1P3GA 1HQ3A 2HIOC 5B24B 3C1CD 4DQYB 4J8VC 1P3LB 5GT3C 3AZIC 3WTPB 4XZQC 3AZFC 1M19A 3LZ1B 3AN2B 5F99A 4XUJD 1BH9A 4XUJC 5B24A 2Y2LA 1TZYB 3UTBA 4Z66D 3RELA 3UT9D 5F99C 1ZLAD 2G5HC 3NQUA 3X1UD 1R4VA 5GT0B 2HUEB 5CPJD 2IO5B 1ULYA 2Y2MA 1U35D 3AZEB 2CV5C 3AZKC 1TZYC 3WKJD 3REHB 2NQBC 5CPKD 5DNMC 5AV6C 3MNNC 4CAYB 1TZYA 3MGRC 5B0YB 3AZGC 3AV2B 1P3KB 1P3MA 4G91C 1S32B 3EPLA 5B2IB 5B31A 4QLCB 5CPIB 4HGAC 4NE6A 1P34A 1HQ3B 3LZ0D 5BNVB 3KWQA 5DNMD 5CPKC 2F8ND 2PYOA 3H0LC 3O62B 2NQBD 3LZ0A 1KX4A 3IP4C 3MGPA 3MVDD 3LELA 3AFAA 2ZY4A 5AV9A 5JRGA 3AZEC 3VH5A 4JJNA 5AVBD 2IO5C 1P3MD 3EG5B 2F8NG 3LELD 1KX4B 3VH6T 3AZGA 3LJAB 1TZYD 3WKJC 3AZKD 4Z5TC 5AV8A 2G5IC 3KWQB 2Y2IA 3B6FB 5DNND 3AFAB 4H9PB 1H3OA 4M6BA 4X23A 3WAAA 4H9RB 3W97C 1U35B 3AZHB 1M1AA 5GT3D 5AV5D 4H9NA 3AZID 3X1UA 3C1BC 3W97A 5B40A 1ZLAA 4J8XB 1M1AC 3TU4B 3AZLA 3AYWB 4YS3B 4ZUXA 5JRGC 3NQJA 4QLCA 1H3OB 3C1CC 2YFWA 3MNND 1F66B 4HGAB 5E5AB 4H9NB 5CPID 5B2IC 3B0CT 4G91B 2Y2PA 1P3GB 2F8NB 4J8VA 3B6GB 1P3OA 3O62D 1M18A 2CV5A 2NQBB 5BNXA 3X1SD 3X1UC 5B32C 3MVDB 4KUDC 1M19B 5AV6A 2CWEA 5B1MB 4WU9A 2HUEC 4ZUXC 1F66A 3RELC 2AROA 3UTBB 1KX4D 3C1BD 3X1VA 2DF4C 3REKD 2Y2NA 3UT9C 3KXBD 1AOIB 2AROD 4Z66C 4WZSB 5C3IC 2JE5A 3B6FD 5DNNB 2HIOD 5DNNC 3RELD 3UT9A 1KX5D 3WTPC 1N1JB 1TAFB 3AV1C 4J8UB 5GT3B 3AZIB 1M18C 1HQ3C 2HIOA 4J8VD 5CP6C 1P3OD 2J8PA 2Y2QA 4G92C 1S32A 3W96B 4H9QA 1P3MC 4EO5B 4YS3D 3TU4D 1ID3C 3AZMA 1P3ID 1U35A 5B0YC 3AZGB 3AV2C 3MVDC 3FDDA 3MGRB 3MNNB 1F66D 3W98D 5E5AD 1P3IA 3UTAA 2RVQC 2PYOC 4Z66A 3LZ0C 3EPKA 3REIA 3B6GD 2ZM5A 1M1AD 5AV5A 3MGQB 5AV9B 3C1CB 4J8XA 1M19D 3WKJA 3EPHA 3AL0C 5DNMA 5AVCD 3REJB 4UUZB 1AOIA 2UWXA 3REIB 1EQZB 3LZ1C 4X23B 3W99D 4Z66B 4J8WA 2VQRA 3AZNB 4Z5TD 1P3PC 1KX5B 3KWQC 5GXQA 5B1MC 5CPKA 5F99D 3AZED 4J8UD 1ZLAC 4NE5A 5BNXB 1JFIB 2FJ7C 3WKJB 4R8PC 3VH6A 4KHAB 3AZFD 1EQZA 5B0ZB 5CPJA 4NE3A 3KUYD 5B31D 1P3FC 5BO0A 3W98B 5BNVA 4WU8C 5B40D 4QLCD 1P34C 5KDMA 3A6NB 4E44A 5B2JD 4R8PB 4LD9A 4AWLB 3AZJB 2FJ7B 5BT1C 4KHAA 3X1TC 3AV1A 3W98A 4YM6C 4LD9C 3AYWC 5B1MA 4WU9B 4ZBJC 3MGPC 1M1AB 1S32C 4E45A 1P3KC 1A7WA 3P5JB 4DRAA 4YM6A 4JJNC 3AZNC 2F2AC 4JJNB 1U35C 5AVBB 1EQZC 4WNNB 3AZNA 3LELB 3REID 4H9OA 3REHC 3REJC 1KX3C 1BH8B 3LJAD 3AZKB 3W99B 4YM6B 2F8NH 5B1LA 3WTPE 3AZND 2RIQA 4Z5TB 4WNNA 3WAAC 3AFAD 3MGQC 3B0DB 5AY8B 5GT0C 1P3AD 1W2EA 3REKA 1P34B 4H9SC 3AZHD 5F99B 1P3FB 5AV5B 1ID3A 3AYWA 1P3AA 2JCHA 2PYOB 5AV8D 3A1IA 4J8XD 3AN2C 3AZFB 1F1EA 5GSUC 5B31C 3KFUG 5FUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A1I A;  2G5H C;  2DQN C;  3H0R C;  2DF4 C;  3A1K A;  2G5I C;  3IP4 C;  2F2A C;  3H0M C;  3AL0 C;  4WJ3 C;  3KFU G;  3H0L C; 
#chains in the Genus database with same CATH topology
 3KUY B;  5B24 C;  1Z2C B;  5GSU A;  2NZD C;  3A6N D;  1P3P B;  5B2J B;  4R8P D;  4CAY A;  5CP6 B;  3AZJ D;  4KGC A;  2FJ7 D;  1M18 B;  2NQB A;  3AZM D;  5E5A A;  5B33 A;  5GXQ C;  5GT0 A;  1P3G D;  5GSU B;  3NQU B;  4WU9 D;  4J8U A;  5B33 C;  4KGC B;  3X1S B;  5C3I B;  1P3B D;  2Y2G A;  3W96 A;  5B2J A;  4JJN D;  2YFV A;  3MGS D;  3X1V C;  4J8W C;  3UTB C;  3UTB D;  3NQJ B;  5AVC C;  4ZUX B;  3X1V B;  4J8W B;  1B6W A;  4YM6 D;  4WV4 B;  5KDM B;  3VH5 W;  3REK B;  1AOI D;  2ARO B;  5DNN A;  5B33 D;  3WTP A;  4KGC C;  1P3A B;  5B40 C;  4WU8 D;  1P34 D;  1BH8 A;  3AZK A;  2LY8 A;  4J8V B;  1P3L C;  3B6G A;  1P3O B;  3F6T A;  4Z5T A;  4DRB A;  2RVQ D;  5AV8 B;  3W96 D;  1BFM A;  4ZBJ B;  3MGP B;  4EO5 C;  3MGR A;  3W96 C;  3MVD A;  4H9O B;  5B1L C;  5AVC A;  5JRG B;  3AV1 B;  4YS3 C;  3TU4 C;  1ID3 D;  1P3P D;  5AV8 C;  2Y2K A;  2ZY5 A;  3H0R C;  1KU5 A;  5CP6 D;  1P3O C;  1P3L D;  3TU4 A;  4YS3 A;  1T3U A;  3AZH C;  5GSU D;  3V9R A;  2DQN C;  1P3A C;  2YFW B;  4XZQ A;  3AFA C;  3MGQ D;  5AV9 D;  5AY8 C;  3WAA B;  2ARO C;  2L5A A;  4XUJ A;  3UTA D;  1ZLA B;  1BH9 B;  2Y2J A;  2BG1 A;  3A1K A;  3V9R B;  3AZL C;  5B32 B;  3X1U B;  5AVC B;  3REJ D;  5B31 G;  3MGS B;  4KUD B;  3KXB A;  5GT0 D;  5B0Z A;  1KX3 B;  1EQZ D;  3X1V D;  2Y2H A;  4X23 D;  3VH5 T;  1P3G C;  2ZY3 A;  3B0C W;  3R45 A;  3X1S C;  4X23 C;  1P3B C;  5B33 B;  2Y2O A;  3O62 C;  4LD9 D;  2NZD D;  4WU9 C;  3AZL D;  5CPK B;  3LJA A;  1F66 C;  2XD1 A;  2BYK B;  3AZM C;  3KUY A;  4AWL C;  5B2J C;  3AZJ C;  5B2I D;  5B32 A;  3WA9 D;  2F8N A;  3MGP D;  4QLC C;  5CPI C;  5JA4 A;  4KUD A;  3A6N C;  1N1J A;  3C1C A;  3KUY C;  5B0Z D;  1HQ3 D;  3LZ0 B;  3WA9 A;  5B31 B;  5CPI A;  5B0Z C;  3REJ A;  5AV6 B;  5DNM B;  3AV1 D;  5B40 B;  3W97 B;  5BS7 C;  3WA9 C;  3X1T A;  5B1L D;  1Q9C A;  3B6F C;  3X1S A;  5AV5 C;  5B32 G;  3VH6 W;  2BYK A;  5G49 B;  4Z2M G;  3LJA C;  5B0Y A;  3AV2 A;  1P3K A;  1P3M B;  4G92 B;  3WAA D;  3UTA B;  1WWI A;  4H9R A;  4H9Q B;  3KWQ D;  5B32 D;  4KUD D;  1KX3 D;  3REI C;  5AVB C;  4XZQ B;  2FFF B;  4WJ3 C;  3X1T D;  3UTA C;  1PZR A;  4UUZ A;  5CHL B;  5AY8 D;  5AV9 C;  1P3L A;  4LD9 B;  3EPJ A;  2NZD B;  3AYW D;  3AZL B;  1P3F D;  2BYM A;  3B0B A;  3AZF A;  1M19 C;  3LZ1 A;  3AN2 A;  2PYO D;  3WA9 B;  1P3F A;  2BYM B;  5GXQ D;  2CV5 B;  2NZD A;  1P3I C;  5AV6 D;  5AVB A;  1JFI A;  3W97 D;  3R45 B;  5E5A C;  3B0D C;  3W99 A;  5B1L B;  5B24 D;  3O62 A;  1M18 D;  3AZM B;  1WWS A;  1P3P A;  4J8U C;  3WTP D;  2JSS A;  3W99 C;  5B1M D;  2ZY2 A;  4NFT A;  5CPJ C;  3LZ1 D;  3MNN A;  4J8X C;  3AN2 D;  1B67 A;  4XUJ B;  3LEL C;  4Z2M H;  3AZJ A;  4KGC D;  2FJ7 A;  3C1B B;  1P3B B;  3AZE A;  3KXB C;  3A6N A;  4R8P A;  5B2I A;  2F8N K;  3UT9 B;  3MGS A;  1AOI C;  2YFV B;  3KXB B;  4UPK A;  4CSR B;  5G49 A;  2HIO B;  4ZUX D;  5CPJ B;  3MGS C;  4J8W D;  3REL B;  4XZQ D;  3MGQ A;  1P3B A;  5FUG B;  2W8S A;  4H9P A;  1TAF A;  2XD5 A;  3REK C;  3X1T B;  3B6F A;  4CSR A;  3REH D;  5BO0 B;  1KX4 C;  5CP6 A;  4WU8 B;  3AZH A;  3W98 C;  3B6G C;  3C1B A;  1P3I B;  3REH A;  5B0Y D;  3AZG D;  3AV2 D;  1P3K D;  5JA4 B;  3KSY A;  3MGR D;  1S32 D;  5AY8 A;  3H0M C;  1KX5 A;  5GXQ B;  2CV5 D;  1HTA A;  5BS7 A;  5BT1 D;  4WU8 A;  4H9S A;  1KX3 A;  5JRG D;  1ID3 B;  5GT3 A;  3AZI A;  1KX5 C;  1P3G A;  1HQ3 A;  2HIO C;  5B24 B;  3C1C D;  4DQY B;  4J8V C;  1P3L B;  5GT3 C;  3AZI C;  3WTP B;  4XZQ C;  3AZF C;  1M19 A;  3LZ1 B;  3AN2 B;  5F99 A;  4XUJ D;  1BH9 A;  4XUJ C;  5B24 A;  2Y2L A;  1TZY B;  3UTB A;  4Z66 D;  3REL A;  3UT9 D;  5F99 C;  1ZLA D;  2G5H C;  3NQU A;  3X1U D;  1R4V A;  5GT0 B;  2HUE B;  5CPJ D;  2IO5 B;  1ULY A;  2Y2M A;  1U35 D;  3AZE B;  2CV5 C;  3AZK C;  1TZY C;  3WKJ D;  3REH B;  2NQB C;  5CPK D;  5DNM C;  5AV6 C;  3MNN C;  4CAY B;  1TZY A;  3MGR C;  5B0Y B;  3AZG C;  3AV2 B;  1P3K B;  1P3M A;  4G91 C;  1S32 B;  3EPL A;  5B2I B;  5B31 A;  4QLC B;  5CPI B;  4HGA C;  4NE6 A;  1P34 A;  1HQ3 B;  3LZ0 D;  5BNV B;  3KWQ A;  5DNM D;  5CPK C;  2F8N D;  2PYO A;  3H0L C;  3O62 B;  2NQB D;  3LZ0 A;  1KX4 A;  3IP4 C;  3MGP A;  3MVD D;  3LEL A;  3AFA A;  2ZY4 A;  5AV9 A;  5JRG A;  3AZE C;  3VH5 A;  4JJN A;  5AVB D;  2IO5 C;  1P3M D;  3EG5 B;  2F8N G;  3LEL D;  1KX4 B;  3VH6 T;  3AZG A;  3LJA B;  1TZY D;  3WKJ C;  3AZK D;  4Z5T C;  5AV8 A;  2G5I C;  3KWQ B;  2Y2I A;  3B6F B;  5DNN D;  3AFA B;  4H9P B;  1H3O A;  4M6B A;  4X23 A;  3WAA A;  4H9R B;  3W97 C;  1U35 B;  3AZH B;  1M1A A;  5GT3 D;  5AV5 D;  4H9N A;  3AZI D;  3X1U A;  3C1B C;  3W97 A;  5B40 A;  1ZLA A;  4J8X B;  1M1A C;  3TU4 B;  3AZL A;  3AYW B;  4YS3 B;  4ZUX A;  5JRG C;  3NQJ A;  4QLC A;  1H3O B;  3C1C C;  2YFW A;  3MNN D;  1F66 B;  4HGA B;  5E5A B;  4H9N B;  5CPI D;  5B2I C;  3B0C T;  4G91 B;  2Y2P A;  1P3G B;  2F8N B;  4J8V A;  3B6G B;  1P3O A;  3O62 D;  1M18 A;  2CV5 A;  2NQB B;  5BNX A;  3X1S D;  3X1U C;  5B32 C;  3MVD B;  4KUD C;  1M19 B;  5AV6 A;  2CWE A;  5B1M B;  4WU9 A;  2HUE C;  4ZUX C;  1F66 A;  3REL C;  2ARO A;  3UTB B;  1KX4 D;  3C1B D;  3X1V A;  2DF4 C;  3REK D;  2Y2N A;  3UT9 C;  3KXB D;  1AOI B;  2ARO D;  4Z66 C;  4WZS B;  5C3I C;  2JE5 A;  3B6F D;  5DNN B;  2HIO D;  5DNN C;  3REL D;  3UT9 A;  1KX5 D;  3WTP C;  1N1J B;  1TAF B;  3AV1 C;  4J8U B;  5GT3 B;  3AZI B;  1M18 C;  1HQ3 C;  2HIO A;  4J8V D;  5CP6 C;  1P3O D;  2J8P A;  2Y2Q A;  4G92 C;  1S32 A;  3W96 B;  4H9Q A;  1P3M C;  4EO5 B;  4YS3 D;  3TU4 D;  1ID3 C;  3AZM A;  1P3I D;  1U35 A;  5B0Y C;  3AZG B;  3AV2 C;  3MVD C;  3FDD A;  3MGR B;  3MNN B;  1F66 D;  3W98 D;  5E5A D;  1P3I A;  3UTA A;  2RVQ C;  2PYO C;  4Z66 A;  3LZ0 C;  3EPK A;  3REI A;  3B6G D;  2ZM5 A;  1M1A D;  5AV5 A;  3MGQ B;  5AV9 B;  3C1C B;  4J8X A;  1M19 D;  3WKJ A;  3EPH A;  3AL0 C;  5DNM A;  5AVC D;  3REJ B;  4UUZ B;  1AOI A;  2UWX A;  3REI B;  1EQZ B;  3LZ1 C;  4X23 B;  3W99 D;  4Z66 B;  4J8W A;  2VQR A;  3AZN B;  4Z5T D;  1P3P C;  1KX5 B;  3KWQ C;  5GXQ A;  5B1M C;  5CPK A;  5F99 D;  3AZE D;  4J8U D;  1ZLA C;  4NE5 A;  5BNX B;  1JFI B;  2FJ7 C;  3WKJ B;  4R8P C;  3VH6 A;  4KHA B;  3AZF D;  1EQZ A;  5B0Z B;  5CPJ A;  4NE3 A;  3KUY D;  5B31 D;  1P3F C;  5BO0 A;  3W98 B;  5BNV A;  4WU8 C;  5B40 D;  4QLC D;  1P34 C;  5KDM A;  3A6N B;  4E44 A;  5B2J D;  4R8P B;  4LD9 A;  4AWL B;  3AZJ B;  2FJ7 B;  5BT1 C;  4KHA A;  3X1T C;  3AV1 A;  3W98 A;  4YM6 C;  4LD9 C;  3AYW C;  5B1M A;  4WU9 B;  4ZBJ C;  3MGP C;  1M1A B;  1S32 C;  4E45 A;  1P3K C;  1A7W A;  3P5J B;  4DRA A;  4YM6 A;  4JJN C;  3AZN C;  2F2A C;  4JJN B;  1U35 C;  5AVB B;  1EQZ C;  4WNN B;  3AZN A;  3LEL B;  3REI D;  4H9O A;  3REH C;  3REJ C;  1KX3 C;  1BH8 B;  3LJA D;  3AZK B;  3W99 B;  4YM6 B;  2F8N H;  5B1L A;  3WTP E;  3AZN D;  2RIQ A;  4Z5T B;  4WNN A;  3WAA C;  3AFA D;  3MGQ C;  3B0D B;  5AY8 B;  5GT0 C;  1P3A D;  1W2E A;  3REK A;  1P34 B;  4H9S C;  3AZH D;  5F99 B;  1P3F B;  5AV5 B;  1ID3 A;  3AYW A;  1P3A A;  2JCH A;  2PYO B;  5AV8 D;  3A1I A;  4J8X D;  3AN2 C;  3AZF B;  1F1E A;  5GSU C;  5B31 C;  3KFU G;  5FUG A; 
#chains in the Genus database with same CATH homology
 3KUY B;  5B24 C;  1Z2C B;  5GSU A;  2NZD C;  3A6N D;  1P3P B;  5B2J B;  4R8P D;  4CAY A;  5CP6 B;  3AZJ D;  4KGC A;  2FJ7 D;  1M18 B;  2NQB A;  3AZM D;  5E5A A;  5B33 A;  5GXQ C;  5GT0 A;  1P3G D;  5GSU B;  3NQU B;  4WU9 D;  4J8U A;  5B33 C;  4KGC B;  3X1S B;  5C3I B;  1P3B D;  2Y2G A;  3W96 A;  5B2J A;  4JJN D;  2YFV A;  3MGS D;  3X1V C;  4J8W C;  3UTB C;  3UTB D;  3NQJ B;  5AVC C;  4ZUX B;  3X1V B;  4J8W B;  1B6W A;  4YM6 D;  4WV4 B;  5KDM B;  3VH5 W;  3REK B;  1AOI D;  2ARO B;  5DNN A;  5B33 D;  3WTP A;  4KGC C;  1P3A B;  5B40 C;  4WU8 D;  1P34 D;  1BH8 A;  3AZK A;  2LY8 A;  4J8V B;  1P3L C;  3B6G A;  1P3O B;  3F6T A;  4Z5T A;  4DRB A;  2RVQ D;  5AV8 B;  3W96 D;  1BFM A;  4ZBJ B;  3MGP B;  4EO5 C;  3MGR A;  3W96 C;  3MVD A;  4H9O B;  5B1L C;  5AVC A;  5JRG B;  3AV1 B;  4YS3 C;  3TU4 C;  1ID3 D;  1P3P D;  5AV8 C;  2Y2K A;  2ZY5 A;  3H0R C;  1KU5 A;  5CP6 D;  1P3O C;  1P3L D;  3TU4 A;  4YS3 A;  1T3U A;  3AZH C;  5GSU D;  3V9R A;  2DQN C;  1P3A C;  2YFW B;  4XZQ A;  3AFA C;  3MGQ D;  5AV9 D;  5AY8 C;  3WAA B;  2ARO C;  2L5A A;  4XUJ A;  3UTA D;  1ZLA B;  1BH9 B;  2Y2J A;  2BG1 A;  3A1K A;  3V9R B;  3AZL C;  5B32 B;  3X1U B;  5AVC B;  3REJ D;  5B31 G;  3MGS B;  4KUD B;  3KXB A;  5GT0 D;  5B0Z A;  1KX3 B;  1EQZ D;  3X1V D;  2Y2H A;  4X23 D;  3VH5 T;  1P3G C;  2ZY3 A;  3B0C W;  3R45 A;  3X1S C;  4X23 C;  1P3B C;  5B33 B;  2Y2O A;  3O62 C;  4LD9 D;  2NZD D;  4WU9 C;  3AZL D;  5CPK B;  3LJA A;  1F66 C;  2XD1 A;  2BYK B;  3AZM C;  3KUY A;  4AWL C;  5B2J C;  3AZJ C;  5B2I D;  5B32 A;  3WA9 D;  2F8N A;  3MGP D;  4QLC C;  5CPI C;  5JA4 A;  4KUD A;  3A6N C;  1N1J A;  3C1C A;  3KUY C;  5B0Z D;  1HQ3 D;  3LZ0 B;  3WA9 A;  5B31 B;  5CPI A;  5B0Z C;  3REJ A;  5AV6 B;  5DNM B;  3AV1 D;  5B40 B;  3W97 B;  5BS7 C;  3WA9 C;  3X1T A;  5B1L D;  1Q9C A;  3B6F C;  3X1S A;  5AV5 C;  5B32 G;  3VH6 W;  2BYK A;  5G49 B;  4Z2M G;  3LJA C;  5B0Y A;  3AV2 A;  1P3K A;  1P3M B;  4G92 B;  3WAA D;  3UTA B;  1WWI A;  4H9R A;  4H9Q B;  3KWQ D;  5B32 D;  4KUD D;  1KX3 D;  3REI C;  5AVB C;  4XZQ B;  2FFF B;  4WJ3 C;  3X1T D;  3UTA C;  1PZR A;  4UUZ A;  5CHL B;  5AY8 D;  5AV9 C;  1P3L A;  4LD9 B;  3EPJ A;  2NZD B;  3AYW D;  3AZL B;  1P3F D;  2BYM A;  3B0B A;  3AZF A;  1M19 C;  3LZ1 A;  3AN2 A;  2PYO D;  3WA9 B;  1P3F A;  2BYM B;  5GXQ D;  2CV5 B;  2NZD A;  1P3I C;  5AV6 D;  5AVB A;  1JFI A;  3W97 D;  3R45 B;  5E5A C;  3B0D C;  3W99 A;  5B1L B;  5B24 D;  3O62 A;  1M18 D;  3AZM B;  1WWS A;  1P3P A;  4J8U C;  3WTP D;  2JSS A;  3W99 C;  5B1M D;  2ZY2 A;  4NFT A;  5CPJ C;  3LZ1 D;  3MNN A;  4J8X C;  3AN2 D;  1B67 A;  4XUJ B;  3LEL C;  4Z2M H;  3AZJ A;  4KGC D;  2FJ7 A;  3C1B B;  1P3B B;  3AZE A;  3KXB C;  3A6N A;  4R8P A;  5B2I A;  2F8N K;  3UT9 B;  3MGS A;  1AOI C;  2YFV B;  3KXB B;  4UPK A;  4CSR B;  5G49 A;  2HIO B;  4ZUX D;  5CPJ B;  3MGS C;  4J8W D;  3REL B;  4XZQ D;  3MGQ A;  1P3B A;  5FUG B;  2W8S A;  4H9P A;  1TAF A;  2XD5 A;  3REK C;  3X1T B;  3B6F A;  4CSR A;  3REH D;  5BO0 B;  1KX4 C;  5CP6 A;  4WU8 B;  3AZH A;  3W98 C;  3B6G C;  3C1B A;  1P3I B;  3REH A;  5B0Y D;  3AZG D;  3AV2 D;  1P3K D;  5JA4 B;  3KSY A;  3MGR D;  1S32 D;  5AY8 A;  3H0M C;  1KX5 A;  5GXQ B;  2CV5 D;  1HTA A;  5BS7 A;  5BT1 D;  4WU8 A;  4H9S A;  1KX3 A;  5JRG D;  1ID3 B;  5GT3 A;  3AZI A;  1KX5 C;  1P3G A;  1HQ3 A;  2HIO C;  5B24 B;  3C1C D;  4DQY B;  4J8V C;  1P3L B;  5GT3 C;  3AZI C;  3WTP B;  4XZQ C;  3AZF C;  1M19 A;  3LZ1 B;  3AN2 B;  5F99 A;  4XUJ D;  1BH9 A;  4XUJ C;  5B24 A;  2Y2L A;  1TZY B;  3UTB A;  4Z66 D;  3REL A;  3UT9 D;  5F99 C;  1ZLA D;  2G5H C;  3NQU A;  3X1U D;  1R4V A;  5GT0 B;  2HUE B;  5CPJ D;  2IO5 B;  1ULY A;  2Y2M A;  1U35 D;  3AZE B;  2CV5 C;  3AZK C;  1TZY C;  3WKJ D;  3REH B;  2NQB C;  5CPK D;  5DNM C;  5AV6 C;  3MNN C;  4CAY B;  1TZY A;  3MGR C;  5B0Y B;  3AZG C;  3AV2 B;  1P3K B;  1P3M A;  4G91 C;  1S32 B;  3EPL A;  5B2I B;  5B31 A;  4QLC B;  5CPI B;  4HGA C;  4NE6 A;  1P34 A;  1HQ3 B;  3LZ0 D;  5BNV B;  3KWQ A;  5DNM D;  5CPK C;  2F8N D;  2PYO A;  3H0L C;  3O62 B;  2NQB D;  3LZ0 A;  1KX4 A;  3IP4 C;  3MGP A;  3MVD D;  3LEL A;  3AFA A;  2ZY4 A;  5AV9 A;  5JRG A;  3AZE C;  3VH5 A;  4JJN A;  5AVB D;  2IO5 C;  1P3M D;  3EG5 B;  2F8N G;  3LEL D;  1KX4 B;  3VH6 T;  3AZG A;  3LJA B;  1TZY D;  3WKJ C;  3AZK D;  4Z5T C;  5AV8 A;  2G5I C;  3KWQ B;  2Y2I A;  3B6F B;  5DNN D;  3AFA B;  4H9P B;  1H3O A;  4M6B A;  4X23 A;  3WAA A;  4H9R B;  3W97 C;  1U35 B;  3AZH B;  1M1A A;  5GT3 D;  5AV5 D;  4H9N A;  3AZI D;  3X1U A;  3C1B C;  3W97 A;  5B40 A;  1ZLA A;  4J8X B;  1M1A C;  3TU4 B;  3AZL A;  3AYW B;  4YS3 B;  4ZUX A;  5JRG C;  3NQJ A;  4QLC A;  1H3O B;  3C1C C;  2YFW A;  3MNN D;  1F66 B;  4HGA B;  5E5A B;  4H9N B;  5CPI D;  5B2I C;  3B0C T;  4G91 B;  2Y2P A;  1P3G B;  2F8N B;  4J8V A;  3B6G B;  1P3O A;  3O62 D;  1M18 A;  2CV5 A;  2NQB B;  5BNX A;  3X1S D;  3X1U C;  5B32 C;  3MVD B;  4KUD C;  1M19 B;  5AV6 A;  2CWE A;  5B1M B;  4WU9 A;  2HUE C;  4ZUX C;  1F66 A;  3REL C;  2ARO A;  3UTB B;  1KX4 D;  3C1B D;  3X1V A;  2DF4 C;  3REK D;  2Y2N A;  3UT9 C;  3KXB D;  1AOI B;  2ARO D;  4Z66 C;  4WZS B;  5C3I C;  2JE5 A;  3B6F D;  5DNN B;  2HIO D;  5DNN C;  3REL D;  3UT9 A;  1KX5 D;  3WTP C;  1N1J B;  1TAF B;  3AV1 C;  4J8U B;  5GT3 B;  3AZI B;  1M18 C;  1HQ3 C;  2HIO A;  4J8V D;  5CP6 C;  1P3O D;  2J8P A;  2Y2Q A;  4G92 C;  1S32 A;  3W96 B;  4H9Q A;  1P3M C;  4EO5 B;  4YS3 D;  3TU4 D;  1ID3 C;  3AZM A;  1P3I D;  1U35 A;  5B0Y C;  3AZG B;  3AV2 C;  3MVD C;  3FDD A;  3MGR B;  3MNN B;  1F66 D;  3W98 D;  5E5A D;  1P3I A;  3UTA A;  2RVQ C;  2PYO C;  4Z66 A;  3LZ0 C;  3EPK A;  3REI A;  3B6G D;  2ZM5 A;  1M1A D;  5AV5 A;  3MGQ B;  5AV9 B;  3C1C B;  4J8X A;  1M19 D;  3WKJ A;  3EPH A;  3AL0 C;  5DNM A;  5AVC D;  3REJ B;  4UUZ B;  1AOI A;  2UWX A;  3REI B;  1EQZ B;  3LZ1 C;  4X23 B;  3W99 D;  4Z66 B;  4J8W A;  2VQR A;  3AZN B;  4Z5T D;  1P3P C;  1KX5 B;  3KWQ C;  5GXQ A;  5B1M C;  5CPK A;  5F99 D;  3AZE D;  4J8U D;  1ZLA C;  4NE5 A;  5BNX B;  1JFI B;  2FJ7 C;  3WKJ B;  4R8P C;  3VH6 A;  4KHA B;  3AZF D;  1EQZ A;  5B0Z B;  5CPJ A;  4NE3 A;  3KUY D;  5B31 D;  1P3F C;  5BO0 A;  3W98 B;  5BNV A;  4WU8 C;  5B40 D;  4QLC D;  1P34 C;  5KDM A;  3A6N B;  4E44 A;  5B2J D;  4R8P B;  4LD9 A;  4AWL B;  3AZJ B;  2FJ7 B;  5BT1 C;  4KHA A;  3X1T C;  3AV1 A;  3W98 A;  4YM6 C;  4LD9 C;  3AYW C;  5B1M A;  4WU9 B;  4ZBJ C;  3MGP C;  1M1A B;  1S32 C;  4E45 A;  1P3K C;  1A7W A;  3P5J B;  4DRA A;  4YM6 A;  4JJN C;  3AZN C;  2F2A C;  4JJN B;  1U35 C;  5AVB B;  1EQZ C;  4WNN B;  3AZN A;  3LEL B;  3REI D;  4H9O A;  3REH C;  3REJ C;  1KX3 C;  1BH8 B;  3LJA D;  3AZK B;  3W99 B;  4YM6 B;  2F8N H;  5B1L A;  3WTP E;  3AZN D;  2RIQ A;  4Z5T B;  4WNN A;  3WAA C;  3AFA D;  3MGQ C;  3B0D B;  5AY8 B;  5GT0 C;  1P3A D;  1W2E A;  3REK A;  1P34 B;  4H9S C;  3AZH D;  5F99 B;  1P3F B;  5AV5 B;  1ID3 A;  3AYW A;  1P3A A;  2JCH A;  2PYO B;  5AV8 D;  3A1I A;  4J8X D;  3AN2 C;  3AZF B;  1F1E A;  5GSU C;  5B31 C;  3KFU G;  5FUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...