4WK1A

Crystal structure of staphylococcus aureus psta in complex with c-di-amp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
117
structure length
92
Chain Sequence
GLVPRGSHMKMIIAIVQDQDSQELADQLVKNNFRATKLATTGGFLRAGNTTFLCGVNDDRVDEILSVINQTCGNEVGGATVFVMPVDAFHQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PstA
publication title c-di-AMP recognition by Staphylococcus aureus PstA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Signaling protein
total genus 18
structure length 92
sequence length 117
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06153 CdAMP_rec Cyclic-di-AMP receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wk1A01
1NH8A 4CNYA 4ZK7M 4OZLA 4YB5A 4C3MA 3GSDA 2J9EA 2J9DA 1V6HA 2ZOMA 4D3GA 4WK3A 2ZFHA 5D4NA 2E66A 4USHA 4USIA 4C3KA 2CZ4A 4CO0A 1QY7A 4Y6IA 4YB6A 3LF0A 4E98A 1J2VA 4YB7A 3O5TB 3X3UA 2VD3A 3L7PA 2NS1B 2XBPA 4NYPA 2Z0GA 1P1LA 3AH6A 2EG1A 1VHFA 2NUUG 3DFEA 1O51A 3AHPA 3AA8A 1H3DA 4RX6A 2EG2A 3N5BA 2J9CA 1V9OA 4WK1A 4CO3A 3BZQA 3TA1A 5D4LA 2GNKA 2PIIA 5L9NA 2V5HG 4USJC 3NCPA 1UFLA 2GX8A 1NH7A 3M05A 4RWWA 1O5JA 2JJ4D 4C3LA 3TA0A 3AA9A 3HLUA 1UL3A 1HWUA 5D4OA 4Y65A 1UMJA 2GW8A 4RWXA 5DS7A 1OSCA 2O66A 1KR4A 3TA2A 2RD5C 4AFFA 3O8WA 4OZNA 2XZWA 1VFJA 4NYOA 4RLEA 1NZAA 5DRKA 4CNZA 4IYQA 1V3RA 1GNKA 4R25A 4D3HA 2XULA 4CO5A 2O67A 2J9DE 2DCLA 2XG8A 1UKUA 1NAQA 3NCQA 1Q1KA 3OPKA 1V3SA 4CO4A 1PILA 3NCRA 3CE8A 3T9ZA 4CO1A 1XK8A 5D4PA 4OZJA 2NUHA 3MHYA 4CO2A
chains in the Genus database with same CATH superfamily
4RW4B 1BC6A 4DPYA 1I1GA 2OPRA 3K8VA 5I3QA 2ZHAA 4FXWA 4WE1A 3UR3C 4ZVUB 2GS8A 2XNQA 5SUHA 3GIIA 4E98A 3TQ1A 2DRDA 4J9KA 3DMJA 3RGIA 5D78A 5KFIA 1FTCA 3AXMA 2PSZA 4F25A 2BR0A 1O5JA 2IDEA 5B0GA 3R5JB 1FESA 3M6XA 1E6VA 4RWXA 1U2FA 3SCLE 3RAQA 4ZPBA 1ZTTA 4CYUB 4ZKAA 2D9PA 1NDLA 4R25A 4UQTA 2L08A 8AT1B 1VQLS 4ZIVA 4NLXA 2M7SA 2C3UA 1HARA 4RBUA 4DPWA 2M52A 4ES2A 4UOGA 1MW7A 1S6OA 2BBEA 3DGVA 2QLJB 1JK9B 5HN0A 2QT7A 4P2XA 4CH7A 2AJFE 2J7UA 4J9NA 2B9WA 1SJFA 4BCAA 1Y5IB 3US5A 4I2PA 1WSRA 1KVKA 3MAAB 2R2UA 4FXDA 1JJ4A 4RR5A 1RHRB 2EKYA 4AL5A 4YB6A 3DC2A 4HACB 3MMBB 3MCSA 4C4WA 1DLOA 3IWNC 1S1TB 2VKZG 1M5HA 1P1TA 5FDLB 2FUG9 2CQ0A 1Y3KA 2XMWA 2MGZA 2KFYA 2OD4A 1FXDA 2AV5A 1Y5NB 2RMLA 5KFUA 4K4UA 4OYPA 1W25A 1X4CA 3BO3A 4I64A 1T03B 5KT3A 4J9MA 4I0WA 2VFUA 5M2RA 3H59A 3HSDA 4M1KA 1AUSL 4Z37A 2IBOA 4DSIA 2BM0A 2OPQA 2J0XA 4NLDA 1ELOA 1X8DA 4ER8A 2YX4A 2VJVA 2XC9A 5HROA 3D7SB 3THVA 3F0NA 2FQQB 3CTRA 3BN7A 1KNZA 3HHLD 4MH8A 5B0AA 2P6SA 3LOUA 4CIOA 4CO2A 1XNQF 5IM0A 2MZRA 4ZLJA 2OH2A 2VBYA 2DHGA 2POKA 4LBHA 3G2XA 3DOLB 3IAS9 2CQ1A 3HHLA 3JTNA 5FLXU 5C2CA 2Q1LA 4DFPA 1UWBB 2FIUA 5J2NB 4ALZA 4O3QA 2AJ2A 1KQFB 2FYXA 4BBYA 2NUUG 1PIEA 1K0TA 1ZOTA 1UFLA 4OV6A 3MPWA 3W64A 3CO0P 5E41A 1GAOA 1OO0B 3J7Z5 2A0FB 3UQSA 5F8IA 1LOUA 4ZJLA 1JLEA 4F3QA 3LANA 4AL6A 4AFFA 2V4RA 2KVIA 3M2VB 4A8SA 2QJ3A 4X62J 1TQLA 3H7HB 3GJSB 2ATCB 2L9NA 4UY8T 1RT6A 4K2JA 4QWEA 1JJHA 1MMLA 1K8AT 1WTBA 4EBCA 3AY0A 1RADB 5E3CA 3CDEA 1PG5B 1NJWA 1A0OB 2OJ3A 3IR5B 1T7PA 4LFAJ 3VTIA 1DZ5A 4UOCA 5KT6A 2VA3A 2PE8A 1CJKA 3KMQA 4XPCA 3M6WA 1OPIA 3HXMA 2MLYA 1XR6A 1D8ZA 3PRBA 3DHWC 5ETQA 2QMWA 2RRNA 3LWLA 3CDUA 3H4DA 1JNRB 4DL2A 3M6UA 2VBXA 1HQUB 4ZPDA 3CDBA 2ZH8A 3PHEA 2DNQA 4NRTA 3CSKA 1ZS6A 2UXDJ 4RBVA 2E1PA 2OPSB 2YKOA 3FCVA 4OV1A 3TYTA 4ZVQB 2E9RX 3KMSA 6FD1A 4NLPA 1D9AA 1Y00A 2ASJA 4IFVB 3KLGA 2B7CB 3BQ2A 4WP9A 1MN7A 4N41A 1T0TV 4O23A 2NPIA 2XWXA 3H5XA 4WU3A 1YGYA 2C2RA 4IQMA 5KFMA 3W7BA 2FHMA 2KHCA 3D0GE 3A8JA 2BRKA 5D6GA 4Y34A 3TANA 2YKMA 3CF5Q 4MYTA 4KPYA 3T1AA 1Y0HA 4EMDA 3DLEA 3BSCA 2N7CA 3I0SB 4DQSA 1SL1A 2GAGC 1VI7A 4HVZA 4C8YA 3T1YJ 4KBIA 1V9OA 2AEFA 1WG1A 4LF7F 4EWTA 2CQDA 2F7VA 1P9QC 2IRUA 5J2MB 1N5QA 3NWRA 2ZNYA 2UZAA 1JKHA 3GSIA 2R7SA 3NG8A 2KXHA 3GU0A 1EKSA 2RF2A 2F4VJ 5B0BA 2XZWA 2GMHA 2PFDA 5KFRA 4GVBA 4ILRA 2V4QA 2O67A 2DCLA 3OVBA 1XNRJ 4B9NA 2DR8A 1F0XA 4RUCA 3RUBL 2W2MP 2XY6A 3MR5A 1BQNA 5LMNJ 4C8KA 3GV5B 3HD2A 2CJ9A 2CPFA 2KFZA 2VOPA 1U0HA 5KFGA 2J9EA 1RP5A 3QRRA 4DUYF 1N5YB 4DL3A 3EZOA 4ZP6A 1Y4ZB 4C11A 5BJRA 2GV1A 4GVLA 3QYYA 2XO6A 1IR2A 4LRBA 4R8UB 5A6WA 1VBXA 2FGOA 2VQEJ 1HBUA 1GMVA 2CPXA 3NWGA 4B9SA 3PACA 1D3WA 4H4MA 4B3RF 2J6SA 1LWFB 4IRKA 2J0SD 4B3SJ 3UD4P 3CJSA 3KG1A 4DR7F 2RE1A 4KIAA 1YZ6A 1VQKS 5AT1B 4DQPA 3C16B 2ZC4A 3FJ2A 4O4RA 3PKMA 3LQVA 4DV6F 4LIRA 5KG1A 1VRTB 4G65A 3CCSS 2YNHA 1TV6B 4Q45A 3EGNA 2BJ1A 4X64J 1CJUB 2CPHA 4ZCLA 3QWPA 1N4LA 4NMXA 1NDCA 2UVVA 2AZ1A 2MZQA 2GJIA 5C25A 2MSSA 2CJQA 1DHMA 5C24A 2APOA 2OKQA 1TVRB 5D4NA 3DYAB 3MCOA 1S97A 1F60B 2CQ3A 2VG6B 1TK5A 5A2QU 1VQMS 3VWSA 1JXLA 1EQMA 2K7KA 4GKJJ 2B4UA 4K4ZA 3CCVS 4P52A 2HHQA 2KT2A 3OSPA 5K8NA 2ERRA 5D4LA 1UEUA 1T9WA 4ZP7A 2VPYB 3M9MB 5DQIA 3CJ0A 2VQFJ 4F50A 1R8AA 4JI8J 3RR7A 4AQYF 1RHUB 1YJ7A 3TWZA 3HD1A 4OZ0A 5T7LA 1N0VC 6AT1B 4M8LA 3Q23A 4DUZJ 1N32J 4UUWA 9ATCB 4DR2F 1KVJA 3NY0A 1QVFR 2GZOA 1N8RT 4O0NA 2PMHA 4USWA 2ZKTA 5ETRA 3OJUA 2DB1A 1FRKA 4CLWA 4L72B 2HNDA 2DNRA 1EX8A 3SQGA 1VHFA 2W24A 3P5BP 1TL3B 5EDWA 4KO0B 4WFAQ 5A0YB 1FCAA 4WJBA 1R8HA 4DL4A 3A1YG 3OD2A 2XYPB 3IP0A 2YWHA 5HVGA 1B4SA 4KHMA 2B7BB 1SH3A 1RTJB 2MLZA 2L9DA 1TKXA 1PBUA 3X1LB 3TZZA 4JI0F 1X9WA 1S5ZA 2XYGB 5KFCA 3S7RA 2IAJA 4RBTA 4EFAC 3A12A 4I69A 1LQ9A 2YKNB 2DGOA 3KDNA 4DG1B 2XS5A 3GLJA 4ELVA 3MEGB 3KLIA 1T05A 1IR0A 4ECZA 2NUHA 5C42B 5L1JA 2VC0A 3ENAA 1OIAA 4PWWA 1CS4B 4B3OB 2FHKA 3UN3A 3AB2B 3M9OB 1BY9A 4DL5A 3ETOA 4ANCA 5DM6Q 1ZA2B 5DO2A 5CYMA 1CLFA 2DEIA 2ACMA 2FZGB 4WIIA 1WC1A 3HI9A 1SQFA 1SI9A 1LW0A 1TL5A 1TU0B 1AFIA 2BE2A 4G1QA 2W8KA 1F1BB 1HNIA 3J81j 1RZMA 2LQJA 1X7VA 4J9UE 4FF3A 4CLPA 4CLLA 2VC1A 4M95A 1CC8A 3OHAA 2H54B 2XQCA 5L38A 1Z1ZA 4X4VA 2XEXA 3MEEA 2EKNA 4U7CA 2FVRA 1Q53A 4PUOB 3H90A 4UY85 1FKPA 3EGZA 3F44A 4P7VA 3GV8B 1F3VA 2DR5A 2MKKA 5J1NA 3R8YA 2OTJS 1S76D 4I68A 3QZ8A 1RWMB 3MF5A 2EI5A 2HBRB 1X4AA 1XNQJ 4HH1A 2F9JA 1SKSA 3M9NB 4NLYA 4IO9Q 1DQAA 2ROPA 3QPIA 2X7IA 3MMAB 5HAOA 1HW8A 4X65F 4WXWA 4EYIB 2BANA 3IS9A 2DPIA 4F26A 3T5JA 4M5MA 3T5HA 3KHRA 6FDRA 1F5CA 2RD5C 3EVOA 1DURA 1FXRA 4DV0J 2AKWB 4I67A 4F4KA 2I38A 2E5IA 2VFTA 3I6PA 3ELHA 4KT0C 1AFJA 2GVZA 5IQ6A 3CB4A 2GQCA 4PWUA 4ECYA 3MHYA 1VQ5S 2HNYA 4UQGA 3NXZA 3W8GA 3UCZP 4FF2A 2I2YA 3T5KA 1Q7YT 3SSRA 4FKYA 1PJ5A 4A8YA 4ANEA 4EGLA 4IUFA 1NPPA 5J1EA 3FFIA 2OPRB 2HVZA 3PZPA 1T02A 3ZFVA 4WE1B 3C2PA 1LWEB 4ZITA 3MEKA 3PG9A 5CAAA 1GQEA 3N5BA 3N28A 2KYXA 2Z4PA 4H54A 4R0JA 2DGQA 4DFJA 1WC3A 2QIFA 4ID5A 3EPGA 1RHQB 1E6VB 1YRXA 2CDRB 4KTQA 4ZHRA 2ADBA 2CXEA 1IUJA 4ZJOA 3M32A 4M5JA 2ATLA 1NSKL 1P6TA 1Q1KA 3GFZA 4TNOA 3PW2A 3DLKA 2WSEC 4NLUA 3T9ZA 4J90A 4DPUA 4LT6A 1Y3JA 2QC3A 3MDFA 4OIXA 2W2OP 3AJ1A 4XO0A 5A6PA 2BJDA 2Z2ZA 3M2RA 2CQGA 4Y2IA 1EARA 4I2PB 2C2NA 2BRLA 5K8PA 4P2MA 2JEIA 2VASA 3BGFA 3UDLA 3HSGA 1RT2A 4ED4A 1L3VA 4C0HA 4PG4A 4A8XA 1DLOB 1TUVA 1QAIA 2O3DA 1EB0A 3UDCA 3UD5A 1TTHB 2KHDA 2Q66A 3JSBA 1L3UA 2V63A 2YPZA 2ZBQA 1HL6A 1TAQA 2MGZB 5CD4H 1SQGA 3EMTA 4C8ZA 1BMQB 1HW9A 1RWWB 4AD6A 4KKOA 4FPRA 2HEKA 4NMLA 1JXEA 2OPQB 1JLQA 2Y1IA 4GRSA 3BQ1A 3PCOB 4NLQA 1H72C 5HROB 3OPKA 2I5JA 1VQ9S 2Q79A 3SIPB 2YPYA 4UF4A 4KH0B 1SH0A 4P10A 3VZHA 5KG4A 1Q5YA 1U1RA 5IM0B 3TUZC 5EWFA 5KG2A 2AD9A 2EFPA 1VRQC 5L1LA 4ES3A 5GMDA 3MUTP 4Q8FA 4CH1A 3HKWA 3HHLB 3D6MB 1RT5A 4OQJA 2XSJB 2UVUA 2PFFB 1WF1A 3GZ7A 5AXNA 2MMYA 3TJ8A 1EETB 2LEBA 3M8RA 2RAQA 2KXNB 3KYLA 2MZ1A 3IG1A 4QIWD 3HF5A 3M8PA 4M63A 2LYVA 1HWUA 3CJ8A 4ECXA 3D0IE 4USUA 3QLHB 2XM3A 5CZXA 4K7QA 1RUSA 1LNQA 4P9SA 2VG7A 2H65B 1NLKL 2BDPA 5JXSA 2QSWA 5DRKA 1WJ9A 4EI2A 1TMMA 2X1AA 4L73A 1PC5A 3EVMA 4B3RJ 5IV4A 1FHTA 4ZN1A 3CVKA 4DR5F 1OSDA 2DY1A 4OZJA 3TI0A 4DR7J 1RT6B 3C14A 3H5SA 5DLGA 2V69A 3SQOP 4L3NA 4M5KA 4DV6J 1X4EA 2QRRA 1FRJA 1C1CA 3QT7A 1HNVA 3FCWA 3U1NA 1PYTA 2NLWA 2HPUA 3U02A 3V4IA 2ZH1A 1LFWA 3HZGA 1QUVA 1CJKB 5KFKA 4GO7X 3R7BB 3ISNC 1UA0A 1Z4UA 3W1YC 1UEKA 4A4JA 1D9DA 1L5UA 2B5JA 4OZ1A 3HM9A 1MNEA 2W7OA 4DV2J 1PJ6A 4XIUA 2GMLA 1SL0A 2JSXA 4B9VA 1G2EA 3EZUA 1IJEB 1S49A 4DQRA 2CIMA 2WAQD 3GG1A 5KTQA 1X5PA 5CHCB 5LJ5Y 3MUMP 3KLGB 1NK8A 2C42A 2AWZA 2V8PA 2VG5A 3T1HF 2FB0A 1T9UA 3RBDA 1SQEA 4R0EA 2HBQB 4O3NA 5A8RA 1IQTA 4YP3A 3T3FA 2G13A 1LXNA 1T94A 2V8HA 4B9MA 2UUCF 2UVWA 2DISA 3H4BA 1IN0A 2CAJA 4JV0A 4EZ9A 3J80Y 1VGYA 2QTWA 3EXYA 1S0OA 2YKMB 3RYLA 3WBZA 3D54A 3DLEB 3PW5A 1RU1A 2LEPA 1NJYA 2J8AA 2QA4G 2VIHA 4C2MA 1F9EB 3BO2A 2A10A 2K7JA 4B02A 3V6DA 3AD7C 2XWYA 4CP5A 1JNZB 1F9HA 3JQKA 2RT3A 2OEMA 5HO4A 3E2EA 2MYFA 4RJVA 3BR9A 1RAIB 3ZZTA 4RUHA 2CG8A 4ZS6A 2DH7A 5EHHA 1UJ5A 1JKHB 5E33A 1T9XA 1K1SA 2RF2B 4USVA 3W9IA 4GVBB 1KFDA 4ZVEA 2XI2A 3FVYA 4ZA1A 3TUJC 4RZRA 3KK2A 4TY8A 2AJQA 3GIKA 2DGVA 4YQWA 1IJFB 2F63A 3BBFA 1OY6A 1FFSB 1BQNB 1WD6A 2QYCA 2YWGA 3DXBA 4JI0J 5AXKA 1U0HB 2F5GA 1UP1A 4R5PB 1HBNA 4WK3A 5EN1A 3MOJB 1SCJB 4USIA 2ZM6F 5EWEA 2E5LF 4C11B 2YQ0A 4ZMMA 1BQXA 4JI7F 2MJUA 1B7YB 3IA0A 2A6MA 2M8DB 5H9FK 3CO9A 3L09A 5GADU 4K4WA 1M5KC 3B78A 3U7JA 2HZVA 4LFBF 2VICA 2HWIA 3BEGB 3MPUB 4RKUC 1YZ7A 2LLZA 5MLCV 1HBUB 2R3VA 5HK4A 1RAAB 3DGPA 2Y9HA 2B3TB 1GFWB 4H4MB 4I4BA 4F4WA 5JMNA 4NASA 3PDNA 3AJ2A 2NXUA 2V4JA 3RBZA 4L76A 4Q43A 1S1XB 4DV5F 1D1UA 4C7QA 3CGIA 4QU6A 2ZJRQ 1Q82T 3AQOA 2WVFA 2HNZA 5DG9A 2DITA 4FYXB 1J27A 2J7KA 1HWKA 1RLCL 1Y9OA 2DGXA 4PEOA 2EK6A 3CD0A 1QAXA 1RISA 3EX7B 1NJZA 5F8JA 5C25B 4ID8A 2QA4S 3C8YA 4L74A 3KJNB 2BJ7A 5C24B 4F2RA 1NSAA 1JLGA 5IFMA 4NEYA 1HI0P 4OX7A 3R1HA 4OHYA 5HL7Q 1IKYA 4J9PA 1JIHA 2U2FA 1C1BA 1HNWF 4DLEA 2JLGA 4X4NA 4J91A 2QZ8A 3G71S 2YWWA 3KDOA 3GIMA 3OJSA 2CJXB 3UDVA 3D6FB 3OL9A 1RAJA 3TJ9A 1JJCB 3HFVA 1C4AA 3W62A 5FLXY 1VFJA 5FD1A 1ZZNA 2VUGA 4CO5A 4DJBA 2DNPA 2PI5A 1XQIA 1NK7A 4G1IA 5MAOA 2DNZA 5T7LB 3QGPA 4UW2A 3VAKA 4AXIA 2RVJA 4X65J 3ZTRA 3DDKA 5DDOC 3UWTA 3G6VA 4P71A 3ZC4A 3GSDA 4QOTA 1SXLA 5F8GA 2MZTA 2VDIA 3DU6A 2DT9A 4PR6A 2GO9A 3CDAA 2CQ4A 3RRKA 1A9NB 3H8YA 1ROFA 3VF0B 4F02A 5KT5A 4IG0B 2IFXA 2PO4A 2HNDB 3SQGB 2I0XA 3Q2SC 2J6TA 2A1BA 4YY3F 3KLEA 5LJ3Y 3BKUA 4QYZJ 3A3OB 1NU4A 4FZVA 2H5EA 2DGTA 4EU0A 2AX1A 1WDTA 4IFYB 4YDDB 2H3EB 1X5OA 1TKXB 1WSVA 2D41A 3PW0A 2X3DA 3QSYB 2QV6A 2W7PA 2B9YA 2AT1B 2FLOA 3EDRB 2GGPA 2IYGA 1RYRA 2NR0A 1S57A 3FSIA 3KLIB 1T05B 2N4CA 4CWBA 4NX9A 1O8BA 1EZZB 2ZH3A 3QJLA 3SDEA 3TZWA 3WIVA 2ZOMA 4HYKA 1IKXA 4K8RA 2HRUA 3JQMA 4ZLLA 4I6AA 2WVBA 5GAHU 3KJVA 3TZXA 3PTWA 3TJAA 2IYIA 5HMXA 3UN5A 5CYMB 2VBZA 2VL1A 3D68A 1UVKA 3TZYA 1VQNS 2G9OA 3VALA 4IH6A 3IBWA 1H2VZ 2B4OA 2B9XA 3VAMA 1HWLA 4MKAA 3IR6B 1LW0B 3MM6A 3LUYA 2BE2B 4G1QB 2Z2LA 3HZEA 2EFGA 3SYZA 5CH7B 1T3OA 1JMTA 3IFEA 1C4CA 2XULA 1DY3A 1N5SA 2NSCA 5J2QA 2HHPA 1CJVB 2CQCA 2XLJA 2WVEA 3M8SA 1S72S 2G1HA 1KQGB 3N5FA 4DR4F 1BUXA 4ZLPA 1IM4A 3MEEB 1UJ4A 4P72A 4C3MA 2ZH4A 1BGXT 3I32A 4CQ1A 5EX3A 2OMOA 4K4YA 3K58A 1FKPB 4IDKA 2NREA 2G2OA 2AHOB 1NK0A 4JOUA 4PAAA 1NKBA 5GAGU 2PEBA 2W1BA 3MR7A 2G2ZA 3UPFA 3CC4S 1LWXA 4Q2LA 3BGRA 4XPEA 2EBEA 2DNNA 4ZVGA 4OI0A 2OSQA 4NCAA 5M2UA 1AT1B 5ETLA 1U1NA 2BZ2A 3FRZA 2CZ9A 4YR2A 3TUIC 3BH7B 1V5VA 1LWCA 3KJQB 5AJ3F 2DR9A 3MR6A 1HI1A 3IS9B 3RRHA 1TP7A 2K8GA 4F4AA 4NE9C 3CEDA 4MTPA 4NRUA 2BMBA 4QIEA 1U1KA 3NCQA 5G4DA 4OI3A 1PILA 5KAKA 2GJFA 1VYAA 2GVZB 2KXFA 5D4PA 2M8HA 1OQ3A 3TARA 4NLWA 5HQMA 2DY9A 1WEYA 4LSNA 5L9XA 1ZH5A 1XIQA 2NXCA 4YR3A 5J1EB 3FFIB 3N6NA 1K47A 1FEEA 5ETNA 5L1KA 2MQ8A 3OT9A 4DR5J 1NO8A 4KHPF 2UU9F 3G6XA 3LA0A 1SUQA 1B70B 4P74A 3HMJG 1K73T 1LK7A 3DLHA 4WKRA 2CFXA 3TA0A 2F8EX 2OLWA 2BW2A 4MK7A 2HQGA 2JEGA 4ENOA 2E7WA 1NK5A 4ID5B 1G4CA 1JQGA 2BJ9A 3NOGA 1YRTA 4ZHRB 2VH7A 5A2QY 2P6TA 3B82A 2D7SA 3OR2A 2J0WA 3DRPB 3BPSP 1R8PA 3M32B 1MMDA 4NYZA 4UOHA 5ETSA 4TU9A 1L3SA 1T95A 2MKSA 3CD6S 2R2RA 1M5OC 4CO1A 3DLKB 1N36F 3GTYX 5K14A 2ZZTA 3WHIA 3OL6A 4QCLA 1RJJA 4QJVA 1R0BG 3D5MA 2DNGA 2VFVA 1GT8A 4ELTA 5JVHQ 3DI6A 3M2RB 2HFZA 2WRMA 5DG7A 3NAIA 3M6VA 2DR6A 4DUTA 2HQFA 2CNOB 2QL7B 2RS8A 1RT2B 5HANA 2M2BA 1VLOA 4PYDA 1IKWA 4FKXA 3T1HJ 3FEYB 4X4UA 1WHWA 3S1TA 3MTKA 4NA2A 5L46A 5H9EJ 4WFBQ 5KFJA 3M05A 2YNGA 4PG6A 5GAEI 3HLUA 4JI3F 3FZ2A 4WYLA 3B4MA 4LIWA 1N5TA 2C3MA 4HDHA 1KD1T 5LL6d 4OYAA 3KK3A 1IBKF 3E3XA 2OPPA 4BS2A 4LR7A 2B4VA 2FVQA 2VFSA 2MQQA 1JLQB 2IY5B 5KFLA 3C6TA 4J9OA 2I5JB 4TQSA 4QWDA 4EEYA 1Q8IA 2HKEA 1IBLF 2Z2MA 1MN9A 1N34F 2XMJA 5A8KA 2LA6A 4OI2A 3MECA 3R5GA 2J9DA 1VIOA 4E8UA 3KTQA 3VAFA 2B8PA 2FJDB 2XLKA 3CJ2A 1UJ6A 3PJXA 3RB4A 4A47A 2MHNA 1RT5B 1NUEA 3G87A 2I9SA 2X1GA 3W2WA 4OJ1A 3L7UA 3IM9A 1U1LA 1TK8A 4HHJA 3I4PA 2HWTA 3M8PB 4ATNA 1V5IB 2XGPA 4J9RA 1UA1A 1FJGJ 2NQPA 4IRDA 2WCXA 2RDJA 2JWNA 1ACMB 3OLBA 2DNHA 4E0DA 4ZCMA 1UVLA 3OL7A 1I6JA 3L3CA 4JI7J 3GJQB 2VG7B 2RSQA 2OELA 3P96A 5K8MA 3MEDB 1YJTA 4X4TA 4LVOP 4X4SA 2OFHX 3Q8QB 3EXCX 4DBQA 2DRBA 1KBRA 1DFDA 2FHJD 2V2QA 4BHQA 1X5SA 5HJXA 2BQRA 1A7GE 4PWDA 4DV5J 4F4XA 2ZE2A 4DSKA 4OYZA 1YDLA 2A6OA 2KM8C 4DPTA 2KH9A 4RW7A 3UCGA 3P8BB 1TZ0A 1C1CB 3DOKA 1S1WA 1HNVB 1IQZA 2FHJA 1PO6A 2MKCA 2DHXA 5DGBA 3GMGA 4F0MA 3V4IB 3PYEA 1U1MA 2CNLB 2XS2A 3R2CJ 4DF8A 1CJTA 2U1AA 1RAFB 1S4FA 3D66A 4OMFG 3NNCA 1B0TA 2OSRA 4GO5X 1KC8T 4O3PA 3SZ2A 1S6QA 4UOFA 1FD2A 2B5JB 3JS9A 3V81B 1X4BA 3LTOA 1VRUA 3SSSA 5HATA 4YHHF 3Q86A 1CG2A 3HDSA 3QAEA 3HHKA 2LQ5A 5D0GA 4NYOA 4KJIA 3PNIA 2YX7A 3L95X 1QAYA 1HNWJ 3KG4A 4C97A 2CWKA 3BYPA 1TL7B 2R8KA 2AEJA 2AP6A 2GFFA 3DDIA 4LREA 2VG5B 3QGHA 1KRPA 3HP6A 3MAQA 5A8RB 1AROP 1RT7A 3N9UC 4LRAA 2RDIA 5F9LA 5JUMA 3QGIA 1M0SA 2CNKB 2W4CA 4DL6A 2CZ4A 1X4DA 2R2TA 1NXIA 1SVDA 1N6QA 2FZCB 3H20A 2YNIA 3R5DA 2LXFA 3Q89A 4F4YA 1TELA 4ZVRB 5THWA 4K5SA 2DEJA 2JHEA 3V6DB 1SPBP 2GMJA 2BW7A 2MHEA 4QIGA 5E3PA 4C8LA 4QBUA 5B0CA 3D4JA 4MKBA 3ILIA 3CCZA 2HHHF 2D1CA 2OI2A 3V2UC 2K06A 3O8WA 4F67A 3R2DJ 1M1GA 2FLLA 4C9DA 3HVAA 4O4GA 2CNNB 1CSJA 1FK9A 2V67A 4XK8C 4YY3J 1K1QA 3ISZA 4TY8B 2A2CA 2YH0A 2IA0A 3CD5A 4TYAA 3G82A 4PPDA 4NZ0A 4ECWA 2DJWA 5HI7A 4WKYA 4NXNF 2CQBA 4CNYA 4C8NA 4LRDA 2XZTB 2CJKA 2CDQA 4ANDA 3GP9A 2HMIA 1HBNB 1XMOF 1R6VA 5E3AA 1DRZA 5IQQA 2E7VA 1S59A 2HWHA 5ADZA 4CDIA 2R9LA 3AJDA 2Y8YA 2DNLA 1GMWD 4FF1A 4U6PA 2YY3A 4OHWA 5I42A 4U67Q 3FBBA 2JNJA 4CO3A 1XN9A 4RUAA 1X5TA 1JLFA 3V6JA 2XI3A 1YJNS 3QT5A 3DGPB 4DZDA 4TLRA 3TEGA 1WWHA 1CQMA 5JJBA 1GMWA 1WG4A 3TVKA 1A6LA 2V4JB 3BSOA 2XY7A 2I1RA 4MKVA 4YN3B 4H4KC 1REVA 3LPEA 2C3PA 3JYTA 2YKAA 2E9TA 1BD6A 2J9DE 3ETMA 3VQSA 4LF2A 4JI4J 2HNZB 2HHWA 2GC8A 1ZA1B 5EX0A 2M70A 4WPAA 1VQ4S 4DL0C 1U47A 2CPIA 4HI1A 3HK2A 4GC6A 3GE9A 1IBMF 2Y1LB 3M8WA 2XYHB 1RKJA 4UZBA 3DRRB 4NLVA 4ED8A 3R6GB 1Q8KA 1JLGB 1YI2S 4DR4J 2FVCA 1ZAXA 3KWMA 2MQNA 1UZHA 2V9WA 1IKYB 4EBDA 5LXYA 1H3DA 1CBKA 4EBEA 4HDGA 2HZAA 1C1BB 4FBUA 4KV8A 3UFCX 3A8EA 5IC6B 1YK9A 4LF4J 1YQHA 2F1FA 2IMOA 4QPTA 3RRGA 2GHWA 4ECRA 1NDPA 1X4GA 4RU2A 4PRFA 4WFZA 2XMTA 4FXVA 1OJ4A 4PPZA 3W63A 3MCNA 2C2OB 1M1HA 3GONA 1YJUA 2FLNA 4DU8A 3QGGA 1GXUA 5AJ3J 5ETMA 4GMKA 1WORA 4QW8A 2ZVIA 2R8HA 3QJPA 1FDDA 5T41A 1QD1A 2WSFC 3KHLA 1X31C 1X0FA 2JX2A 3WX8A 1RWUA 2YKPA 3NS5A 4ZOSA 2VB6A 3BBCA 4Y2CA 2HS4A 3H25A 4TVAB 4WBFA 3N01A 2CUYA 3L7PA 4DFMA 3ZZZA 2AGQA 2ZZNA 4I7FA 3GQCA 4BWJA 1AA1B 2IJRA 4XDCA 2MXYA 2KZZA 4WK1A 1ZETA 1WOOA 2CQ2A 4ECTA 3RJMB 4IH7A 4USJC 3RAMA 5SZTA 2SXLA 3KLEB 1X4HA 3V6KA 2KVQE 3IC1A 2ZH7A 4JYAF 4OYXA 2E5HA 1VQYA 1VC6A 1X9MA 2ACYA 2QX0A 3PEJA 2FVSA 4KHPJ 1U2RA 3F41A 4MIBA 2UU9J 1EIYB 1H7WA 4TU7A 1X0PA 2KRRA 2PN6A 3DLJA 3A3PB 4YUDA 1RT1A 3KLFA 1S0VA 4J5OA 2CJYB 2JLEA 2GGPB 1FRLA 2IM0A 4FVMA 1S9GB 1DBDA 3J7AN 5D0EA 2GJ2A 3SDEB 2PMWA 2OUGA 3TNVA 2DK2A 4FYVB 3BSNA 5CCMA 3NS6A 3C66A 4UTGA 4Y0FA 1IKXB 1AZSA 1WDDA 3B8HA 3LF0A 3O5TB 1SJRA 3KJVB 2XSFA 3ZZRA 1N36J 1SJQA 3CCUS 3UR0A 2EW9A 1SIWB 2R7RA 5I3UA 4OL8A 3VZIA 1F9FA 5KG7A 5KT2A 2ZEJA 2HBZB 4HACA 1SC1B 1VK8A 2HURA 3GB0A 3KFWX 2G1DA 1NHUA 1W2IA 4DV7F 1FA0A 1WF0A 4K2XA 3MM6B 3LP0A 2DHSA 3D9BA 4LF8F 1QVGR 1WI8A 2QE5A 3AD9C 4IKAA 3D1HA 2R7VA 1T03A 4J9QA 2VA2A 1WOPA 5J2QB 1Q16B 4Q0BB 1WF2A 3KOAA 3CE8A 2W01A 3CCES 4JI3J 3D1QA 3R5CA 5IWAF 3VGUA 1B0VA 1Y10A 4KGZB 3PRDA 5KFBA 3QRPA 1RAGB 3MM9B 4QR0A 1VQPS 2XTJP 4J7CA 2CKWA 1IBKJ 4LQ3A 2UXCF 2R7WA 1JX4A 8ATCB 1VBYA 1I3OB 2KT3A 2F9DA 4IDKB 4AXJA 9RUBA 4LBIA 3HX9A 4TQRA 1NHVA 1AUDA 1U26A 1RHJB 2ZDPA 2OGUA 2UUTA 3W5XA 3BO4A 5LMUF 3BGRB 2HQ3A 3GWCA 3DOLA 1N34J 1HA1A 3G96A 2V5HG 2D69A 4GKKF 4TYBA 4C3LA 2V2KA 3FQLA 2N3OA 5I3PA 2XMUA 1HBOA 2DHHA 1FRHA 1LWCB 1JLCA 4K50A 1LW2A 4A8WA 4Q7AA 3ZZUA 1TMJA 2ZVSA 4ZVOB 1QE1A 1AXQA 2VHGA 4ICLA 4DFKA 4OLPA 3FC9A 4DLGA 4P2SA 1HHSA 3BKFA 4YDXA 4ECQA 5GMEA 5A76A 3EUNA 3IRXB 3K57A 4HHUA 4W4MA 1D8YA 2IHR1 2E29A 2XO7A 1LV5A 4LSNB 3V5RA 3LP2A 2C1EB 3M8QA 2EFNA 5RUBA 5B08A 3C3LA 1UPMB 4PXDA 1VJQA 2YWFA 2NS1B 2C2ZB 2XHWA 1NK4A 1BQMB 1GXLA 4F8RA 2Z56B 4Z2XA 3LWMA 3KUGA 4XDDA 1SUQB 4K5RA 1HBMB 2Y0BB 2P2CB 4U8VA 3D3CJ 3PVXA 3OFFA 4X66F 2F8MA 4DMZA 2C2KB 3R6LB 1QTMA 1S10A 3FCHA 4LF1A 3TA2A 3T9NA 3KUEA 2MQPA 3TVZA 4Q5VA 3UD3P 2QGFB 1VCTA 1U2CA 3T41A 1KHVA 3OR2B 1VLYA 1SJ4P 4IO1A 2BJEA 3AODA 4B3MJ 1UVJA 2JVOA 3NL0A 2M3DA 5HQLA 4DCJB 5K14B 3RG6A 3MURP 3TRGA 1G1XA 4QZVB 3DI6B 4ETZA 2QEXS 3R7SB 1RLDA 3CDWA 1RTDA 3A8KA 2CYYA 1HD1A 3MOZA 1WKJA 3JSRA 3RBEA 1OQ6A 1FVQA 3QAUA 5A8WB 1RKIA 4FF4A 3H5YA 1IKWB 4EZ6A 1X9SA 5HVFA 1ZZFA 3KK1A 3IBCB 3O3LA 2FJVA 1RCOB 1P9YA 3UCUP 4W92B 1J5OA 1FDBA 1UWAA 5KFPA 2XMAA 2ZOGA 5ITHA 2GO8A 1R31A 4HR2A 1RQ0A 4A8FA 3TW0A 1M5PC 3FEZA 4KH1B 2IC3A 2DNKA 3CJ4A 2DR7A 2H4YB 2LEAA 3RB3A 3KK3B 3EDQB 4RUBA 2RU9A 4KY3A 2OPPB 4LJMA 4LFCF 4CLZA 3HULA 2BOPA 2BKNA 1LFPA 2HVEA 5J2MA 3NBPA 1KQSR 2YBVA 3LGMA 2VU5A 3FK4A 3C6TB 2C2MB 2MQMA 5E3RA 3PX0A 3G86A 1VBZA 2RHSB 5HJYA 4OYOA 2W9CB 2HHHJ 1K0VA 3SSQA 3OTCA 5IT9U 3ILOA 4P7TA 4IR9A 2WZ1A 5A8KB 1H6KX 3BYRA 3MECB 4P73A 1NKCA 2ZH5A 2RKIA 3AFGA 4RW6A 2CVEA 1FD8A 3M2UB 1FO1A 2OTLS 4NXNJ 1N5YA 3VAHA 3W2WB 4NWBA 1XMQJ 1X60A 3OUYA 1DAXA 4X2BA 1XMOJ 1W26A 1UMJA 5KOXA 4JI5J 4EK2A 3BDPA 3DXSX 5L1IA 4X62F 4FNIA 3M8YA 1LWFA 1XWLA 1EP4A 3W9HA 1B7FA 5KFVA 1D09B 3NGSA 3DRXA 2Y8WA 5F8NA 3DN9A 2ZC3A 3EVWA 4LRFA 4CLYA 4L75A 2QLBB 2R7TA 1F6TA 1I94J 4ZPVR 4F3MA 3PKYA 1RAEB 1MROA 4DF4A 1N56A 5KFFA 4G6VB 4PWDB 2ZE2B 5KG6A 4DS4A 1W7WA 3FEXB 3D6HB 1IM6A 4DV1F 3DOKB 1S1WB 4JV2A 3JSYA 4HTIA 2W8LA 2B8QA 3IO1A 4O0IA 1RGVA 2IPOB 3NMRA 2RIJA 4B9LA 1CJTB 2YTCA 2W25A 2J8SA 4RU9A 1N54B 3GYNA 1IBMJ 1T3NA 2FZKB 3BKTA 3W8PA 4ED3A 1S6QB 5D8HB 1U6ZA 3W9JA 5BXIA 1VRUB 2HG4A 4C8OA 1S99A 1GTHA 2P8IA 3PFEA 3EPIA 4IYQA 4D3HA 2IA6A 3K5OA 1HHTP 1AB8A 5DZ6A 3PIPQ 1SL2A 1D9FA 2V2ZA 5HVHA 3J7YU 5CQGA 2KG1A 3NNAA 2DGUA 1UVIA 3ISND 1B99A 4MK8A 5KG3A 3ZZPA 3CCWA 2JVRA 4JI6F 2H5IB 3EICA 4BC7A 4CLKA 3K8WA 1TL4A 2YNFA 2VZ9A 1RT7B 3IXQA 1KQKA 2F40A 2KJWA 3HVWA 2ZFHA 3B4DA 1RT4A 2YX1A 3S8SA 3BS9A 4HT5A 1FRIA 3U1MA 4OHZA 3P5TL 1N6QB 4K4VA 4ZP9A 2PA8D 3AHPA 1Q8LA 1RAHB 4W90B 2VDHA 1Q81T 4JP8A 4QIFA 3FUYA 3NCPA 1NH7A 1NCLA 2C3YA 3GV7B 4DR1F 4V19J 1FDNA 4ZVHA 3O6QA 4MFBB 4JB8B 4CRJA 2R8IA 1TL3A 1Q8BA 4CCHA 1NM2A 3PV8A 3GCXP 5HLFA 2IM1A 1HD0A 3DHXA 4Q8EA 2HGNA 4QW9A 3OVSA 2BKOA 2ASDA 2CG4A 1FK9B 5KFHA 4PG8A 1FT8A 5LMNF 4Y2KA 4JYAJ 2RNEA 3G82B 4DV4F 3NNHA 4ILMA 4NXMF 2W4PA 2AYBA 2HQDA 5AE1A 1HR0F 2FDNA 3V4MA 3MEGA 2A3JA 2HMIB 3PJ9A 1HQEA 1QM9A 3I87A 2QLWA 3HKZD 4M5GA 3JSMA 2AGPA 5HBMA 2VQEF 4FN5A 3OLAA 4ZVSB 4CLSA 5I42B 3NGUA 4IOCQ 1S48A 1U6FA 1W2BR 1JLFB 2QYGA 2ZH2A 2OP5A 1TAUA 1WC0A 2JLFA 1YJWS 3I55S 2M9KA 4LSZB 5KOWA 4DI6A 4MIWA 3MR3A 1NMEB 4M94A 1N33F 4QIVA 1REVB 3JYTB 1Q0NA 4QR2A 4F04B 3D2WA 2MSTA 1NNDA 1UW9A 2W4DA 1KLNA 2HIYA 3TAMA 2CQPA 1DQ9A 4DV7J 1HI8A 4WCEQ 3CC2S 2VKRA 1XEZA 2QSFA 1R8CA 4PQAA 5F3TA 1RCXB 1FNXH 3W2VB 2P9GA 4QYZK 4MT1A 3SBMA 2XS7A 4C0BA 3QZ7A 3L7OA 4PUOA 4HEA9 5IWAJ 2PMZD 1YJ9S 4KFBA 4PXBA 1SKRA 2EG2A 3GJRB 4OI1A 2LP4A 1TL1A 2UXCJ 1Q7LB 4JI8F 2MPUA 1SKWA 1TFWA 2JZ5A 4KV8B 4RO0A 3BR8A 4DSLA 3PYDA 2ILZA 2KRBA 1D0EA 2RQCA 3HFZB 3THTA 4RW8B 1H2TZ 2KZMA 5LMUJ 1S1VA 3NS7B 4BC9A 4OYBA 2C2EA 4DUZF 4FYWB 3CCMS 2RRBA 5CA5A 2BQ3A 1WC6A 2L41A 1TKDA 1IVZA 1S9FA 3MM8A 3FBCA 4W98A 1RXOB 4JI2F 3DMJB 2GIFA 2DO4A 2RUGA 3CPWR 1B0PA 2P9CA 2DGSA 1JXVA 1UFWA 1H7XA 2KDOA 2JOQA 4NLOA 3BPDA 1WTFA 2O5DA 2JC1A 2BJ8A 2B6AA 3K2YA 3Q8PB 1SV5A 3ENQA 1Z2LA 3BH6B 4I7FB 1YHQS 3CIMA 4M5NA 2DXFA 2E7XA 2GNKA 1UZDA 1TUGB 3P6YC 3GYGA 2E5JA 1LWEA 1XBWA 2EFOA 2N82B 2DYAA 2LU2A 3VAIA 3RB0A 2CPDA 3R97A 1IR1A 3VCDA 2VPZB 3RTVA 2VV5A 3TAPA 4DOZA 3RU0A 3EE3A 2C28A 1P27B 4YOEA 5GADI 3I0RA 4ZPCA 2IM2A 3ONQA 3ITHA 1NAQA 2WONA 3G6YA 3W3SA 4CO4A 1RT1B 3KLFB 2NZCA 4X66J 2YH1A 4DS5A 3JB9k 5HP1A 4OX9F 1KEKA 4JI1F 2AJ4A 1RHKB 3N79A 5F8HA 1HMVA 2IVMA 4OLOA 3SEOA 3QMQA 2E9ZA 3FSYA 4PQUA 4YS2A 3QIPA 3M8ZA 2Z8QA 1RDRA 4BDPA 1AZSB 2PA3A 4ZPAA 3E01A 3P4UB 3NRBA 2MQLA 4QU7A 1XTZA 4DSFA 1YRUA 5I3UB 4S0MA 4CTAA 1U8SA 3LP1A 4ES1A 1UFKA 2V8GA 2AEMA 3VGSA 4Y65A 4LF7J 4A8KA 1ZPWX 2DCUB 2V0NA 1WEXA 4F0HA 2JEFA 4MKYA 3LP0B 3G6ES 2DNYA 1RSCA 1UAWA 4DQIA 2OD6A 3IRWP 2ZJQQ 1FI4A 3P45B 5K8OA 2UV8A 4AT1B 5F8LA 2CQHA 4M5LA 3C15A 1PSDA 1QSSA 1ITPA 5F0UA 3D3BJ 1DQ8A 4X4PA 1M5VC 2ZKUA 5F9NA 3H40A 3SV3A 2W2NP 3ADAC 1FJCA 1YTYA 3E8OA 4LFCJ 1J5EF 4AL7A 2ZBCA 2DXEA 4USTA 2K3KA 2QG9B 1QY7A 3J81U 1VISA 4DUYJ 1L3KA 3RW6A 4P2FA 2AJ0A 1ZAVA 3EGVA 3I31A 5H1SV 2J9CA 1JLEB 5L39A 4OYMA 2FLPA 3MXHP 3IGNA 2V6AA 4B08A 5LM7E 3JAMU 3DRSA 2XSJA 5LSLA 2MTLA 1UL3A 4JBCA 3IWLA 4DV0F 3KUHA 4MYUA 3W61A 1EETA 4KHRA 1HBOB 5L8RC 1JLCB 2PEHA 1LW2B 4F3OA 2YWKA 4HTJA 3G9CA 1PGZA 4WFYA 2BX6A 1QE1B 1YKWA 3QLHA 1JLBA 2LVWA 2GHPA 2R8JA 4ICLB 3THPA 2I6WA 1PYSB 1R0AA 5K9FA 4DXLA 4MMOA 4RNOA 1VQOS 1XC9A 2G2YA 1C2PA 3SCJE 4N8NA 1NDKA 2RQ4A 5H9EK 1BE4A 2IVYA 1U1PA 3OFHA 4C8MA 3PY8A 3LP2B 3M8QB 3ZZOA 2P9EA 3R5BA 4DX8H 2G0JA 4HI2A 3X3UA 3UW1A 4Q2MA 3TAQA 3AH6A 5J1PA 2EG1A 1FVSA 2Y1JA 4KR0B 3QSIA 3PO5A 2NYIA 3CJRA 1UCNA 4OHXA 3BM7A 3ENWA 4IG3A 2R42A 1RHMB 1KSPA 4DV1J 1SC6A 4QQBA 5HMWA 4WZMA 5E2QA 1KN6A 1U7LA 2DGWA 4NA3A 5GAHI 4AQYJ 2B56A 5DQGA 2DBBA 3V6HA 3HSJA 4WFXA 1Y11A 2XNRA 3DOMA 3QT8A 2E1MC 1YLXA 2K3IA 3RAXA 3RB6A 1YX2A 2KT5A 4A8QA 2H4WB 1HLWA 5F3ZA 4KQZA 1TKZA 2N4DA 4JV1A 1V6HA 5DJBA 3A8IA 2XMVA 1OPZA 1Q79A 3PYGA 3MM5A 4DR2J 3K5LA 2RJZA 3BSAA 5ETPA 2ALZA 4CT9A 1FJ7A 1U49A 1RTDB 3EM1A 1HYSA 3AB4B 4YEAA 3SFUA 2ZUGA 3QO9A 3KK1B 4JI6J 7FDRA 3SXLA 2N7YA 1J5OB 2DNMA 4RWWA 2LA4A 1RI7A 1QUPA 3MPDA 2W2QP 4M5IA 2QL9B 3CWJA 1IXKA 5GAGI 2IC3B 4U95A 2KL8A 2GIRA 1WI6A 4DN0A 3OW2R 3CJKA 4RLEA 3MM7A 2HQIA 1KOHA 3NBPB 4DR1J 4J9SA 3BN4A 3ET6A 3UDEA 1GMUA 2HYIB 4Y3CA 4AYBD 4ZJQA 4N77A 2LU1A 3SMZA 2BEFA 2BUNA 5JVGQ 3CT9A 2C3OA 4Y6IA 2JEJA 3OL8A 2RKIB 3TO8A 4ZP8A 1RBOB 4NYPA 4RW6B 1GX5A 2AJ1A 4DV4J 4R5PA 4O44A 1QSLA 4C98A 4NXMJ 3FRYA 3BV8A 3BZQA 4URQU 1VC5A 1HR0J 3HJFA 2BM1A 3PHTA 3QBCA 3OUYB 3OFGA 1FJEB 2YNHB 1VBKA 3W60A 2OEKA 2WVCA 2PC6A 3FMWA 1YWXA 4OZNA 3UVJA 2HZCA 2CPYA 5AXLA 2KB2A 1EP4B 3T19A 3GR1A 2M5YA 5J2PA 3IN5A 4ITSA 3PR5B 1S1XA 4LF6F 1PAEX 1SJ3P 1PCAA 2B4PA 3LAMA 2IBKA 2GQ2A 3HT0A 1KS2A 3H2LA 2HFSA 2QO3A 1EHWA 1MROB 1N33J 2WW8A 2E66A 1HIYA 2HFOA 3L4BC 3RW7A 2D74B 2RQMA 1QDUB 5K5MA 3CCJS 4KGXB 2EPIA 4HKQA 1EJ7L 1ZM2A 3KLHA 2DXDA 4B17A 3DFEA 3Q24A 4PABA 1UW4A 3T6BA 4P6QA 1DTQA 1ZM9A 4DV2F 3OTBA 4CZCA 3FNNA 1OY9A 2Q6CA 5CZVA 4KSEB 1NK6A 5EGYA 3TX8A 2MEWA 4B9UA 3Q0AA 3HPOA 1FKAF 5DG8A 1S7IA 1VR6A 4JUZA 3EYZA 2HVDA 5M2PA 2IM3A 2F3JA 2HFVA 1KTVA 2ZH9A 5IT4A 3UN2A 3PM9A 2R4FA 2LFVA 3AAWB 2F4FA 5DM7Q 1JLAA 1XERA 3CNQP 2HRYA 3CCLS 5CABA 1AW0A 4U7UD 3RR8A 2WOMA 2DH8A 4I6YA 5B7WA 1SC3B 4DU7A 1VOMA 4O3OA 1NB7A 4DR6F 4KC5A 3OXLA 2YNFB 2Q6BA 3SFGA 3MFIA 5LSOA 3QNWB 1MSWD 3WZ0A 4USHA 1U02A 2LQBA 1RT4B 2FJXA 4NZ6A 5CYQA 2HAFA 1O6XA 2CQIA 3H2VE 3BDEA 3PO4A 5CD4A 4QWCA 5KFTA 5CCLA 5EWGA 2C22A 3Q2TC 3H5UA 1Q95G 4JI2J 2IAJB 1K44A 1MWZA 3O44A 4IG0A 3MAHA 2PT0A 4OZ5A 3BJYA 4Z7YA 4Y2MA 3FBEA 1NB2A 3MI7X 4FS2A 1RK8A 3A13A 5D0RA 3M1VA 1VIXA 2RU3A 2ZITA 4ZLNA 5HLFB 4NI2A 5U47A 2R7QA 1RACB 4CM0A 1Q86T 2J0QD 1URRA 1RBLA 3WC0A 3K0JA 1R89A 1PJ7A 1BLUA 4IFYA 3ULHA 1VS3A 1TFYA 4DV3F 1YBTA 2HGLA 4OFZA 1RWKB 3AOCA 3HHEA 1C0UA 3G8QA 4K59A 1KKHA 3IR7B 3I96A 3O1LA 3W5ZA 1KP6A 2V8DA 1AYEA 4EO8A 1S1UA 2W2PP 1RB0A 3PW7A 2XGQA 2DO0A 3UNYA 4LVNP 3DLGA 1HQ2A 4WZQA 3FDSA 2E1CA 4DDFA 1HQEB 2Z30B 4KRWA 4NLSA 3JSMB 5IS2A 5HBMB 1R43A 1HPZA 1QSYA 2EXUA 2MZSA 3FSXA 3HHLC 4JI1J 4OX9J 2R7XA 2NYHA 1HNIB 1T9VA 4N56A 1QTNB 4ECVA 3OTOF 4C48A 2Z57B 5KFDA 3IMQJ 5D0HA 2BXJA 4OJHA 1R0CB 1CULA 3SCKE 2WK4A 3OV7A 1U48A 1T8EA 1FWPA 1FKOA 1UETA 2NXEA 3KG0A 2JDJA 5BYQA 4HH0A 2HGMA 4F4ZA 3NKYA 2DKOB 1TKTA 1ICEB 4I1TA 3TAMB 3GPAA 4OX8A 3M4XA 1KHWA 2ZOFA 4WTOB 1CJVA 2OO4A 4RPFA 1TUWA 2LECA 2OFGX 5KFXA 4ELUA 1OY8A 3GYXB 3NGRA 1HKAA 1I5OB 1PYOB 4CLUA 2JFKA 2EEYA 4DX6A 1H0HB 3IGVA 4FDFA 1RT3A 1YG0A 1MLAA 4YR0A 4H4OA 3GG0A 3HVTA 2BANB 2KN4A 4KFBB 2DRAA 3FZBA 3CD7A 2AZ3A 1TL1B 2AYMA 3GILA 2QA1A 1RTIA 4J37A 1BWVA 1FRXA 4H4KA 1J5EJ 5IT9Y 4L6V3 4FYDA 3VVUA 5D4OA 2L48A 4PG7A 5CXTA 3HHNB 1PAUB 4PCQA 2O66A 1KR4A 2WBRA 4LBPA 1NKEA 2JFDA 2HS0A 2FJWA 2H5JB 1CEZA 4DCOB 2WHOA 3GFYA 1S1VB 2HNYB 5KG0A 3C19A 1T11A 5AXMA 3VV2B 2RUSA 4DCPB 3I5BA 1UVNA 4G3IA 1IKVA 1WHYA 3OFEA 3DM2A 2O01C 3M30A 4F0KA 2HK2A 1NH8A 3VR1A 2HHUA 4YB5A 3POTA 1FNOA 3FKBA 1ZAWA 2WSCC 3MM8B 4IR1A 1U0SA 1S6PA 4TLQA 4USKA 4YFUA 4X84A 1C0TA 3FBFA 3PIOQ 1M5SA 3Q83A 4QWBA 1TR0A 1S9EA 2XBPA 2Z0GA 2F65A 3C46A 2AGOA 2B6AB 1SV5B 1I51B 2FGCA 3CUNA 1OS5A 3F73A 1WKLA 2ZWOA 3K7RA 2W7AA 5IT0A 3MPVA 3ZTPA 3H42A 5B09A 2GVDA 4RNFA 4ECUA 1ZTWA 1WG5A 2OAUA 3NEKA 3A3NB 4M5DA 2W9BA 1H73A 4DX5A 3I0RB 4TY9A 3TP2A 2WBMA 4ZVTB 3ITHB 1DJ0A 2WONB 1RWXB 3S6EA 4FVCA 2QN6B 1S12A 4XTTA 3DRPA 1GTEA 2D3ZA 5HP1B 4TXSA 1RYSA 1VC0A 5FJ4A 1MWYA 1WC5A 1HMVB 2UUCJ 3AD8C 1WELA 1VQ8S 2DD8S 2ZDOA 1T9TA 4DN9A 4PQUB 3QIPB 2HBYB 3GFXA 7AT1B 4LSLA 2PI4A 1VQ7S 3W66A 1P1LA 3E01B 2K1RA 3DDNA 2M4MA 3AA8A 3ZNUA 2H9ZA 1Q78A 4KKOB 1NJXA 1E6YA 5KFWA 2GQQA 4DSEA 4E2FB 2YXLA 4CTAB 3LP1B 2V8VA 3DNCA 2FJBB 2GA7A 4N7TA 1HNXF 3I82A 2VPWB 2HVIA 2KO1A 2JC0A 2PD1A 2KFNA 4YMEA 4N47A 3LH2S 2EFQA 3R1LA 3H98A 3Q8VA 2R2SA 3D6TB 4CH0S 4NCGA 4X4QA 2H48B 2L9WA 1KTQA 1RTHA 3C15B 2FVPA 1RBAA 3CXCR 4CLTA 2V94A 2V50A 4WIQA 4F36A 1GH8A 4V1Ak 1YBAA 3OXGA 1F2GA 3IG1B 5G0RA 4QR1A 2AQ4A 2ZM6J 2BABA 2HFNA 2E5LJ 4OJGA 3NOCA 2MQOA 4NLTA 2LKZA 4NA1A 2KI2A 2KKHA 1REGX 4LFBJ 4LMZA 3BGOP 4KYZA 2HFUA 3DRSB 4HT7A 2UUBF 4DZ6A 2GW8A 4I2QA 2QL5B 2D3UA 3MCMA 1WUUA 3DRYA 8RUCA 3H0PA 2EWHA 2FHOB 2O1PA 1F5BA 3C14B 5DGAA 3NGTA 1B3TA 4K4XA 3FMBA 1R3NA 3F56A 1T9YA 1JLBB 1H98A 3D28A 1RABB 1JJ2R 1NEEA 4LF9F 3TR5A 3SI8A 1R0AB 3OR1A 1IWGA 3MEDA 1FF2A 2VJUA 2NXNA 2AU0A 1KLMA 4DR3F 3PXGa 5K20B 2XZDB 5T14A 4Q44A 1UPPA 5EUHA 1IBCB 1HNZF 4ED6A 2XCAA 1MU2A 1NBEB 1SH2A 4TKTA 4LF6J 1ZM3A 3R27A 1M1KT 1EAYC 2FTRA 2H1YA 3ILJA 2CZVC 3WX4A 3I56S 3LW5C 1H74A 3MMCA 2UUAF 4IG3B 2LXIA 3JTOA 4KGKA 3IWXA 3DCAA 2BJ3A 4MAKA 2NZ4A 5KFEA 1XJWB 4NLRA 2FY1A 4Z7CA 3KHHA 4DX7A 1VK3A 4AUKA 4J9LA 3NMAA 5ETVA 4OZ2A 2H51B 3V81A 5E5NA 3DOMB 1UKUA 3WIUA 3UO0A 2MDAA 5D3GA 2BOAA 2VONA 2HHXA 1VHIA 4URSA 2HQCA 2FD2A 4FNHA 1S0MA 2A18A 1TL7A 1TKZB 5C7PA 2RHQB 1U45A 4Y2AA 1NPRA 2V9KA 3MM5B 3KNGA 3HFKA 2ZD1A 2HSEB 3OHBA 1DTTA 1O0PA 4YB7A 1M90T 1HYSB 4X4RA 4ETXA 2IDLA 4PKDB 3QATA 1O51A 2CPEA 3TOQA 4DR6J 3QO9B 2COLA 4JV5F 5HMZA 1EKRA 2RH3A 3PYFA 1EQ0A 3VGVA 4IRCA 3LGHA 7FD1A 1NJIT 1WOSA 3KK2B 3C6UA 5KFYA 2MY7A 1JWWA 1OSCA 3ZXWA 1CQNA 3TVYA 4FBTA 3K17A 3OTDA 3Q8YA 2BV3A 3CJKB 4BLGA 4UT4A 1S4EA 2ZBIA 2WB4A 3MM7B 5DETA 4RW9A 2WB1D 4ED2A 5D15A 5AE2A 4TN2A 5F0WA 1R8BA 2HHVA 2IRYA 3ET6B 4ZN3A 1KONA 3ZTQA 2HHTA 2CVIA 1FE4A 1R7IA 4PG5A 5ETTA 2G4BA 1ZM4A 4NOHA 1PC4A 4EO6A 4NCBA 1YJVA 4DV3J 2XMMA 4WP8A 2B43A 4ZDNA 1SBRA 3BREA 1HFEL 2ALYB 4PXEA 2FJAB 1GK8A 1RE1B 1FJGF 4O44B 5HSPA 4ED0A 1ZYQA 3VVTA 2Z58B 5F41A 2UVRA 3CJ5A 2XHCA 1LKZA 2EBGA 3L9ZA 2BVZA 3FQKA 3VAGA 3WQPA 3GCWP 3UVJB 1UVMA 1CPZA 3GR0A 3JQJA 2VODA 2AMCB 1VQSA 2E5GA 5J2PB 1OYDA 3OTOJ 4KE5A 1SKUB 3UNGC 4J9VA 4ZPWR 4FYYB 4OZLA 1ZPVA 2ROGA 3GIJA 4M5HA 2AYGA 2FC8A 3MD3A 2AX0A 3G8TA 4ERDA 2GCFA 2QFIA 1JB0C 2AIRB 2ZWPA 1URNA 2XY5A 3KLHB 1FERA 3DRRA 4N8OA 1FFGB 1DTQB 4DQQA 1Y5LB 3NGDA 2PDAA 1FDAA 2MKIA 2CRLA 4BWMA 3HO1A 3WDOA 4DHVA 2A2DA 1RU2A 5DS7A 3N0VA 2XB2D 2Q3PA 2CA9A 1MG7A 1U25A 3PX4A 3BGUA 3J81Y 1YVFA 2HLUA 4RL1A 1WHXA 1F5AA 1HWIA 1Q5VA 3R3TA 4A48A 2IJFA 3NCRA 1JLAB 3KHGA 4PXCA 3KLVA 1N0UA 2RRAA 2I8EA 4ZCIA 2KM8B 4RNMA 3W5YA 3JAMY 2WOMB 4RW4A 2HS3A 3ILLA 2QLFB 2FJEB 3E51A 4XAKA 3ZZ0A 3Q8RB 2MKYA 3SCIE 2YQ1A 4CLFA 1LXJA 3ZNJ1 4F7VA 5IZHA 2RQKA 5CYQB 1V3ZA 2YQ3A 3IAM9 2YVSA 5E7OB 3Q22A 2Y0SD 2W9AA 1PKUA 1U6BA 1KDNA 1R6YA 2D3OR 1H38A 3P3DA 3ZZYA 4WXOA 2B51A 1SC4B 2EK1A 3OQ2A 4CYUA 2F8HA 5HQ8A 3MFHA 2J76E 3M1VB 2DPJA 1V3RA 2ROEA 1RWOB 4NI2B 5AE3A 2EFVA 4ED7A 2EC2A 1S77D 1FFWB 4LR8A 2UXBF 2BQUA 4KGVB 2DVIA 1FRMA 1FNMA 3O2IA 1C0UB 2DIVA 4K0KF 4B9TA 1BHNA 3PX6A 3MAAA 1RWVB 4IOBA 1G3OA 1U24A 1S1UB 4HLBA 2ZJPQ 3A4TA 1APSA 3DLGB 4LUBA 3B54A 2KJVA 3PJWA 4ZIWA 5LSRA 3MR2A 1S9GA 2MJNA 3MMBA 1H2UX 2UV8G 1S1TA 2QMUB 3TQEA 1HPZB 5FDLA 3PW4A 2HVHA 2JRSA 2PIIA 3FGVA 5BYSA 2NCKL 5C5JA 4QPXA 4NL5A 1RWNB 3AA9A 2D3O1 5C2GA 5KFSA 3W65A 5LT5A 1RWPB 4RNNA 1BWEA 2ZNZA 4WTYA 1CULB 1YBUA 1WNEA 1FKOB 2E1AA 5BR8F 4JI4F 4YB1P 2G0IA 3BBBA 2ZBRA 5DDPC 3G4SS 3HSZA 4OYWA 1XK8A 4OI4A 1FTRA 1HNXJ 1TKTB 3EWGA 4MJKA 4DL7A 2HAIA 3ICLA 3LAKA 4Q0BA 5KFOA 3QRQA 1IBLJ 4RNHA 4UZCA 3GJTB 2AW0A 2E1RA 1UWBA 5J2NA 1N88A 3LO3A 3MM9A 2UUWA 3PR4A 1U1QA 3CCTA 3MD1A 4LF5F 1RT3B 3J7YI 2NXJA 3MUVP 4B3TF 3AOBA 4H4OB 3HVTB 1GX6A 2V34A 4LF4F 4LQ9A 4NZ7A 1UTAA 3EZ5A 3AQPA 2XCPA 2GX8A 4U9RA 2HIQA 1RTIB 4ZVFA 1HHQA 3CCQS 5B0EA 1VDHA 1OMSA 3EGWB 1ZBTA 2ZH6A 3M2VA 2Y3YA 4CNZA 3CCRS 2OMLA 1S6UA 3OTEA 3UI3A 3HJVA 2XLIA 3GFHA 4U96A 3MGJA 2UUBJ 1RAOA 1IKVB 3K59A 4PZVA 3DM2B 3M30B 3NP5A 1DARA 2NSBA 3POTB 4FP9A 4OZ3A 3ZTOA 5FIIA 1S6PB 1NSQA 1FX2A 1QAJA 1C0TB 3R9LA 3UE2A 3IRXA 2ZUAA 4O3RA 2VD3A 4LF9J 1S9EB 3CW2C 2DH9A 3TA1A 3K5MA 4DR3J 2FPHX 2OHDA 1HQUA 2MZJA 1HNZJ 1FWKA 1BQMA 3I5AA 3CC7S 3T5LA 2GVDB 2OPSA 3I4HX 1U09A 2V2VA 2C2DA 2CJBA 1HBMA 2MKJA 3CJQA 4M5DB 4YHHJ 1R27B 2LXUA 2ZBPA 2W9BB 1B64A 4IFVA 1G6BA 2X51A 4OI6A 4KPCA 1YIJS 3TUPA 2UUAJ 4WYWA 1G7CB 1Z2ZA 3CULA 3S01A 1X4FA 4GC7A 1Q4RA 2E44A 1CVJA 3PFOA 4ZPTR 2CPJA 5F8MA 4Y28C 3VHQA 1L3TA 3I0SA 1N48A 2GHVC 2YNGB 4LSLB 2JL9A 2K1RB 3KKFA 3OVAA 2VFRA 3QFWA 2RDDA 1MWQA 1E6YB 1KVIA 2RILA 5A8WA 5DDQC 3ENVA 3QFHA 1WC4A 2LQ9A 4K4SA 4V19X 1MMNA 1SB6A 3EJMA 3HHDA 4I56A 2J7WA 3IBFB 2ZHOA 2J5AA 4LR9A 4F2SA 3CJ3A 4JV5J 2XG8A 5I4MA 2QA2A 3TX0A 3MMJA 2HW3A 3I9V9 2IIHA 3LGNA 4NCGB 3MZIA 3DLLQ 1OYEA 1RTHB 3IM8A 3Q8UA 4NPOA 2BKPA 3PRVA 1SJ1A 1HWJA 1NPKA 2L3MA 3D1OA 2W9CA 3VGTA 5B0DA 5G0RB 2X3GA 1OWXA 2KG0A 2YWEA 4R8UA 2LDYA 4WFNQ 2R8GA 4HHHA 3DKDA 2NPFA 3CMES 3K5PA 4KB7A 2QLXA 4DPXA 2GAHC 2Z2YB 2CADA 1LEOA 3OBIA 3M2UA 2DHAA 3QIDA 1FE0A 1QLNA 3HCXA 4CM2A 4I2QB 3C16A 4FPIA 1VMBA 1VRTA 3HVRA 4I6WA 1NZAA 1TV6A 2CPZA 1WACA 1GNKA 2MLXA 1CJUA 4LFAF 2HLTA 4EYHB 3AXKA 3TEHB 2VF3A 5DQHA 4N76A 2R7OA 1S7HA 3CJTA 5IV3A 2KTQA 4ILLA 3T6JA 2VOOA 3H2UB 3NLCA 4EUVA 4RW7B 4DWIA 3OR1B 5IXUA 5B0FA 3KJFB 1FX4A 2MB0B 1KLMB 2OIHA 1TVRA 3DYAA 4ZCKA 2D9OA 2HK3A 5LXRA 2VG6A 1RA6A 1Y7PA 2WW4A 3M7VA 4WP3A 2FC9A 4CO0A 3VQTA 2UXDF 1U4BA 4A46A 1MU2B 1J2VA 1XMBA 1SIZA 4OJ3A 3JXOA 1YSJA 2LCWA 1XR5A 3OSNA 3ZTSA 3BF4A 1GXTA 3J7ZT 2AF6A 1KWMA 2WTFA 2M88A 1LK5A 2ILYA 2P5VA 4USMA 2DNOA 2RS2A 3R7NB 4PYAA 2ZZMA 3CMQA 3JTPA 3MMCB 3CMAS 5H9FJ 3AT1B 3QT6A 4N5SA 4P75A 3SV4A 2ADCA 4B3MF 3AOAA 2G0CA 5IOLA 3I5CA 4ZVPB 3CIZA 1V3SA 5D3GB 2QMXA 4QYRA 4KAIA 2V68A 2BACA 1UEVA 3T1YF 2AYEA 1U1OA 4ZK7M 3I9ZA 2KYZA 2J6UA 2DTJA 2YNIB 4ECSA 5IC4B 4WWSA 2ZD1B 4URGA 5KT7A 5GVQA 2OEJA 2F4VF 1RA7A 4L3KA 1DTTB 5LOQA 3J7A1 1FWLA 2X1BA 2DIUA 4KO0A 4RX6A 1BXNA 2Y1RI 5A0YA 2QFJA 4NEZA 1XNRF 4MIAA 5L9NA 2FY8A 2M0GB 4OHVA 2YKQA 2JJ4D 4O4GB 1NSPA 4G1PA 4WU2A 1CC7A 1RTJA 4UUXA 3C6UB 4DEZA 1N52B 4WF9Q 4OYIA 1XR7A 2LDIA 4ED5A 3NAHA 5KT4A 4Y00A 3U1LA 4MFBA 2YKNA 4DG1A 3N6MA 5KFQA 4U8YA 4RW9B 3BGLA 4KGMA 4TU8A 1IWAA 5KFAA 3D67A 5C42A 5GMKa 4X4OA 3D0HE 4ED1A 2KU7A 1FXLA 1NRKA 2K2PA 3BQ0A 3VAJA 1CS4A 3B6BA 5ETKA 4B3OA 4D3GA 3HT3A 5DZ7A 4B3SF 2B9EA 4C3KA 4C6AA 2MY8A 1ULRA 3Q8SB 3QWUA 4HL9A 3ZO7A 2UXBJ 1WKKA 1XMQF 1F2HA 3N4WA 4A8MP 5E3QA 4U7UK 1NHKL 3G8SA 1U8WA 4K0KJ 2BYCA 1P8GA 2VBWA 4X64F 2BE9B 4JI5F 2ASYA 3QQCD 2BE7D 2R7UA 2ABYA 1NZ8A 5KFZA 3MPYA 4DSJA 2PGCA 5BYRA 3N6LA 1F3FA 2UP1A 3DU5A 1VJWA 1WEZA 2N3LA 2Q43A 2LQ8A 4LF8J 5E0OA 3RBXA 2IJNA 2EC0A 2EVZA 1I94F 2GIQA 1S79A 2BA9A 4GKJF 3PEHA 2HRTA 1YITS 4LRCA 1KFSA 1RTZA 2IVFB 1WHVA 4IH5A 2MKHA 5GAEU 1QJHA 2WVDA 3MTJA 3LPYA 2X1FA 3MWBA 3BB5A 2VPXB 3GIRA 5BR8J 2LMIA 2VQFF 2CJAA 5ETOA 4DPOA 3KXDA 5HMYA 4QWAA 4FS1A 4OX6A 4A8OA 5D77A 2IRXA 3DLBA 3QJJA 3W2VA 2CWXA 5CYJA 2JH3A 3WC2A 3RZAA 1VQ6S 4O3SA 1FEHA 3MMAA 2IMWP 2ZHBA 1PBAA 4CI0B 5DDRC 1N32F 4C0OC 4GKKJ 3J80U 3U27A 5KG5A 3OXFA 2HHSA 4K4TA 1N5VA 2B0GA 4LF5J 1S0NA 3KNAA 4B3TJ 2ASLA 4NLGA 3NGKA 1KOOA 4MK9A 3K5NA 4IOAQ 3P49B 3R5AA 5DLFA 1GEHA 1YJRA 4CT8A 1TK0A 1K9MT 1NK9A 3K89A 4RW8A 3LALA 5KFNA 4IQXA 4AE5A 2XMKA 2RB7A
chains in the Genus database with same CATH topology
3DRPA 2W9CB 1Y9OA 1GTEA 1K0VA 3SSQA 2D3ZA 2DGXA 3OTCA 5HP1B 4RW4B 2EK6A 3CD0A 4P7TA 4IR9A 1QAXA 1RISA 4TXSA 5A8KB 1H6KX 3EX7B 1RYSA 1VC0A 1NJZA 1BC6A 3MECB 5F8JA 5C25B 4ID8A 2QA4S 5FJ4A 1MWYA 1I1GA 3C8YA 1HMVB 2OPRA 3K8VA 5C24B 5I3QA 2ZHAA 4F2RA 1WELA 1VQ8S 2DD8S 2ZH5A 1NKCA 2ZDOA 4FXWA 4DN9A 4PQUB 4WE1A 3UR3C 3QIPB 2RKIA 1JLGA 5IFMA 2XNQA 5SUHA 1HI0P 3GFXA 3GIIA 4LSLA 4OX7A 4E98A 2PI4A 3TQ1A 3R1HA 1VQ7S 4RW6A 2CVEA 4OHYA 5HL7Q 1P1LA 1IKYA 1FD8A 3E01B 2K1RA 3DDNA 3M2UB 4J9KA 4J9PA 2M4MA 3DMJA 5D78A 5KFIA 1FO1A 3AA8A 2OTLS 1JIHA 2H9ZA 2U2FA 1FTCA 1Q78A 3VAHA 1N5YA 4KKOB 1NJXA 1C1BA 1E6YA 4NWBA 3W2WB 1HNWF 5KFWA 2GQQA 4DLEA 2PSZA 4F25A 2JLGA 4DSEA 4X4NA 1HWKA 2QZ8A 3G71S 2BR0A 3OUYA 4CTAB 3GIMA 3OJSA 1O5JA 1DAXA 4X2BA 3LP1B 2V8VA 5B0GA 3OL9A 3DNCA 2FJBB 1RAJA 2GA7A 1FESA 1UMJA 3I82A 1HNXF 5KOXA 2VPWB 1E6VA 3M6XA 4RWXA 2HVIA 1U2FA 3SCLE 1C4AA 3RAQA 3BDPA 2KO1A 2JC0A 4ZPBA 2PD1A 2KFNA 1ZTTA 5FLXY 1VFJA 3DXSX 5L1IA 4YMEA 4X62F 4N47A 5FD1A 4FNIA 4ZKAA 2D9PA 1LWFA 4R25A 1ZZNA 1XWLA 2L08A 2VUGA 1EP4A 4UQTA 4CO5A 1VQLS 3LH2S 4NLXA 2EFQA 2M7SA 2C3UA 1B7FA 4DJBA 1HARA 2DNPA 4RBUA 2PI5A 3R1LA 5KFVA 3H98A 2M52A 4ES2A 2R2SA 1NK7A 4G1IA 5MAOA 2DNZA 4CH0S 5F8NA 1MW7A 1S6OA 3DRXA 3DN9A 4NCGA 5T7LB 4X4QA 2ZC3A 3QGPA 2L9WA 2BBEA 4UW2A 3VAKA 4AXIA 1KTQA 1JK9B 2RVJA 5HN0A 1RTHA 2QT7A 3DDKA 4CH7A 2FVPA 2AJFE 2J7UA 5DDOC 4J9NA 3UWTA 2R7TA 2B9WA 1SJFA 3G6VA 4BCAA 4ZPVR 3CXCR 3ZC4A 1Y5IB 4F3MA 3PKYA 3US5A 3GSDA 1MROA 2V94A 4QOTA 1SXLA 5F8GA 4DF4A 1N56A 4I2PA 5KFFA 2MZTA 3DU6A 4G6VB 2R2UA 4PWDB 2DT9A 4PR6A 2GO9A 3CDAA 2ZE2B 5KG6A 1GH8A 2CQ4A 3RRKA 4DS4A 1YBAA 3OXGA 3FEXB 4FXDA 1JJ4A 1F2GA 1A9NB 3H8YA 3IG1B 2EKYA 4AL5A 5G0RA 4DV1F 1ROFA 4YB6A 3VF0B 3DOKB 4F02A 1S1WB 5KT5A 4ECXA 4QR1A 2AQ4A 3DC2A 4JV2A 3MMBB 3MCSA 3JSYA 4HTIA 4C4WA 2W8LA 1DLOA 4IG0B 2PO4A 2IFXA 2HNDB 3IWNC 2BABA 2HFNA 3SQGB 3IO1A 4O0IA 1S1TB 1RGVA 2VKZG 3NMRA 2I0XA 3Q2SC 2RIJA 1M5HA 4OJGA 4B9LA 1P1TA 2MQOA 4NLTA 2J6TA 2YTCA 5FDLB 2LKZA 2W25A 4RU9A 2FUG9 2CQ0A 1N54B 4NA1A 1Y3KA 2KI2A 2XMWA 2MGZA 2A1BA 2KKHA 2KFYA 2OD4A 3GYNA 4YY3F 1FXDA 3KLEA 5LJ3Y 2AV5A 1T3NA 4QYZJ 4LMZA 1Y5NB 2RMLA 5KFUA 1NU4A 4K4UA 4ED3A 3DRSB 4HT7A 4FZVA 1S6QB 1W25A 1X4CA 2UUBF 3BO3A 5D8HB 2H5EA 4I64A 1T03B 2DGTA 2GW8A 2AX1A 4EU0A 5KT3A 4J9MA 4I2QA 4I0WA 2VFUA 5M2RA 1U6ZA 3H59A 2D3UA 1VRUB 3DRYA 2HG4A 4IFYB 4M1KA 4C8OA 2EWHA 4YDDB 1S99A 1GTHA 1X5OA 4Z37A 1TKXB 2IBOA 2D41A 2BM0A 4DSIA 3PFEA 3EPIA 2OPQA 3PW0A 2FHOB 2O1PA 1F5BA 4IYQA 2J0XA 5DGAA 4D3HA 4NLDA 1ELOA 1X8DA 2IA6A 2YX4A 2QV6A 3K5OA 2B9YA 2XC9A 2W7PA 1HHTP 4K4XA 3FMBA 5HROA 3PIPQ 1SL2A 1R3NA 3F56A 3THVA 2FLOA 1D9FA 1JLBB 1H98A 3D28A 3CTRA 3BN7A 2GGPA 3J7YU 1JJ2R 5CQGA 2IYGA 2KG1A 1KNZA 1NEEA 2DGUA 1RYRA 1UVIA 2NR0A 3NNAA 3HHLD 3ISND 4MK8A 4LF9F 3FSIA 3TR5A 5KG3A 3KLIB 4MH8A 3SI8A 1T05B 2N4CA 5B0AA 2P6SA 1R0AB 3LOUA 4CIOA 3ZZPA 4CO2A 3OR1A 4NX9A 1O8BA 3MEDA 3CCWA 2JVRA 1FF2A 2ZH3A 4JI6F 1XNQF 4BC7A 5IM0A 3QJLA 2MZRA 3K8WA 1TL4A 3SDEA 2AU0A 2OH2A 2YNFA 1KLMA 2VZ9A 1RT7B 2VBYA 4DR3F 2DHGA 2ZOMA 3IXQA 3PXGa 1KQKA 5T14A 4Q44A 4HYKA 5EUHA 2F40A 2KJWA 2POKA 1HNZF 3HVWA 2ZFHA 4ED6A 3B4DA 1RT4A 3DOLB 3IAS9 2CQ1A 3HHLA 1IKXA 2XCAA 3JTNA 2HRUA 1MU2A 2YX1A 3S8SA 2Q1LA 3BS9A 4I6AA 4HT5A 1FRIA 1SH2A 1UWBB 2FIUA 5J2NB 4DFPA 5GAHU 4TKTA 3U1MA 3KJVA 4OHZA 4ALZA 3P5TL 4O3QA 1N6QB 1ZM3A 4K4VA 3R27A 1KQFB 4ZP9A 2IYIA 5HMXA 1M1KT 4BBYA 2FTRA 2NUUG 2PA8D 3AHPA 1Q8LA 4W90B 5CYMB 1Q81T 1K0TA 2VBZA 2VL1A 4QIFA 2CZVC 1ZOTA 1UVKA 3NCPA 1VQNS 1UFLA 1NH7A 2G9OA 2C3YA 3MPWA 3GV7B 3WX4A 3VALA 4IH6A 3IBWA 5E41A 1GAOA 3I56S 1FDNA 1H2VZ 2B4OA 2B9XA 1OO0B 3O6QA 4ZVHA 3J7Z5 3LW5C 3MMCA 4MFBB 3VAMA 1HWLA 4MKAA 3UQSA 3IR6B 2UUAF 5F8IA 4IG3B 1LW0B 1LOUA 2LXIA 2R8IA 3JTOA 1TL3A 4KGKA 3IWXA 3MM6A 3DCAA 1JLEA 3LUYA 4F3QA 4MAKA 2BE2B 3LANA 4G1QB 1Q8BA 2NZ4A 4AL6A 5KFEA 4CCHA 2Z2LA 3HZEA 2EFGA 4AFFA 4NLRA 3SYZA 3KHHA 2V4RA 3PV8A 2FY1A 5HLFA 5CH7B 2IM1A 1T3OA 1HD0A 1JMTA 2KVIA 1VK3A 3IFEA 4AUKA 1C4CA 3DHXA 3M2VB 4J9LA 4Q8EA 3NMAA 2HGNA 2XULA 4QW9A 3OVSA 2ASDA 1N5SA 2NSCA 4A8SA 2CG4A 5J2QA 3V81A 5E5NA 2HHPA 1UKUA 1FK9B 5KFHA 2MDAA 4PG8A 2CQCA 5D3GA 1FT8A 1TQLA 2XLJA 5LMNF 2VONA 2HHXA 3M8SA 1S72S 1KQGB 2L9NA 3N5FA 4UY8T 4Y2KA 4DR4F 1RT6A 2RNEA 4QWEA 4URSA 4ZLPA 4DV4F 1IM4A 1JJHA 1MMLA 1K8AT 3NNHA 2FD2A 4FNHA 3MEEB 1UJ4A 4ILMA 4NXMF 2W4PA 4C3MA 1WTBA 2AYBA 2ZH4A 1BGXT 4EBCA 3AY0A 3I32A 4CQ1A 1S0MA 5E3CA 5AE1A 3CDEA 1HR0F 2A18A 2FDNA 5EX3A 2OMOA 4K4YA 1TKZB 1NJWA 3K58A 1FKPB 4IDKA 3V4MA 1U45A 2OJ3A 3MEGA 2A3JA 4Y2AA 2HMIB 2NREA 1HQEA 3IR5B 1T7PA 2V9KA 3MM5B 1NK0A 4JOUA 1NKBA 1QM9A 5GAGU 3VTIA 1DZ5A 4UOCA 3KNGA 5KT6A 3HFKA 2ZD1A 3I87A 2QLWA 3OHBA 2VA3A 3HKZD 3JSMA 2PE8A 2AGPA 1DTTA 1O0PA 4YB7A 3KMQA 1M90T 5HBMA 3UPFA 4XPCA 2VQEF 3CC4S 1HYSB 4X4RA 4ETXA 3M6WA 1OPIA 3HXMA 4Q2LA 4FN5A 1XR6A 1D8ZA 3BGRA 3OLAA 4PKDB 3PRBA 1O51A 4XPEA 2CPEA 3DHWC 2EBEA 3TOQA 2QMWA 3QO9B 2DNNA 4ZVGA 5I42B 4OI0A 2RRNA 4IOCQ 2COLA 4JV5F 3LWLA 5HMZA 3CDUA 2OSQA 1S48A 3H4DA 4NCAA 1U6FA 1W2BR 1JLFB 5M2UA 1JNRB 4DL2A 2RH3A 3M6UA 2VBXA 1HQUB 4ZPDA 1U1NA 2ZH2A 2BZ2A 2OP5A 4IRCA 1TAUA 3CDBA 3FRZA 3PHEA 2DNQA 4YR2A 4NRTA 7FD1A 3TUIC 3CSKA 2ZH8A 1NJIT 1LWCA 2JLFA 5AJ3F 1YJWS 3I55S 3KK2B 3C6UA 5KFYA 2DR9A 2M9KA 4V19J 2MY7A 1JWWA 3MR6A 1OSCA 5KOWA 1HI1A 3IS9B 4MIWA 3RRHA 1CQNA 4RBVA 2OPSB 1TP7A 2YKOA 3MR3A 3TVYA 4FBTA 2K8GA 4OV1A 3TYTA 3OTDA 4M94A 3CEDA 1N33F 2BV3A 2E9RX 3CJKB 4QIVA 4MTPA 1REVB 3KMSA 4NRUA 6FD1A 4NLPA 1D9AA 1Y00A 2ASJA 4QIEA 3JYTB 1U1KA 4IFVB 3NCQA 2ZBIA 4QR2A 2WB4A 3MM7B 3KLGA 3D2WA 2B7CB 5DETA 5G4DA 4RW9A 2WB1D 3BQ2A 4OI3A 1PILA 5KAKA 4ED2A 4N41A 2MSTA 1NNDA 2W4DA 2KXFA 5D4PA 4O23A 5AE2A 2NPIA 4TN2A 1KLNA 5F0WA 2M8HA 2XWXA 3TAMA 1OQ3A 3H5XA 1R8BA 2HHVA 4WU3A 2CQPA 1DQ9A 2IRYA 1HI8A 4WCEQ 4NLWA 1YGYA 3TARA 2C2RA 3CC2S 1KONA 2VKRA 4IQMA 1XEZA 5KFMA 2QSFA 2HHTA 1WEYA 4LSNA 3W7BA 2CVIA 1FE4A 2FHMA 2KHCA 3D0GE 1R8CA 1R7IA 4PQAA 5F3TA 5L9XA 1FNXH 2BRKA 4PG5A 5D6GA 1ZH5A 4Y34A 3TANA 2YKMA 3W2VB 3CF5Q 2P9GA 4YR3A 4MYTA 2G4BA 4KPYA 5J1EB 3T1AA 2XS7A 3FFIB 4C0BA 3QZ7A 1Y0HA 3N6NA 3DLEA 3BSCA 2N7CA 3L7OA 4PUOA 1ZM4A 4NOHA 1FEEA 1PC4A 5L1KA 4HEA9 3I0SB 4EO6A 4NCBA 1YJVA 4DQSA 2XMMA 1NO8A 2PMZD 1SL1A 4KHPF 2B43A 1YJ9S 4ZDNA 1SBRA 3BREA 1HFEL 1VI7A 4HVZA 4KFBA 4PXBA 4C8YA 4PXEA 2FJAB 1SKRA 2UU9F 2EG2A 4KBIA 3G6XA 1V9OA 1FJGF 1SUQA 4OI1A 1WG1A 4O44B 4ED0A 3HMJG 1ZYQA 1TL1A 1K73T 4LF7F 1Q7LB 1LK7A 4JI8F 4EWTA 3DLHA 4WKRA 2CFXA 2CQDA 2MPUA 3TA0A 1SKWA 1TFWA 2F7VA 2JZ5A 2F8EX 4KV8B 2OLWA 3BR8A 4DSLA 1P9QC 2IRUA 2ILZA 2KRBA 5F41A 2BW2A 4MK7A 1D0EA 2JEGA 5J2MB 1N5QA 2UVRA 3CJ5A 2ZNYA 2UZAA 2RQCA 1LKZA 2E7WA 1JKHA 4ID5B 1NK5A 2EBGA 2R7SA 3NG8A 2KXHA 3THTA 2RF2A 5B0BA 4RW8B 2XZWA 2BVZA 1H2TZ 1YRTA 3FQKA 4ZHRB 2GMHA 2VH7A 5A2QY 5KFRA 3VAGA 2KZMA 2P6TA 1S1VA 3B82A 2D7SA 4ILRA 2V4QA 3OR2A 2J0WA 3DRPB 4BC9A 1UVMA 2O67A 1CPZA 2DCLA 3GR0A 1R8PA 3M32B 2C2EA 1MMDA 4NYZA 4DUZF 3OVBA 4TU9A 2VODA 1L3SA 1T95A 2MKSA 3CD6S 4B9NA 2R2RA 1VQSA 2DR8A 2E5GA 1M5OC 4CO1A 5J2PB 3CCMS 2RRBA 5CA5A 1F0XA 3DLKB 4KE5A 4RUCA 2BQ3A 1N36F 3UNGC 2XY6A 5K14A 4ZPWR 2L41A 3MR5A 1BQNA 1TKDA 4C8KA 3GV5B 3OL6A 2CJ9A 2CPFA 4QCLA 2KFZA 1RJJA 1S9FA 4QJVA 4OZLA 1ZPVA 3MM8A 2VOPA 2ROGA 3D5MA 2DNGA 5KFGA 2VFVA 2J9EA 1GT8A 4ELTA 5JVHQ 3GIJA 1RP5A 4JI2F 3DI6A 3DMJB 3M2RB 2DO4A 2RUGA 3CPWR 2AYGA 2HFZA 2WRMA 4DUYF 1N5YB 5DG7A 1B0PA 2P9CA 3M6VA 2DGSA 3NAIA 4DL3A 4ZP6A 1Y4ZB 1UFWA 4C11A 1H7XA 2FC8A 3MD3A 5BJRA 2GV1A 2KDOA 2AX0A 3G8TA 4ERDA 2GCFA 2JOQA 4NLOA 2RS8A 1RT2B 2M2BA 1JB0C 1IKWA 1WTFA 2O5DA 3QYYA 2JC1A 3FEYB 4X4UA 2B6AA 3K2YA 1WHWA 3S1TA 3MTKA 3Q8PB 1SV5A 4R8UB 3ENQA 1URNA 1Z2LA 2XY5A 3KLHB 4NA2A 5H9EJ 1FERA 4I7FB 5A6WA 1YHQS 3CIMA 1VBXA 2FGOA 2E7XA 1HBUA 4WFBQ 3DRRA 4N8OA 2GNKA 2CPXA 3NWGA 4B9SA 1DTQB 3PACA 1D3WA 4DQQA 3P6YC 1Y5LB 4H4MA 2PDAA 3M05A 5KFJA 2YNGA 3NGDA 2E5JA 2J6SA 1LWEA 4PG6A 5GAEI 4B3RF 3HLUA 1FDAA 1LWFB 1XBWA 4IRKA