4WK6A

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
243
structure length
243
Chain Sequence
FMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVASVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae 12129(1)
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
total genus 88
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2014-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wk6A00
2GUGA 1JWAB 4A5OA 1E5LA 4WPGA 4UUMA 1P1RA 8ADHA 1B8PA 3KYDA 1Q0QA 3DTYA 3PHHA 3PP8A 3ZW9A 3WGIA 3H65A 3ZH2A 3H9GA 3JTMA 4BOYA 3RKUA 5F5LA 1PTJA 3KEOA 2V6MA 1GYRA 2BF7A 3AUAA 4E33A 1EBUA 4BNVA 3QLJA 4U8GA 3A1NA 3RSHA 3ADPA 4D7AA 3EZLA 4RDHA 4ALJA 2Z1MA 1UXIA 1U28A 2GN8A 3EAGA 2YQ4A 1KIFA 3CMCO 3E9NA 4UREA 4R69A 1RYDA 3AFMA 3DBLA 1BDMA 4R68A 4YJFB 2PKQO 5JCJA 5IDXA 1MP0A 4EZBA 2AQ8A 1HZZA 1NAIA 1YH3A 2QZ9A 3I3OA 1IPEA 1K0UA 3HJAA 3QVOA 2Y0DA 5DZSA 3WYCA 1XEAA 4TROA 5CDGA 3GA0A 4YTEA 1PU2A 3GZNB 1T4DA 1HDYA 4WCFA 1QYCA 4IGEA 4BGIA 2WE8A 1GEEA 3K73O 3ZV4A 3F46A 3Q11A 4OQZA 2H6EA 1Y8RB 3LC1O 4CMKA 2Y1EA 3PQFA 3PFWO 3F9IA 1LU9A 3K6JA 4CV2A 5L45A 4XB2A 2GR9A 4A2CA 3FPLA 2B4QA 4R3WA 5K9ZA 2E6UX 3PZRA 4EJ6A 3GVIA 1PZEA 3JYOA 3DZGA 3TF5A 4D0RA 2OO5A 5G0WA 3VPFA 4DQVA 3SC6A 1E3EA 1ZFNA 3O03A 2RHRA 4YCAA 5AQ1A 3CH6A 2NTVA 5A06A 5A5EA 3I6QA 1UDBA 3GUYA 4IDDA 4S3MA 1ENOA 3O26A 4HBGA 2X8LA 1LTHR 3I83A 1YL5A 3WWZA 2IODA 3I23A 2I6TA 3D64A 3O4RA 4XQGA 4PLTA 5IAAA 4FCCA 4RGBA 3D0OA 1T25A 4HNHA 1PQPA 2OP1A 3DBVO 4XQEA 3T7CA 3OMLA 4ZA2A 3PHLA 4PLCA 5CP8A 4ZVVA 4D3FA 4RVFA 3WLEA 2EG9A 2C82A 3ZWXA 1NWHA 1UAGA 2ZKLA 3AUSA 4G2NA 4KP7A 3I1JA 2Q4BA 3RROA 5L7YA 4OXNA 1R0SA 4WUVA 1P3DA 4YPOA 4J2OA 1JVSA 1PL7A 3EW7A 5IN5A 4QECA 1I5RA 1UJMA 3HDQA 3H9QA 5DULA 4A26A 3TZHA 4AICA 4PVCA 1Y9AA 2J3JA 3NTOA 3PHGA 1LBEA 3GAFA 3QE3A 3VZPA 1ZH8A 5TIIA 4FQ8A 4TRJA 4LMRA 2JJYA 5LCXA 1VJ1A 2DQ4A 3HNPA 1ZK2A 1LEHA 4I5GA 4BMSA 3VVCA 2GN4A 4GKBA 3U09A 2WD7A 3L07A 2IXBA 3CPSA 2DC1A 3F1LA 4NBRA 3ZWCA 3FWNA 2WYVA 4BQPA 1ZK0A 2Q1TA 2PH5A 1HSOA 1P1JA 4EDFA 2NADA 3CKYA 3MJEA 1BW9A 1ZEJA 3K2BA 1CJCA 2CF5A 3ZNNA 3FN4A 2B4RO 3AM4A 2F00A 3IJRA 3LYLA 2DBQA 3A14A 4CMGA 2ILTA 4YJGA 2Q3EA 2AG5A 3GF4A 1YB1A 1NBOA 3QP9A 1EFKA 3Q9UA 3HSKA 4KDEA 3ETEA 4QUKA 4EW6A 4JBHA 2VHWA 5CDUA 3V5NA 3VKVA 1JAYA 4YQZA 5TJ9A 1BVUA 1NASA 3FPCA 4WEOA 4D0SA 2Z95A 5U1PA 1PX0A 3FTNA 4Z0PA 1BDBA 4B3HA 2C5AA 1XG5A 2JKVA 4A0SA 3BTVA 1G0OA 3BA1A 2R00C 1C14A 1VSUA 1E3JA 4Z3KA 3OICA 2QX7A 2D5CA 2IZZA 1HKUA 4RJTA 1NQAO 4P4GA 4TMFA 1B16A 3I52A 2RAFA 3RC7A 2P5YA 3QJ5A 5JFOA 2WM3A 2VRCA 5COBA 4D3DA 3PWSA 3NX4A 4ND3A 3WBFA 5HS4A 2JFHA 5JYDA 4IJUA 3A06A 2CDCA 5JAZA 1ADBA 3ZV5A 4J3FA 3W1VA 4CM4B 1D3AA 3U0BA 2CVZA 5TQVA 3IKTA 1NHWA 1VL8A 3BIOA 1LRLA 5L51A 5L4NA 4K6CA 4YVFA 1OFGA 1LLQA 2G1UA 5JYEA 2Y1OA 2BFPA 3TFOA 3WG9A 2LDBA 1GUYA 3JD1A 1WW8A 2GO1A 4L4XA 3CMMA 1NX6A 1Y81A 3PGJA 3PYMA 1NFRA 3KEQA 2I67A 3PYLA 4JX8A 3ROQA 4B8WA 3IUSA 5KCZA 4ESOA 4JBIA 3ICCA 4NH4A 1I24A 1UR5A 1F12A 1YGYA 2PZJA 5JCJD 2Q49A 3RUFA 4NBVA 5CAEA 1U4SA 2FSSA 3ZWWA 2X0RA 1AXGA 3ABIA 4QQRA 3CEAA 2GYYA 2Y0CA 4MVJA 4R01A 4B4UA 3HDYA 3GOHA 4BL5A 1D1TA 1Q2XA 5F3RA 3WTCA 4DVJA 1KY5A 3F3SA 1BTOA 2HRZA 1P74A 2XF8A 1T2AA 4BMVA 4D41A 1H6AA 4WLVA 2BGKA 3DZIA 3O8QB 4QFCA 2WMDA 4RV9A 2VNSA 3KSDO 2JD2A 1DRVA 1IE3A 4BO6A 5H82A 1QRRA 3GHHA 3W6UA 2C7VA 1HDZA 4II2A 4FGSA 3WQQA 4UVEA 3HDJA 5BNTA 4CUZA 1C1DA 1PWZA 1K6XA 1ZNQO 4QO7A 3C85A 1D4FA 3WGZA 5GZ3A 3BMOA 4B7UA 4HY3A 2Z5LA 4MKRA 2I9PA 3G3EA 3GEMA 5AXBA 3FI9A 4S1VA 2Q46A 1KYQA 2NLOA 4GGOA 2V6FA 4E2YA 3QQPA 3I9NA 4PLHA 5U4QA 1GAEO 1LRJA 3JQBC 4ND2A 3UHAA 2IZ1A 2WD7B 2OXIA 1PJCA 3PTZA 1LSOA 1LSUA 5KJEA 4WOJA 3HADA 3ZU4A 4FN4A 1ISHA 4KUHA 2P5UA 3I9MA 4TVOA 1DC3A 1PS8A 2WYUA 3JQ7B 4BNJA 4B4VA 1E6EA 1Q0LA 2FN7A 1Z82A 2ZJ0A 1HE4A 1GL3A 2E48A 3RUEA 5IDWA 3BMNB 4E3ZA 4JQCA 2FSVA 1BW9B 1YONA 1ZK3A 4IDFA 3RI3A 1HEUA 2NVBA 4N5NA 4XYBA 1ZIDA 2BLLA 4M1QA 5CEFA 2PZLA 2UDPA 4CLXA 5EL0A 1BVRA 1B15A 1K2WA 4GPD1 5GY7A 2BHLA 3DZBA 5IZCC 2YV2A 2NQ8A 2B35A 2PGDA 1LQUA 1MA0A 2VTEA 4FW8A 4XKJA 4HP8A 2X22A 1NM5A 4LK3A 5CG1A 5IJZA 4MVJM 3T4EA 4EJMA 2OBYA 1GZ4A 2HMTA 1PEDA 5TC4A 4J4HA 1KERA 2AXQA 1ULUA 3CXRA 4J4BA 1JKJA 2X5JO 4UUOA 3ROKA 5ADHA 1XIVA 4TKMA 5JAMA 2GN9A 3PRJA 2G82A 5EPOA 1GDHA 4ILKA 5ILGA 5T57A 3E5MA 1NFQA 1LDEA 3B1FA 3N74A 1ISIA 1BXZA 2W4QA 3JQCA 1HE3A 4B4OA 1H94A 3EYWA 1HZJA 2IEBA 2IEDA 3EVNA 4ROSA 4YRAA 3OSUA 4NZ9A 1Z74A 3I5MA 1GR0A 2EEZA 4WCFC 1MUUA 2YQ5A 5CPBA 2J5RA 2P68A 4G5HA 5H81A 1SO8A 4XRRA 1K89A 1T2DA 4R5MA 4XCVA 1HYHA 2X6TA 2GLXA 4FJ2A 3FNFA 3RWBA 4GQAA 1B7GO 4J0EA 5DOZA 4OH1A 4QX6A 4YWJA 5TGDA 4HV4A 2O3TA 5HA5A 1KVQA 4MIEA 3LQFA 3VTFA 3EDMA 5CDSA 3H2ZA 1N1GA 3W4KA 1U8XX 1ADCA 1UZMA 2JCVA 4HWKA 1ZSNA 1PJLA 2RBEA 4OIMA 5G4LA 2B83A 1MB4A 1P45A 4RVSA 2JCYA 1EVYA 2GZ2A 3KYBA 1E3WA 5ITWA 2NU8A 2YHIB 1VPDA 3R6DA 4O1MA 4J6FA 1HLPA 3OJFA 1QV7A 3WTBA 1A9YA 2OL4A 3MCVA 3UCXA 2POQX 2O4UX 2Y1DA 1NXQA 3GG9A 5TX7A 1U3TA 1C1DB 3ZZNA 4Z9FA 2PD4A 2AE2A 4A73A 4DLBA 4E32A 5ENVA 3OJ0A 3WXBA 1P1HA 1E3IA 2PR2A 4OQYA 2P2SA 4L74A 1PJ4A 1JTVA 1K6JA 3PYXA 3DMYA 1H0KA 4LRTB 1ZMOA 1ZVMA 2R6JA 1JA9A 2CDAA 3CUKA 1E7SA 1P31A 3G17A 1GUFA 5G4KA 2AEJA 4BB5A 4N18A 4BNYA 4YJGB 4XB1A 4R51A 2JFGA 1J0XO 5JDCA 5C5IA 3OHSX 4RO0A 4DL9A 3TFQA 2W2LD 3HFGA 1M66A 8LDHA 4BKPA 3TNLA 4B3IA 1U3WA 2VRCD 3E5RA 3PIDA 2EP7A 3ZI0A 4WE3A 2IDZA 2O23A 2WDZA 3SJUA 1ONNA 3PFFA 2VHYA 1JW9B 2VTDA 2X9VA 3HZZA 3Q6IA 4PIVA 1NVMB 4W9NC 4AVYA 1I10A 3MOIA 5JSFA 2VQ3A 1ONPA 4MVJF 1PL6A 1G6KA 4W6ZA 4XDZA 4TWRA 3VZSA 1EE9A 7MDHA 3JQ8B 2DPHA 3KRTA 5HTOA 3S2GA 3DWFA 2DTEA 1UDAA 5TF4A 5A5FA 2FZEA 1O94A 5IN4A 3BTUA 3VOSA 1T2FA 1R4NA 1KVRA 3JQ7A 4ALLA 3ONDA 5BSEA 6LDHA 4KQXA 4UVDA 3ZDFA 3I4FA 2BFAA 3C1AA 5CDTA 5L53A 1E7MA 3E03A 1T1RA 2BFOA 2DU8A 3Q2IA 1LC3A 1WVGA 5A4DA 1D1SA 2VHZA 2Q1UA 4IUYA 1X13A 5DCUA 4HFJA 2Y1GA 7ADHA 3LLSA 3AU8A 3ZHBA 1ISFA 4UEJA 4B3JA 3JQFA 5T5QA 3KETA 3AW9A 2BELA 3DZJA 3KHUA 4L0QA 3OQBA 4O59O 3AUTA 3F5SA 5CDYA 2CZCA 1SBYA 2O3SA 1QP8A 4Q3BA 1EEHA 4UVGA 1I2BA 3I6IA 2X0IA 3GN2A 3Q0EA 3D3WB 4HXYA 4LISA 2AE1A 1E7QA 5AXCA 3PXXA 3GVPA 4Z6KA 2VYND 3BTOA 5EQFA 1CIVA 3ITDA 2X1HA 1OMOA 1Z7EA 2EHDA 4FFRA 2GF2A 4IJKA 1DJQA 2Q99A 4IY1A 1FDTA 4EJ0A 1E7WA 3D7LA 2EERA 1W4ZA 1PR3A 3M6IA 2C2YA 3DOCA 2JHGA 3WYEA 1W8DA 2V6GA 4EYEA 2AMFA 3ZWOA 4CM8B 1ENPA 3Q1LA 1NWCA 3R0IA 1K5HA 1R0KA 1GADO 4JP2A 4NQZA 3W6ZA 1LC0A 4M55A 4MP3A 1AHHA 2AQKA 2HAEA 4LRSB 4BB6A 3WB9A 5A9SA 4BO3A 1ZXBA 4J0FA 2YDYA 2QG4A 3PIIA 5LDGA 2VZ0A 2FMUA 4NK5A 4XYGA 5A05A 1F06A 4U6QA 1UP4A 4FC7A 4K26A 4PZCA 3UCEA 3RUIA 3LDHA 5COQA 4WEQA 4ZQGA 3SEFA 3ZW8A 1N7HA 3WIEA 4AG3A 2PWZA 4XYLA 2DTDA 4FSHA 2FR0A 4CM3A 3KSZO 1T2EA 3ZWNA 3NDRA 1VM6A 3WGHA 3DOJA 3K30A 4EBFA 2DFVA 4GMGA 4TRMA 4YDRA 3GZNA 3DZKA 4WLOA 3WMWA 5BT9A 2IRWA 3JD2A 2CFCA 2W98A 2EKQA 1KOLA 1WDLA 4AJLA 3PLRA 5AOVA 3ASVA 2XXBA 5FI3A 5FYDA 4DUPA 4WLEA 4CV3A 1BRMA 3PZBA 1JKIA 1LLCA 3PI7A 1O6ZA 1RWBA 2OFPA 3L4BA 1OC4A 4KZPA 4DA9A 1PJ3A 1I32A 4NDNE 4PLGA 2FOIA 2ZCVA 2X86A 3PJDA 1LSJA 2PGJA 4FBGA 4LGVA 1SEPA 3WFJA 1RM0A 5KKAA 3WGQA 5DDIP 1CQJA 1GQQA 1F8GA 2I76A 3VKUA 4E2XA 4DWVA 5IXSA 3C1TA 3QWIA 3RUAA 4NFHA 2AG8A 4JJFA 2BGMA 2DBVO 4RVGA 2Q2VA 4TRRA 2DKNA 4DXHA 2Y1FA 4BV8A 2EP5A 4HKTA 4TKLA 2GPTA 3ROPA 1IZ0A 3NDIA 3ZV6A 4RDIA 3L0DA 4R5HA 1EDZA 2HK8A 2BKAA 5DF1A 4FFLA 4F6LA 2GERA 5TNXA 1UXHA 1T1SA 4DYVA 4NPCA 1IZ9A 5DOVA 1TT7A 4B8ZA 4DPKA 1AUPA 2ZQYA 4OM8A 4Y9DA 1O5IA 1V3TA 1RM3A 3V1TC 5KVQA 1PWXA 1VL0A 3D5QA 4J1QA 1KEPA 3ETGA 1MXHA 4NJMB 3U5TA 2UVDA 2ET6A 4OOEA 5A9TA 1JKFA 4A03A 1NAHA 1XA0A 5ER6A 5T6BA 4ND1A 1O95A 5G0VA 5AXAA 3ANMA 4NBWA 3IOYA 1MX3A 1L1FA 1U2DA 4H15A 4MJLA 4URFA 4M87A 1ARZA 1EVJA 2EXXA 1XU7A 3K92A 4PRLA 2C5EA 5JS6A 2NTJA 5GMOA 4BO4A 4CQMA 5K6AA 1Y1PA 2B5VA 2GCGA 2GZ3A 3EUWA 4NJMA 5FWNA 1Y5MA 2PKRA 3SBOA 2AQIA 4YT8A 1TVEA 1UXGA 4CM7A 1U8FO 1YQGA 3ULKA 1P44A 4P4NA 4YRBA 1HF3A 3KUXA 3CIFA 4U0JA 3W4JA 1E6UA 1FDVA 1NTOA 4LSWA 5JDCC 4FD3A 4P38A 3KOUA 1ISJA 1I3KA 1LQTA 2XPCA 2EJVA 2DUWA 4GBJA 1T26A 3BTSA 4JBGA 3WR5A 1B8UA 1EK5A 4BVAA 3QV1A 4CUJA 4OXKA 2PD3A 3B20A 3DMTA 1VL6A 4MPDA 1HXHA 4UVIA 5ITVA 2A92A 1KS9A 4RF2A 3FF4A 4DTIA 1M75A 3S8MA 3NV9A 4L8VA 5FEUA 3B6ZA 4G65A 1GZ6A 4CLHA 3ANNA 1DFGA 1YKFA 4BNZA 2YYYA 1Y6JA 3DEYX 4MVJP 1EQ2A 1PQUA 4XGKA 2E37A 4TRNA 2BH9A 3RQSA 4E2ZA 4GX5A 4YXFA 3C7CB 3JQAD 4XEHA 3ZWVA 3OA2A 3UCFA 2X9NA 3GR6A 1JWBB 4GMFA 3UUWA 1PGJA 3H8VA 2QQ5A 1V3VA 4XJTA 3PHIA 4Y8VA 2HMSA 4FFNA 1MV8A 1NYTA 1IUKA 4XGNA 1VJTA 4PG6A 3B70A 3H7AA 5HWSA 3GLQA 1GQ2A 3GMSA 5U9CA 4WLNA 4RPGA 3RC1A 1EMDA 3WX0A 1O9BA 4Y6SA 4CLRA 1LDYA 1BSVA 1BXKA 2QRKA 3PK0A 4B79A 5AVOA 4IM7A 4E21A 2DPGA 1DSSG 1DFHA 4IXWA 5ES3A 1GQYA 2NM0A 2X5KO 2V7PA 3D5TA 2HDHA 5I9LA 3OEWA 2WD8A 2O2YA 1QG6A 4YAEA 3DB2A 3BMQB 3D4PA 3JV7A 4BNNA 1D8AA 4ND5A 3ZHYA 4EEZA 1HDOA 3S2FA 1LA2A 5FI5A 1VLLA 4UULA 1ADGA 1CYDA 1TT5B 4CUKA 5LC1A 1ZK1A 1HWYA 4R1UA 4PLPA 2OORA 4E12A 1EVIA 4QXMA 2HJSA 4GWKA 5KNLA 5I7SA 1ZJZA 5G0UA 4BO5A 5KJ1A 5KJCA 2VCYA 4B7CA 5A3VA 4MIOA 2CD9A 5L95A 1YS4A 3DHYA 5L4LA 3FBTA 3B1KA 3ZCXA 1B8VA 3AK4A 1P1KA 2C29D 2AEFA 4Y6PA 4BV9A 1DXYA 5DBIA 2VWQA 5KVVA 3LT4A 4CLEA 1M6WA 1K6IA 3UICA 1L7DA 1YQXA 1XQ1A 1LXCA 3RU7A 1HYGA 1GZ3A 1BHSA 3NDJA 2WYWA 2UAGA 3H9UA 4HADA 3ZHZA 2EGHA 1HT0A 1CQIA 3GVHA 3AOGA 4NHEA 2H5LA 3SVTA 1LDMA 3ZNPA 3BHIA 4JJIA 2O3JA 3RFXA 5BNFA 3HN7A 4EUEA 1QMGA 3KYDB 2CDBA 4P8RA 1Y8QB 1P9LA 3BMOB 2O3UA 4I8XA 3DAFA 3WQSB 5A03A 4E5NA 1Y9EA 1T4BA 3RIHA 1S7CA 2YFQA 3M2PA 4J7XA 3WYBA 4D43A 1WLYA 1XYGA 4BNMA 5MDHA 1OI7A 2D59A 4II3A 3L6EA 2D4AA 4HFRA 2BD0A 3WDSA 3MWDB 1TEHA 3HB5X 3SJ7A 2YFHA 2GN6A 3QW2A 3JQ9A 3ANLA 3OH8A 4F6CA 3NKLA 2HK7A 4YJFA 1MC4A 4KWIA 3RFTA 1FMCA 4DYDA 4Z0TA 4BNGA 2X58A 3DZFA 3L4SO 1U1IA 3D4NA 1P0CA 4R9RA 5CEEA 5JC8A 4AJPA 1YO6A 3E9QA 5KTKA 2G17A 1F8FA 1J4AA 1TT5A 2QRLA 3BYZA 2J3HA 2Y05A 4BO0A 1WZEA 3AUUA 5L3ZA 1QXSA 4NU5A 2HKIA 1RPNA 3JYPA 4DPLA 1M2WA 1GYPA 4WNCA 2EGGA 4AFNA 3LVFO 3SLKA 1I01A 1OBFO 1BGVA 3KVOA 4YA6A 4EGFA 4CODB 1FDUA 1X14A 2HMUA 1U3UA 2FPPA 4O6VA 5JAIA 1NNUA 1KVTA 2WWRA 1PIWA 2PLAA 2ZIZA 2ZB3A 3RU9A 3GQVA 1IL0A 1DLIA 1V8BA 4IMRA 2VWPA 2PNFA 1NP3A 3KO8A 1PJQA 4K9DA 1H6BA 4WLUA 3NEPX 5JCXA 1C0IA 1Z45A 3MJCA 3OQ1A 3QVWA 4JJGA 4CM4A 4ZD6A 2JL1A 3WICA 1B3RA 1OAAA 2Y99A 4AJ1A 2VNAA 2A4KA 2UYYA 3INRA 3JQAA 1Z7BA 4KMSA 4OXYA 4XR9A 2XAAA 3INTA 4ALNA 1R16A 4AJEA 4DIFA 9LDTA 4OJNA 3OIGA 4BNWA 1LUAA 3U4IA 4IPTA 1U5CA 2O48X 2FR1A 3KV3O 4FGWA 1EFLA 1T2CA 3DONA 4J7UA 3VPHA 3MJTA 2UUPA 2I65A 4DLLA 1EZ4A 4IQ0A 3WQRA 3KLPX 1TXGA 3TDKA 3ROMA 4BO8A 1R4MA 4CQMD 4CM6A 1EUCA 2Q1SA 4QSMA 5MGBA 2ZTMA 4WLFA 1IPFA 2VYNA 4IDGA 1ONOA 3JQAB 3OETA 4E30A 4BGEA 3P7MA 4MKZA 1I3MA 2TMGA 3DMTC 4RZIA 3NJ8A 3QWFA 3W8EA 1HDXA 3GGGA 3JYNA 4XD2A 4XIJA 3C8MA 4MVJE 1X0XA 3DOOA 1YL6A 3VZQA 5L9AA 2NQTA 1V0JA 5I7EA 3FSRA 1XDWA 5AXDA 3E8XA 3MEQA 4CR7A 1U9JA 3TOXA 3PVZA 1M6HA 3JSAA 3F6YA 2PGLA 3GFGA 3U3XA 5B12A 3DBHB 3ST7A 3QVXA 1DIAA 4HX5A 1QYXA 4LCJA 3ZWPA 4GWGA 3D4OA 3BAZA 4PCVA 2WJPA 1GPDG 3W8FA 3GG2A 4CQMB 2QW8A 1EDOA 1EK6A 3FWZA 3GC6A 4E5PA 3ZWYA 4J1SA 3IMFA 3WWYA 3GVCA 4I08A 4N54A 2VRBA 3DFUA 4R1TA 4LSMA 4AJ4A 4CL8A 4CMIA 5JDIC 4MIYA 5C7IO 2I5PO 5JDIA 1E0DA 4GVXA 3QY9A 1PL8A 3NRCA 3L6DA 4L4RA 3IAHA 1UZLA 4GLLA 3L9WA 1MLDA 4BKQA 1G0NA 4JROA 2EKPA 5BQFA 3OF2A 1QR6A 3VH1A 2HMWA 5DCYA 2QHXA 5JO0A 1DJNA 1FDWA 1ENZA 1Q7BA 4RLHA 1VKOA 1WNTA 5EMHA 1WPQA 1I0ZA 4N5MA 4D45A 4AJHA 4JIGA 3TWOA 1I2CA 5JMPA 3VH2A 3UH1A 1HYEA 1XR3A 1VRWA 4I5EA 1SNYA 4CR8A 3NGXA 1ZXLA 2CMDA 4KTTE 4R4JA 1U7TA 2WEKA 4BO7A 3GPDG 1R4NB 1XCBA 1PR9A 2ZTUA 1KY4A 1G1AA 1GD1O 3G0OA 3WNQA 1TA4A 5KVCA 2HK9A 4R54A 1KETA 3ASUA 3UF0A 1H2HA 5F5NA 5B4VA 3IIEA 3GRKA 1GFSA 2NTNA 4YT4A 4CM9D 3LC7O 1I3NA 1JQBA 3WGTA 3FCOA 4FOOA 4BKUA 1F17A 2YW9A 3ZU3A 1VE9A 4ZN6A 3TL3A 4AJIA 4FIZA 1PGPA 1JLLA 2D5AA 3IUPA 4BO1A 1N1EA 4W99A 2VOJA 3ZN2A 2ZTVA 1BXGA 2C2XA 2FR8A 4U0KA 4YAIA 3K8ZA 2FPGA 3ETDA 1E3WB 4F45A 4IDEA 3VDQA 1YB5A 3KSUA 1EVZA 1LJ8A 1CEQA 1KBZA 4NFYA 4OYRA 3KZVA 1ZJYA 4TZKA 1KEUA 3RUCA 1VC2A 3MJVA 3DC2A 3ZU2A 1C1XA 1IHXA 3COSA 2A35A 1UAYA 5F1KA 5A04A 1L7EA 1E77A 1YJQA 3GUCA 3BHMA 2VOEA 4PLWA 4YQYA 5K6AC 2NWQA 3OIFA 4PG5A 2EIHA 4ALMA 2FY8A 1IYZA 1LLUA 4FFOA 3BZUA 2NU6A 4YAKA 4OO3A 4DIOA 2DFDA 3G49A 1PGQA 1QYWA 2RCYA 3DBRA 1DIGA 1N9GB 4WECA 4CMEA 3V2HA 5CFZA 1Z75A 1UDCA 4Q39A 3NJ4A 4RVDA 3D3EA 1EE2A 2ZYAA 1MC5A 3LU1A 4OKNA 5BSGA 1RYEA 4YEDA 1E6WA 2EKLA 4OOFA 3H3FA 1R37A 5T64A 5TJHA 2F1KA 5CHEA 4WCFB 2EV9A 1HDGO 3L6OO 3LZ6A 3AJRA 2D2IA 3MJ4A 1U3VA 1X7GA 3K5PA 2XXJA 2CF6A 4ZQFA 3X2FA 3HN2A 4H7PA 5KKCA 4WCDA 2YV3A 4DPMA 1VSVA 4WGGA 1HLDA 2YZ7A 3EY4A 2FPIA 4K28A 5DN9A 3S2EA 4BNKA 1GTMA 4NG5A 2OGUA 1WMAA 5IZCA 2C0CA 4WOKA 3QHAA 4EUFA 5LDHA 3F4LA 3V2UA 3WS7A 1ULSA 4TVBA 1SEVA 4D44A 4E5MA 1PJ2A 2PA3A 5A1TA 5KOIA 3WSVA 4UAGA 1IHYA 2Y68A 2AW5A 5IDQA 2ZYGA 4R3NA 1V3UA 1DRUA 4OGWA 4IZIA 3UFXA 3SXPA 4BGUA 4JXKA 2VN8A 3EMKA 5CEJA 4XX0A 4M49A 3UAGA 1QKIA 4D3SA 5JO9A 5HBRA 4RPJA 3KBOA 3WGOA 3RKRA 2NU9A 1SMKA 2E49A 2YDXA 3IS3A 2QRJA 4E5YA 4D79A 2J8ZA 5IFLA 4F46A 1ENYA 2HU2A 4PLFA 4PFJA 5A9RA 4ZRMA 5IF3A 2CSUA 5IXYA 5KIAA 4XIYA 3QIVA 4H3VA 4KWHA 4CMIB 4HFMA 4E0BA 1YWGO 1SB8A 2BGLA 5T8KC 2D3TA 4RPKA 4K6FA 4MINA 4FFPA 5HM8A 4BNXA 4XQCA 2CY0A 3OA0A 1QORA 1UZNA 4W7IA 1AXEA 1H6DA 1XELA 3NTRA 4WKGA 4J2HA 2WE7A 3F47A 4UUNA 4CLDA 4DMLA 2GRAA 2G0TA 4M54A 4W7HA 1X7DA 4FS3A 5EERA 1NFFA 2JD1A 4GAEA 1NQOA 1IY8A 4CJXA 1EUZA 1Y8QA 1C0PA 2PKQP 3FD8A 3JD3A 4OL9A 2VT3A 3TN7A 3PDJA 1XKQA 2AHRA 3P5SA 4J90A 5F21A 3DTTA 1C3VA 2CVQA 3EHEA 1KVSA 3LLVA 4ZU3A 1LLDA 1C1XB 4WASA 2Q1WA 1LI4A 1EQUA 2O3RA 2VHVA 2VYVA 3L77A 4YACA 5AYVA 3PPIA 1WMBA 4IJVA 4CMJA 4RVHA 3CE6A 4QO8A 3LT2A 2AQHA 3KYCA 3AI3A 5ILOA 1DO8A 3JQFC 3RC9A 1OC2A 2GZ1A 4FFMA 4MP8A 1YE3A 3AI1A 2DM6A 4P4LA 4E5KA 1HDCA 3AY3A 3JYQA 3OJLA 3GY0A 4U6SA 2B4TO 4I5DA 5B4UA 4GL4A 1DDOA 5A02A 4DBVO 2B0JA 3ZU5A 2ZQZA 5K0ZA 2W2KA 4JK3A 4U5QA 3PJEA 2YHIA 1O0SA 1NQTA 2HJRA 2HUNA 4N5LA 4R16A 1H93A 3OJEA 5GZ6A 2XOXA 3JCZA 5H83A 4J49A 3IDSA 4LVUA 3LF1A 3S2IA 5DP1A 4J9VA 1IB6A 1RKXA 2PH3A 3GDGA 3PWZA 3F5QA 5ICSA 1WAMA 1HRDA 4DC0A 3IJPA 5C7LO 1ISMA 1HDRA 5A3JA 5GZ1A 3IL2A 4WK6A 2Q2WA 5COAA 3DBLB 4CL3A 5DBGA 2NSDA 1K3TA 2ZK7A 5JW6A 3ZWBA 4ITUA 5B4TA 1ZKMA 4IGFA 2GDZA 1DFIA 3OEYA 3U9LA 5TT0A 4BHTA 1H6CA 2NVUA 5TS3A 2ZCUA 3WFIA 1CRWG 1UP7A 2AEMA 3EZYA 1XGKA 1M76A 1LDNA 1R15A 2EJWA 2J3IA 2R2GA 3AY6A 4YBZA 4DRYA 3V1YA 5IG2A 4UVHA 3NYWA 2C7GA 2BI7A 2Z1NA 1DAOA 1CERA 4ZQHA 1FXSA 3E1KA 1MGOA 2PY6A 2EWMA 4A10A 3UKOA 1QLJA 2Y93A 3KXDA 4A7PA 2PV7A 3JQ8A 5G2OA 3E18A 2HRBA 2JFFA 3JQEA 3H2SA 1WDKA 5JNLA 2FRDA 3JD4A 2PZMA 4YT5A 3RUHA 1NPTO 3H9EO 3BMQA 3HHPA 3LSYA 4E6PA 1I3LA 3S1LA 1B26A 1SCUA 2CVOA 2W2KB 1SOVA 4BGVA 1ZSYA 2NVWA 3C1OA 1I36A 3PLNA 4IZHA 1SB9A 2BMAA 3KM0A 4M8SA 3SX2A 3L9XA 1Q7GA 3JD0A 4OAQA 2ZYDA 4RQUA 4XDYA 4JGBA 4XA8A 4DC1A 5C3MA 1PS0A 2HSDA 2ZATA 4F3YA 5C7OO 4AJKA 2EW2A 4CLRB 4NMHA 1FK8A 1A71A 1HL3A 3KYCB 2DUUA 1H2BA 3PGXA 1E92A 4BKRA 3TQHA 2Q4EA 4GI2A 3VAZA 4BNTA 4I9UA 3TJRA 2VZ9A 4BKOA 1DPGA 2VT2A 1OZAA 3ONFA 3DHNA 3C3XA 3WMXA 2PFGA 1DLJA 3R3SA 2Q50A 3DBRB 3UGKA 2J3KA 1TI7A 1KEWA 3DAGA 1UUFA 3CZRA 4D46A 4IQGA 3DL2A 3VTZA 4IINA 1N2SA 3MTGA 4CR6A 3AM5A 4ALIA 1VJ0A 2ZB8A 3X2EA 4OSOA 3DHEA 4E31A 2GNAA 1E1MA 1GUZA 2P9CA 3OM9A 4PN3A 3V2GA 3U4HA 1CWUA 3ADOA 4BO9A 3ZNOA 1TLTA 5TLSA 3BXXA 4OKIA 1F0YA 1O89A 5L7WA 1JU9A 5TRTA 3RUDA 5TSDA 3E48A 3JQDA 1YVEI 2DAPA 3E9MA 4QEDA 4IS2A 5EIOA 3TL2A 3LT1A 2JAPA 3T7EA 1E3SA 4IXTA 5J23A 4H16A 4J1TA 3K2EA 2SCUA 4GSLA 5CG2A 3PJGA 1JN0A 4YAJA 1A4IA 1OOEA 1GV0A 3B1JA 1PZHA 5DP2A 1J5PA 3GH3A 2HO5A 4PRKA 4G81A 3STHA 1X0VA 5B37A 1SAYA 3ZNQA 3O9ZA 4L76A 1ZEMA 4YYZA 4BO2A 4AJ2A 2J6IA 4MDHA 1D7OA 1SZJG 2G76A 4GGPA 4YJHB 4L4SA 4CPDA 3QRWA 4CMCA 3W4IA 1DAPA 4GX0A 5THQA 1YDWA 1E5QA 4YAGA 1C0LA 3A28A 4RF5A 1BG6A 2JCXA 3OP4A 1UP6A 1ZO8A 4XJSA 3WIDA 2HMVA 4WJZA 3FTPA 3MWEB 4YJHA 4GX1A 2CNBA 2VUUA 4W82A 2YY7A 5JMWA 1GY8A 2I3GA 3FNHA 5BSHA 4JCOA 5G0TA 4INAA 4UEOA 3RBZA 3H9JA 1R0LA 3F1KA 4GKVA 3VPGA 1ML3A 1U2GA 1VKNA 4XZ3A 1HE5A 1O8CA 3GK3A 2H9IA 4LCEA 2DVMA 3GRPA 4CQLA 2JHFA 4HFNA 4RCVA 3U62A 2ZB4A 2Y67A 4NR0A 1LRKA 2A94A 2RHCA 1XU9A 3FRJA 3ZV3A 3RJ9A 2Y1CA 2I3AA 3WJ7A 2ZJ1A 4XGIA 5ER9A 3O38A 2IXAA 3CINA 4PG4A 3AY7A 2OMEA 4LW8A 1N9GA 1X1TA 3PJFA 4Q3NA 1T24A 4RPLA 4RF4A 1X1EA 4OHUA 3C7DB 2X23A 3BMCB 3CSDA 3ICPA 1YOVA 1XSEA 1UXKA 2D0IA 1N7GA 2O3QA 1GPJA 4NFSA 3FR7A 2P4QA 1ZBQA 2HQ1A 1YBVA 4FJ1A 2HCTA 4AL4A 3EK2A 4I9NA 4BS9A 4XYEA 1A5ZA 4MVJH 3BMCA 4Y67A 4BNIA 3ONEA 1I8TA 3WOHA 3GDOA 1B14A 1CF2O 3AOEC 3ON5A 3JQ9C 5BNIA 1IULA 3AOEA 4GLOA 3GVXA 1Y5RA 1NPDA 3MTJA 2Y66A 4Y98A 3M1LA 1FDSA 3ENKA 4L9RA 2J5QA 1Z73A 4NBUA 4BNHA 4ZRNA 3UXYA 4DQUA 1DC6A 1R4MB 1W73A 2QYSA 1SC6A 4MVJG 1P1IA 4BIIA 3WJAA 4PVDA 2FZWA 4ONEA 3RBXA 2WSBA 4YR9A 1R12A 3I9JA 1N8KA 5BR7A 3I9KA 5CPFA 2B5WA 3GEDA 1EUDA 2X5OA 1GYQA 1LSSA 1P77A 4R9SA 5DT9A 4DBZA 5EESA 4EI2A 3NUGA 2C07A 2ZB7A 4RZHA 4UEKA 4PZDA 1PS9A 2RH8A 2BI8A 4HNGA 1S6YA 3VC7A 4A27A 3SLGA 3A4VA 4ID9A 2VYVD 1WDMA 1MFZA 1ZZEA 3DR3A 3H4VA 4XQ9A 5FF9A 3UN1A 5JBIA 2DBZA 1QLHA 2B37A 5B1YA 1YJ8A 5JY1A 1XWFA 5KJ6A 1Y7TA 3TOZA 4PG7A 2DBRA 3PEFA 2X7HA 1B0AA 1N5DA 4Q3AA 2OHXA 4D42A 1A27A 4IIUA 4O63O 2NVUB 4IDAA 4AJOA 2Q2QA 3PWKA 1E1NA 3GMDA 4YRDA 1I2ZA 4CM5A 3E6AA 3NT4A 2NU7A 4M86A 2AA3A 3E82A 1E3LA 3HFSA 3GNSA 1E7YA 2OP0A 4KTVE 4E2WA 3L4BC 3TZQA 1V6AA 1Q7CA 5FFFA 3V8BA 2A9FA 4OSPA 3INGA 4QTZA 2JD0A 3GN1A 4R1SA 4JN6B 4NK4A 3PQEA 3PHJA 3PQDA 3ORFA 4IS3A 2W2LA 3WLFA 4C7KA 3UW3A 3I9LA 1ID1A 4CMEC 3VH3A 3ZHXA 4DQXA 1Q1NA 3HUDA 1H5QA 2W8ZA 1XQ6A 1ZSVA 4RF3A 4ZQBA 2BFMA 3KTDA 4DMMA 3DBHA 2H63A 2FP4A 3KLMX 4IDBA 4CM9A 1MFPA 3NTQA 4ND4A 1NVGA 4FJ0A 4I5FA 1ZUD1 1ZCJA 3WGYA 5I8ZA 4MO2A 3QVSA 3C7AA 3GFBA 4KOAA 4IQ8A 5ICMA 4XR4A 3TZKA 2D8AA 3MOGA 1DBVO 3FBGA 4EITA 3IC5A 4CM1A 4YB8A 3TZCA 3U49A 1DRWA 1LDGA 3AWDA 4B4WA 1YL7A 1V35A 4J91A 3H6KA 2PTGA 2X0NA 4ZJUA 1ADFA 1Y8RA 3GT0A 4C4OA 1XHLA 1N92A 1PJTA 2R00A 1A7KA 1A4UA 3Q2KA 2YHUA 3FR8A 3Q9NA 4ZICA 5HRUA 1YQDA 4RVUA 1AHIA 1C0KA 5EN4A 3U4DA 1PJBA 5KJFA 1FF9A 3VH4A 1PJSA 3HQ4O 4FB5A 4E4YA 1TB4A 2YJZA 4L73A 4IIVA 3OECA 4Z9YA 2Y0EA 4IJWA 1RJWA 1EBFA 2O7SA 4RPHA 2YV1A 5EJ2A 3GPIA 5L7TA 5JLAA 3AM3A 4ZQEA 2TMDA 2VHXA 3D3WA 3P19A 4DREA 4E13A 1I33A 1DB3A 2V65A 3H5RA 4ZHSA 1CETA 1NHGA 3RCBA 5T8KA 3FHLA 4W9NA 1X15A 4KDFA 4DLAA 1B3BA 1LNQA 1MG0A 2UUOA 4J7CA 2FHSA 4FPXA 4RLSA 3OBBA 3S55A 4NJOA 3DXFA 3ITKA 4PLZA 2HLPA 1PSDA 3M1AA 3QVTA 3TZ6A 4YT2A 3I9OA 4CM8A 9LDBA 2NACA 1GCUA 1E1LA 5DBFA 1YDEA 3CTMA 3K9QO 2P91A 4IMPA 3FNGA 1QYVA 2VUSA 3RBVA 1UXJA 4UUPA 3T4XA 1MG5A 3VVBA 1R66A 1XLTA 4LN1A 1ORRA 4HUJA 1A7AA 3RFVA 5T67A 3DO5A 4CMHA 1DOHA 2IE0A 4MOWA 4CLOA 2DLDA 3HDHA 4NIMA 1M67A 6ADHA 3OIDA 1BMDA 2C59A 4TSKA 4KQWA 4O0LA 4WNIA 1NVTA 3WNVA 5I7FA 2OUIA 4RQTA 5ENDA 2P9EA 4CLOB 1YBAA 2I66A 1NPYA 3V1UA 4I9HA 4GX2A 4M89A 3ZWAA 4BNUA 3HWRA 1NR1A 4IDCA 1KEVA 3P2YA 3UVEA 4DGSA 2X9GA 1H9BA 2RH4A 3K31A 4Z3DA 1SPXA 4EUHA 1PGOA 2DT5A 3GGOA 5G0SA 4NBTA 1JVBA 4ALKA 4U7WA 3NAQA 5JAQA 1VI2A 1AN9A 1KC1A 3Q3CA 3GZ4A 1UH5A 3BHJA 3RVDA 4CV0A 3KB6A 4Q3EA 5JE8A 4BUCA 4Z9XA 4MVJD 5I9NA 2IYPA 2Q45A 4O5OA 3IQDB 3DAPA 1A9ZA 4J43A 4RORA 1JAXA 4JNKA 1YB4A 1SOWA 3P2OA 3QSGA 5JXWA 2B69A 2GD1O 3JQBA 3EVTA 3VPXA 4TZTA 1RM4A 1PZFA 3C24A 1HSZA 2NUAA 3RC2A 3W8DA 1PQWA 5L40A 3H5NA 3WBBA 4C7JA 4NI5A 2GASA 4PGFA 1P33A 1P0FA 2CUKA 2PZKA 1HTBA 3D1LA 3DZHA 4I1IA 5L4SA 1U5AA 2P4HX 1R6DA 2FWMX 3ZGYA 5DCWA 1P1FA 3QWBA 2UV8A 4AJJA 4FOSA 4J9UE 3RASA 3A9WA 1HETA 4CMBA 5JY6A 1QYDA 1ZMTA 2OOSA 3GNQA 1NR7A 3N58A 4NU6A 1QV6A 1GEGA 4QT0A 4YJDA 3GAZA 3R1IA 3ENNA 4LMPA 3JYLA 1DHTA 3H5AA 4CV1A 5A9SB 2LDXA 5JPIA 4XRGA 3K96A 4N7RA 1X7HA 4Z0HO 4BNLA 4NNJA 3EC7A 3JQGB 3WSWA 3UOGA 1ZW1A 4QFDA 2I99A 3TPCA 2BRUA 4RL6A 3NGLA 1A72A 3FNEA 1DHRA 1PGNA 4DIBA 4FC6A 4XWYA 2PD6A 4MP6A 4EEXA 2E82A 3HG7A 4GSKA 2G5CA 5I7VA 3QWAA 3VZRA 2GGSA 1DIHA 4FR5A 4CQLB 4PZEA 1PZGA 2IYOA 5THKA 3DQPA 1H9AA 3TRIA 2OBNA 3JQGA 1ZK4A 1I30A 4JP3A 1KVUA 4PLVA 5HS6A 3OFSA 1FJHA 2W90A 3WGGA 1GV1A 1JDJA 4ZGWA 1HE2A 3HE3A 1WXDA 2EF1A 2D1YA 4KUGA 3VDRA 1NQ5A 2ZTLA 1V9LA 4PLYA 1J6UA 2NV6A 4KUEA 3PDUA 4MKXA 3AU9A 5EQDA 3AI2A 4BQRA 3QWHA 1MXFA 3U4CA 3EGOA 2X4GA 1AGNA 2QZZA 1E1KA 4CMAA 1WZIA 4FDAA 2PK3A 3GGPA 1BWSA 2H1SA 4BNFA 1E7RA 2O4CA 3IP3A 1YBMA 2X0JA 3G1UA 3R3JA 3RAJA 5IZ4A 4L75A 1RM5A 4IBOA 3TSCA 3NT5A 4J1NA 1ISGA 1QSGA 1J49A 3I4CA 5IDYA 5G4KB 5DNAA 3DDNA 4X54A 4J16A 2O7QA 4B7XA 3GHYA 3G1TA 1U7HA 2VZ8A 4GH5A 4XYMA 1LX6A 2DTXA 2WTBA 5JC1A 1YXMA 2OZPA 3GDFA 4Q3DA 2O2SA 2JAHA 5I8WA 3OJOA 1YOVB 3IKVA 1B2LA 3N7UA 1WP4A 4AJNA 3O8QA 3LC2O 4Q9NA 3RD5A 1IOLA 1U4OA 4P22A 5F1PA 3MJSA 1CDOA 1Q0HA 4Q3CA 2YUTA 3VPSA 1AE1A 4Y6RA 5EINA 3LK7A 2C20A 4R1NA 4R41A 1F14A 1DEHA 3MZ0A 1BXGB 3H3JA 1W6UA 1DC5A 1Z6ZA 2B36A 3JQ6A 3NT2A 4TQGA 2E4AA 3QA9A 3AFNA 2RIRA 4W4TA 2VWGA 1DC4A 2QIOA 4JLWA 3CZMA 5BSFA 3GNTA 3IP1A 3ZWMA 3RJ5A 2C54A 1WWKA 3OQ6A 1YRLA 3M2TA 2VWHA 2V6BA 5I9MA 4OMUA 4PG8A 1W0CA 2QYTA 3G79A 1DIBA 2GSDA 2NNLD 4GVLA 2P9GA 4K1LA 2EW8A 5F1OA 3VHRA 2O50A 4MVJI 1LDBA 5KVSA 3LF2A 2VUTA 3F4BA 5KWEA 4BMNA 5TT1A 2J5KA 3BMNA 3DFZA 2IZ0A 1GCOA 3SC4A 4J4TA 4LVCA 5C37A 3HB4X 1DIRA 1GU7A 3LT0A 1KC3A 3GEGA
chains in the Genus database with same CATH superfamily
2GUGA 2H57A 4A5OA 3TM4A 1E5LA 2GAFA 5BN3A 2K7ZA 4DNOA 1F3OA 1MA3A 5KNDA 4HNRA 1YUNA 3KYDA 3BT7A 3R2JA 3FIUA 1FNNA 1MAAA 4ZAZA 1Z68A 3H65A 2NTYC 4H77A 2AZMA 3H9GA 3VO1A 2J7PA 5F5LA 1Y42X 1PTJA 4MGHA 1NI4A 5F7JA 1GKYA 5HRAA 2IU0A 1V7ZA 4HDKB 4U8GA 3VXKA 1D8TA 5A5VA 2FDXA 3A1NA 3UMRA 2FPLA 2R8YA 5ILQA 1V9SA 4D7AA 4M9CA 5J58A 1GL7A 4OI1A 2VTKA 4CWAA 5DHPA 4BNDB 4FZ5A 2YQ4A 4UREA 1U8CB 4QFMA 3QLVA 2C7PA 3YASA 5DTQA 1CQXA 3DBLA 4MWBA 4DMHA 4F21A 1QFMA 5LMZA 2V7GA 2XTZA 3W3AA 2DHDA 3MS4A 3Q85A 4RA9A 5IDXA 2ZU6A 1MP0A 3A1VA 4TQ9A 3TK1A 3ZE1B 1E32A 1N2OA 2QZ9A 5SY4A 3NOXA 5INTA 2YJ6A 1XJ5A 2Y0DA 5FAXA 5DZSA 2BTQB 4DHEA 4WINA 3IAS1 2CMKA 1XZDA 1XEAA 2C2ZA 3ZKAA 4I99A 4KH0A 3H18A 4TROA 1QGUA 2R11A 4DR3B 5EI5A 3LMKA 1PU2A 4OP3A 3NRBA 4JJ7A 5BT8A 2JLBA 3BRQA 3NTVA 4WCFA 1ND6A 3FGPA 3WO1A 1OFTA 2AN5A 1HEIA 2WE8A 3K73O 1BDIA 1DJMA 2ZUSA 2IDJA 1GRQA 5KPDA 3HPQA 3LC1O 3GJZA 5MF6A 4LDZA 2QTVA 2DSNA 4O4IA 3PFWO 3F9IA 3K6JA 5CT8A 5ALKA 1QQAA 1PL0A 1Q84A 2WPDD 2GR9A 4HVLA 3EZGA 4TTAA 3TLBA 2BUAA 2R1ZA 2B4QA 3N0TA 4R3WA 2WSMA 4XWAA 5AJVB 4ZOEA 3W2FA 2DWQA 3ZOKA 2E6UX 3EOBI 1J2TA 5BN4B 2QUKA 4X45A 4X9XA 4MRPA 5DYIA 3QLUA 1M1YE 4G5GA 4KPGA 1A5AB 2QM0A 3WGMA 4I8DA 3WMEA 3QVMA 4UPEA 3WWEA 3TF5A 1W4RA 3D7KA 2XXAB 2C1XA 2OO5A 4MUKA 4RFSB 2FE4A 1DCMA 1QUFA 3UB4A 1E3EA 3VPFA 1CY7A 3O1LA 1ABFA 2WFLA 1ZFNA 3O03A 1KPHA 1D2NA 4L07A 5LKAA 1A9XB 1F8YA 2N3ZA 2JIZA 1EFHA 1OV6A 4FBMA 4Q01A 2PBFA 5AQ1A 5IT0A 2NTVA 1RRCA 2QN9A 2O2GA 5A06A 5DE3A 5A5EA 3I6QA 5DSTA 1QHGA 3T7AA 1UDBA 1H3EA 3T54A 2R79A 3Q0TA 4LOKA 3ANYB 1BX1A 1O1YA 1YL5A 1AUOA 1UK6A 4IHQA 3OJCA 3EISA 2UYHA 2NU9B 1U8ZA 2BW0A 4PLTA 1OWLA 3QTBA 4H7JA 4FCCA 3S6JA 3D0OA 1T6BY 1RAHA 5GGYA 4YRNA 3MC1A 4G23A 4HNHA 4B44A 1P62B 1PQPA 3DBVO 4D9GA 2CJPA 2RHGB 3RRXA 2LE0A 1UFVA 5F9HA 3ILHA 3PDIB 3CTPA 1ZAYA 3ZDXB 2WP0A 2BE7A 2OAGA 4PLCA 1IMJA 4WXRA 4ZVVA 3SOPA 2IUSA 2YZ2A 1WZUA 3UHPA 1FU7A 1MVNA 2C82A 2B7BA 2P1RA 2R60A 2QN1A 1GZ7A 3QF7A 2WWHA 4HDRA 5ITZB 2Q4BA 4HNVA 1N78A 1RI5A 3EB9A 3IV9A 3LWZA 4RMIA 5K3DA 3RIMA 4OXNA 4EA9A 2AV6A 4WUVA 4QRDA 4CIBA 5F2NA 1NJ2A 4YJ3B 2G28A 3GFQA 5K1ZA 1C30B 4QECA 1I5RA 2H1IA 4MR8A 1RDFA 3GLGE 2JBWA 2WKPA 2HWWA 5DULA 1DU4A 2ZREA 1Y9AA 3FAKA 3VZPA 5JZMA 1LBEA 2BZ0A 2OQRA 4UBIA 1Q11A 1RYYA 4HN2A 4TRJA 2ODPA 2OHHA 3ROGA 7MHTA 4L6AA 2O2DA 2CEAA 4JYZA 1S96A 1LEHA 2HIHA 3JRNA 1FFXB 1WUKS 4OHXA 1Q0TA 3GJ8A 1AQNA 4UTOA 3GRUA 4IXNA 2R85A 3HK2A 3QYFA 1C2YA 1E2JA 2XMGA 3DAYA 3QITA 3CW9A 2A1UA 2XRMA 3CKYA 3NIDB 4MQFA 1BW9A 1YBFA 3ZNNA 2B4RO 4ZEVA 3IO3A 3EFOB 4KVAA 2ZDHA 3KQMA 3LYLA 5DT2A 4JI7B 4MUGA 1ADJA 1H2ZA 3VKHA 4FOLA 2ILTA 5LQRA 3EASA 1JP7A 3QP9A 3GF4A 1YB1A 1NBOA 5JNWA 1EGMB 1EFKA 1VI6A 4NY1A 4UHBA 2VEDA 1NJ5A 3IAM6 3ETEA 3LBYA 1O94D 5DLEA 1SHTX 4OHYA 1BWRA 4XOUA 1DG9A 2G8LA 4M1ZA 3X1KA 1XTIA 4GPBA 2PEYA 3B3GA 5DM2A 3QOWA 1L5FA 4LBYA 4WEOA 1T29A 1Y4AE 3KTOA 1EG7A 3QELB 3FLEA 1PX0A 4Z0PA 5FH9A 3C3DA 1YZ3A 1XZAA 2QPOA 3KE9A 1E3JA 3HVKA 1B6GA 3LSTA 3T35A 1W47A 4X41A 2IZZA 1HKUA 3BPSA 2GEBA 2BF4A 4G89A 3I52A 4OBBA 3O84A 1W0KA 4V0KA 3R76A 5JFOA 3VR2D 1JI0A 1G5PA 1JQ5A 2VRCA 4N3GA 4M4SA 3PWSA 4MEJA 3N70A 4X66B 3RADC 5JPCA 2WZQA 2H8KA 3HN6A 4UNNA 3RG8A 4QT4A 3OEEA 1P6QA 3EZ6A 5FCDA 3W1VA 1ZH2A 4B6QA 3U0BA 4ZJPA 4YY3B 2QL9A 1MABA 3ORQA 2VC2B 3D81A 2IW1A 4J0CA 3S5UA 5DGXA 3U6BA 1LRLA 3SI7A 5KOHA 4YVFA 1UMKA 1X2EA 2AFIA 1OFHA 4LPKA 2ODAA 3QYJA 3V48A 5JYEA 4YI5A 2Q5EA 3A7DA 4G2TA 1IIRA 4GZ5A 4JLMA 4MRMA 4NCKA 2C3PA 4QVIA 1LK0A 4L4XA 3SQLA 3STTA 1WSBA 1R6BX 3BJMA 4GOOD 3R3ZA 5K7SA 4HMPA 3PRYA 4PHTA 4B8WA 3IUSA 1CUYA 1CY4A 5CNIA 1P29A 4JBIA 4CBVA 1G2QA 1JG4A 2BONA 1YGYA 1DQNA 1VZ3A 1QFJA 2XUKA 2Q07A 2Q0HA 1U2TA 1W2GA 5JD5A 4MCHA 2XQFA 1NLUA 1L4LA 3WLOA 4Z7NB 1XT6A 3HYLA 3NYQA 4UUQA 3SBDA 1AXGA 4LPSA 2EYUA 2FWBA 3GA5A 4QQRA 2VTBA 4RLQA 3KVRA 5EC8A 4B4UA 4LOJA 3GOHA 3ELYA 3QELA 4A91A 1MZVA 1Q2XA 3H0KA 4BRSA 2PVPA 1GQRA 2P6PA 2HZ7A 1XTUA 3MWFA 4ESVA 4GECA 2PMWB 3C3BA 4PGHA 4DNQA 1S4MA 1SQSA 1BTOA 1G3IA 3KP1A 2Z83A 5HNKA 3LX8A 2VKQA 3MERA 4PPQA 1T2AA 2O5EA 5ALMA 3DZIA 3ZYZA 1JJ7A 3O8QB 2WMDA 2VNSA 1DRVA 4I50F 2A5DA 3VMMA 3GHHA 2L18A 5CM9C 1UM8A 3WMFA 4F4CA 4EB8A 4GYYA 7AT1A 1X6VA 1AKYA 1JSZA 1USVA 1KJ8A 3ORHA 4PPFA 3AR2A 3OU2A 4B7UA 2I9PA 5DRTA 1EUCB 1IOWA 3FYCA 3TOSA 4P08A 1NNEA 1KYQA 1JFLA 5CIYA 3QQPA 4R83A 3A0UA 3V32A 4CHGA 1GAEO 2GHQA 3QF4B 1L5VA 4PQRA 2OXIA 4F71A 3TJMA 1BAPA 3ZW7A 3L8FA 3H42B 1C0EA 2Y1LA 3ZKWB 4WOJA 3HADA 3ZU4A 2W4IA 1KQOA 1ISHA 3CU5A 4DV7B 1K9VF 1Y6RA 2NPOA 3I9MA 3N39C 5AMXA 1DC3A 4BNJA 4BXOB 5FTNA 3DMDA 3G5AA 4KPFC 4B4VA 1Q0LA 2FW8A 2FN7A 4KQFA 1MX9A 5L3QB 3AVYA 4EHNA 2D2FA 1Z0UA 2B7CA 2E48A 2Q29A 4WFJA 5DGTA 1TJNA 4A0GA 3UMMA 1TNDA 3NIGB 1UZAA 5GM2A 3L40A 3A6KA 4IDFA 5IK2D 2DWUA 3AB7A 1HEUA 1XYYA 4FYKA 1OBVA 2NVBA 3OHPA 4DR5B 1VYVA 3EFHA 1A2OA 3RFFA 3NHAA 4M1QA 5FPQA 4P34A 4CLXA 4U7FA 1A2KC 1NVVR 2VF4X 3HPRA 4AKSA 5EJ4A 1GZ5A 1K2WA 3C87A 4GPD1 4XLTA 2IV3A 3E7FA 2Y4NA 3IBFA 1TIBA 3HACA 3B5IA 1G20B 1M34E 2BUCA 3U7RA 1NOJA 1N32B 4HEA6 1XZJA 1G7TA 1VG0B 5HCNA 4BYMA 5LOVB 4MHOA 1YIDA 4IX1A 4LK3A 4PZUA 1ZG3A 4EPRA 3MQFA 4HGQA 4COOA 1Y0BA 1YZYA 2YWHA 4XD7D 5TC4A 3W79A 3B6IA 3LM8A 4ECAA 3NFRA 3BWDD 4C3UA 4CEJA 2AXQA 1WSWA 1ULUA 4J4BA 2I55A 1JLRA 4OU4A 3GXBA 1IK6A 4YS6A 2XDQB 4UNPA 1HGXA 4ILKA 5BN4A 2QL7A 4BY9E 3E5MA 2PUDA 2IQIA 3OJWA 2VA8A 1BJKA 3W6PA 3B1FA 3BD8A 1BXZA 3AR8A 3G9ZA 3N74A 4DYHA 4NS1A 2FPXA 1FXWF 3MJHA 3G23A 1NI5A 3RVPA 3H1GA 4XUDA 2ZPAA 3MJDA 3GGDA 2PGIA 4YRAA 2OC4A 3OSUA 1TEVA 2QJRA 4IICA 2FSPA 3O2NA 3WYAA 3UBTA 4C29A 2NUPA 3KKLA 4H0NA 1GR0A 2OPBA 5CVJA 3OFJA 2P68A 4G5HA 4U39A 3QZUA 5AM0A 3GPLA 3UV3A 4C5CA 1ZISA 1FFHA 1SO8A 3K5HA 3PX3A 3GPCA 3JTEA 1HYHA 3IP7A 4LF9B 2C8KA 2X6TA 4MUBA 3CYFA 2EBHX 2Q9AA 2D1QA 2QXTA 5EUQB 3UAVA 5TQ2A 4XOIA 4J0EA 3NXSA 3MMNA 4YWJA 1WB5A 2A1TS 4TSFA 5IW8A 1XEFA 2ZPTX 1U3GA 1KVQA 4US2R 2BM9A 3T4UA 1ZH4A 4MPTA 1QF6A 1IATA 2G5PA 3WLMA 1PYGA 2J9RA 1P7YA 2C3UA 3R75A 1TLLA 3N2IA 3QU2A 5EIXA 1IZYA 1U8XX 1GNQA 1ADCA 1TYAE 2Z57A 3D8HA 4HWKA 4ZRDA 1GUBA 2Z3ZA 1PJLA 2RBEA 3M4JA 4ZZ2A 1QC5B 3UJ3X 5KNCH 4OLJA 2CJXA 1MB4A 3L1UA 2ZROA 1X87A 3U26A 4MQLA 1EVYA 1VIVA 5BYAA 1V8FA 2ONZA 1T2VA 3KYBA 4OJKA 3PR2B 4NZMA 1PNOA 3AVPA 2HF7A 4JR0A 3UOAB 3LUDA 2WWTA 3R6DA 3TW6A 4DOMA 3OQOA 4DR6B 1TU3A 1K8YB 4J6FA 1HLPA 4O2BA 4OXIA 1UCFA 1KDPA 3UHOA 5C8ZA 1DADA 2OL4A 4RAQA 4RK1A 2ZG6A 1FJGB 2QB5A 4KE7A 1NY6A 3AHDA 1Z07A 3IEVA 2QLTA 3TE6A 4RHFA 1JYFA 3O74A 2I4OA 1C1DB 1PEYA 2MTBA 3KJIA 5DNDA 5TX7A 3HB9A 4DLBA 5CXSA 3CZPA 5ENVA 1E3IA 2PR2A 3HA5A 1OXBB 2P2SA 4TT3D 3DEHA 3FYHA 5C53B 3DPSA 3F8TA 2HM7A 1K6JA 1MD9A 1UDRA 3MLAA 4HN9A 1L5RA 3DMYA 1H0KA 4LRTB 3SNHA 4FI3C 2OK7A 2YWBA 1JA9A 4K6GA 1W36D 3L46A 4IH4A 3OY2A 5DIFA 3G17A 4B40A 1NRJB 5E9JA 4BB5A 1G3MA 4N18A 3UC5A 1PKEA 4BNYA 4NV0A 2HA4A 1AG9A 4XB1A 2OXTA 4AY6A 1SHKA 4PAQA 2RBGA 3OURA 2R7MA 3SEAA 5JFTA 2CYAA 3ZS8A 1Z22A 2W2LD 5JCPA 1IHUA 1Y6QA 1HMPA 3EW9A 4GGMX 3WKDA 4RPIA 2VQ6A 4FYWA 3DOFA 2D2XA 4QQFA 4B3IA 4WQMA 1PVVA 3PIDA 3ZI0A 2D54A 1ZD8A 3AEUB 3MQ4A 5DFAA 3VR4D 1C3XA 1ZNWA 3GJRA 4QJ4A 2AD1A 2WDZA 4DARA 1W29A 3PFFA 3IA2A 2O0HA 2PZGA 1C29B 2B20A 1CVLA 2ECPA 4UUAA 1Z0FA 4O4LA 5AK4A 3BQMB 3UWOA 3WGUA 5JSFA 1B8NA 3NBAA 2JGFA 1DX4A 4MVJF 1Q12A 4TM7A 5HF9A 3EMVA 2AG1A 1XZFA 4HDAA 4OYHA 4AYXA 3VZSA 1EE9A 1YR1A 5D7BA 5ECYA 7MDHA 3F7MA 3DLBA 3KRTA 3EZNA 5DEIA 2QNIA 1TJPB 4TWZA 3GZTB 2EW1A 3DWFA 2DTEA 5LZ7A 3S2GA 1UDAA 5BV1A 2JBAB 4OHZA 5A5FA 5JASA 3FMGA 2IU3A 5E2IA 3WJ2A 1WBBA 1L7BA 5FWXB 3HJUA 1T2FA 2HTFA 1R00A 4V0NA 4MPRA 1YRBA 4GYKA 4JEMA 5CB4A 3ONDA 5K3CA 1BIFA 3RVOA 4KIWA 2GNPA 4OMDA 4QLOA 4QJ3A 4MV0A 4UVDA 3SHFA 1MJGA 3ZDFA 3THYB 4Z0NA 1EFVA 2I3DA 4YCJA 4HLUA 4HDCA 1WULS 1SUPA 2BFAA 2XCLA 5BSTA 3UWPA 1HM5A 5L53A 3RUPA 5F7XA 1E7MA 1WUYA 1T1RA 2VQEB 1CRZA 1LC3A 1E9RA 1WVGA 4GDMA 4F3CA 5EWMA 4N6GA 2FE1A 2DHEA 2VHZA 2Q1UA 4XUEA 4B1FA 2AJCA 3GLIB 1USUA 3FMOB 4DNXA 2QVBA 1K0FA 4HFJA 1JXMA 4ZI5A 2M6KA 2ARKA 2QP3A 2WTAA 3ZHBA 2X8JA 2ZIUB 3AJ8A 5EGSA 1M5TA 2ACKA 1OGYA 2ZSHA 2NV0A 4RTOA 3AW9A 4MRNA 1N6KA 1QQTA 2BELA 1XALA 3NKVA 3PNBA 4L0QA 4R2HA 4V38A 3HYCA 4GM1A 5ALLA 5CLFA 2CZCA 3ZHSA 1OAOC 4Q9IA 3L41A 2O3SA 4EZIA 1E69A 1VBKA 2IYWA 2H1LA 3GN2A 4HXYA 4LISA 2HNAA 2Z3VA 5AXCA 1KSHA 1F5NA 2XUIA 3GVPA 5AKYA 2PYZA 3BTOA 4DN6A 4UDYX 1QFYA 1T91A 2CL0X 4Z6KA 2VNIA 1VFPA 2X1HA 4XH9B 2XD9A 1Z7EA 5H4GA 9MHTA 4K3VA 1D07A 5CJJA 4OGGA 4F3KA 1FDTA 2BLNA 3C5CA 1QOQB 3D7LA 4MAMA 2JNWA 2EL9A 3CA8A 3OIYA 2I7TA 3AETB 1KBOA 3WDMA 3UJ9A 4UOEA 1YCFA 3IVRA 3L7IA 1YS9A 2J6HA 4HMOA 5E7QA 1WCIB 2WHRA 3H8JA 1ENPA 4J0HA 3R0IA 1WZNA 2GK4A 4TLBA 1IB0A 4LE0A 2GD2A 2XDYA 4QYSA 3NBXX 8ATCA 4WX2B 3UMBA 2VVTA 3WB9A 1Y82A 4AY4A 3NVMB 4F38A 3E7DA 1EDEA 2YDYA 4J0FA 2QG4A 5LDGA 1II8B 4DMRA 3NBYC 5FQNA 4TTPA 5CFRA 1Z6GA 1P80A 4XYGA 4P3OA 5A05A 3HM9A 1F06A 1NC1A 1SA0A 4IV0A 1B2RA 1ECGA 1UP4A 2AFHB 5G1OA 1Z28A 4MUXA 2RK4A 1P4JA 2LCFA 2J09A 3LDHA 1SVSA 3QHPA 4XFJA 1WV1A 3SEFA 4ARAA 4D96A 4YR7A 1N7HA 2XMZA 4LDQA 3WIEA 4AG3A 4YUWA 3JQPA 3VRHA 1F38A 4FSHA 4KQHA 1X7ZB 4V0MA 4D81A 5TMEA 1TQ8A 1FFBA 1T2EA 2ZUFA 1MOPA 3EVGA 1Q5PA 2JFBA 3K30A 4INPA 4J76A 2V03A 3V1KA 1DZ3A 2YVQA 4LDAA 1DOAA 4FM9A 3ZIUA 3M6MD 3D6MA 4WLOA 5KYGA 2GRJA 5BT9A 3FUWA 3KQNA 2CV1A 1W59A 2R6CA 1YSCA 1M1ZA 3I3SR 4EHFA 2QP9X 2ZJ7A 4TYMA 1PZNA 3GUVA 4WFIA 2GAAA 2XXBA 2YXNA 3C70A 2DF8A 5ES4B 3TTYA 4DUPA 1BRMA 3PZBA 4YRLA 3F78A 4TUYB 3ZX4A 3DWEX 4G0YA 4JLAA 3GDHA 5EHIA 1O6ZA 3W5IA 1RWBA 2C4UA 2SNIE 2FP3A 4DB4A 3Q8MA 3P9QA 3DR5A 1QMPA 3PE6A 3ZBQA 5LJIA 1Q0ZA 4DA9A 1PJ3A 5JNVA 5K0TA 4U7PB 3V4RA 4EGSA 1DG1G 1Y3BE 3IAS6 2X86A 1LSJA 2PGJA 3W7BA 4LGVA 1SEPA 2ZRFA 3CW8X 2O5RA 4JCCA 1CQJA 5DDIP 5HXAA 1YRAA 4PWYA 4LF4B 3C8UA 3L1IA 1J09A 3IOEA 1F8GA 2I76A 4TT8A 4ZOLB 2CDNA 4DADA 3V6LA 2BMEA 1FNCA 1E0JA 1RPTA 2IVZA 5EJ6A 1UKCA 4IR7A 5L51A 4XTRA 1RCTE 2DBVO 1ZR4A 4TRRA 5JD3A 4A6DA 4B35A 4EA7A 4NXNB 2NUAB 2Y1FA 5E6UA 2G0NA 5CFOA 3FCXA 3AP2A 4TKLA 2V0GA 4IV8A 3B1ZA 1YT5A 4RDIA 1SUBA 1EDZA 2ZWMA 1JJAA 5DYTA 5KYYB 2IOFK 2PRSA 2WFMA 3RVMA 1G55A 3HI6A 5TNXA 1UXHA 1T1SA 4DYVA 2VAVA 3DL0A 4NPCA 3ENQA 4HWOA 1TT7A 4WNAA 2PBRA 4E88A 3V8NA 2ZQYA 4RVNA 1O5IA 3V1TC 1RM3A 2J4DA 2WV9A 3K20A 1JA1A 5KYUA 4OBEA 2FR8C 5HF8A 1OLXB 5M34A 4LHYA 2ET6A 4OOEA 3G7NA 1JKFA 4Q24A 1L7MA 1NAHA 3P8ZA 3PQ7A 5DXJA 5IT4A 2BSQA 1C9DB 2G63A 1O95A 3H5LA 3DC7A 1DT5A 3ANMA 1L1FA 5I9BA 2JAXA 2GM3A 4RTRA 2W2XA 2H4ZA 2O0JA 3B5EA 4FXOA 1WXEA 1XU7A 2PJDA 4HTFB 2DR3A 5CH8A 4EJSA 4YASA 2DX7A 5E3JA 4FZJA 5GMOA 4ZHQB 4BO4A 4CQMA 3EXIB 2ZZMA 2HFKA 3IPLA 4NE7A 5FWNA 4IILA 5KHAA 1J06A 4NJMA 5EP1A 3SBOA 4GKJB 3UCEA 1UXGA 2OKCA 1F9AA 3EXAA 2VT7A 2C8JA 1YQGA 4R8LA 3ULKA 4CM7A 1P44A 2PUAA 1FZTA 3KUXA 3W4JA 1E6UA 1TAGA 4BZZA 1FDVA 1PLLA 5CYOA 5ALEA 3WV4A 1J33A 4K9LA 3BWMA 1O2DA 4K9OA 4AROA 4OQQA 4V1CA 1E2KA 1JUDA 3EIEA 1GSHA 2EJVA 2XGGA 3F71A 1EA5A 1WLSA 4HTAA 4RMNA 5G1PA 5B1DA 4CKCB 4PO1A 3ER8A 2MT9A 4GBJA 4L5JA 3N8HA 2O05A 5LQAA 4CDMA 5EMJA 1A69A 1A1VA 1EK5A 1FFDA 2OHGA 4L6CA 3W5DA 2C7OA 1E58A 2HDOA 5SZKB 4X61A 1ZP6A 3P9NA 3IMGA 5BQOA 2A0YA 2A92A 1JYEA 1MAWA 4GU5A 4DTIA 4EHJA 3LW8A 2V74B 4KB5A 2R97A 3S8MA 3JZMA 3NV9A 1KP9A 4L8VA 3U61B 2AT1A 4G65A 1GZ6A 2AGVA 3HDGA 2BFNA 4JL8A 3T7DA 3HBAA 3OE7D 1TIKA 1JU3A 4DR7B 2J5BA 4DMGA 3FGNA 1WHTB 1N33B 3OLQA 4QGFA 1BVYF 4Q7JB 3SY8A 4G0QA 1IIBA 2E37A 2VDLB 3AESB 4KK4A 4ZARA 3L1JA 4KXFB 2W6CX 5BSRA 4S1WA 4E2ZA 4YXFA 1XX6A 5JSKA 5JSZB 5ULLA 1T3GA 4XEHA 3J81k 3SMVA 1QUEA 2FSGA 3ZWVA 5BP7A 3OA2A 4K9RA 3CLRD 1WIWA 2WJ4A 1OT5A 1V3VA 4QPNA 5EZYA 1ORVA 3K9FC 1LVUA 2XQGA 1EGHA 1QK4A 2JJQA 1NYTA 1AA6A 1VJTA 2ZTSA 1L7XA 3B70A 3BXZA 1O58A 3H7AA 4FFBA 4LZAA 4WBXC 4ZODA 3SBXA 3S29A 1WE2A 4QHYA 2FUEA 1OIWA 4R05A 4L5IA 3WX0A 5CXUA 4QNMA 4CG1A 1VQ1A 1XL0A 3DJYA 1BXKA 2FYTA 2HU8A 1A7JA 2A86A 2QRKA 3PK0A 1EVQA 1YOBA 4MW2A 4PGGA 2VP9A 3DMFA 5FBKA 5I9LA 1UMDA 2WD8A 2PX6A 2CW5A 2O2YA 3IXLA 3LV8A 4IVQA 5B57C 1RC8A 2GXQA 4TV9F 1QG6A 1U0BB 4L22A 3DB2A 2OZEA 1JR3D 1OE0A 2GZDA 5BOSA 1D8AA 3IVXA 1CDEA 4MULA 1U0RA 3HXMA 3R5SA 4YWHA 2GPNA 3TEJA 1VLLA 4TZ0A 1R9GA 3VZBA 4P9NA 1NUTA 1U04A 2QROA 4X7RA 3FZGA 4W5TA 4AI6A 4CUKA 3SIWA 5CDFA 3MJRA 3AT1A 4N7MA 4KN5A 3UQZA 3PXUA 2P2YA 3KG2A 5EMLA 2W0MA 3EGIA 1J0BA 1RR6A 2HJHA 2ILVA 2X42A 1WMSA 4TL7A 3P2JA 1S7GA 3G6WA 2XWPA 4PLPA 4PICA 4H7FA 1D2GA 1TMKA 1TQHA 1YZFA 3E15A 4GWKA 3VSDA 4EENA 4EX6A 3WLLA 1W9HA 1B0PA 4FZVA 3WKAA 2ID9A 3IT0A 3PKZA 1FPQA 1DX6A 4B7CA 4DJAA 1YFJA 1NVFA 1PFVA 1ZUNA 1JQEA 4MVXA 4AMVA 1P72A 3FWKA 4OFWA 3TMAA 3OF3A 1BX0A 3BIFA 4LF6B 4O2AF 3RSQA 3TTWA 2WBLC 3CLRC 2CFIA 3OM1A 5HZHA 1B8VA 1VHDA 5F9FA 1D03A 2AEFA 4HLQB 1R74A 3AEQB 1A82A 1RIFA 3OUTA 1QCDA 5KVVA 4C3ZA 3EIOA 5BYJA 1QC5A 3BEOA 3T1QA 1YQEA 2H3EA 2VUIB 3LT4A 4AKEA 2VRNA 1M6WA 5J2TA 1F2VA 4AS1A 4BCDA 4KO1S 3RU7A 1ZNXA 2YNMD 1E94E 3ND5A 1WA5A 4HADA 2WJ6A 1U8TA 2EGHA 5I9IA 3LVRE 5HQJA 4OLFA 2H1OA 3GVHA 3D6TB 4URWR 1Z18A 5JJ5A 4R2JA 4DG9A 3SVTA 5A4KA 1RXUA 1LDMA 1IRXA 4NZZA 4NJEB 2VSQA 4ZCLA 4EKYA 1FB5A 1ZIPA 2NNWB 1OI4A 3AEXA 1X1BA 1AF4A 4JFRA 4RAOA 5IJWA 1Q1EA 1SIBE 3DE4X 3I05A 4LQDA 3TNJA 5IYZA 1MENA 4PYKA 4E5NA 3IELA 1Q7EA 3QMPA 1Y9EA 4PS0A 1T4BA 4X7MA 1U28C 4MTLA 3RIHA 3LUPA 1U2ZA 1VSQA 3KPUA 3ADCA 6CHYA 2ODTX 3FM9A 3OCCA 4BMOB 5IBQA 2W83A 1XYGA 5B7NA 1R0ZA 2D59A 5CFNA 2ATIA 1Q1AA 1SRQA 3I72A 5MN6A 3U7IA 2BD0A 3WDSA 3IE1A 1TEHA 3HB5X 4ER6A 2GN6A 5C8DA 4GT1A 2YUIA 3OH8A 3I9V1 5EXDA 3NKLA 4ZC1A 3MGGA 2AMLA 3AB8A 3OLCX 1G9TA 4HQKA 2B99A 2OCBA 1ZRHA 1KAMA 2JLRA 3BD6A 5CM2Z 3EIFA 1V71A 5EE0A 2XSZA 3T99A 4QLBA 4WBNA 2RBKA 4W8OA 5JSZA 2R1UA 4ZVPA 1P81A 5FUVA 3ZX5A 2Q4OA 1P0CA 2VSFA 4ENSA 4JOQA 3K9NA 3BORA 1FP6A 4EKIA 5KTKA 4Y6GB 2G17A 4D9CA 2DFKB 2IY7A 2F64A 3NFYA 4CF6A 1PI3A 1L5YA 3FZEA 4WJLA 5KQGA 1Y9ZA 1NM5C 2WVGA 2Y05A 5EZQA 4UBNA 1E61A 2PL3A 4K3UA 2TRSB 3U39A 1RPNA 3N3AC 2GESA 3E0XA 4OU5A 1GYPA 4W7SA 4JUFA 3L0CA 1P4AA 3HXKA 1JR4A 4KIFA 2XZLA 2BP7A 3KVOA 2C57A 2IHYA 1FDUA 2JCBA 1V5FA 2HMUA 1U3UA 4BMZA 1Y33E 4O6VA 5I4KA 3HP1A 2RB4A 3OE5A 1TJ5A 5HIMA 3T5TA 5JAIA 2HT1A 1PIWA 2PLAA 1M2GA 1JQ3A 3OFKA 4OFZA 4F8JA 3PGKA 2DKOA 1DQYA 4JVMA 2UZ1A 2PNFA 1NP3A 4TL9A 3JWGA 3WLHA 3T38A 5LPNA 1G64A 1OH6A 2X8WA 2EJTA 2QAGA 4WLUA 1X7YA 5HIIA 5LYYA 2AS0A 4ZD6A 1AMNA 1N6RA 1UBLS 4BLSA 1EEXB 2Y99A 4WNAB 2RGEA 4ND8A 3SG0A 1NF3A 1W46A 2KE5A 2DJ5A 2FG6C 2VK4A 3JQAA 1DI0A 4I1OA 2HDWA 4XR9A 2EBFX 3INTA 3PICA 2H18A 4QUAA 2A0KA 2KMLA 2ZWIA 3LHFA 4JJ8A 4YP6A 3W2TA 2FQ1A 3WNBA 1U5CA 2A9OA 2FETA 2H7VA 2ZB2A 1T2CA 3KR9A 4J7UA 2W6PA 2VF5X 4PBSA 4XM1A 3UMCA 5BSWA 5JR3A 4P6VF 5AKZA 2MYNA 2BBTA 4IQ0A 4XX1A 3KLPX 5AM4A 3TDKA 1WB9A 4BO8A 1R4MA 5LP6C 1EUCA 2UZ0A 3KJXA 2FOLA 4GPTA 3CCCA 4MQUA 3QXJA 4WLFA 4XUGB 5E1DA 3UJCA 1SXIA 3THXB 3D43A 5DHFA 1ONOA 2FRVA 2CV0A 1NGSA 4PCUA 1KP2A 4BGEA 3TSZA 2CLLB 4NHOA 4C0JA 1GG9A 4MKZA 5G1NA 1I3MA 3C6MA 5K45A 3DH0A 3Q5DA 2WSSA 4M9XA 1PR4A 4CRWB 4JYCA 2DB3A 3GIWA 4L9WA 5F4BA 1XMPA 3HR8A 3EBLA 4R2KA 5BMVA 3KBBA 1D4ZA 3C8MA 1JR3A 1X0XA 3F74A 5L9AA 4EGCB 5KU7A 2NQTA 1V0JA 4XJXA 4YP0A 4CR7A 1YV9A 3E8XA 1NXXA 2X19A 2I4NA 3FWHA 3HMQA 3RJZA 1CLEA 3PVZA 3UENA 3F6YA 4R0VA 4LXUA 4CIDA 2PGLA 1PLKA 5BURA 2FZKA 3R5XA 2B6HA 2ZYUX 3DBHB 4MUIA 3QVXA 4NZPA 1MOQA 5ECGC 1SURA 5FD8A 3RE1A 4MTCA 3L92A 2D06A 4WDRA 3UIEA 4LYEA 4IH1A 1N0HA 1EPUA 1CUJA 4LCJA 1GA4A 3D4OA 3BAZA 2WJPA 1SU7A 1EVLA 4PRZA 3W78A 3W8FA 3WK4A 2WIKA 4CQMB 2QW8A 3NHZA 1U80A 3WNDA 2NZVG 2ATEA 3LCRA 1UMCA 2VHCA 4U9IS 4J1SA 3WWYA 4IYJA 2VRBA 1XV5A 1GAJA 3DFUA 1P2TA 1JL3A 1XCOA 3Q7PA 1NMSA 2VDUE 3NASA 4G8CA 4R1TA 5JDIC 4CMIA 4MIYA 3VR1A 5C5DA 4GVXA 4N03A 3K1YA 3UK1A 4X64B 4ECEA 3IAHA 4YUXA 1UZLA 4GLLA 2B30A 3AJ9A 1EYZA 1MLDA 1P2BA 4Z3OA 2HWXA 3NM4A 4U2DA 3OF2A 3IOMA 2D74A 2FKNA 5AKIA 2Z8YA 2OD9A 2HIMA 2C04A 4HYYA 5DCYA 4YN3A 1R8SA 1CB7A 1YI8A 3D4IA 4ZWNA 3RS3A 3U56A 5FBWB 2ROQA 3WA6A 3IDAA 1QKKA 1SY7A 4FK8A 4K46A 5DI3A 3A6GA 3GRFA 4P7BA 4PC7A 4AURA 4IG9A 4JIGA 4AJHA 2V9ZA 3UH1A 1HYEA 2BPOA 3HVHA 3WYDA 3UV6A 2YXEA 3ROXA 4OSEA 1PQ4A 4KTTE 4JODA 2J3EA 3CVVA 1ULBA 4B6EA 1U7TA 3X0DA 2WEKA 3CR7A 1RC1A 1R4NB 1RJ9A 1XCBA 4ZKEA 5A4FS 1XEWX 4YLEA 3DV0A 2VSNA 1A9SA 1VJGA 3IP8A 3G0OA 1HEYA 4WZAA 3NOVA 3KKPA 3LOUA 1OXKB 1Z7YA 3DTNA 3SZMA 1QP7A 3NH9A 1GUAA 5KVCA 2P11A 1U90A 3AVTA 4FGUA 3UANA 5D84A 1H2HA 3L06A 2Z0MA 1X74A 2KPOA 3PD7A 4G8BA 1C9EA 1L4UA 2GB4A 1UEJA 2P4EA 3LZCA 4K6HA 1U9IA 2HRRA 1MJGM 4WIAA 4CGZA 2MHCA 3LC7O 1JQBA 3LHIA 4JOBA 3JASA 2CNWA 2OCLA 5K6RA 1D5CA 2AFIB 2D7CA 3FCOA 3HRKA 3GFSA 4FOOA 1WU7A 3ZU3A 4B6OA 5KQMA 3RYFB 4TKVB 3TL3A 2PX4A 1NMYA 2GK3A 1JLLA 1QZXA 2CK3A 5J9FA 4IGKA 1KHHA 3QBJA 3TD9A 3MWYW 4BO1A 4NE2A 3BH7A 4W99A 3D1JA 5FV4A 3ZN2A 1NOIA 2P9QA 2IL1A 3RF7A 5IMSA 2GN1A 1PDWA 1ND5A 3B3QA 1CZNA 5JH7F 2JLVA 4FMDB 4IDEA 1C3LA 3URMA 2IUUA 2HPZA 2WUDA 4NFYA 4TZKA 2NT4A 1ZJYA 2GTPA 1KEUA 1G38A 3RUCA 3LHKA 3ZLBA 4KFCA 3BFXA 1PEAA 3F4KA 3BFJA 4ASUA 3MPUA 4AZ3A 2GDJA 4R40A 1X8XA 3VKWA 1M3SA 4HPJB 4HCJA 3P1JA 1RQXA 3S1SA 3KUCA 5F1KA 5THXA 4CIXA 1L7EA 2QN2A 1T5SA 3GUCA 4G01B 4DMCA 2VG8A 2COEA 5K6AC 2AJLI 2EIHA 1E1YA 4G9BA 5HDBB 4ALMA 2VDWA 1VP3A 5E7JA 1ZU4A 1LLUA 5J5AA 2H48A 4KLNA 2NU6A 1RC0A 4BAZA 2ECKA 3OHMA 4YAKA 3L7JA 1L4MA 2DFDA 3G49A 2ZGVA 5TXGA 1CUCA 1PFKA 1I7NA 4FHEA 3PITA 1DIGA 4FMPA 1Z2EA 2JJ2A 3ZDEA 3Q8XB 4R7GA 5HVNA 4WECA 1QO0A 5KC8A 4PXAA 4GZLA 4HBZA 2WT9A 3DFMA 2A9VA 4ZPXA 1TMYA 3C6QA 3E70C 1KJJA 1UT8A 4H7EA 4DIKA 1VL2A 1R6XA 1NBEA 1MC5A 2B5OA 3F67A 4BECA 3A1EA 2IF2A 4C0LA 2R6FA 1PW5A 4AU1A 4ENQA 3RTDA 2R8PA 1TUGA 3PENA 3O4IA 4MRVA 1KH2A 5CHEA 3CEHA 5AJTA 4YRKA 3LZ6A 3L6OO 1KYVA 4RMJA 1KSJA 1XTKA 3PWTA 4QQ8A 1J8VA 5EQJB 3NHMA 2GILA 3E7WA 4AMUA 4MS4B 4N3AA 1CIPA 1GGHA 4ZREA 2H52A 2BMVA 1GN9A 1VI5A 1KJNA 4H7PA 3GROA 3OT1A 5CRIA 3A2MA 1SUAA 1CT9A 4EY6A 5JS8A 2WU4A 3KYIB 1VSVA 2X1VA 3EY4A 3K8YA 2PSSA 4BJ1A 3MYRA 2A9QA 3W2HA 4NG5A 2OGUA 3CUYA 3VUFA 4ZCMA 2D6FA 1VA4A 1GPBA 5IZCA 1CS4C 3CUWA 4I3GA 4OIFA 4EUFA 3F4LA 1WKCA 3GV0A 1SU6A 2QW1A 2JA2A 4OX9B 1RWOA 4ZYZA 1FLNA 4L5YA 4X1YA 3AINA 1ZRSA 2Y68A 5IDQA 1VG9B 1I4DD 5HQ3A 4FMCF 4CCSA 2RE8A 4XX0A 1ETHA 1B6RA 4P31A 5JO9A 1Q17A 5EVCA 4IQFA 3BFVA 3DE2X 1T0IA 1ISRA 1KZYC 4BLWA 4E5YA 3QKSB 4OL0A 3LQRA 1OY1A 4MYCA 2KW5A 2J8ZA 4RNDB 1PT6A 1ESNA 4D79A 1L8AA 1RLOA 3UXHA 2X4DA 1HBJA 2VJMB 3TZEA 1JEYB 4ARCA 4HG2A 3UMSA 3D02A 4PFJA 2GMWA 2OHOA 2XWBF 3E22A 4ZRMA 3FSGA 2CSUA 2Y0BA 3BXGA 1VCIA 3LQQA 2ECOA 5IXYA 2QLJA 5KOHB 3B9RA 1AKRA 1CUXA 2QN8A 1L1QA 4P81A 3ESQA 1SB8A 2NO4A 1P2DA 3IRUA 3O2QB 1LB1B 2D3TA 4Y2XA 3RREA 2YYZA 3C5VA 4FFPA 2HOQA 4XQCA 1T9ZA 2OZLB 4UM5A 4JLDA 1AQUA 4WXMA 2GCEA 4DLSA 2DMRA 2B8TA 2PG3A 4WH0A 4WKGA 4ETMA 4YUZA 5LOVF 1L7NA 4J2HA 5B53A 1I7SB 4DCSA 4DMLA 1QGED 2ERXA 4YHBA 2R5WA 2G0TA 2XUJA 3GOQA 3Q72A 4FS3A 4X1KB 4ZOLF 3RODA 2FOXA 4ITVA 2CXXA 2JH9A 5KQPA 2IH5A 3AYXB 4RA6B 4CJXA 4YCSA 1MQ8B 1Y8QA 5CK4A 3FD8A 4G63A 4C21A 2JIBA 2YXBA 2D5LA 5KNBD 2B98A 1QH8A 3Q7IA 3R4CA 4HRYA 2RI0A 1C3VA 1XVIA 1TM7E 3LLVA 2ZQ5A 2PHZA 3WVNA 1LLDA 1Z5OA 1C1XB 1T4MA 4P2GA 4WASA 4NL4H 4PBTA 3L77A 2VYVA 5FOSA 4YACA 3HJNA 3BREA 4JJKA 2QTCA 1CY1A 3LT2A 4M0UA 3VM6A 3KYCA 3AI3A 1P7CA 1DO8A 2BZ1A 3RTBA 3RC9A 1OC2A 2GZ1A 3SWWA 4ZQCB 1Q21A 1TYDE 4MP8A 2DM6A 4HHEA 2QZJA 1HDCA 2GA9A 2WIJA 4G09A 2B4TO 3IQEA 4IKPA 4GL4A 5JV5A 4D57A 2ZYRA 5KNBH 4PYIA 3NV7A 2B0JA 2XUHA 1FA9A