4WK6A

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
243
structure length
243
Chain Sequence
FMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVASVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae 12129(1)
molecule tags Oxidoreductase
total genus 88
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2014-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wk6A00
1QYWA 1DDOA 4XX0A 2JFGA 1H9BA 1V3UA 3I4FA 4GH5A 3PLRA 2Y93A 4P4LA 1P1FA 3C8MA 2RCYA 4M49A 3TPCA 5BT9A 3DWFA 1P9LA 1HETA 1UDCA 2OMEA 1ZO8A 4KWHA 3BTSA 3JD2A 4BNLA 3JQGB 4PRKA 1DC4A 1H93A 3IMFA 1WNTA 2VWHA 1T2EA 1OC4A 4YAKA 4WCFA 4J1NA 3M1LA 1SOVA 2JL1A 1XKQA 2VUUA 2YFHA 4XJSA 2NQTA 5BSGA 3FHLA 4IDDA 3TFQA 2VHXA 4DMMA 1I3LA 3BA1A 3DZBA 4KUGA 5HA5A 1ISMA 3FNFA 4AICA 3K30A 1X1EA 4R51A 4XYEA 3F5SA 2PH3A 3ZNNA 4BNTA 1KVUA 2VYNA 3EK2A 4IJVA 1PJSA 2A9FA 2IXBA 2EHDA 1F8FA 1O6ZA 2WMDA 2FSVA 3WIDA 3DBRA 4QSMA 3QVOA 1AUPA 2GCGA 5ICMA 1QMGA 2VQ3A 1DEHA 4Q3CA 3WLEA 4J43A 5DNAA 4L0QA 1ZEMA 3IJPA 3KM0A 5AOVA 3G79A 3V8BA 4DYVA 2WE7A 3GRKA 3LC1O 4J6FA 4IJWA 4OQYA 2E37A 4UUPA 4WOKA 1GY8A 3QJ5A 4UUMA 4BO3A 4PCVA 2E48A 3EGOA 3HN2A 3UN1A 3MOGA 3DHNA 4AL4A 2VHZA 5K0ZA 1ZVMA 1L7EA 1XA0A 3KSUA 4WK6A 3ORFA 3ZWOA 4MOWA 5TGDA 3VPHA 5A1TA 4F6LA 2NU6A 3RBVA 5G0WA 5JE8A 1BXGA 1P1JA 3E48A 4GQAA 5DP2A 1VI2A 4PZCA 2EP7A 1H0KA 1K5HA 3OHSX 3H9GA 4TRNA 4IIUA 4XQ9A 3RKUA 4CLHA 5MDHA 4RLSA 1KERA 2QIOA 3H2SA 3QWFA 3E8XA 3DR3A 3ROQA 1I33A 4WLFA 5I7EA 3RCBA 4UEOA 4QUKA 2TMGA 4BNXA 5CAEA 3HHPA 3VC7A 4QT0A 1FDTA 3V1YA 1GQQA 1P44A 5ILOA 2NU7A 2HJRA 3NGLA 2IRWA 1ENOA 4CPDA 3PWSA 2CFCA 3HUDA 1T4DA 2JAPA 1TA4A 2OGUA 4G65A 3VHRA 2ZB7A 2VWQA 3QQPA 3JQAD 4MIOA 1IL0A 3QVTA 1E77A 3HG7A 4FFLA 3X2EA 3WGOA 2P9EA 1AXGA 1PZEA 1H6BA 3NKLA 5G0SA 1A9ZA 2X1HA 3MJCA 4FBGA 4AFNA 1IPFA 4HNGA 3TZQA 1VJ1A 2HRZA 3N74A 2YZ7A 4FIZA 1G1AA 3F9IA 4DREA 5L4LA 3F47A 3MJEA 4B7UA 2Y66A 1JU9A 3IUPA 2EW2A 1C3VA 2X86A 1NAIA 4K6FA 2NVBA 4GVLA 1O8CA 3E82A 1LUAA 2C2YA 4BO7A 4D44A 4MKXA 4IQ8A 2CF6A 1QSGA 4R9RA 5CDGA 4KMSA 3SEFA 1EUCA 1DRWA 4Z9XA 4WNCA 1Q7CA 1PGOA 3JQ8A 3GVXA 1I32A 3VH4A 3WQRA 4FD3A 3U4DA 4BO2A 1IPEA 3FD8A 4BNKA 4QO7A 3ASVA 2DKNA 1OBFO 3KLPX 4KTVE 1EZ4A 4BGVA 4CM6A 3SVTA 4LISA 4WLOA 4AJHA 1IE3A 1TT5A 4Y6PA 4YXFA 4GBJA 3L9XA 3PPIA 4GSLA 5HS6A 3V1UA 2BI8A 2POQX 1HDCA 4I9HA 4Z0HO 4ZGWA 3I5MA 4XEHA 4CLEA 3OQ6A 1F0YA 4GMFA 1R12A 1Y81A 2PKQO 1ONPA 1J0XO 1Y8QB 5JY1A 2VWPA 4FW8A 1NFFA 3GAZA 1DB3A 5IZCA 1X14A 3IKTA 1CIVA 1R4NB 5L7TA 1LQTA 5ER9A 2AQKA 1DAOA 3PHLA 2DBVO 1R4MB 4JIGA 3SLGA 3KYDB 1HT0A 3I9NA 2O3QA 3OH8A 4PVCA 4YCAA 4W99A 3WFIA 2QYSA 2J3KA 3TL3A 4XDYA 3H9EO 3FTNA 4RVHA 1CF2O 3BYZA 3DO5A 4MDHA 2HRBA 2X5KO 1XQ1A 1MC4A 4R5MA 3AOEC 5DP1A 3WQQA 1U28A 1FDUA 3IS3A 4RPKA 4RVFA 4JX8A 3VPGA 2GUGA 2P4HX 4NU5A 1Z7EA 5JW6A 3INGA 4HFNA 3JYNA 3M2PA 4WNIA 2X6TA 3KVOA 2DLDA 4DXHA 1NWHA 3H2ZA 2XPCA 5HRUA 2DBRA 2AG5A 2Q1WA 4J4BA 1YJQA 2Z5LA 3F3SA 4W7HA 1H6AA 3PTZA 5JO0A 2CUKA 3OIFA 4FS3A 1LDMA 1R0LA 1FDSA 5AXDA 3DZJA 3GVCA 3CZMA 4BNYA 5TIIA 1VKOA 2C82A 3DONA 4IDEA 1KEWA 3RUAA 2P5YA 2WD7A 4OJNA 1PWZA 1T4BA 2X0IA 3NTOA 1B8VA 3CE6A 1SMKA 2B36A 3HE3A 4OOFA 1Y5MA 4BQPA 1GFSA 5F5NA 3OBBA 3QWBA 4EZBA 2B0JA 1W0CA 3EVNA 3PGXA 3U49A 1S7CA 3OJFA 3HJAA 3VZRA 5I9MA 1H6DA 3WQSB 1PZFA 1B16A 1A7KA 1YQDA 5EQFA 4E2ZA 3ADPA 4OL9A 4I5EA 3GEDA 5AQ1A 4NH4A 3LU1A 3PRJA 3VPFA 2NTJA 2CMDA 3I23A 1YDWA 1Z82A 1U4SA 4OKIA 1B3RA 1A4UA 1GTMA 2CDAA 3NRCA 3RUHA 2C07A 4RORA 5IN4A 4D79A 1KEUA 1IUKA 5LDHA 2G76A 2IYOA 5L53A 1R15A 4QEDA 4A10A 1YO6A 1MB4A 3OETA 4TROA 4J49A 1BWSA 2RIRA 4GMGA 3COSA 3RSHA 5COBA 2AW5A 2D59A 2XF8A 5AXBA 6ADHA 3PZBA 3F4LA 2BD0A 3U62A 4NDNE 4B4UA 2B35A 4EEXA 5GZ3A 1EQ2A 3I9OA 4AJOA 1XSEA 1EVYA 4G2NA 4J91A 4H7PA 1UP4A 2JJYA 5I8ZA 3ROKA 3KYCB 1PJ3A 3FSRA 1VM6A 4IINA 1N1GA 4M55A 2E82A 4YT4A 4NBRA 2NVWA 1A72A 2CD9A 1EUDA 1XQ6A 3RQSA 1VC2A 2J5KA 1U8FO 2GZ1A 3EZYA 1PL6A 2FR8A 3A1NA 4PLTA 1LRKA 5IDXA 5TLSA 2GSDA 1U8XX 4OO3A 3OF2A 1QV7A 3W4IA 3DBLA 2QYTA 4RF2A 5U1PA 3PYMA 2F00A 1U5AA 3RBXA 3ZWAA 5IF3A 4OQZA 7ADHA 1UXKA 1ZMOA 4UVEA 2F1KA 1E7RA 4NMHA 2CVZA 2HK9A 4E5KA 3G1TA 1T2CA 4U6SA 1GD1O 1I3NA 1R6DA 2Q49A 3D4NA 3LC7O 4R3NA 3SX2A 4BKOA 2VCYA 4J9UE 3PHHA 1AN9A 2R2GA 2VRCD 3K96A 4XQGA 3PFFA 4ILKA 2JCYA 1ADCA 1P1KA 5CEJA 1BVRA 1XLTA 4BO0A 1YB1A 1I36A 1LA2A 1QYVA 2A94A 4FJ2A 3G0OA 3DMTC 4Q3NA 3ENNA 5G0TA 5JMPA 4OIMA 2QRJA 4AJJA 1N92A 3Q9UA 2HLPA 3UCXA 5KVVA 1MG0A 1PGQA 5A3VA 1U7TA 4YACA 1K2WA 4PLPA 3DTTA 4JBGA 3AFMA 1HDRA 3D4OA 1AHIA 3ZW8A 4I5DA 1OOEA 2EJVA 4IUYA 4XRGA 4KQXA 3AM3A 3WMWA 4BKUA 4LMPA 4BMSA 2VUTA 1LQUA 5DT9A 1EDZA 3GEMA 1U7HA 1NVGA 1UXJA 2RH4A 2YY7A 2ZCUA 2NVUB 3ZV6A 4CV0A 4E30A 4CLOA 4HFMA 3RI3A 5KVQA 2AE2A 3BTOA 4MVJI 4WJZA 4MVJF 1TT7A 4XQCA 4AJLA 3ZWPA 3KV3O 3SC6A 3LC2O 3O38A 1NVMB 2FOIA 3RC9A 2GN9A 4EBFA 1U2GA 3MWEB 5TJ9A 3HZZA 4IGFA 1YKFA 4L4XA 1J49A 3VZSA 2HSDA 3WGQA 1QYCA 4M1QA 1PU2A 2JHGA 5FI3A 4R1TA 2RH8A 1N7HA 1B8UA 2ILTA 3H3FA 2GYYA 5DOZA 4EEZA 3I4CA 3I83A 4J0FA 5JAQA 5BNTA 1LC0A 1CYDA 3DTYA 1JAYA 4IDCA 3LSYA 2O3TA 3C1TA 5ITVA 3JQCA 3KSDO 4XYLA 1KEVA 5K6AC 2X23A 4CM8B 3EUWA 1NX6A 4OYRA 3ETDA 1YB5A 4JP3A 3VZPA 1CQJA 3ZNQA 4AJNA 1NQ5A 2HMVA 3FNEA 3K2BA 1QYXA 1UAGA 2CVOA 5FYDA 4JROA 4BQRA 3KXDA 2NADA 4HP8A 3ZWWA 5CG1A 3GPIA 2DFDA 1E7WA 2D4AA 1PS9A 1VKNA 2I65A 2AXQA 1KIFA 4D43A 3LF2A 2J3IA 3RUFA 1RM3A 5FEUA 3WMXA 5JYDA 2IYPA 3WDSA 3ZWXA 1R0KA 1DJQA 1CETA 1PGPA 4JBHA 2NTNA 2VZ9A 4ZRMA 3O8QB 3RVDA 1E3LA 4YVFA 4QQRA 3RWBA 1G6KA 1YL5A 3GVHA 1EBUA 1EE9A 2FPGA 5G4LA 4BMNA 1EEHA 1LJ8A 4OSPA 5T64A 3TOXA 2CF5A 3BHJA 4CL3A 1I10A 3STHA 1FF9A 3M1AA 4BKQA 4YJFA 4IXTA 1LEHA 3BMOB 4A2CA 2E4AA 3VTFA 2JFFA 4WUVA 1OMOA 5KJ6A 1I30A 5G4KB 4RJTA 1XR3A 3OIGA 3LVFO 4EYEA 4YT8A 3FRJA 4ZQEA 3DBVO 2E6UX 1WWKA 3Q9NA 1PQPA 4BB6A 5CPBA 4IM7A 1PWXA 3K8ZA 4HV4A 1A7AA 4AJIA 3C24A 4BV8A 1PTJA 2BFOA 1I3KA 4J7CA 2O2SA 3LK7A 1DHRA 3FWZA 4NJOA 4Y98A 2EERA 4CQLB 1CDOA 2UUOA 3KZVA 4ZICA 4WLUA 3IAHA 3RFXA 4AJPA 4TKLA 3LZ6A 3G17A 2WYVA 1V3TA 1WAMA 4DVJA 1ARZA 2PK3A 5AVOA 4L4RA 3H5NA 4II2A 4DC0A 4IDFA 4CUKA 3D3WB 4CUZA 3A06A 1FK8A 1LXCA 2HK7A 1DFIA 4NHEA 3WS7A 4GL4A 3WYCA 1GUZA 5A9RA 1K89A 3E18A 3U4CA 2TMDA 3T4EA 4RQTA 2VT3A 1DBVO 2OOSA 2Q99A 2XAAA 3H9UA 4DQXA 2C7VA 1DFGA 1H6CA 3L6DA 5GMOA 1LX6A 4EUFA 1E3SA 1LLQA 3ON5A 3QRWA 3WBBA 4JGBA 4NJMB 2PTGA 1HYGA 5GZ6A 5A02A 1N1EA 2DTEA 1Y7TA 3SJ7A 5L7YA 1DLIA 2EF1A 5BNFA 3VAZA 2BRUA 5JCJD 2WEKA 4RDHA 2I6TA 3D7LA 5BSHA 3B70A 4FGSA 2VZ8A 1M6WA 1H94A 2B83A 4QFDA 2Y1FA 3N7UA 4BNNA 4CQMA 1LSSA 4MJLA 4DGSA 4K26A 3ZWNA 4P4GA 4O5OA 4DLAA 4L4SA 3JQEA 4ZQHA 4GX0A 1HKUA 4CM1A 1NPYA 3DL2A 4WEQA 1RYEA 3JYPA 1EQUA 5IN5A 2NUAA 4CMGA 2O50A 3PEFA 1HZZA 3ZH2A 3AM5A 1IHYA 2B5VA 5I9LA 5F5LA 1B0AA 2DC1A 3ZV5A 4X54A 4IY1A 4JJIA 3T7CA 5B1YA 1JVSA 1XWFA 5A04A 4S1VA 1HDZA 3OECA 4ZJUA 3LQFA 4U8GA 1FMCA 2W2KA 4CMEA 5EMHA 2ZCVA 4J0EA 4YWJA 2ZJ1A 1GL3A 2NTVA 1ZK1A 3I3OA 2CVQA 3OSUA 4BNZA 1RPNA 1PZGA 1QLJA 4E2YA 1GEEA 1E7QA 2G82A 1O5IA 1HDOA 1Q0HA 4MVJD 4N7RA 2C7GA 5HTOA 2NLOA 3MTJA 4KUHA 4EGFA 3NTQA 3BMNB 5TX7A 2H6EA 2WJPA 5IXYA 5JC8A 2EW8A 4IQGA 3DAFA 5JCXA 4AJKA 1BVUA 2R00C 3DOOA 4OGWA 4B3IA 3CTMA 4GX1A 1GYPA 1Q7BA 3HB5X 3RUEA 2D2IA 2DBQA 4CR7A 1DC5A 3E1KA 2HMTA 1ZFNA 3DOCA 4MVJM 3P7MA 3NTRA 3F1KA 1P3DA 2O23A 1HWYA 3JQFA 1A5ZA 5KWEA 1U1IA 4JJGA 1EBFA 3AM4A 3GZNA 3QIVA 5MGBA 1JKIA 3OJOA 4OH1A 1I0ZA 3PQEA 1VPDA 3DAGA 1DIAA 2Y1OA 1QG6A 8ADHA 4YT5A 4Q3EA 3QWAA 4TVOA 3SC4A 2D8AA 4BL5A 4CMEC 1VJTA 1DXYA 3B6ZA 4IXWA 4MP6A 5DOVA 1E6EA 2PGLA 2XXJA 1C0PA 1YH3A 4PLHA 4Q3BA 2EG9A 3K5PA 1J6UA 4E31A 3MWDB 2VYVA 4RL6A 4J1QA 3MJVA 4LCJA 3DHEA 3PJFA 3BMCA 4WEOA 1BXZA 1E6UA 4DWVA 4CMHA 3BMCB 1N9GA 2C20A 5JFOA 1BXKA 4BMVA 3H9JA 4AJ4A 3ZWCA 2D1YA 4ALJA 1O9BA 1N5DA 3O9ZA 4J2HA 5CP8A 3K31A 4II3A 5AYVA 3BHMA 4RVDA 2DTXA 1MP0A 5JDIC 1LLUA 1ID1A 5BSFA 3GDOA 3ADOA 3JQFC 4WCFB 1T1SA 4PG7A 5DZSA 2I3AA 1HSOA 1LLDA 2DPHA 4IZHA 4TRJA 2HJSA 3JD0A 3KEQA 4ITUA 1A9YA 4JBIA 2RHRA 1ISIA 4L9RA 2J5QA 2ZK7A 5CDTA 1E3EA 3PQFA 4Y6SA 3ZN2A 3RJ5A 3C3XA 4XR4A 2AQIA 4XGNA 4BNMA 3PDJA 4J3FA 3SBOA 4R9SA 1IULA 3UHAA 5EESA 3B1JA 3CPSA 3QVXA 3DBRB 5CPFA 1PL8A 1NR1A 3FNHA 3WBFA 3IKVA 1PR3A 5KVSA 3NT4A 3U4IA 3LLVA 5A3JA 3U09A 1WZIA 1C0LA 3Q3CA 2LDXA 3GNTA 4XGIA 1IZ9A 2GR9A 2B4RO 5U9CA 3WGZA 4UVDA 4FB5A 1U9JA 3W4KA 3TRIA 1DJNA 5JPIA 1UZMA 4BV9A 3NUGA 3GC6A 4RVGA 4YJGA 1F17A 3ST7A 5H82A 3QP9A 3HN7A 3TJRA 4LVUA 4B4WA 1EDOA 1W8DA 3L07A 4FDAA 1BXGB 1IY8A 2WSBA 4M54A 3V2HA 5A5FA 1M2WA 1WXDA 3JSAA 5ENDA 5CG2A 3AUAA 3NJ8A 4HADA 3D1LA 4ROSA 2B5WA 1C1XA 5AXCA 5JNLA 3AUTA 4Q9NA 1GQYA 5A9SA 1G0OA 1NPTO 3HNPA 1CJCA 1SPXA 4IJKA 4L73A 1DFHA 2EWMA 1H2HA 4YJDA 2WTBA 1NTOA 1WP4A 3GN2A 4A73A 2O3UA 4AG3A 3DMYA 4A26A 1GZ4A 3OQBA 1CWUA 3GK3A 1Z6ZA 1GYRA 4ZD6A 4IDBA 5FFFA 5TC4A 1ULSA 3FBGA 2AMFA 3ONDA 4CR6A 1X1TA 4E2XA 2G17A 4YRAA 4NBVA 1HE3A 1NHWA 1UP7A 3PHGA 3PGJA 3QHAA 3ZNPA 2ZTUA 3PWZA 4UVGA 5L4NA 5F3RA 1PR9A 3A28A 5H83A 2DAPA 3KOUA 1XCBA 1DC3A 1D1TA 1LDGA 1Q7GA 4O1MA 3NX4A 3PJDA 1ZMTA 4PG6A 5THKA 4UAGA 2A4KA 1NYTA 4GWKA 3H7AA 4B3HA 3CH6A 4JNKA 4MVJG 2FR1A 3SXPA 5KNLA 1BSVA 3FBTA 1ISGA 2H5LA 3AOEA 1YONA 2UUPA 3CSDA 3JQ8B 4LRSB 4BO5A 1HRDA 4YQYA 4XRRA 2PZJA 4ZQGA 3NYWA 1ONOA 3WGGA 1TT5B 4W7IA 4AJEA 4FFNA 2VTEA 3K73O 3PFWO 3ZWMA 5DBIA 5ADHA 5F1OA 1KS9A 5T5QA 3VH3A 4NI5A 4UUNA 4UUOA 2H1SA 2D5CA 3TZ6A 3UGKA 2ZB4A 4RO0A 2ZTVA 3ROPA 4D45A 3WWYA 3NJ4A 3WLFA 1GUFA 1X7DA 4F46A 2OFPA 2QRKA 3DOJA 1H5QA 5CEFA 3OA0A 3PI7A 1LSJA 3RC1A 4RPHA 1T2DA 3W1VA 2X58A 2BFAA 5BR7A 5T6BA 3E9MA 4FC7A 4MVJE 2C59A 1GV0A 1GZ3A 2WM3A 1R66A 2G1UA 3T7EA 5KVCA 2JKVA 3I6IA 3ZWYA 2ET6A 3OICA 3TFOA 3KYBA 2OP1A 2HK8A 4LRTB 3Q1LA 4BNUA 1S6YA 3AUSA 4QTZA 4F6CA 4RVUA 2WYWA 3NAQA 5TRTA 3F4BA 3UF0A 3BZUA 3ZDFA 1EFKA 4M87A 2FP4A 2PD4A 4CUJA 5KJFA 3ZU3A 1IYZA 5L3ZA 3L6EA 1ADBA 1E92A 2FPPA 4ESOA 1YQXA 1WDKA 4A5OA 3ICPA 4U0KA 1YVEI 5FWNA 4MP3A 1TXGA 1H2BA 4R69A 1I24A 3FR7A 4FFMA 4IIVA 4CM9D 4GWGA 5I9NA 2W4QA 1Q2XA 1RM0A 3JYLA 3WNQA 4FFOA 2QHXA 5A9TA 1DIHA 4LK3A 3VVCA 1P31A 2OZPA 4IS3A 2WD7B 1NQTA 2E49A 1HE5A 1LSUA 4L74A 3TF5A 3V5NA 3JQ9C 4RDIA 1EFLA 1NBOA 3AJRA 1M6HA 4LSWA 1ADGA 4R5HA 1PS8A 5EQDA 4Y9DA 3PK0A 1XU9A 1JW9B 2WE8A 3ULKA 2WDZA 3LYLA 4NNJA 4I9NA 4P22A 3WGYA 5BQFA 3NEPX 4ZU3A 4LMRA 2W2LA 4I1IA 3RC2A 4W82A 3P2YA 4IMRA 3WR5A 1ISHA 4TQGA 1UZLA 4WKGA 5CHEA 1DHTA 4B4VA 4D3DA 1EUZA 3GG2A 1B14A 2JD1A 4IMPA 2GERA 2OHXA 4ZQFA 9LDTA 1ONNA 1XGKA 3QVSA 4DMLA 4EW6A 1B8PA 8LDHA 1NASA 4Z0PA 3FNGA 3UICA 1ZH8A 2NWQA 2PFGA 4EJ0A 5T8KA 1KVQA 2D3TA 3S2FA 5TQVA 1T26A 5C7IO 3GUYA 4GVXA 1X15A 3GF4A 4XJTA 5T57A 3GFBA 3JTMA 3RU7A 3OEYA 4AJ2A 4XB1A 3DMTA 4CM3A 4YPOA 1QR6A 2VNAA 1Z45A 4H15A 4O0LA 3HDYA 3GGOA 3WSWA 1U4OA 2P9GA 4FOOA 3KEOA 3NDIA 4E32A 3WGIA 3RAJA 4J4HA 2ZATA 2ZQZA 2HMSA 3IP1A 4YJHA 4MP8A 3HDQA 2DT5A 4HXYA 4XDZA 3AOGA 2AA3A 4EUEA 4EJ6A 3VTZA 3GHYA 4GLOA 2FSSA 1SBYA 2PA3A 3O26A 3DBLB 2NACA 2YW9A 4DL9A 4CMAA 2DTDA 2GN6A 3UKOA 2P9CA 3BAZA 4UREA 2X8LA 1OZAA 2EKPA 4N5LA 1YJ8A 4Y67A 2Y0DA 4DBZA 4QFCA 1GADO 1XG5A 3ANNA 3JQ7A 2C5EA 4N54A 1PEDA 3NDRA 5T8KC 1LDYA 4YR9A 2NSDA 2DQ4A 2EGHA 3CKYA 3ONEA 2RHCA 4K1LA 1SNYA 2Y1DA 2C2XA 1VE9A 3QV1A 2C29D 2PH5A 2QRLA 1MA0A 3SJUA 1LDBA 4TWRA 4YQZA 4JJFA 4DPLA 1PGJA 1Z73A 3G1UA 1PJ2A 4UVIA 2QX7A 3FN4A 4PRLA 2EXXA 1IZ0A 1W4ZA 2P4QA 2VYND 1KVTA 3WNVA 3U9LA 3PQDA 3E9NA 3NV9A 4MKRA 5K6AA 1KVRA 2IEDA 4XA8A 1JN0A 2H9IA 4E3ZA 4KWIA 3DBHA 2C5AA 3UOGA 4B79A 1ADFA 4O6VA 3OJ0A 4RF3A 1ENYA 4IQ0A 4XKJA 5JY6A 1QKIA 4CLOB 1K6IA 1ZSNA 2DVMA 2ZYDA 5F1PA 1HE4A 5JYEA 4BB5A 1Y9EA 1AE1A 1C0IA 3F5QA 4CMBA 1I2CA 2VT2A 5BSEA 4E2WA 1ZJZA 2PZLA 3GGPA 4NR0A 4OKNA 2B69A 1ZW1A 1DIRA 4K6CA 3W6UA 1AHHA 2QZ9A 2X5OA 2CZCA 4YAEA 4IDGA 4W6ZA 2JCVA 1M75A 3JQDA 4CMCA 3U0BA 3TWOA 1E7YA 2VHYA 4R16A 1VL6A 3PIDA 3V1TC 3RBZA 4WCDA 2Q45A 4FQ8A 3AUUA 2VZ0A 3IDSA 4LVCA 1EVIA 4JLWA 3P19A 3TDKA 1ZJYA 4A03A 2V6BA 1QLHA 1J4AA 4IJUA 4BVAA 2NU8A 3D5TA 1NVTA 4CLXA 3OIDA 2NQ8A 4Q3AA 1UDBA 3Q0EA 1KBZA 4DBVO 2BGKA 3QE3A 1R16A 3C7AA 5I7FA 2O2YA 4PIVA 1UXGA 5H81A 3GVPA 4MIEA 3D5QA 4DA9A 2GLXA 4RGBA 2PR2A 5TT1A 2HO5A 3UAGA 2GRAA 2HCTA 2I76A 5K9ZA 2P2SA 2OUIA 4CR8A 3DEYX 3ZCXA 3GDGA 4CMJA 1YOVA 1XYGA 2CNBA 3JQAA 4UULA 3QY9A 2PD6A 4WLVA 1YDEA 3INRA 3NGXA 1DRUA 3ZU4A 1JKFA 3AU9A 2VNSA 1P77A 4OXNA 1OC2A 4E21A 5KTKA 2DFVA 3UFXA 4IBOA 4E33A 1LNQA 3I6QA 4Z9FA 4R41A 1PQUA 1SC6A 4YJFB 5DN9A 2EKLA 1MGOA 4TMFA 1JWBB 2PV7A 4FN4A 1MX3A 3HDJA 1ZZEA 2FN7A 1I8TA 2CY0A 4PLVA 3EW7A 4GSKA 3H3JA 4HBGA 3K9QO 4AVYA 1GPDG 1JQBA 1P45A 1DO8A 3B20A 1IHXA 5TS3A 1YRLA 1V9LA 2V6MA 3KSZO 4J7XA 2JD0A 1FXSA 2YV1A 3VVBA 1NWCA 1ZSYA 2XOXA 3CINA 2IZZA 2WWRA 4QECA 4NIMA 4A0SA 2NU9A 3VPXA 3WOHA 5L9AA 4JXKA 1DOHA 4MINA 1NM5A 3Q2IA 4FJ0A 1ZBQA 4WASA 1I3MA 4ZHSA 1P0CA 3JD1A 1UP6A 1BHSA 2IDZA 1JDJA 4DPMA 1KEPA 3F46A 4QO8A 3ZU5A 2Z1MA 4K9DA 1OAAA 3L4BC 4UEJA 3FR8A 4DLBA 4INAA 1HLPA 4LSMA 1YL6A 2DM6A 3MEQA 3BTUA 3JQBA 3D4PA 3W4JA 4ZN6A 5C5IA 1MG5A 4G81A 3BMQA 1XIVA 4PLZA 4EDFA 1SB9A 4RZHA 3WTCA 1GYQA 4GI2A 2JAHA 3OP4A 4NQZA 2YQ5A 2BMAA 3UCFA 3DDNA 1DLJA 4DRYA 1P1IA 2HAEA 4TZKA 3JD3A 2GO1A 2P5UA 3P5SA 3RC7A 5IFLA 3PLNA 3DAPA 2CDCA 4KP7A 5JC1A 4R01A 2GN4A 1UH5A 3GNQA 2PKQP 5HS4A 1KC3A 2R00A 3BIOA 4CQMB 1Y8RA 1HSZA 2BKAA 4XYGA 5J23A 5IDQA 3F1LA 1XELA 3W8EA 2LDBA 5B4UA 4H16A 4J90A 1DRVA 4XZ3A 3AY7A 2Q2QA 2EGGA 1LRLA 3IOYA 2V6GA 4PZDA 1E3WA 4E5PA 3ZHYA 4CM5A 1GR0A 3TL2A 2FR0A 2Q2WA 3JQBC 3GZ4A 4TSKA 4WOJA 4BO6A 4NBUA 1VL0A 3CZRA 4J9VA 4S3MA 4YBZA 2DBZA 2YJZA 2ZB3A 2CSUA 3EY4A 3T4XA 1PJLA 2HDHA 1HXHA 1QV6A 1O89A 2W2KB 4FCCA 4XR9A 1LRJA 4BO9A 2RBEA 2O48X 2PNFA 3EDMA 4YAGA 4RF4A 5TSDA 5JAIA 3WWZA 3HADA 2B4QA 2AQHA 4J1SA 5COAA 1E5LA 1E0DA 1ORRA 2DU8A 3RUCA 4BNGA 1TEHA 4KUEA 1K6XA 5DCWA 4CL8A 4NZ9A 4F45A 1ENZA 3WICA 4QXMA 2HU2A 3HWRA 2PD3A 4OMUA 1ZNQO 1D3AA 3NDJA 4DIOA 3DFUA 4CMIA 2BH9A 1YB4A 4EJMA 4LCEA 1KVSA 4EUHA 5JDIA 2NM0A 4P4NA 3C1OA 3OQ1A 3JYOA 5DCYA 5C7LO 3ANLA 1NPDA 3CIFA 4E5YA 2B4TO 2ZYGA 4RPLA 1ZXBA 4JQCA 4YDRA 3GA0A 1I2BA 3EVTA 3GZNB 2Y68A 4D42A 2YUTA 3UH1A 4D46A 4RV9A 2A35A 3WSVA 2OBNA 3AY6A 3VKVA 2PZMA 1B26A 4CLRA 3AU8A 2GZ2A 4ND5A 4CM4A 4R1SA 3HQ4O 4XIYA 4CM4B 1MXFA 4B4OA 2I3GA 4OXYA 3PIIA 1MC5A 4MO2A 2AQ8A 5IZ4A 1JA9A 4MKZA 3I9MA 5L7WA 5TJHA 1JVBA 1KYQA 3HFGA 2I5PO 1P1RA 4PLYA 1N9GB 1Z75A 1Y1PA 5ITWA 4XWYA 4U7WA 3C7CB 5KCZA 3PJGA 1GQ2A 3DZIA 2VRBA 3IIEA 5EL0A 1PJQA 5LCXA 4F3YA 2VWGA 1EMDA 5JS6A 3UW3A 2VTDA 2OORA 2EIHA 3I52A 3ZV4A 2YQ4A 2R6JA 3QLJA 5DF1A 1RJWA 4E0BA 1PGNA 1LLCA 4OHUA 3H4VA 3KO8A 4J7UA 3VOSA 4RZIA 4HUJA 4C4OA 2GDZA 4E6PA 3JQGA 1JLLA 1LU9A 4TZTA 3F6YA 4PLWA 3X2FA 5G0UA 3DZFA 3W6ZA 1UDAA 3W8FA 5A03A 2VRCA 4FSHA 4RPGA 2UYYA 1YBAA 1P74A 3AI1A 3GQVA 5IXSA 2X5JO 3GN1A 3TQHA 1RM4A 4U5QA 4OM8A 5AXAA 2Q50A 1GAEO 3E03A 4Y8VA 1BGVA 3AFNA 3FPLA 3BTVA 1RWBA 4FFPA 2UAGA 4E4YA 4R1NA 3K2EA 3RU9A 5KKCA 1GCUA 4MVJH 3TNLA 2D0IA 3I1JA 4YTEA 3RKRA 1TB4A 3GGGA 1UAYA 1R37A 2H63A 3GFGA 4ZQBA 1BG6A 1HZJA 4YJGB 4D0RA 4FR5A 4I9UA 3VPSA 1B7GO 1U2DA 2VOJA 3H6KA 5C3MA 2WYUA 2X22A 3SLKA 4L76A 1KOLA 1WMAA 3ITKA 3V2GA 4GX2A 2OO5A 4B8WA 1C1XB 4BNWA 3IJRA 3OJLA 1BRMA 1T2FA 3BHIA 5A9SB 1M67A 1ZK3A 2BFPA 1B15A 4I08A 3MJ4A 3KHUA 4WCFC 3C7DB 1PQWA 2GASA 4ZRNA 2YV3A 3CMCO 3QVWA 3EZLA 1C1DA 2PKRA 1YE3A 1HDYA 2ZTMA 4D0SA 1C1DB 1HYEA 2I99A 3TZHA 1JKJA 3QA9A 5FI5A 3WFJA 4WLEA 3VH1A 5CEEA 1E1KA 1NP3A 1BTOA 5GZ1A 2B37A 2ZB8A 1YBMA 2VOEA 3MJSA 1M66A 4I8XA 4OXKA 2EJWA 2VUSA 2HMWA 3KRTA 4ND2A 3KLMX 3GG9A 4CLDA 2Q4EA 2V6FA 2GPTA 1R0SA 3UCEA 1MLDA 4Q3DA 2W8ZA 1GPJA 3RD5A 4BNFA 1E3IA 3GDFA 5F21A 2SCUA 2PLAA 4KDFA 4ALNA 1Y5RA 2QG4A 3GLQA 3ROMA 1VLLA 2X0JA 4BNHA 2BGMA 4BIIA 3KTDA 6LDHA 3VZQA 5I8WA 1AXEA 5ILGA 2IZ0A 5EERA 4BHTA 2VN8A 1PX0A 1O0SA 4LGVA 5KIAA 1ZXLA 4TRMA 5G2OA 1KY4A 5IDWA 5EPOA 2IZ1A 5IDYA 2Y1EA 1X7HA 5G0VA 4XYMA 2AEMA 2O3JA 3TN7A 3FI9A 3S2GA 3ETEA 3ZHZA 5JBIA 3M6IA 3PZRA 4CMKA 5HWSA 4NBTA 3D0OA 3ZWBA 3ZV3A 1PL7A 1UXHA 1ZK0A 2AEFA 4CJXA 1DIBA 3RIHA 7MDHA 4M8SA 1HEUA 5JMWA 1CQIA 2JD2A 5TT0A 4CODB 5B4TA 3DC2A 1ZCJA 3RUIA 1D8AA 3VDQA 4XIJA 1H9AA 3IC5A 4H3VA 2I67A 1ZSVA 1CERA 1SB8A 1HDXA 3E5MA 2W90A 2UDPA 3PWKA 1Y8QA 3JQ9A 3PVZA 4BS9A 3DXFA 1T24A 3R0IA 5B37A 4HWKA 4KQWA 1R4NA 2AG8A 1SEPA 3FCOA 3IL2A 4KDEA 4GAEA 3L9WA 3JQ6A 4LN1A 3GEGA 1R4MA 3H5AA 3RFTA 3KYDA 1PS0A 3C85A 5CFZA 2Y1GA 4BKRA 2YV2A 3CEAA 3OM9A 2UVDA 5JO9A 2AEJA 4PZEA 3LT2A 4DTIA 4D3SA 1MFPA 1A4IA 1VL8A 3EC7A 3S1LA 1GU7A 3PYLA 4GLLA 1U3UA 1OFGA 1PJTA 3O03A 4ALKA 1Y9AA 2BELA 3MOIA 1HLDA 2X9GA 3FF4A 3GVIA 1HL3A 4N5MA 4DPKA 2C54A 2Y0EA 5CDYA 2YDYA 3WXBA 4PFJA 4CQMD 3HDHA 2O4CA 4Q39A 3FWNA 3INTA 1UZNA 1LTHR 3KB6A 4MIYA 1G0NA 1NNUA 1J5PA 5JCJA 3WX0A 3D3EA 2BGLA 4TRRA 3ZNOA 4PG5A 3W8DA 1NXQA 2X9NA 1KC1A 4N5NA 4HFRA 2AHRA 1LSOA 3NT2A 4NU6A 1GV1A 1PJBA 1UXIA 5FF9A 5IZCC 4C7JA 5ER6A 1ENPA 5DBGA 2Q1TA 3ICCA 2Q2VA 2Y0CA 4M89A 4Z0TA 3LLSA 3MTGA 4NK5A 5IG2A 1DIGA 5CDSA 5HBRA 1T2AA 1EK5A 5B12A 3HFSA 2ZIZA 3I9LA 4R68A 4FGWA 4HKTA 3E9QA 4A7PA 1ZK4A 3WYEA 2Q1SA 1TLTA 1EK6A 3VH2A 4DIBA 4E5NA 3WTBA 1I01A 1E1NA 3OJEA 4UEKA 3B1FA 1K3TA 2V7PA 1QP8A 3EYWA 3JV7A 4CV2A 1XHLA 4GKVA 4JP2A 4GGPA 2FY8A 5L40A 3G49A 5KKAA 1ZUD1 1IOLA 3G3EA 3GMDA 2BFMA 3GR6A 4PG4A 4DIFA 1U3WA 1T1RA 4D41A 2AE1A 5KJCA 3CMMA 3TZKA 2FMUA 5JSFA 2YFQA 4MVJA 1L7DA 1GZ6A 3GNSA 3LT0A 4PLGA 3PP8A 3ZWVA 3N58A 4J2OA 1PJCA 1QXSA 4IDAA 4DLLA 3S2EA 1Z7BA 3ABIA 4WPGA 3S55A 4WECA 1WW8A 2BF7A 3S8MA 4L8VA 4BNJA 1D1SA 1MUUA 3AI3A 4C7KA 1O94A 4W9NA 5TF4A 1C14A 4E5MA 5DULA 5L95A 4FOSA 4YJHB 4WE3A 4DUPA 4NK4A 1GDHA 3VDRA 1NAHA 2JHFA 1M76A 2NV6A 4NPCA 3RASA 2VYVD 3KYCA 3IQDB 2J3HA 4I5FA 5A5EA 4ALLA 1E1LA 4RPJA 4YRDA 4B7XA 5L45A 4XB2A 3DB2A 3Q11A 1I5RA 4JK3A 3IUSA 4JN6B 1NFQA 2X9VA 3H9QA 5ICSA 3JQ7B 4J16A 1L1FA 5JAZA 1PZHA 2D5AA 2Z95A 4ONEA 3LDHA 1SEVA 4XCVA 3ENKA 3KETA 1BMDA 2BHLA 1N2SA 3WGHA 1WDLA 2HMUA 4Z3DA 1ZK2A 1P0FA 4LW8A 2FZWA 4FJ1A 4W4TA 2VHWA 3V2UA 3GH3A 4ND4A 2GGSA 2V65A 3ONFA 4RVSA 1VRWA 3GY0A 4K28A 1K0UA 4E12A 5A4DA 3NT5A 2GNAA 4W9NC 4FFRA 3R3JA 4BKPA 2YHIA 1ZEJA 2YHUA 4AJ1A 1VJ0A 4ID9A 3UXYA 2OXIA 2YHIB 3MJTA 2Y1CA 3K6JA 2J8ZA 3DBHB 4HY3A 3A9WA 5JAMA 2JFHA 4BGEA 2EKQA 4OSOA 3TSCA 3M2TA 1B2LA 1LC3A 1XDWA 2GF2A 3WIEA 5B4VA 5A05A 4RCVA 2QZZA 1FDVA 3ETGA 2Z1NA 4YB8A 4P38A 1JAXA 2A92A 4YT2A 3A4VA 1RM5A 4WGGA 4M86A 4N18A 3QWHA 4B7CA 2QQ5A 2Y67A 1NFRA 2NVUA 3AW9A 1Q0LA 5DDIP 4CM7A 3MZ0A 2BI7A 1U3VA 2PZKA 4U0JA 4DQVA 5A06A 1XEAA 1X13A 1ZIDA 1MXHA 1DC6A 1CEQA 1LDEA 1E7SA 3HSKA 1I2ZA 1NQAO 1JWAB 1EVJA 1YGYA 5TNXA 4BO8A 4BUCA 1E1MA 2Q3EA 1ML3A 1N7GA 4ALIA 1UJMA 4O63O 3A14A 3I9JA 3JCZA 5GY7A 4HX5A 1P1HA 4BO1A 3DQPA 3O4RA 1BW9A 5T67A 1YL7A 1NQOA 1XU7A 1Z74A 1BW9B 2YDXA 1V35A 2ZTLA 4GX5A 4ND3A 1DSSG 1PSDA 3CUKA 4IPTA 4D7AA 2P91A 2UV8A 4RF5A 1TVEA 1KY5A 1E7MA 5IJZA 1HTBA 3GPDG 4NFYA 4PN3A 5C7OO 5JDCA 3PJEA 1D4FA 4XQEA 3ZZNA 5BNIA 1NR7A 2HUNA 2BLLA 4IS2A 3I9KA 2O7QA 1E5QA 1OI7A 4CM8A 2QW8A 3UUWA 1DAPA 4PVDA 1P33A 3U4HA 4ZVVA 3WYBA 3AWDA 4A27A 1QRRA 3PHIA 2OL4A 3JYQA 1GEGA 1YWGO 4OOEA 3OEWA 5EN4A 1U3TA 4Z6KA 3C1AA 3OA2A 3ANMA 1C0KA 2O7SA 1YOVB 4GKBA 4NBWA 3JQAB 1YXMA 2HQ1A 2NNLD 4EI2A 2OP0A 3OMLA 4R54A 5JXWA 3L4BA 4XGKA 3ZW9A 5C37A 2PWZA 2Y05A 3O8QA 3S2IA 3U5TA 4BGIA 5KJEA 1D7OA 2X7HA 3OFSA 1K6JA 4DQUA 3AK4A 3ZHXA 4BNIA 1T25A 4IGEA 5DCUA 1WVGA 1F8GA 4KTTE 4TKMA 2GZ3A 4WLNA 5IAAA 4GPD1 1E3JA 5JDCC 3P2OA 3KBOA 4BO4A 4URFA 3HB4X 3BMOA 1HF3A 3Q2KA 4PLFA 5JLAA 1SAYA 4KOAA 2IE0A 3R6DA 3RROA 3L4SO 4R1UA 1F12A 4YRBA 2J5RA 2PGDA 4O59O 4DC1A 4Y6RA 4UVHA 3PDUA 4IZIA 5G4KA 4E13A 5LC1A 1YBVA 3PYXA 3FPCA 2G5CA 1VSVA 2IEBA 3Q6IA 4CV3A 2G0TA 5EINA 3GUCA 1F14A 3GRPA 2C0CA 3TOZA 5I7SA 1V8BA 3QSGA 3DZGA 4ALMA 1N8KA 3AI2A 4CQLA 3BXXA 3PXXA 4Z9YA 1V0JA 2RAFA 3DZKA 3GAFA 1WPQA 3JD4A 5EJ2A 1O95A 3VKUA 4YEDA 2FPIA 4YA6A 5ES3A 2Q4BA 5I7VA 2W98A 4G5HA 2O3SA 1CRWG 4XYBA 1IB6A 2I66A 3BMQB 4OAQA 3TZCA 3D3WA 4D3FA 3MCVA 4FC6A 1B3BA 1UUFA 5L4SA 4YAJA 3QWIA 4PGFA 4HNHA 2JCXA 2Q1UA 1F06A 4J1TA 3E6AA 2J6IA 3RFVA 4B8ZA 2ZKLA 1MFZA 2FHSA 1JTVA 3K92A 3ITDA 2EV9A 2IXAA 4XD2A 1SZJG 3L6OO 4NJMA 4EITA 1LDNA 1UR5A 5HM8A 3DFZA 2YYYA 1Y8RB 4P8RA 1Y6JA 1NHGA 1U5CA 1YS4A 3R1IA 4Z3KA 1GUYA 1FDWA 1LBEA 1SCUA 2FRDA 1X0VA 4I5GA 5L51A 4DYDA 4BNVA 3DHYA 3WG9A 3ZHBA 1E3WB 2IODA 4CM9A 3ZGYA 2GN8A 1HYHA 5THQA 1EE2A 3PHJA 3GOHA 3LT1A 1W6UA 2X0RA 3R3SA 1A71A 4YYZA 3WJAA 2ZYAA 2VHVA 2DUWA 2FZEA 1VSUA 2W2LD 4CV1A 3L0DA 2DPGA 2DUUA 2O3RA 2PY6A 3CXRA 1LI4A 5U4QA 2Y99A 1V3VA 4KZPA 1Q1NA 1X0XA 3ASUA 1Q0QA 3E5RA 3GHHA 3RJ9A 5EIOA 1GCOA 2PGJA 4J4TA 4ZA2A 4BOYA 3RUDA 1YQGA 4TVBA 2Q46A 1PIWA 2HKIA 4R4JA 4HFJA 4B3JA 3GT0A 2OBYA 3B1KA 2GD1O 1AGNA 2X0NA 5CDUA 1SOWA 3D64A 1TI7A 4NG5A 4FPXA 4CMIB 1V6AA 3IP3A 3EHEA 1FJHA 1QORA 2EEZA 5COQA 1HE2A 3BMNA 3EMKA 3LT4A 2I9PA 2X4GA 4ND1A 1E6WA 1QYDA 9LDBA 3WB9A 5KOIA 4L75A 1SO8A 1WMBA 1WDMA 2J3JA 2P68A 1DPGA 4RQUA 2XXBA 3DZHA 4U6QA 1BDBA 1ZKMA 1EVZA 1RYDA 2FWMX 1MV8A 4CLRB 2O4UX 4PG8A 4JCOA 1PJ4A 1A27A 4R3WA 4PLCA 4BGUA 5KJ1A 1ISJA 1WZEA 2CDBA 1KETA 2ZJ0A 3GMSA 4MPDA 4MVJP 1RKXA 3U3XA 3L77A 3ZU2A 3WJ7A 4QX6A 4NFSA 5F1KA 3WGTA 1ULUA 1X7GA 3H8VA 3AY3A 3KUXA 5ENVA 4GGOA 1ISFA 2WD8A 3QW2A 4YAIA 4NFHA 4RLHA 3UVEA 5DBFA 3FTPA 3EAGA 5LDGA 1WLYA 3ZI0A 1W73A 2ZQYA 3H65A 3LF1A 1BDMA 3H5RA 2EP5A 1HDGO
chains in the Genus database with same CATH superfamily
1D1PA 5HFJA 1DDOA 2H57A 2JH8A 3PQ6A 4XX0A 4YFYA 3CXUA 3V8MA 4EZIA 4Y6GB 1C4KA 1SXPA 4LC9A 1GQRA 2ERYA 4RX1A 3OU7A 1P1FA 3C8MA 1Y89A 4KMOA 3DWFA 1OYVA 2PQMA 3D6NB 5BQ3A 3FKSD 3JQGB 2Q6IA 4PRKA 4BQNA 1J99A 4BJ1A 4F8YA 5JPDA 1T10A 4HB4A 3BORA 5DGDA 1WNTA 2VWHA 3H5TA 1OC4A 1US8B 1YK1A 3QM1A 4PHHA 1NVWQ 4WCFA 1Y3IA 4A2PA 4F11A 4JSRA 4CF4A 1J2UA 2JL1A 2VUUA 4UTZA 3E8SA 1J90A 2BEVB 2NQTA 4IIBA 5BSGA 2ZYWX 3FWPA 4A0FA 5JCPA 4ZCQA 3BA1A 3DZBA 5HA5A 2QVZX 1YQQA 1FFWA 2Z2IA 4AICA 2WAYA 1S4QA 3K30A 2IU0A 4D2IA 4XYEA 3F5SA 1YI0A 2JIRA 3IBFA 4NYJQ 3ZNNA 2HT1A 2WINI 3C3JA 1U98A 4UXIA 1GM5A 1BN7A 3QUTA 1O6ZA 3X1JA 2TECE 4CF7A 4QSMA 1Y3DE 3UMYA 1TJ4A 2MYPA 1DT3A 4ER0A 1UINA 2QQ0A 4BDSA 2CK3D 1DEHA 4U7FA 4LJSA 4QPJC 5E1BA 3SSAA 2QOEA 5H0IA 4F4IA 4L0QA 4ZAFA 5GVSA 2IELA 2GFHA 4UHHA 3V8BA 3TO5A 5JVDA 1YS6A 3MWKA 4IJWA 4WVFA 4Y2QA 3OZEA 3RYIA 3S44A 2TMYA 5K3AA 5DMHA 2MWMA 3QJ5A 3DKVA 4BO3A 4PCVA 5HGXA 3W5CA 3SDSA 3AHEA 4FLFA 3HXTA 2YWXA 4C01A 4CVNA 1VIDA 2HQOA 3KSUA 5JH7A 2X4DA 3ORFA 1PFKA 4EB3A 5A1TA 3ZDRA 5JS7A 2G3YA 3ROTA 3DCNA 2GZRA 3PENA 4NL4H 5JE8A 2P75A 4GQAA 1KL7A 1VI2A 4I7EA 1JH8A 2WJHA 1K5HA 3OHSX 1X2EA 1HFWA 2NPIA 3H9GA 4XQ9A 2UZ1A 5EJEA 1VE6A 2H48A 3EZGA 4RLSA 3PVSA 4ARSA 2QIOA 1YI1A 3H2SA 3QWFA 1EM6A 1JDNA 1EHCA 1ONBA 4MLDA 3LYUA 1BU8A 4JR1A 1H2XA 2V7UA 4OJYA 4AIIA 3L0OA 5D7NA 4DHWA 4BNXA 5CAEA 5ARCA 2JBAB 2VHEA 1FDTA 1ACLA 1GQQA 1X7ZB 1ZOOA 4YCDA 2COKA 4ZKEA 3IKJA 4DV1B 3AF5A 1P44A 4MCIA 4AP5A 5ILOA 5AVJA 2ZAOA 1E9BA 1T8WA 1N3IA 1KI6B 3EGDA 3NGLA 4HATA 1T34A 4MQMA 3ROXA 3WA7A 2CFCA 2DQSA 3FCEA 2B94A 3FVWA 2NPFA 2JAPA 2OGUA 3HCPA 2ZB7A 3QQPA 3DEKA 4QVIA 4FFLA 2DUJA 1WR8A 2XE8A 2Q9UA 2GD0A 2SCUB 3GT7A 1X77A 3X2EA 2P9EA 3CLRD 1XZLA 4OBEA 2E2WA 3U1VA 2GEVA 2YS7A 1H6BA 1VG8A 5BXYA 4CKWA 3FPJA 1ZM9A 1J33A 1EVEA 1IPFA 2I3DA 3C6KA 3DAOA 3OUTA 3HU5A 3BH6A 2HRZA 2ZFUA 1VFNA 4X7MA 2UYCA 1G1AA 2WWTA 5LNK6 2WU8A 3G7SA 3UKJA 2G25A 3IUBA 5BQXA 5L4LA 4FDMA 2QGZA 5CDFE 1CLEA 2Y66A 2EW2A 1JB9A 4HMPA 2AN3A 1AV6A 3OMXA 4GVLA 3CVOA 4QBHA 2O1XA 1O8CA 1SD5A 1LUAA 1UWCA 3E82A 4U1RA 2HBRA 4QYIB 5WRFA 4D44A 4AKIA 4TTIA 1OI3A 1QSGA 1WA5A 2IYVA 2RK6A 3FPAA 2PMEA 3V3KA 3PGLA 3VHXB 1DRWA 2F59A 2Y1XA 3SPXA 3KUDA 2CBXA 3JQ8A 4IHAA 4NJEB 3VH4A 4NV1A 3DT6A 3E58A 1IPEA 3FD8A 3PDWA 4BNKA 4QO7A 3UPTA 3N2GA 1WMFA 2IYAA 2WTXA 4LISA 4DABA 2XYQA 1XZQA 4RK6A 2UZ0A 3L9XA 4N76A 3CLKA 3PNOA 1E9FA 3V1UA 3NHYA 5F7XA 2OXTA 2KYRA 5I9BA 4UBKA 4FFSA 2VLBA 3ZLJA 2C4NA 4NS1A 3O4JA 1RPJA 3C7TA 4MYTA 3OQ6A 1Z3CA 4IOJA 2QUZA 4I4CA 4V0ME 1YGPA 1ONPA 1J0XO 1WMDA 2PKQO 4M3NA 1TRKA 4X44A 5DU2A 5SZHB 3VC3A 3KT8A 2WYOA 3GAZA 3RARA 3PL5A 2ZBQA 2EDAA 1LQTA 2F8MA 3D31A 4B2IA 5EQJB 2O57A 1QPBA 2C8JA 4OFXA 4TZ6A 4JI6B 4P84A 4R9NA 5MGNA 2O20A 2HU5A 2I2AA 2CCGA 2O3QA 3C48A 3FRIA 3I9NA 5EGSA 4KVAA 1H2EA 4PVCA 4DDTA 2Q3JA 1NF2A 2QYSA 4IVPA 1EH5A 4XDYA 5A4IS 5DNEA 2JAWA 3DO5A 4NARA 5H4HA 4IKPA 1E5XA 3AQ4A 2HRBA 1TFRA 4F93B 1CJVC 2A0KA 4TT8A 1DOZA 3LWBA 4R5MA 4TWAA 3P0IA 5DI9A 5DP1A 3S70A 4DDWA 2FFHA 3RH0A 5CA0F 3QFTA 3IS3A 1UCFA 2YV5A 1FUYB 1N6HA 1NMZA 4RFLA 4YRJA 4ZVRA 4ARZB 2ZE7A 3MBOA 4QOSA 1OWPA 1WXHA 1C1YA 2FZLA 3G0IA 2CHQA 4NU5A 5SY6A 2W00A 2HJVA 3WZ2A 3KVOA 3QX3A 1ODCA 2RMKA 4RJ2A 2FJ0A 4ZU6X 2AC7A 2QVLA 3H2ZA 1F3LA 4P5EA 5FFNA 1ZXXA 2XNKA 2DB3A 2AG5A 3HRHA 2ZZKA 1NATA 2C04A 3H1FA 5K45A 3NJRA 2CUKA 2PZBA 2MHCA 1OU4A 4FS3A 4OUKX 1JQDA 2BEJA 2HD4A 4TKVB 3IAM6 2AVDA 4OYHA 2FOXA 2GEDA 5REQB 4ERXA 4OHOA 1Z83A 5AXDA 1W76A 4KDCA 5A2QA 4H7IA 1XQXA 3GVCA 3GGDA 4HYTA 1VKOA 5TIIA 1W0JD 1Y4UA 1XLUA 2JLSA 5AIAA 4QT4A 3RUAA 1XZHA 1Q22A 1PWZA 3ISJA 1T4BA 3OF3A 4M8NE 4ETWA 1FS6A 2CJYA 2B36A 3P9ZA 5FA6A 3ECSA 4KN8A 4F2GA 3A9TA 4PYQA 3ZBPA 4JWTA 4JZKA 2QTLA 4RQBA 4OQEA 5SZIA 1C7JA 3HA3A 5FUVA 3DDZX 2V6JA 4ZJYA 4CIVA 4QDUA 2IHNA 4K8OA 1T9ZA 3KIPA 3HJAA 4TWIA 3COVA 1H6DA 4KFUA 1B16A 1XZNA 2R79A 3NC1C 4NG4A 3OT5A 1A7KA 1P5FA 1R8QA 2Q3DA 3DMGA 1FUUA 4RA9A 3WMRA 821PA 4NC9A 4MVWA 1EGMB 1GPAA 2WJJA 3G2PA 1R2QA 4PSAA 5HIIA 2VQ6A 3LWZA 4DV4B 2ID8A 4G1UC 2QPOA 3PRJA 4XVUA 1WX1A 2HSZA 2P9HA 3INYA 5ITZB 5AKLA 3ELBA 1C8LA 1DNPA 1NLZA 5DYNA 2OKGA 1X1QA 1U4SA 4C4PA 2ZR0A 4DSAA 3A1CA 2AWNA 1XF1A 2JFXA 1A4UA 1GTMA 3L5KA 3M3HA 2HJHA 2QVXX 3MFYA 3NIDB 4RWEA 3RUHA 1E6KA 3IE0A 4B0OA 1KP2A 5HYVA 5LDHA 1PR6A 4KQ1A 3QX7A 1DJMA 2IC5A 4QEDA 4A10A 5CIQA 5KC8A 1MB4A 1S8NA 3MIIA 3OETA 4TROA 1CVIA 5HF5A 2PN1A 2W8BA 3FTEA 3OIWA 4CEIA 2GTIA 3DAYA 1PT9A 1AZSC 4GMGA 4BQQA 3CKKA 2C3OA 5BSVA 2YNMA 2XMQA 5DN6A 1UBCA 3CY6A 3DVLA 5COBA 4ZAGA 3QMVA 4MTLA 3RIEA 1N36B 4REQA 4KSCA 2XVZA 5J1TB 4IHJB 1SU8A 3N28A 4B48A 4Z4EA 2B82A 4EEXA 3LWNA 4DV7B 5KBYA 4TOIA 4AJOA 1F7UA 1EVYA 2IHKA 3CRZA 4G2NA 5AKIA 5JXIA 3T1HB 2JJYA 1PJ3A 2BF4A 2FZ5A 1VRVA 3FSRA 2JC3A 4FW9A 1UWKA 3E5HA 2ZCJA 5AK0A 4Y6LA 3E1SA 5AW2A 1WHTA 2NVWA 3AUFA 4K6HA 4JFRA 2H4YA 1A72A 1VTKA 4PX3A 4B84A 1IBRA 2H16A 4MRMA 5E9QA 2WIFA 1EJBA 1U8FO 2BT4A 3LKBA 4PLTA 3RQSA 4GPBA 2JGRA 3QXHA 1UJ2A 5ANRB 4QUDA 2PDAA 3R5TA 5F2EA 3T3PB 3OF2A 2VBIA 3WOVA 4BP8A 4ZFNA 1AB5A 2WF5A 5T4HA 3IUEA 3B9PA 2QYTA 3ILYA 4RF2A 1D5CA 4XD7A 2Y3IA 5E0OA 1Q74A 4JYZA 4A2WA 3GYBA 3ZWAA 1I1OA 4OQZA 4UVEA 1K97A 2DFKB 4ZDWA 5ECDA 1IBMB 1BDJA 1RC0A 1M2OB 3AERB 4HEA1 4MJ3A 3EOAI 3G1TA 3EA4A 3OZVA 1YB7A 2Q49A 3D4NA 1JU3A 3FCCA 1QH9A 4JI3B 3BJIC 5AJHA 4DWWA 1JQ5A 3G88A 1E6MA 1AN9A 2R2GA 4WDQA 5KYWB 1CZLA 5AP9A 3TUZC 3MBIA 1ADCA 3NOVA 1SXJA 5JU6A 3IALA 3UOWA 3DEIA 1I36A 2P4SA 2A94A 2X9QA 1GT91 2HJWA 1Y3BE 3ENNA 5EMJA 4OIMA 4AJJA 3HXLA 3DVSX 2JEZA 3K0EA 2YJ4A 2LIVA 3MQ4A 3VNBA 5CVUA 2CHGA 1GGMA 4BASA 4EQ6B 1JPJA 1G18A 1ZS9A 1HDRA 1MRZA 1AHIA 3TJZA 2Q5HA 1OOEA 4HUQA 2EJVA 3LKZA 3NWPA 4KQXA 3WMWA 4LMPA 2PEZA 1XPOA 1SIBE 4BMSA 1LQUA 2W2XA 5DT9A 4MJXA 1NGSA 3GEMA 1NVGA 5ISMA 3ESZA 3ZV6A 4AMVA 2Q28A 1Z08A 1RMQA 5HG0A 3GUZA 3KQMA 1UDXA 2Q0HA 5E2IA 4MVJI 4X00A 3HL4A 1DG1G 4AJLA 4DM3A 3ZWPA 5JJBA 2YY6A 4WZBA 4K9PA 1RJFA 4QUEA 3UXEA 1YKSA 3BFXA 1KOJA 2YWDA 4JU8A 3SM9A 3H17A 3ANTA 4ND7A 1HTWA 2WJAA 3MWEB 3E61A 3W2TA 3M4YA 4IGFA 4MV4A 3OOJA 4URWR 3VR6A 1E3MA 2ZUEA 1TM2A 3BIXA 1EGVB 4P4SB 2VYCA 4TTVA 2EX1A 1K8QA 4OGFA 1VHLA 1M0SA 4I55F 1MDFA 1Q1QA 4FVTA 1U9ZA 2ILTA 4MW9A 4EEZA 6NULA 3EGWA 3J7AC 2M32A 1PWYE 4J0FA 3KPJA 1SVOA 1XVUA 2M9MA 3CLUC 3DTYA 4X60A 4IDCA 5EIWA 1JYSA 4MUGA 3LSYA 1YS7A 2O3TA 2QORA 2ZITA 4HNQA 4HN9A 3NP7A 1UJ5A 1KEVA 1GZUA 1W4RA 5D3QA 5C1PA 3T3GA 4DDMA 1A7UA 2WM2A 1NT4A 4PPYA 1MPTA 3MXOA 4JP3A 4PFSA 4TN5A 5JZBA 1CQJA 5A62A 4AJNA 3FNEA 5FUXA 1M6VB 4MH0R 5E8JA 1QYXA 4N40A 4LYFA 3JRNA 5FYDA 4B3CA 5ALIA 4A8JB 5I5GA 3A9SA 2HGZA 3FCSB 3KXDA 2A7QA 1KIAA 4EHNA 3GPIA 3H87A 2DFDA 3N39C 4ZOLA 1ZGGA 2I65A 1PR1A 3JARA 4DIUA 1IN6A 3A25A 2J3IA 3QNUA 3RUFA 2IS2A 4GFDA 3SYLA 4X65B 1U6IA 2BZ1A 4YP7A 1WPXA 1Z5UA 3FIJA 1R0KA 4DEXA 4G1FA 1DJQA 1CETA 4K9KA 3M4ZA 3WRWA 4YC7A 4DLZA 3H7IA 4JBHA 3BXHA 4PWYA 4UM7A 3C7KA 3RVDA 4AK9A 3KZKA 5JD4A 3RWBA 1XWIA 3LRXA 2BTOA 3L7LA 3HVUA 3JALB 2FPGA 4X20A 3ZTTA 4OSPA 1Q15A 2WSSA 5E1DA 2HN9A 1FA9A 2VH1A 5EIBD 3K6SA 5DM2A 4L15A 3RU3A 3I2GA 1HT3A 3VMFA 4XFJA 4JEUA 5AI4A 4NRDA 5LQDA 4ZO7A 1I4LD 3UMCA 2FKNA 3BMOB 3R0JA 3CVJA 3KLBA 1KXZA 1YB6A 3TTUA 5A1JA 4ABTA 1WB4A 1XCGB 2JFFA 3OE7A 1UBSB 4LDNA 2JAOA 3VTFA 4F21A 1SHLA 3A31A 4U00A 3PDCA 4ZARA 4MS4B 4MS1A 3HGQA 3ERCA 3FRJA 2Q7DA 5HQ3A 2XRYA 3OZFA 2XY4A 1RJGA 2X7JA 3OKFA 1T2NA 4HDRB 4IM7A 1XRMA 4BB6A 4L07A 4RKRA 1T9DA 3K8ZA 1E2PA 1M8GA 2X0EA 1N0IA 4BV8A 3FPSA 2BFOA 2YV4A 4BLPA 5H5JA 1DHRA 2C4VA 4CQLB 3G8DA 5C7YA 4TMVA 1KSGA 3SEQA 1L7MA 3HR7A 1JMYA 1CV2A 1EYZA 1M7BA 1Z3IX 3EXAA 3I9V1 5LD2C 1QGYA 3LZ6A 4R3UC 5JFTA 5C8ZA 1V3TA 2BL4A 3A4MA 1SUAA 5G1NA 1YCDA 1YJAA 3H5NA 4II2A 2QTCA 4ZEXA 3A4LA 1M8KA 1LLFA 1OV4A 2BDUA 3B48A 3GD5A 2XZTA 4C4YA 5EXSA 2BGGA 4RUKA 1Y1LA 1FK8A 4G4IA 3TKAA 4EWLA 4TMTA 3HWSA 2OY0A 4P86A 5A9RA 2P7IA 1IZYA 4EDFA 3PXGA 5E9JA 5B4VA 2VT3A 2OOSA 3KZMA 4DGQA 2Q99A 5DO9A 4DQXA 2CLSA 3V8NA 4QNRA 1SUCA 1ZGBA 3OZAA 1VSQA 1H6CA 4B83A 1PG2A 1XNQB 3KKNA 4HJXA 4OLAA 3JQRA 2WFAA 3DFFA 3A1FA 3KTAA 2KBFA 4JGBA 4YASA 3X1KA 4EVRA 2PTGA 2IS1A 2BKUA 1C30A 1XQYA 1N1EA 3L02A 1PWEA 1Y7TA 2HX1A 2QX4A 1YZGA 1ZLXA 2ZT8A 2NYVA 5AUQA 2D6FA 3W5AA 1PTJC 2DZDA 2BRUA 1SGWA 2A1TS 2H92A 4RYDA 2FSIA 3LL7A 1QNFA 5JCJD 2I6TA 1TA9A 5BSHA 2A3RA 4FGSA 4KVGA 1EFDN 4GP9A 4GPZA 1YZLA 1RJ9A 2REOA 3UK7A 1H94A 4P6VF 1BS1A 1XKXA 1H0RA 4QFDA 3T7RA 4DCGA 3I34X 4BNNA 1EFRD 2I4LA 1FYEA 3EXIB 1E59A 1BEUB 2C00A 2ZUCA 3P0RA 4O5OA 4P4GA 1CULC 5K03A 5BVGB 6ADHA 4HHEA 1B6TA 2KJQA 1Z6GA 1F5SA 4L0CA 1NW7A 4L4SA 3JQEA 4BLQA 2G5PA 4GX0A 1D2MA 2FN9A 1RYEA 3JYPA 3HXKA 1AKTA 2NUAA 2O50A 5FI0B 4DMUB 1IHYA 4KGDA 1GFIA 3ESDA 4XOUA 3ZGNA 1O5OA 3IMKA 5H80A 4QBTA 3EDRA 1GXSA 2NX2A 3VR4A 1B0AA 2DC1A 3P0HA 3A3NA 1YC5A 1YOBA 2P2YA 4X54A 5B1YA 4BFLA 3OECA 2QLTA 2ZSUA 3KHTA 3SE0A 3WNCA 5D5HA 1OPXA 1Q1AA 2XCRB 5EMHA 2Z6QA 4YWJA 4YXWA 1H5NA 1HLGA 3ETCA 4AP6A 4DJEC 3M33A 2G0AA 2CVQA 2H0QA 4MPRA 4PZYA 1ZL2A 2I29A 3K09A 4IH9A 1RPNA 4ZI7A 1CB7A 2QI9F 3ZH9B 1GEEA 3TTYA 2VJCA 1HDOA 2FSUA 1CJSA 2ADMA 4G0OA 2NLOA 5CW1A 3MTJA 5IS2A 1RKQA 4JLDA 3BT7A 5TX7A 1BQ4A 3GRVA 3R5FA 4IV0A 3TX6A 3CUWA 1F8UA 4AS3A 4H1HA 2EW8A 3NHZA 3DAFA 2BMDA 3PFGA 4RTPA 3UO8B 1CS0A 4L0DA 4B3IA 4EECA 3EDOA 1NKVA 2BTQB 2D2IA 2DBQA 4L5JA 4C14A 4CR7A 2AN5A 3NONA 3CRVA 1MRNA 3DDWA 3O8OA 2HMTA 1ZFNA 4P3OA 5GINE 1GRRA 3P7MA 4CE6A 1D6SA 1ESDA 1JHUA 1P3DA 1ORVA 1A5ZA 1JG3A 2DBYA 1U1IA 3CM0A 4WOBA 2AJLI 3AEUA 3N76A 1PDWA 5MGBA 1OBOA 4HEHA 3OJOA 5CGZA 4FE7A 4NULA 5DHPA 2VJAA 3PQEA 4B6QA 1K4MA 3AYXB 1XD2A 2Y1OA 2ZI4A 1QG6A 2WF7A 3HI6A 4H18A 4JUCA 3VYVA 5B58C 1GU0A 8ADHA 5H16A 4TVOA 3EEOA 3ZZTA 1XXHB 1GPH1 1YACA 2ASVA 2O6LA 1QFJA 1DXYA 3K9BA 4UE6A 5SV2A 1V9SA 4RFSB 5DOVA 3G59A 4NCJA 2H17A 3X1XA 5DM60 1Z63A 1E8DA 1PT5A 3RRXA 2FUEA 4TYNA 2J9GA 1MMFB 3HS3A 4FMPA 1QO9A 2OLEA 4IV8A 4XSGA 3UV6A 3KV1A 5IARA 3DHEA 3PIRA 4BYGA 4RK0A 1L7OA 2J0SA 4XX0B 1N9GA 4Q6WA 4E1BA 2D1YA 4Q7LA 3NALA 3WIUA 2ORVA 3PUYA 3TYXA 4S2EA 1UZUA 1HR0B 2C9MA 4RYLA 3V7UA 3KJZA 3BHMA 5LBUA 4N9WA 5JDIC 2JK1A 1Z5WA 5BSFA 1ZL0A 5HMLA 4DLYA 3AVPA 4WCFB 1T1SA 2AR9A 2I3AA 5JZMA 3X1YA 4D9EA 2ISCA 1DG3A 1O87A 3JD0A 3KEQA 2ZWAA 1A9YA 3ZDZB 1QG4A 1WD7A 1AUVA 3D6JA 4LDPA 3VU3A 2J5QA 1L7QA 3WC4A 1G55A 1M2GA 1TU4A 3E22A 3PQFA 4HI0E 4Y6SA 4B71A 1SKQA 3C3XA 3RJ5A 4Z49A 3GT4A 4BNMA 2X13A 4D8UA 3RTDA 2A8YA 4R9SA 1UIMA 1IULA 2FPMA 2WV7A 3SQMA 5EESA 3TRDA 1MJNA 1SC4A 1OYWA 3CPSA 4C0QC 1DKOA 4DCTA 3ME5A 3NHWA 1QIKA 1XTRA 2JI7A 5CPFA 3FNHA 1N6KA 4JENA 1VB3A 2C3MA 2PXHA 6PFKA 2V9PA 2EX4A 3DULA 1L4YA 1YVUA 4RE5A 1XRLA 1M8PA 5JVDB 3R6LA 3PEVA 3GNTA 5CH5A 3RYIB 4W5TA 1NUUA 1MB0A 1ULAA 3KVNA 4IEEA 2BJHA 4GM4A 4UVDA 1JHQA 1UEJA 4IDQA 4NKRA 4FB5A 1J8YF 2HBZA 4FFBA 3TRIA 3TVTA 1UZMA 3NIFB 4JBWA 4OATA 3EFEA 3NUGA 4BJ3A 2VI5A 4YJGA 1EK1A 3DS8A 3GJ8A 4YIHA 2ZRPA 1MPXA 1RYMA 4EY4A 1J8MF 3QP9A 1SFRA 3L2OB 4LVUA 5HKBA 3KOWA 1EDOA 1TD1A 1P2VA 2INGX 4QGSA 2IH2A 3D3KA 4YP1A 1VE5A 3LY8A 3F74A 5H59A 1A7JA 1AG9A 1M2WA 3N6VA 2WHRA 4FYYA 5HF8A 2UZ1B 3AUAA 3NJ8A 4LF7B 4HADA 1OWLA 1S89A 2PBZA 3OQJA 1ODTC 1F38A 3D1JA 5AXCA 5JNLA 5A9SA 1NPTO 2JAQA 2WF9A 3MFQA 3HA7A 4FI3F 5K8UA 4IJKA 4EJSA 5K8CA 5AHXA 4I3GA 5CAEB 3EVGA 1G291 3BXFA 4PIMA 3T35A 4YJDA 2WTBA 5CITA 9ABPA 4CCAA 1WP4A 4XB6B 2H2GA 3ZJUA 2GHQA 4O02B 2PSSA 1M1YA 3EGDB 3GK3A 2IDMA 4UNSA 1X8JA 2A59A 3FJOA 1YUNA 2J3EA 1PFWA 1YDMA 2G7MC 2H00A 5EQTA 4D80A 3FBGA 3QE2A 4RSRA 1JQJC 1JILA 1W96A 4E2XA 2JA1A 2PCLA 3AG6A 2BKVA 4IZ6A 4RHFA 4UZSA 3SJBA 2ZJ4A 1YRHA 1SU6A 4P7GA 3WY9A 7AT1A 3HP4A 5EJAA 1P3Y1 2ZZMA 2VP4A 1MEOA 2PL9A 3IQWA 3KKMA 3MTBA 3P27A 3PGJA 2ZTUA 5ERYA 5BORA 5CB4A 3W06A 1N8NA 1PR9A 1TC1A 1CVLA 2XR1A 3O82A 1YZFA 1U9IA 4IUDS 1RQXA 5CURA 4FDUA 5K0EA 5KHOC 2W43A 3KB1A 3NW9A 1DC3A 3QI2A 5FTWA 1R3DA 4O1MA 2CXNA 2AUTA 2J3LA 3QTBA 4P3NA 2OO5C 2REXB 5F78A 3PJDA 1WEHA 4UHFA 3Q8WA 5A7HA 2PRIA 2RHTA 3LK6A 2R65A 2FV8A 2MR5A 2PL3A 4GWKA 2EFHB 3H7AA 3GP3A 3HWWA 5FHQA 4B3HA 3JAMA 1BSVA 2QN8A 2IHVA 1ISGA 3C6BA 3CSDA 3ESRA 2XSZA 3JQ8B 4IO0A 4J2TA 4LRSB 5C1BA 1EHIA 1CR6A 1A98A 1VPEA 2GZDA 3N2GB 1IU9A 4I50A 4Z99A 2XRMA 3STYA 3KXKA 2AC2A 2DOKA 1PK8A 4FFNA 3NI2A 3PFWO 4Y2JA 1MX9A 3RHFA 1AU9A 2O19A 2QAGA 1K08A 2RGNA 1U8YA 4UUNA 1RIFA 3BE6A 4MK4A 4D9NA 2D5CA 2PGIA 1WD5A 5AM2A 1RQNA 5C18A 2ZB4A 1M7GA 2ZUTA 1ZD5A 1IY9A 3NJ4A 1H3FA 4EL5A 4BEVA 3GFSA 1DKMA 1LCIA 3MLAA 4F46A 2OFPA 4X1YA 2P69A 4R8SA 5ESXA 3TE7A 1H5QA 2Q07A 3RIXA 3BXGA 2A14A 1P5RA 3PNVA 1EFHA 3KSBC 3BCHA 1F2DA 3Q5EA 4IJMA 2RI0A 2FGJA 1H85A 1Y8ZA 1I9CA 2C59A 5HJ2A 1GV0A 4AX4A 1RLOA 2WM3A 3VVLA 4G85A 1Q84A 3ZOKA 3LDFA 1PK9A 3OICA 2QRQA 2RAUA 1VP3A 3M49A 1OBVA 3R0ZA 2DUMA 5LYJA 1V48A 5A7FA 4CL0A 4BNUA 1C7ZA 4DLTA 1R5NA 1L2TA 3TLKA 2HCJB 3IMEA 1K3FA 5C34B 3BZUA 2C31A 3IAFA 2P4EA 3UF0A 4Z4FA 4AW9A 1IYZA 2VDNB 5L3ZA 4ZJPA 4LV8B 3L6EA 4M1ZA 2Q5OA 5D7BA 1ADBA 3IUYA 3L93A 2FFAA 4KX5A 4AQ7A 1GGEA 1WDKA 3ICPA 1Q1GA 3KXIA 2ZT7A 1V41E 3CISA 1YVEI 5FA8A 5FWNA 2JI4A 3ZBTA 1T6YA 4KQ2A 1WSAA 2FX2A 4REMA 1H2BA 1J70A 2V59A 5KWIA 2GPNA 1E2JA 3NYIA 2IZ5A 4EY7A 4G36A 5B64A 1Q0TA 4CM9D 5JW6A 4BUZA 5IT5A 1RM0A 5IYZF 2P6NA 1E58A 3H86A 2GESA 2VP0A 1YJBA 2WILA 2P9YA 4JX9A 1G5QA 2QR5A 5ELXA 4FFOA 4OGLA 3T12A 2QHXA 221PA 2O7NA 1GGFA 2QYOA 4Z4HA 1NOJA 3X1MA 4IS3A 4U7GA 2XZLA 2MSEB 2B7CA 1EFVA 1HE5A 2MMGA 2BISA 4EO9A 3R9KA 3K1YA 5JCOA 1ADGA 2C7BA 3S6JA 4KCGA 1GRQA 2A9VA 3FYDA 3UMGA 1MKYA 4R40A 2P2NA 3W3AA 1JLHA 2WE8A 1JW9B 2P2CA 4KI7A 5CT8A 5DKFA 5JJKA 4QRIA 5H9VA 5D3ZA 1BFKA 1GSIA 3LYLA 4EW1A 4N7JA 3EWNA 4P22A 3WGYA 1Y1TA 5BQFA 3UGTA 3MTQA 4RA9B 2J85A 4YHHB 2WLSA 3D8HA 3PV0A 1C2YA 4IWYA 3RFCA 4CIXA 5B3LA 4J0DA 5TQJA 1TJ3A 3LP8A 3WR5A 1DQNA 3T9DA 3GIWA 4V0MA 1AURA 2ODQA 4U4AA 3BC1A 5DM1A 4HPXB 1ZA2A 5CHEA 1BJTA 1DHTA 5H7XA 2PUFA 1Y6RA 5FPYA 1B14A 2DF8A 4CEJA 3FUTA 3E9CA 3RS2A 1BJKA 9LDTA 1XGKA 1L4EA 4PYIA 4P4UA 8LDHA 1B8PA 1RI1A 3U9SA 5JUWA 3FNGA 5CD9A 2W8BB 5DB4A 4YCLA 1ORHA 1ZH8A 2QTVA 2NWQA 4LZNA 4R1LA 3RVKA 3S2FA 3QKTA 3GUYA 4O2BF 4GVXA 2FVXA 4PGMA 2I7XA 4RM3A 4O2RA 4REQB 4ESHA 2W6JA 4YIKA 3SFZA 2ENWA 1QHXA 3LBIA 3TTWA 1LI7A 1IBLB 5M04A 2FU5C 3R5XA 4UXJA 4WQMA 4CM3A 5ALHA 3PT5A 4KB5A 3Q3GE 4YCNA 1NMQA 4O0LA 1SR8A 3HDYA 3P9PA 3QPCA 4OH7A 4YLYA 3FM9A 5B30A 1GRCA 2PSHA 3LDGA 3P8ZA 3ZIAA 4WBXC 2E89A 4KNVA 1FSGA 1D4AA 2PXAA 3FYUA 4NS4A 2RG7A 5CXSA 2NTYC 1XD9A 3IP1A 1M3SA 1JX6A 1WHTB 3GIDA 4J4HA 3K9NA 4YJHA 6YASA 2ATEA 4MRMB 4NDZA 4XDZA 2Q5FA 1U8UA 1W581 3U7IA 2AA3A 1U1DA 5HK9A 4EJ6A 1RABA 2QKYA 2ODNA 2IKQA 4GLOA 2FSSA 1UBGA 4LYGA 4JP1A 1C2TA 3E3AA 1W48A 1YJXA 3O26A 1G8HA 3I09A 2GN6A 2Q2OA 4EA8A 2B30A 3BAZA 4UREA 4UOEA 5JALA 2HMYB 4N5LA 3CNQS 5CMLA 3DE0X 2YRFA 1H5UA 4QFCA 4P7KA 4KG7A 1XG5A 2UZAA 4DA0A 5LP6F 1PEDA 5T8KC 3RT7A 4I99A 4AT1A 1PYGA 2EGHA 3JX9A 4K1XA 2RHCA 1PW5A 3RW9A 4GO1A 3IURA 2NSJA 3B13B 2WQ7A 2GPYA 5I4BA 1UC5B 1SXJB 2C29D 2PH5A 1QU3A 1FXWF 3P52A 1MA0A 1RHKA 2FZ4A 4MA0A 4F12A 3BSWA 3PC8A 1PGJA 4DADA 2J32A 4MA4A 1G7RA 4M0MA 4MW2A 4DPLA 4ZVQA 3VHLB 3FKSA 1KVRA 3CEMA 4B6FA 4X8OA 4YP6A 1WXQA 4E3ZA 4HUQB 1L4GA 4KWIA 3DBHA 5JMTA 3RRFA 4MGEA 3UOGA 4E08A 3RDPA 1LWNA 3G82C 1ENYA 1XEWX 4IQ0A 1JJVA 1W5AA 1ZSNA 3FXAA 2LD4A 5B58T 5F1PA 2CLFB 4PZZA 3RAFC 2Y27A 3T1OA 4BB5A 4IIDA 2YZNA 3D4IA 3F5QA 3K1TA 1I2CA 3S2YA 4NZOA 4F1WA 1LY1A 2J59A 4FHCA 3GGPA 1NVKA 4DKXA 1OZHA 4LHZA 2CK3A 4OKNA 4J0QA 2B69A 3CUVA 1ZW1A 3CUUA 3HJGA 2Q9BA 1TMOA 5H3LA 1AHHA 4AB1A 2R7KA 2QRMA 3VNAA 3W90A 4QASA 2CZCA 1AO0A 4EYQA 4YAEA 5CA1A 1L7AA 2H8GA 3R40A 4IDGA 3UTCA 2JCVA 3JQDA 5LYYA 1U0GA 3V8EA 3P0JA 4QSHA 3K7EA 3U0BA 1RBYA 1BU5A 2R6DA 4C6SA 5C4MA 3Q4GA 3V1TC 3JAKA 1BCRA 4G24A 4WCDA 1FNMA 1D6MA 3CN9A 3ZCVA 4JLWA 5IC4A 2B20A 4BN0A 2JJ1D 2V6BA 3LUAA 3OAAD 1A04A 3KVRA 1VMEA 2CLCX 1PT6A 3P2MA 5IXJA 2X77A 1ZHHA 4CLXA 3O4IA 5A6VA 1R8SA 4DBVO 3G5UA 5JYBA 4DJAA 1PBTA 1CQJB 2O2YA 1NW9B 3C3PA 4F5YA 1UXGA 5KNDH 3D5EA 1R0ZA 3H18A 1IOWA 2Y71A 3CS3A 1PVOA 1EUYA 1YVRA 1U94A 3AZPA 3R0QA 1A9QA 2F17A 2OZLA 4QPNA 4BFVA 5EIEA 3SG0A 2GTPA 3KU1A 4XXHA 3W78A 4ZOLB 3E23A 1SUIA 3EGVA 3JARB 2C4KA 4TV8A 4DA9A 3NH9A 3UYLA 4LJRA 4RMHA 3A1TA 4QARA 5BNIA 4HN4B 3VUEA 1XDZA 3QKRA 3T7KA 1UOOA 4NBKA 3TLYA 3P9IA 2I76A 3MAJA 4FGJA 1OY1A 4IRUB 1Y0BA 1XVAA 3IX7A 3DEYX 3ZCXA 5I7VA 1ZGJA 3E15A 5D85A 1CJMA 3DKIA 1GNRA 1YOVA 2OVFA 4II7A 4RTOA 1YB2A 3AJDA 3QY9A 1NULA 2FPGB 2P9QA 2PD6A 3ITNA 1C41A 4TXLA 4WLVA 4TKZA 4UFNA 3AU9A 1KWKA 2XBLA 3K6SB 3WSTA 5FJJA 2AXPA 3GARA 3T3MB 2XV1A 1K27A 1NSTA 3UFXA 4R1OA 4JIMA 4E33A 1NDHA 1JE1A 2H9YA 2HSJA 4R41A 4Z9FA 4AMGA 4UHBA 2PL5A 4BAGA 2VJDA 3T4PA 1T6BY 3LGAA 3IR7A 3THXB 3OTGA 4YJ3F 4I5IA 1JDZA 2YXLA 4ZYVA 1EGAA 2AW3A 2CY0A 4B3SB 4TQUS 3EW7A 3B85A 4GSKA 1CFJA 4DG5A 4MS1B 4FONA 5K8VA 3AVWA 1IQRA 3CLVA 2DPLA 4PAGA 2Z8YA 5LA6A 1Q92A 3V48A 4AVYA 4ZHQB 5BV1A 1V11A 3EA0A 4QG7A 4LJ6A 2JD0A 4GBMA 4QUGA 3TM4A 4GOXA 4BKMA 3WYAA 1K8RA 1NWCA 2XNJA 2O0JA 3GP5A 3JVEA 4HWGA 4BE4A 4BMZA 4F60A 5AJZA 1A88A 3GLSA 3IELA 2C5FA 2VZEA 4NIMA 2I1QA 3L18A 1QGAA 4ESVA 2HF2A 3HLYA 3LVQE 4OU4A 3Q3JB 2GT1A 4DA7A 3N8DA 5L9AA 1Z4IA 4A8JC 2FQ1A 1TTPB 1BC5A 4MINA 4V0SA 2GCOA 1KS2A 1E60A 1KF0A 2WSLA 4WASA 5FBQB 1I3MA 5CLJA 4HSEA 3JD1A 1R0WA 4FZJA 3F3KA 3O4FA 3UPUA 5TGZA 4DPMA 1W93A 3FUCA 1EJ0A 1R8YA 3KSMA 1QFYA 4K9DA 3M6WA 2JEOA 4BQEA 3FR8A 4DLBA 4R1QA 2XVYA 3SHTA 2NIPA 1DUVG 3UJNA 1MABB 2P78A 4CG1A 3B8HA 8OHMA 1DAGA 2H29A 3FFTA 2YIJA 1ST2A 2GF9A 3NDPA 5K8LA 1P0IA 1Z5VA 1E2HA 1Q44A 4RZHA 1G2OA 1I2MA 3WTCA 4C5BA 2R86A 4M2LA 5GGXA 1DG9A 1GO2A 1XAIA 5JD3A 5IWCA 3KTAB 5GOZA 2MCFA 1C30B 1DLJA 1TO6A 1UFRA 5FOWA 2YMQA 1P1IA 1NLFA 3JD3A 4H7FA 4LYYA 4BN4A 1E2DA 5FUMA 3PLAE 3RC7A 4KFSA 1ORIA 3W04A 3AF4A 5IFLA 1TKAA 4FMDF 2BUAA 1VP9A 2VKQA 1RJ9B 1U65A 3F2IA 5ARBA 1UT6A 1N34B 1U8AA 2D13A 1KC3A 1XXLA 4XYGA 3MILA 3KD3A 1DC8A 1MO4A 4EUNA 3UZUA 4DG8A 5K01A 3AUJB 3ZDDA 4A7PA 4LXHA 4XZ3A 1V8ZA 1TCVA 4B4DA 4G97A 3TRFA 2Q2QA 2NUAB 1LRLA 1LVGA 3IOYA 2V6GA 4CM5A 4TVSA 3R76A 3TL2A 1S1CA 2D4HA 4GW3A 1M34A 1O95C 4JI7B 2V74B 4FOLA 1GXSB 4FYIA 5FPTA 1CUHA 5D3MA 1W87A 5AKYA 3CZRA 1W0JA 4J9VA 4YBZA 3T1TA 2ONCA 1GQSA 2ZB3A 4LXIA 4NE9A 1NYQA 3VZCA 2XGJA 3T4XA 1PJLA 2R7LA 2HDHA 1SKAA 1DBIA 1QV6A 1O89A 4B34A 3U3RA 4XR9A 2FSGA 2FXVA 1G98A 2WWIA 1UWVA 1KKMA 3E7DA 5EJFA 1JL3A 4G8JA 4G84A 4RF4A 3CX6A 1T0IA 4BLWA 1CJUC 5JAIA 2ZS7A 3FAZA 4ZI7B 1F4LA 2B0CA 2RHWA 4XW2A 5COAA 4F7DA 1T5IA 3H1EA 5KQPA 1XA3A 5DCWA 4KUEA 3ZKWA 3BD9A 1L6RA 3JASA 4CL8A 4NZ9A 1FP7A 1ENZA 4HF7A 3KQLA 1TUBA 2ZGVA 2WB4A 1NBMD 2ZI9A 4AKGA 2ZJ6A 4WKOA 4D4KA 4DV3B 4W8OA 1OX6A 4OMUA 1ZNQO 3ZCSA 1NE2A 3P9SA 8ABPA 1ZGCA 3LCCA 3DFUA 4A91A 1CS0B 1I2DA 2BH9A 3RREA 3EVBA 3OZUA 4NQRA 4UTOA 4G5QA 3BJEA 4UDOA 5H02A 3OQ1A 1L5LA 3N87A 5C53B 1ODLA 2GWRA 3O8OB 4F97A 1KQPA 1NPDA 2A0UA 3ANLA 3CIFA 3G0CA 4E5YA 4F5EA 3L40A 1T2UA 4RPLA 4F2HA 2CHUA 5JS8A 4YJKA 1ZXBA 4JQCA 3GA0A 3HSSA 1PJ8A 3WLRA 3IA2A 4MQUA 3AEUB 2H1VA 4QIHA 1HNWB 2Y68A 1QCDA 3O8BA 4N82A 1P6XA 4DSUA 2HEIA 2YJ3A 1T3GA 3IKLA 5AOAA 1XD2B 3KFVA 3X43A 2GFQA 2PZMA 4CLRA 5M7EA 4CM4A 4RH0A 4ND5A 3TR5A 1Y7IA 4K3VA 3HQ4O 4XIYA 2P6OA 1W19A 3HBLA 5KNCH 3LH5A 4EGAA 1POXA 2GVZC 4A9AA 4MO2A 4PX9A 5C46F 1XRNA 1JA9A 2MIIA 3SM3A 5TQ0A 2CBGA 5I48A 5CVCA 1KJNA 2FWJA 4JU9A 5EYPA 1NI5A 4ARIA 4LI0A 1HG1A 2JFVA 2RARA 5FOVA 3L6BA 3VOAA 1N9GB 5I9TA 4GYKA 4XEUA 1Z8NA 3W2GA 4X64B 4E5VA 5EZSA