4WKHA

Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (1mm) at 1.05 a resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
369
structure length
368
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTENDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Chitotriosidase-1
total genus 133
structure length 368
sequence length 369
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wkhA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wkhA01
4FK9A 5D9PA 1UG6A 2G3MA 1HKKA 4GI6A 4UOJA 4BQ5A 2A3BA 1HP4A 1UZ4A 4B9ZA 4ZE5A 1BYCA 1D2KA 1ISVA 1KGXA 3OB8A 3WMSA 4M56A 5A6AA 1W2PA 3WF3A 3CHDA 3WIJA 2WC3A 2YDQA 3GNPA 4W7WA 1PX8A 3WF2A 1U2YA 1EHAA 4BA0A 1KB3A 1HVXA 5CSYA 2DGAA 1QPKA 3PZVA 2WAGA 4CU7A 2XVKA 3KL5A 1UH3A 2YL5A 4S3KA 3CIVA 3I3BA 4D6GA 3W82A 1CGXA 4ZE4A 5DMYA 5I24A 3MUAA 3W6LA 3G6MA 3QHMA 2JF6A 4X9YA 6TAAA 5E0FA 2W67A 4OOUA 1ITCA 2QPUA 1E6PA 4CD4A 3NSNA 1KWGA 3AS0A 1BG4A 2XVLA 1SMDA 1UD6A 1E4MM 3K8LA 1VB9A 3BAWA 3PZNA 4ML4A 3ARVA 1GOIA 3CUIA 1ISYA 1Q4NX 3MANA 1WDPA 3EBVA 5CPQA 3WNLA 1QNRA 4W5UA 5HBFA 5BRPA 4QP0A 4JHZA 2Y5EA 1JZ6A 1QI4A 1CXIA 1BGGA 5E9AA 1M7XA 3ARXA 5HPOA 1W9BM 4HA1A 1MFUA 3LMYA 4P7QA 3VTRA 1EGZA 1EH9A 2VRKA 2VZOA 3VGHA 3T0BA 2VOTA 2VQUA 3N11A 2J8FA 1GPFA 1E6QM 4UZSA 1FP9A 4UNIA 2Y8KA 3M46A 1QI0A 4OKDA 1MVYA 4DUVA 1KCKA 4CD7A 1KXQA 2JFEX 5DT5A 3RJYA 3CH9A 3W6MA 3UG4A 2VQTA 1QI2A 4WJXA 2WNWA 2CEQA 1B30A 2VCCA 1V02A 4JAWA 5DO8A 8A3HA 3K8MA 1KXHA 1UWUA 1CXKA 4AZHA 3ZO9A 2WZEA 2X2YA 1W9VA 4ACZB 5IHSA 1GCYA 3AIEA 1BYDA 3OGSA 2VZSA 4D6DA 4PUDA 3WQ4A 3M07A 3T09A 3AI0A 4N0RA 3LPOA 4TOQA 2OLHA 1HL9A 3THCA 3WL1A 3ZT7A 1UWSA 2Y24A 2WVSA 1J0JA 1BAGA 3WD2A 2BY1A 5BXTA 2MANA 3ARPA 2UWFA 1GOWA 4QDMA 3WEZA 2WMHA 1KXVA 2ZWYA 3BCFA 1V3LA 1VRXA 2WLYA 3VU2A 4R5EA 3KWXA 4CD5A 1V6XA 3UESA 4PRWA 3CHCA 1OCQA 1TA3B 5A8MA 3SCTA 2GSJA 4N42A 1FH9A 3WDJA 4F66A 4DUWA 1R86A 2ZXBA 3SCUA 2VURA 1XGZA 4PSPA 3AHYA 2NT1A 2XVNA 1UHVA 3WUFA 1HJXA 1JFHA 5I23A 1EDQA 1W9DM 3ZSSA 3TONA 3BSHA 3WL0A 2WC7A 4M82A 1K9TA 1I1WA 4MTVA 4WKFA 1HJUA 1J18A 2YDRA 3GH4A 3ZJKA 2WWDA 1NQ6A 4KH2A 8CGTA 2UY5A 2CKSA 4NRRA 1V3JA 3RM4A 1H0IA 1L8NA 4A3HA 5GPRA 2XYLA 4WF7A 2FHCA 2ZUUA 4J3SA 4WSJA 4J3XA 3RJXA 2WZHA 1OIFA 4W85A 1O6IA 2J4GA 1RD6A 1J0KA 1C92A 5LA2A 3MS8A 4CN6A 3NYDA 5AYIA 4AD1A 4HMEA 3ZQ9A 2W66A 4AYSA 2VT0A 2F61A 1VENA 2WWCA 1PX3A 4HPHA 3EDJA 1E56A 2A3HA 3CTTA 4HTYA 1NH6A 4JHOA 1JF6A 1NOFA 1LG2A 5CQ1A 1GOMA 3AJ7A 4FF5A 5HOSA 1VJZA 1OGSA 1HL8A 1SYTA 3U57A 4D1IA 5D4YA 1LF1A 1JD7A 3MV01 4KRUA 1CNVA 1CGYA 4D1JA 4CVUA 2CCRA 3WMBA 2DSZA 1R7OA 4AZCB 4GI9A 5A2AA 5GNYA 5CPSA 4W88A 1GOOA 1D3CA 1UR1A 3CZEA 1J10A 5IHRA 3CZGA 2BS9A 3NDYA 3FNDA 1OGGA 1XC6A 3T2QA 1FFRA 1X6LA 1GQIA 2J7FA 3RIKA 1AMYA 1VAHA 2CIPA 3A47A 3TTQA 1ZBKA 2V3DA 3IAQA 5FD0A 1DP0A 3VIPA 3U7BA 1Z32X 3F5JA 4F9DA 1FOBA 3BXWA 4BCEA 1B90A 1KQYA 1VEOA 3VGGA 1G5AA 5E6YA 3CUFA 2FH8A 2ZX8A 4HZ6A 2X1IA 3K46A 1HJSA 2PC8A 5E0CA 1ISWA 1B3VA 4P7NA 2VZVA 3LPFA 5ABGA 1WNOA 1BHGA 4U5IA 2VVSA 4X0NA 4XZWA 5I2UA 2E0PA 2YLAA 3NCOA 4E8DA 1E4IA 3WF1A 2D23A 3RMEA 1A47A 3W38A 4BZYA 1UYQA 1UR9A 4WLCA 1V6WA 2WXDM 2W62A 1NWTA 1KGWA 3AHTA 1CGWA 1KXTA 3AICA 1E6SM 2ZXDA 4E8CA 5A8OA 5I78A 7CGTA 2C0HA 2YLLA 1WB0A 2D3NA 1BYBA 3ALFA 3N12A 2E8ZA 3WFZA 2W4XA 4P8UA 1Q6DA 2NT0A 3O2LA 1W1PA 2JEQA 1JZ2A 1B3WA 5CJ5A 1QW8A 1GOQA 4JFSA 1BPLB 5CG0A 3CBWA 3ARSA 2GDUA 1B0IA 3VIMA 3WN6A 1KR1A 4QAWA 4MAZA 1C91A 1H4PA 5GQBA 1VBUA 4S3JA 1JFXA 1JYNA 3VKKA 1SFSA 3WH9A 1QI5A 2X8RA 1Q6EA 1KQZA 2XGBA 1DWIM 2WCGA 3EDKA 4P8XA 2CXGA 4JKMA 2WANA 3O9NA 5IFPA 2DSWA 2ZWZA 5FKYA 3DYPA 4LX4A 3RM9A 5A8QA 4PMDA 1UKSA 1TCMA 2VRQA 3EMQA 1IT0A 5A6MA 3OGVA 2W5FA 3SCQA 3WDHA 1KGUA 1GJUA 2ZUSA 1KBKA 3AZTA 4CGTA 3CHEA 3AIQA 1HJQA 1WZLA 1CENA 4QLKA 3QHNA 1ECEA 4EK7A 3KZSA 1JZ5A 1E1EA 4JFWA 3CMGA 3ZJ7A 2W91A 1TUXA 1JYVA 4W89A 3AIUA 2ZXQA 2DEPA 3GXIA 3SCSA 1RP8A 3IJ9A 1V6YA 4ZXOA 1WCGA 3UETA 1UWTA 4GZJA 1CEOA 4P7RA 1TA3A 3WUEA 3AHXA 3IK2A 5JH8A 3SIMA 1V6VA 2RGLA 4TUFA 3MUY1 1HKJA 3ZIZA 1UD4A 1CLVA 3VIOA 3UEQA 3VX1A 1C93A 4MAVA 2UY2A 5FL1A 4XUYA 4MJ2A 1B3YA 2DT2A 2XG9A 1SR0A 3EDFA 4W87A 2O9OA 2D2OA 2PWDA 1EQPA 1V08A 1XH2A 2JF7A 2ZE0A 3BGAA 3DHPA 4BF7A 5IXEA 1UR2A 4C7FA 1GQJA 1DWGM 3WNNA 3PZTA 5BCAA 4UFJA 1JYXA 4UQ9A 4MB3A 2CNCA 1VEPA 3DYMA 3WNOA 5KZ6A 1C7SA 4GZIA 3POHA 5IFTA 1WPCA 5CSUA 1LLOA 2CHOA 3SCNA 4Q7NA 6A3HA 1EO7A 2WMGA 4PMXA 4PMYA 3VIJA 3VVGA 2FH6A 1JDCA 4JL2A 5A8NA 3K8KA 2W63A 2J78A 2V5DA 1E55A 2FHFA 3BAJA 5EFDA 2X05A 4CU8A 4UFKA 5ECUA 1FHLA 3RM8A 1CWYA 1FHDA 4HU0A 3CZ8A 2IXUA 1GQLA 3GH5A 4EAMA 1FH7A 4GQRA 1OD0A 1JXJA 5I77A 1XSIA 2VX4A 3TTSA 2EO7A 3SURA 3AMGA 2XWEA 3PZGA 4AZCA 3VGDA 2W61A 2UY3A 2WHJA 4U33A 2Q8XA 2EPOA 2DIJA 2WMKA 4P7LA 1LWJA 1WZKA 1F4HA 2BHYA 3VPLA 4YPJA 4F9JA 3WQWA 2G3IA 4AMCA 2B31A 1W3JA 4AZ5A 1L0PA 1UKQA 4DM2A 2J77A 3QR3A 4E2OA 1TVNA 5M03A 4PSRA 4XZBA 4FLSA 1TFVA 4U3CA 4W86A 3VDAA 2CESA 2QLYA 3W27A 5E6ZA 1XD0A 3QHOA 3N15A 3TTOA 4LXFA 9CGTA 3WKZA 3IANA 2VX6A 1K6AA 2CYGA 1MQRA 1BTCA 3D5HA 1QNQA 4D71A 4J3UA 4H7VA 4OUEA 4NZCA 1U30A 4LYPA 3HN3A 1B3ZA 4LQ1A 2DPEA 5BYWA 1J0ZA 4KRTA 5D9MA 4WK9A 3WEMA 5ABFA 4UQBA 2D3LA 4UQCA 2PF0A 5TD4A 2DH2A 1PZ3A 2XVGA 1LWHA 4HA3A 3AFBA 4DM1A 4HOXA 3OLIA 4OOZA 3MMDA 4AEFA 1E0XA 1OM0A 1WKYA 5C71A 3SUVA 2VL4A 2E4TA 3VMPA 3WH5A 4GINA 2D0FA 4XV0A 2QPSA 4TVUA 3SEPA 4PTVA 3VD3A 3AISA 3G6LA 3GNOA 1R7AA 4UFLA 4KMQA 3AXIA 3B9AA 1E5NA 1E40A 3L4VA 4GXPA 4D72A 3KEHA 3OLGA 2EPLX 3SUSA 3VIIA 1YQ2A 3LPGA 4CUCA 4HZ8A 1PX4A 2J7CA 4AC1X 4KGLA 3VD4A 4MB1A 3B8SA 1J01A 2Y8VA 7A3HA 3RO8A 1UKPA 1GQKA 1D7FA 1GVIA 3WF0A 1W1YA 5DT7A 4Z2IA 1JZ3A 2BXYA 1E6XM 2G41A 2XM1A 3WQ5A 1EOMA 1UD2A 4IPLA 1QOXA 3AS3A 3CUHA 2VI0A 3VNYA 4HA4A 5AC5A 4GQQA 1HF6A 3KL0A 3OZOA 1KWKA 3POCA 3L4XA 5A95A 2AAAA 2WVVB 1UOKA 1M03A 1LL4A 2JIWA 3AMKA 5GNZA 5CPTA 1VJSA 2BY0A 1BSIA 1H49A 4UFMA 1LQ0A 3GBDA 4ZXLA 1X6NA 1TZ7A 1JL8A 2YL8A 3W28A 2C8NA 1VF8A 2WVVA 2JIEA 2J75A 4KGJA 1R85A 2PWHA 4R27A 3VGEA 1E6NA 1ZS2A 2WB5A 3NDZA 2XSAA 5A6JA 1UQYA 3CO4A 3CGTA 4C7GA 1ZJAA 4OBSA 2XSBA 3N17A 2NSXA 3WH6A 1UUQA 3T0AA 3IAPA 3N18A 3GH7A 2XFFA 1E3ZA 2WMFA 1HNYA 1EOKA 2E9BA 1QHOA 3L2LA 5D9NA 1I1XA 4K68A 1GUVA 4HOZA 2DQXA 2WYSA 1V02E 3AMLA 2YL9A 2IXVA 3CMJA 1JZ7A 3APGA 2GK1A 1AQMA 5I5RA 1E1FA 4WKAA 2XGIA 3UG5A 3W25A 5M3WA 4ATWA 4V27A 2W92A 4YN5A 1NP0A 4CN1A 3AYRA 5E70A 4MNMA 1PPIA 4UQDA 1E72M 4GKLA 3WSUA 1JZ4A 1V0MA 1MXGA 1C3FA 2EXOA 1OGBA 3K1DA 4ACYA 1UKOA 4JFUA 1QVBA 1J12A 2GK1B 1DWHM 2AOSA 1PJ9A 3AS1A 4GI8A 1CXEA 2X0YA 1BYAA 4NF7A 3OGRA 2GJXA 4YHEA 5AY7A 1NOUA 4RE3A 3KE0A 4TX6A 2FGLA 4XX6A 1VFUA 3GBEA 1B1YA 2YDSA 3M6DA 2GJXB 2PI6A 2WK2A 2YA2A 4GIAA 3ARQA 2D24A 3L4ZA 1JAKA 2CITA 1SMAA 5E09A 3BLPX 5D8WA 4TVCA 3EDEA 3AOFA 3PZIA 1V6UA 3ARRA 3SCPA 4W5ZA 3WDQA 1MFVA 1UWQA 4W7UA 4CU6A 5A1AA 3AHVA 4LYRA 2WZIA 3A4AA 1G94A 1HIZA 2QV4A 3UR8A 4PMVA 4MJ4A 1W3HA 1TG7A 2OWWA 1E5JA 1MW2A 2X09A 2VR4A 5A8PA 2O9RA 4H8VA 2X0HA 5I0DA 3CLWA 3FW6A 1BVZA 1HJWA 1VFMA 1UR4A 3W81A 5BXRA 4Y7EA 3FXYA 2XIBA 4TTGA 4PEEA 1LL6A 4W8BA 3S6TA 1VFFA 3WD1A 1DWFM 1CDGA 2YL6A 2YBTA 3VGFA 4D6HA 1ZU8A 4PCSA 3AIVA 3AZSA 4A3YA 1H2JA 3WMCA 3ARZA 3VUPA 4HOWA 2ZOXA 2OSXA 5JBEA 5DEZA 1UD8A 4UCFA 3SCVA 2HISA 5ABFB 5JUVA 2CPUA 3MMUA 2UY4A 4MPKA 1OB0A 3W37A 4L4OA 1EIBA 3B9EA 1TE1A 4AW7A 4AZIA 2OYLA 4EE9A 2JE8A 3SUTA 5M5DA 2BHUA 3GYCA 1B9ZA 3QOMA 2WLZA 4H2CA 1QW9A 3EYPA 1FP8A 3N1AA 4ZENA 3DHUA 1JNEA 3VDBA 1GNXA 1VFOA 1K9EA 3NIYA 2WKLA 4IISA 4Z2LA 1GOKA 3F5LA 3M7SA 4IM4A 4PTMA 3FAWA 1E0WA 3TA9A 3SCWA 3WUBA 4B3LA 1N82A 1Q6FA 3AIWA 5A6SA 1OT1A 3ZMRA 5ABEA 2XUCA 1ZB5A 1E73M 1HKMA 2XJ7A 3QOKA 1P6WA 3BLKA 4TXEA 1CXLA 3GXMA 1XSKA 3MO4A 3ARWA 1M04A 4PN2A 1V0KA 3AYSA 2EEXA 1RP9A 2BY2A 1K9DA 4AY1A 1HX0A 2Z1SA 3PTQA 1XRVA 3CUJA 2IUZA 2D20A 3MSDA 1UWIA 3NJ3A 1R87A 3GZAA 4W7VA 4FLQA 3B9DA 2V3GA 4J28A 4AIUA 2YA1A 3CHFA 2J25A 4PTXA 2TAAA 2ZUNA 1ITXA 3GNRA 1W32A 1ZBCA 2VJXA 2WCAA 1C8YA 3NSMA 4PYSA 3WENA 1E70M 1X1NA 2EPMX 1UA3A 3WBAA 3WNPA 2WVUA 3N9KA 3FAXA 4AD5A 3WELA 1KR0A 4W84A 3K4DA 3GXFA 3ZJ6A 1MW1A 4ACZA 3JUGA 1BGAA 1WZMA 2GJPA 4AZ6A 1PAMA 3II1A 1WDQA 1E4NA 3VDHA 2WSKA 5A69A 4PUEA 4DWSA 4CD8A 3VM5A 1I75A 1C8QA 3HMCA 4OZOA 4MNLA 3WH8A 2BVDA 4Q22A 4MNKA 3ZJ8A 4L4PA 4JCMA 1DTUA 1UH2A 3GM8A 4DWSC 3NUKA 3THDA 4H41A 3T08A 2VCAA 4AIEA 4PMOA 3W0KA 3SCRA 2WVTA 4F79A 1IZJA 1V3KA 1QNPA 1MWOA 3PTKA 3I3EA 1EA9C 3U5YA 2ZX7A 4HMCA 1FA2A 2CBIA 4B3KA 1BQCA 3VMNA 3WD0A 1C7TA 1NOWA 5IDIA 2OYMA 3AXXA 4AWEA 2G8ZA 4PCTA 3ARTA 1MQPA 1HP5A 2WC4A 3RCNA 1E43A 1EO5A 2XIIA 1BF2A 3SUUA 1XSJA 1PEZA 4EANA 2YBUA 1G01A 4OBRA 4YHGA 3BCDA 2D0GA 2EBNA 3PBGA 2J8GA 2J79A 2ZIDA 1XV8A 1XD1A 1ZBVA 1DEDA 2E8YA 1XYFA 2ZUVA 1J11A 1HVQA 5A6KA 2D0HA 1V3HA 1NWSA 2PB1A 4J3WA 1JXKA 2DH3A 5EB8A 1PIGA 1CBGA 4UOQA 1JIBA 1PZ2A 2QF8A 5AYBA 4AIOA 1ZL1A 4QFUA 4CKQA 2VX5A 1R8LA 1OD8A 2WW5A 3TP4A 2VCBA 2D1ZA 2CERA 1FH8A 1LL7A 2XVPA 4RL3A 2F8QA 1JF5A 2DT0A 1ISZA 4QLJA 3VIGA 4HU8A 5EMYA 2WHMA 3A6OA 1M53A 1W1TA 5FL0A 4AZ7A 4AXNA 3FN9A 4HMDA 4IPNB 4J3VA 4J27A 1E71M 3VOCA 1H41A 1QNSA 1E0VA 1DWAM 1DWJM 2J7EA 5CLWA 4JL1A 3ZOAA 3MKKA 1PBGA 4MB5A 3ARYA 3ZT5A 3BH4A 1J0YA 3MMWA 3IJ7A 1KFWA 3A4WA 5I6SA 1V3MA 3CZLA 2FDMA 1WP6A 5LA0A 2BV9A 1CECA 3AXHA 2AMGA 3VO0A 4GPNA 3GXDA 3MU7A 1V3IA 2OSYA 1QHZA 1BG9A 1A3HA 3PZOA 3S2CA 2EJ1A 3EMZA 4ATLA 2A3EA 2G3NA 1EHNA 5GNXA 4M81A 2FGZA 4PMRA 3T2OA 3TOPA 1HT6A 3DYOA 2NW0A 4UTFA 7TAAA 4WSKA 3FY1A 1UD5A 1Q6GA 4MADA 2DSKA 2OWCA 2DSUA 3W4RA 3VM7A 4AEEA 1W3LA 2JEPA 4UFHA 5CGMA 5A3HA 4GZEA 4D6EA 5BROA 2CBVA 4PTWA 3BAKA 1WE5A 4D6FA 4CD6A 4A4AA 1EDTA 1NARA 3VINA 3CZJA 5D9OA 1CYGA 4FMVA 2BNJA 2GVYA 4U3AA 4C7DA 1CLXA 1GHSA 4QCEA 1GONA 4M8UA 4AD4A 1XH1A 1TVPA 2YKKA 1OBAA 5HXMA 4Z2JA 1CPUA 1H1NA 2PWFA 1B2YA 3L4TA 3ZR6A 1CIUA 2ZUTA 2YA0A 4CCEA 2VRJA 1NM9A 1S46A 3VDCA 5I3DA 1Q6CA 6CGTA 1JDDA 2BHZA 2EPKX 1XCWA 2BY3A 2JALA 4HZ7A 2A3CA 4M1RA 4RE2A 1W9XA 2ESCA 2RGMA 3UG3A 4H8UA 1W9PA 3WQ8A 3A3HA 1BVNP 5JIWA 2CKRA 4M29A 2VZUA 3MUZ1 2YOCA 4EKJA 4TX8A 1WDRA 1U33A 1XYZA 1US3A 3EMCA 3F4VA 2C7FA 1BLIA 3VX0A 2HVMA 2WHLA 3OG2A 3OLEA 5AC4A 2CETA 3HU7A 4GO8A 1ZBWA 1US2A 4ZEPA 4MB4A 3VNZA 1OIMA 5DFAA 1ESWA 5BWFA 1AVAA 2WM0A 1QBAA 2G4FA 5DF0A 4MNJA 1UR8A 2VO5A 2PBOA 3VIFA 4GO9A 3CUGA 1KBBA 4ATDA 1G1YA 5KEZA 4AD2A 5HNNA 3J7HA 2OYKA 2WMIB 3BAXA 1CGVA 1QHPA 5HDRA 4TVDA 3AHZA 1FFQA 1ODZA 4RE4A 1M01A 1JGIA 4MDPA 3SCOA 4KWUA 4AZGA 1E6ZA 4PMUA 4NRSA 3AMCA 4URIA 2BFGA 1CZ1A 3WD3A 2WMIA 1RPKA 4D6CA 1EQCA 1EXPA 2DDXA 2WKGA 3ECQA 3MSGA 3RILA 1XHGA 3LPPA 1W9UA 4OJYA 1TMQA 2O9TA 2E9MA 2CBJA 2E3ZA 5JIPA 3UR7A 5F7UA 2XTKA 3L4UA 1WZAA 4JFVA 2V38A 5BRQA 1J9YA 2Y4SA 1AQHA 2XM2A 1ZJBA 3WNMA 1C8XA 1XH0A 3WD4A 3OBAA 5A6BA 5ABHA 2EQDA 4AZBA 2F2HA 3WQVA 3ZSTA 1JDAA 1H3GA 3W29A 1V0NA 4AD3A 3AIRA 3PZQA 1E15A 1GVYA 1QBBA 1VEMA 3UCQA 1MW3A 5A2BA 3VILA 3AZRA 3T2PA 4CCDA 4H8HA 4WKHA 3WY1A 3I3DA 1G9HA 4LYQA 4ZFMA 4QCFA 1IZKA 3VGBA 3W24A 1HN1A 4WIWA 2DT1A 5JBDA 2VVNA 1B3XA 1WO2A 2GJRA 5CZKA 5BXPA 4UZUA 3A4XA 2D22A 1JNDA 2EPNA 3WBEA 4B16A 1CXFA 2ZX6A 1CGTA 1B31A 4BQ4A 2Y2WA 4CCCA 3PZMA 1BFNA 4UQEA 1K9FA 2VZTA 4HP5A 4JFTA 1H5VA 2WSPA 2J7GA 1Y7VA 4M24A 3F5KA 3K4AA 2J7DA 3BSGA 3TTYA 4U31A 2QMJA 3VD9A 3L4YA 3L4WA 5A2CA 1DHKA 1TR1A 1HXJA 3VMOA 2YJQA 2BVTA 2XWDA 1WDSA 3AIBA 1NWRA 1E9LA 4PMZA 1UD3A 5A6LA 4BS0A 4F8XA 3KL3A 1GZJA 4JCLA 4XB3A 1E6RA 3AROA 4D6IA 1HKIA 3FHAA 5A94A 2VTFA 1W91A 4FLRA 2V3FA 1MW0A 5CXPA 1F4AA 3BC9A 5LYRA 4JKKA 1V03A 2ZX5A 2XHYA 2ZX9A 5JBFA 3WDPP 1ISXA 2PWGA 1HJVA 4LPCA 5C8BB 1LG1A 3DECA 3NSXA 1VBRA 1UA7A 3EDDA 2J47A 2J62A 1V0LA 3IJ8A 4DWSB 1QNOA 2DIEA 3PTMA 4JZ5A 3SUWA 1UKTA 5FOOA 1NWUA 1JD9A 4BQ2A 2CBUA 3WDRA 3WQ6A 4MDOA 3UERA 2ZICA 2J74A 1G0CA 3MUIA 1ODUA 4B15A 3DC0A 4QLLA 1JG9A 3OIHA 1J0HA 4P8VA 2WCSA 2WBGA 5EBAA 3WH7A 4CN4A 4PMNA 4BQ3A 1IV8A 4U2ZA 5A6BD 4NSBA 4B9YA 1JI2A 1E3XA 1KCLA 1CXHA 4P7OA 3WDIA 4HPGA 4UQAA 3PZ9A 3VD7A 2DSVA 1PIFA 3GDBA 3ARUA 2J7BA 1JI1A 2QHAA 3MV11 3PHAA 1H0GA 4W93A 3BMVA 2VUYA 1UR0A 3WEOA 4DWSD 4JKLA 1MYRA 5LA1A 2ZUMA 1JZ8A 3RDKA 2XFRA 3WFLA 1OINA 1W2VA 3ZM8A 3AS2A 3W53A 3VIKA 4Z2HA 1W3KA 3ALGA 4LGXA 2PWEA 3BMWA 4E4PA 3PN8A 1AQ0A 4AD0A 3OLDA 4J3TA 2ZXAA 4V28A 1WAWA 3T0DA 1C90A 3U7VA 4TTUA 2VNCA 4IUGA 1UH4A 1UQZA 2WMJA 4CVWA 3VD5A 1MQQA 1CGUA 4AISA 3AQUA 1H09A 3WUGA 3PZUA 2Z1KA 4UFIA 4OIFA 4Z2GA 2WPGA 3VIHA 2PBGA 2OSWA 2YIHA 3W26A 2VX7A 5M17A 2O92A 2ZUWA 3GTNA 4V2XA 2QMKA 4PBGA 3CPUA 4UOZA 1RH9A 1GJWA 2CHNA 2J7HA 2DT3A 2G3JA 1LJYA 3E1F1 1H11A 5D8ZA 1JAEA 4DUXA 4M80A 2A3AA 4U5KA 4X0VA 3WNKA 2WBKA 5FIPA 4UR9A 4NI3A 3U5UA 2WHKA 5BXSA 2GUYA 4W8AA 1O7AA 1QI3A 4D6JA 1YHTA 2O9PA 4JIEA 2OWXA 1GORA 1W1VA 1UWRA 1GW1A 2E9LA 3HJEA 1MXDA 1VIWA 2VC9A 2XFYA 3AMDA 1GHRA 4PMQA 2BVYA 2E40A 4H04A 1NP2A 3D3AA 4P8WA 3ZR5A 2VR5A 5EFFA 3L2MA 1OWQA 2BXZA 5FCZA 1XCXA 5C70A 1CTNA 1J0IA 3BAYA 2V3EA 1E4LA 3RPMA 4Z2KA 2VMFA 3FHQA 3CZKA 4J7RA 4U2YA 3O6AA 3OA5A 5HPCA 5CLTA 4W8LA 1OSEA 2GFTA 3BAIA 1EDGA 5CGTA 2FHBA 3N13A 2GDVA 2V5CA 1JYWA 2XPKA 1OT2A 3N04A 5I79A 3OZPA 3WF4A 1UZ1A 3ZT6A 3QGVA 4FLOA
chains in the Genus database with same CATH superfamily
1F3TA 4FK9A 4MJZA 1XM3A 2G3MA 3TAOA 2V9DA 2R1LA 4BQ5A 1T41A 1XBXA 1ADSA 4LCRA 3O5JA 1UZ4A 4H00A 3L66A 5CAHA 3GB6A 3OEXA 1ISVA 4NAFA 1XKJA 4M56A 1W2PA 3WF3A 3CHDA 2YDQA 3WMLA 4EXQA 3LGDA 1I2NA 3DN5A 3W9ZA 2DGAA 3UPMA 2YGYA 2YL5A 4D6GA 3W82A 1CGXA 1L2UA 4ZE4A 4I8DA 5I24A 4PA8A 3EX2A 4RZ5A 1F40A 3G1RA 3QHMA 2JF6A 4X9YA 2QDDA 5E0FA 5C7HA 4PGLA 2EF9A 2PEVA 4FXRA 3KAOA 4TR9A 1I45A 3ITLA 5K4XA 4GGBA 1SMDA 1UD6A 1VB9A 5IRPA 1TPUA 3CUIA 1Q4NX 3MANA 3CMFA 3VUSA 4J9JA 3WNLA 4H6QA 3BK0A 5HBFA 2QYGA 4GH1A 5HJXA 1FY6A 2Y5EA 1IZCA 3W1LA 1JZ6A 1QI4A 1CXIA 4EWND 5E9AA 5AYXA 4QNWA 4E4FA 1MFUA 2PTDA 1EGZA 1EH9A 2IKIA 2VZOA 3VGHA 2VQUA 3R6IA 2J8FA 1EL3A 3TQKA 3O5MA 4CD7A 1KXQA 1P0EA 5DT5A 2O55A 4HBOA 3E5BA 3NZQA 1XWYA 3PBUA 4WJXA 4PB3A 3NQBA 2WNWA 3GHTA 4AZHA 4UUIA 3ZO9A 3FEQA 3G24A 3ONBA 1LUCA 2X2YA 4JNYA 3E0WA 1GCYA 3OGSA 1MUCA 2PDGA 4Z1AA 2YBVA 2FZMA 1MUWA 4PUDA 1S5MA 2HE8A 3WCZA 3KCEA 2E1WA 4TOQA 1H7NA 1TJ0A 5D09A 4WXYA 1UWSA 1FCUA 2CLFA 1BAGA 3W2JA 2R1MA 2UWFA 3LS9A 3PJXA 1E44A 3GIPA 2WMHA 4LUYA 1KXVA 1VRXA 3NG3A 1RD5A 4CD5A 3FYYA 2XH4A 2ZRYA 4PRWA 3CHCA 4Z1BA 1DYSA 4ODOA 4NIRA 1TA3B 3SCTA 2QVNA 4N42A 4NAEB 1Q63A 2E25A 4A3QA 3L5AA 3B9NA 4LVAA 4UWMA 1PYMA 3WUFA 4YTTA 4IX2A 4MZYA 2G0WA 2R1KA 3R0KA 2WC7A 2FPTA 3W87A 1I1WA 3TR2A 1ADOA 4HB7A 4WKFA 1J18A 1OYBA 1SSDA 2YDRA 3ZJKA 2XZ9A 2J6VA 8CGTA 3IJ6A 3VZZA 4C5YA 4IZGA 2UY5A 1V3JA 3RM4A 1L8NA 3EXRA 1ZP3A 5GPRA 1EP3A 5AZ1A 2GSEA 4QGCA 2CLEA 2ZUUA 3E38A 3Q2DA 1AW5A 1O6IA 4H7ZA 1RD6A 2R91A 1J0KA 1C92A 2XH2A 3OPSA 3GC5A 3MS8A 3SN0A 1K02A 4NASA 4JIIX 3MKVA 4DO4A 2XSXA 2E5DA 4AD1A 4HMEA 2W66A 3C2VA 4JN8A 4LJ3A 2F61A 1VENA 1GVSA 2TRSA 2WWCA 4HPHA 4LAUA 3EDJA 5B7ZA 2A3HA 4JHOA 2A85A 4NZ3A 3UF8A 2QDHA 2BTMA 2RJHA 4FF5A 5HOSA 4MWAB 1HL8A 1LQAA 1SYTA 3D47A 3U57A 5D4YA 1LF1A 2VFFA 4OQVA 3B0UX 4U28A 4KRUA 1CNVA 1SO4A 4HYRA 4D1JA 4CVUA 4KERA 3WMBA 4IMGA 1R7OA 3FA3A 3B0XA 5GNYA 3N6JA 2R8WA 4W88A 3RU6A 3QKZA 4ODLA 4UCGA 2NX9A 4MGGA 2BS9A 3N2XA 1JNTA 4ZA0A 3SDOA 4JX6A 3MO7A 1OGGA 1U79A 4N19A 3SAZA 1KC7A 1GOXA 1XKYA 3CAWA 3CQ0A 1AMYA 4MJMA 3W7JA 3WLKX 4M5PA 2Y0FA 3QLDA 3BW3A 2E28A 2V3DA 1XCFA 5FD0A 4JHMA 1Z32X 3DXIA 3F5JA 1FOBA 4BCEA 4F48A 2YW4A 3TYAA 1KQYA 1PE1A 3VGGA 1G5AA 3PR9A 3N19B 3BJSA 4A6GA 3R13A 3K46A 3NNTA 4MOZA 3OYZA 1MXSA 1HJSA 3OVPA 1ISWA 3EPNA 2HS8A 5ABGA 4RK8A 3B0VC 1LDCA 4JTKA 4E8DA 1C29A 1E4IA 2D23A 3W38A 3KRBA 1UYQA 1UR9A 1PKYA 1SFJA 1TZ9A 3OBEA 4F2TA 4WLCA 1AMKA 5J8LA 4DRNA 1YPIA 3AHTA 1A0CA 4PCFA 1CGWA 3AICA 5I78A 3IK4A 3BG9A 4MKVA 2ZYFA 1I60A 3C5QA 5ABTA 2NT0A 3DFHA 5LHFA 5K9CA 2YCLB 1Z69A 1L6FA 1KT1A 1W1PA 4LY8A 4N4QA 3CH0A 1JZ2A 2Y5JA 1TTQA 1B3WA 3PR2A 2Z2UA 3N2CA 4IG2A 3S1VA 1BPLB 1RJPA 2GDUA 1B0IA 3FDGA 3VIMA 1KR1A 4TO8A 3WN6A 1J4EA 4M3PA 1A4LA 3L7RA 1JFXA 3O6DA 3PNUA 2KR7A 1QK0A 1OQFA 4LS0A 2WCGA 4WCJA 3EDKA 4NHVA 4XAFA 5IFPA 2DSWA 4O4VA 5FKYA 3ORWA 2W79A 4YU1A 3DGRA 4PMDA 1TCMA 3QBUA 4ILSA 3CV2A 2BB0A 3EMQA 3GC4A 3SCQA 1W26A 1GJUA 2ZUSA 1KBKA 3MBDA 4Y9PA 1QO5A 4QG6A 1VBHA 3IV8A 3NGFA 3AIQA 3UXKA 4J40A 4JX5A 1WZLA 1SQ7A 1PBKA 4L61A 2ACRA 2ALDA 3LMZA 4BI6A 3KHDA 2GGGA 3ZLHA 1P48A 4JFWA 4DF0A 1UR3M 3CMGA 3QYSA 4W89A 3AIUA 5FAGA 4JYEA 3NPVA 1RZMA 3SCSA 3V0SA 4E3TA 1V6YA 1WKFA 3UP8A 3DESA 1WCGA 4H7CA 2H9AB 5I3GA 3UWWA 1UWTA 1GTEA 4BR1A 2J9YA 3TWAA 3SIMA 4GY1A 4MUPA 3MUY1 1CI1A 1GVFA 2INZA 4TNSA 4IIBA 1CLVA 2J13A 3VIOA 2DORA 3VX1A 3P3BA 1C93A 4MJ2A 3BVJA 2QIIA 3EDFA 4W87A 2O9OA 2D2OA 2PWDA 3MUXA 3SQSA 4J2PA 2NV2A 2Y63A 3DHPA 5IXEA 1DIKA 1DWGM 3PZTA 1XLBA 4UQ9A 4MB3A 2CNCA 4GZIA 5IFTA 2WJZA 3P8IA 3P61A 5CSUA 4FSAA 1P5QA 2I5IA 4AB4A 1EO7A 1ZCOA 3QSTA 4PMYA 1A0EA 2FH6A 1LT7A 5A8NA 5C7VA 4UTTA 4GIVA 1UPMB 4CQ8A 1SFTA 4ROPA 1E55A 4QR6A 4I9AA 3TV8A 2FKPA 4CU8A 3RM8A 1HXVA 4S23A 3QY6A 4ZQPA 3TA6A 4HU0A 4DHGA 2IXUA 3Q94A 4GQBA 3E2QA 4Y90A 4LU0A 4S1FA 1DIDA 3ITOA 3Q4DA 2BGQA 4JTDA 1FWBC 8XIMA 1JXJA 5HW6A 2C16A 4N7QA 3TTSA 3O8AA 1PHQA 2EO7A 3R1ZA 1VPQA 5HANA 2N87A 2OT1A 5C55A 4FHAA 3O5IA 2J8TA 5EPDA 3A5FA 3E49A 1DBTA 2AMXA 2WHJA 3GVWA 1HUVA 2VP8A 3QPYA 2EPOA 2NXIA 2ZC8A 2OB3A 1WZKA 2BHYA 1JDFA 3N3TA 3SQLA 3WQWA 2G3IA 1XXXA 4AMCA 2PPNA 3H2FA 2D73A 3W1TA 1UBPC 3FSUA 4AZ5A 2OQHA 4DM2A 2Z1VA 3QR3A 1TVNA 4EF8A 4PSRA 1B4KA 1GW9A 3PPCA 4HN4A 2G97A 4W86A 3W27A 3QHOA 3TTOA 3HB9A 2B81A 4XIMA 5HWCA 3P5ZA 2Y70A 5BU9A 3UWZA 2ZDSA 1D6OA 4H7VA 3PBMA 4OUEA 4NZCA 3PS7A 3ABOA 2VEGA 3TJ4A 2XFWA 3KXQA 4ODQA 2D3LA 2VOMA 3LI0A 2QJGA 2DH2A 2VYOA 4DM1A 1G7UA 3U48A 4OOZA 5D2YA 4HOXA 3OBKA 4AEFA 4C6PA 1OM0A 2VFDA 2VL4A 3M43A 2E4TA 3VMPA 4GINA 4NJGA 2D0FA 3A64A 4Z1DA 3SQMA 3FOKA 4GYJA 1RQEA 4IJBA 3SEPA 5F4WA 4N6EA 3VD3A 4FNRA 3VKJA 4AF0B 1Q45A 4UFLA 4KMQA 3T6CA 4JOMA 1XIGA 1E5NA 4Y96A 3WLHA 1OFDA 3CEPA 4Q4QA 1HQTA 1MMFA 1SZRA 2EPLX 3MCNA 3PUOA 1J6OA 4LF2A 3SUSA 1PX4A 2NVCA 1W5PA 4A8LA 3GS6A 4MB1A 3HGJA 1G7VA 4REQB 3FCPA 3XISA 1JULA 3WF0A 1W1YA 3GYEA 1JZ3A 2BXYA 2P3EA 1RR2A 3WQ5A 1GYMA 1W17A 2Z29A 4DAFA 4HA4A 5AC5A 4GQQA 3BURA 1V77A 1IEVA 3B4UA 3L4XA 2AAAA 3W7LA 1FHUA 1DXEA 1XDLA 4XZHA 3ITXA 3PY2A 4ODMA 1OX4B 1LQ0A 4F0LA 3GBDA 5FEWA 4S3DA 1ZAHA 2C79A 1JL8A 1KM4A 2YL8A 2AKMA 1EJ7L 3GAYA 3W7OA 2JIEA 1DORA 4KGJA 4R27A 1E6NA 2QXWA 1UQYA 3TE9A 3N17A 1KFJA 1UUQA 4UMCA 2KFWA 4WOZA 3T0AA 3PPGA 4LNCA 1ZCCA 5HTGA 5FJJA 2Q09A 3UZJA 2E9BA 1Q8JA 1QHOA 4KEZA 5D9NA 4KFNA 3T42A 3RGCA 3VE9A 3M9YA 3UJ2A 1FKGA 1GUVA 3GSMA 5I3JA 3LK6A 3UWYA 2DQXA 2WYSA 2YB4A 1V02E 2VEMA 1CX9A 3QV6A 4FA3A 1TCOC 2YL9A 1X8FA 3CMJA 5I5RA 1AQMA 4XD4A 3W25A 4V27A 3DZ1A 4FO4A 1KM6A 2W92A 4CN1A 1FWEC 4UQDA 2ZR6A 3UQAA 1DXFA 1E72M 1YEYA 2PUZA 1JZ4A 3DERA 1W3NA 1OC5A 4S39A 2PD5A 1DWHM 4LW7A 4YTSA 4Q4MA 4JTFA 3NTPA 1M41A 3UD6A 4NF7A 4AEOA 4I7UA 3IGXA 5AY7A 1NOUA 3V18A 1DJHA 3BQ5A 1SW0A 3KE0A 3C2OA 3STPA 1OFQA 3URNA 4GBUA 3WF4A 1DJGA 2GJXB 2YA2A 4NI8A 5FACA 3ARQA 2D24A 3L4ZA 3ZR4A 3ZVIA 3NTYA 2DV0A 2DW6A 5E09A 5D8WA 4OUIA 3FK4A 3EDEA 2G50A 4R85A 4W5ZA 3GKFA 3KBWA 4Y9MA 3H4XA 5A1AA 3AHVA 2PDPA 4LYRA 2WZIA 4ICNA 1G94A 2QV4A 3GG0A 4IQ2A 4JQ2A 4MJ4A 4I9TA 1W3HA 1E5JA 1YW5A 2ZVRA 2VR4A 1DQXA 2O9RA 3ZVHB 1TVLA 3FW6A 3M0XA 3PANA 1AA1B 1E1CB 1UC4A 5CZTA 2BXVA 4CNSA 4PCNA 3NQVA 4Z42C 4ERGA 4Q8TA 4ZB0A 2PE4A 4TTGA 2IKHA 3BLFA 1VFFA 1R3YA 3WD1A 3W7QA 1EEXA 3QTGA 4D6HA 3NI6A 3KOZA 3AZSA 4LCSA 2Z1XA 5AYZA 4HHHA 3B0YA 3LEPA 4Q8OA 4RCXA 1XGDA 4HOWA 5JBEA 1DJZA 4UCFA 3SCVA 3P5YA 2HISA 2LJ4A 1OB0A 4AW7A 4WGXA 2OYLA 4E2DA 3I4EA 5M5DA 2WLZA 4DJFA 4H2CA 3APTA 5CBBA 1H63A 3N1AA 4HPJA 2AGKA 4O1CA 1XISA 4IH3A 4IISA 4IM4A 4H9TA 4NVTA 1TUFA 4O19A 1KKOA 1N1AA 2XP9A 1N82A 1TPEA 3AIWA 5A6SA 3DBNA 1ZB5A 1E73M 1P6WA 3BLKA 1CXLA 1M6JA 2PRMA 1XSKA 4NX0A 2B7QA 2P1FA 3ARWA 1M04A 2A5HA 4UR8A 4YS1A 1V0KA 4GH3A 2XIMA 3GG1A 1HX0A 3PTQA 2D20A 4NNRA 4NUWA 3W2LA 4LVDA 2G96A 3QQWA 1R87A 2ICSA 1P1MA 3MKCA 4W7VA 3CL7A 3IGUA 4DPPA 1BKFA 3B9DA 2Y61A 4J28A 4AIUA 3S5YA 2TAAA 4HNLA 4X2RA 3P62A 3GNRA 4E5TA 6XIAA 1KTCA 4PYSA 3P81A 3WBAA 5HQLA 3TH6A 3LXAA 4I5RA 4QXIA 3HPAA 4AD5A 1QRQA 2EULA 4IP4A 4HNUA 1MW1A 3PWGA 4M51A 4PZVA 1BGAA 4AZ6A 2EKGA 3IUHA 5FSEC 4U10A 5EKYA 1XLGA 3O6YX 1EJVC 2A6LA 4CD8A 1I75A 1FCBA 1XYCA 4KQNA 2OELA 4GC4A 4RXGA 3WG6A 3CUXA 4JCMA 3QR1A 1DTUA 4Z17A 1UH2A 2A7RA 2A3LA 4B5TA 2GWNA 4DWSC 1ROUA 2ZZ7A 2VC5A 3W86A 4DZIA 3W0KA 3QLLA 4O1AA 1V3KA 1QNPA 2X1TA 3GK0A 5FJUA 3PTKA 3G0SA 3QQ1A 1DV7A 2ZX7A 1C7TA 3EA3A 5IDIA 3I7RA 2G8ZA 1KFKA 4FOJA 2Z1BA 3ARTA 4DRPA 1YX1A 1MQPA 4L6DA 3RCNA 2LLEA 5D38A 4DO5A 1ADDA 2VFHA 2YCEA 3GU9A 2YBUA 1RBLA 2EBNA 2PDMA 3L9CA 4V15A 3P0XA 3A13A 1HVQA 1AFSA 1Z7AA 3SZ8A 6ENLA 4HK5A 1JXKA 3ONCA 4J3WA 2BASA 5EB8A 3OIXA 3EEGA 3UJSA 5HULA 4FX7A 4AIOA 1YBQA 4QFUA 2Z7GA 4JR5A 2QCLA 4RZ6A 4I8YA 5J5RA 2GQAA 3AC0A 1OD8A 2WW5A 4KCWA 1M9HA 1LL7A 2GUUA 1B6CA 1JUEA 4XO7A 2PDFA 5H91A 4PH6A 3LI1A 5GPGA 1W1TA 3C0QA 3P2VA 2VN1A 4KT2A 3SY8A 5C2CA 3NM1A 2DJLA 4AXNA 4IIHA 1EUAA 2PDHA 2B7PA 3N6QA 1PO9A 3SI9A 3LCWA 1R3WA 4HSHA 2NQZA 3NQFA 2HDJA 1S5TA 1QNSA 1P0NA 5AHEA 1Z9AA 5FJPA 3UR2A 1HG3A 1V93A 4JL1A 2X1UA 2BOGX 2FPVA 3GR4A 4MB5A 3C3NA 3REQA 1MDLA 3BH4A 3TZNA 4EVZA 3AJXA 1KFWA 2FYMA 3A4WA 1JPHA 2XPAA 2ZZ2A 4DJEC 9XIAA 1WP6A 1NU5A 3LBCA 1CECA 5LXXA 2AMGA 4JFIA 1JPMA 2DVTA 3MU7A 1YYAA 2OSYA 3BLDA 1QR7A 1QHZA 3SRFA 1A3HA 2ZZ6A 3R8RA 1D3HA 3S2CA 3UYIA 2A3EA 4QS5A 4ATLA 1EHNA 2QGYA 2QQ6A 3F4NA 4R3UA 4AXKA 2VGGA 4UTFA 1W5QA 2BG5A 3CL8A 1EJUC 3CL6A 2GVJA 3INPA 2DSUA 3LSBA 3VM7A 1RJQA 2QUUA 4HCLA 1WXZA 2DU2A 2CFFA 4QJ1A 4GZEA 3FV9A 2Z24A 3MW7A 2Y88A 5BROA 4C60A 4NNCA 3N14A 2ZBTA 5D03A 4O53A 4CD6A 1KT0A 1NARA 1KRBC 5T8GA 4FR1A 3V75A 4L64A 1CYGA 4FMVA 4JICA 3UYCA 2PV3A 3UWEA 4GISA 3TSDA 3VNMA 4AWSA 1GONA 4UTMA 1YE4A 1IT7A 1SJDA 1TVPA 2PDIA 3TLLA 2F4EA 3LGEA 3WO8A 1H1NA 1BEUA 1FHVA 2PU1A 3LLDA 2YB1A 2ZUTA 2PLJA 1FXPA 1S46A 3V5CA 5I06A 1M1BA 3UQNA 1REQB 4GFIA 4QQ3A 1VPYA 4GVIA 4UMAA 2BHZA 6CGTA 1XCWA 4DYKA 4MZ1A 3O5FA 1JCJA 4JTSA 4IFRA 4RE2A 2L5HA 3L23A 3LOTA 4MVAA 1W9PA 4ONVA 3G18A 2G3FA 5JIWA 3W2KA 2CKRA 2OQLA 2YOCA 4JNZA 3URAA 1US3A 1U5VA 3EMCA 4BI5A 3F4VA 3F03K 3VX0A 4Q8UA 3OLEA 4B91A 3HU7A 5G4WA 1US2A 2DUAA 4ZEPA 3QW4B 2V2DA 4MB4A 4YTQA 5MHBA 4LAKA 4XSLA 1QBAA 3HPSA 3EWDA 5AC7A 2VO5A 3R7MA 3TDBA 1A5UA 5KEZA 3DX5A 4AD2A 3P74A 1L2QA 1KM3A 3RRXA 3W72A 1QHPA 4TVDA 3AHZA 1LT8A 4WOQA 4L3NA 1XP3A 1CCWB 3VC6A 3DKJA 1ONWA 2QDEA 2RQSA 5EMMA 1CZ1A 3RX2A 4J4KA 2WMIA 1LLZA 4QS6A 3RILA 1NY1A 3VOHA 2I57A 2ZRWA 4XTDA 1TMQA 1SUXA 2O7SA 2E9MA 1GYLA 2PC4A 1XICA 5DBTA 3KLKA 5LIWX 2BDQA 3WX7A 1Q6IA 5HMDA 4PULA 1FBAA 1J9YA 5BRQA 1AQHA 1NQKA 3SY5A 1XH0A 2I14A 4XSMA 1GRJA 3BG3A 3WQVA 1K8YA 3ZSTA 1ZALA 1JDAA 1XFBA 2PDQA 4L9ZA 1H3GA 3DOPA 1ZRQA 3R0DA 5DXYA 3UCQA 3TYZA 3RN6A 1R3VA 1MW3A 5A2BA 3T40A 5CGQA 4L80A 4H8HA 4L6OA 5LZLA 5LNVA 3EPOA 4NAFB 3I3DA 2R94A 4ODNA 1IZKA 1HN1A 5JBDA 1RVGA 3BDKA 1TQXA 1YTEA 4QEHA 2CW6A 2ZZ1A 3KZPA 4YYFA 1JNDA 2EPNA 4QRNA 1IX5A 2HK1A 1B31A 4YLWA 4H4IA 4XBJA 4V33A 3MI6A 3W23A 6ALDA 1KO0A 4O57A 1P5BA 2J7DA 3BSGA 4U31A 3L4YA 3L4WA 4IFOA 4EP8C 4JYFA 2BVTA 4DJFD 2XWDA 3AIBA 1NWRA 3TROA 1N8WA 1E9LA 3VFCA 3TXZA 4L56A 3R43A 2KI3A 3UXAA 4FP1A 4JCLA 1A5KC 4XB3A 5FAJA 1E6RA 3UPWA 3HO8A 2F6UA 4Q4SA 4FN2A 3G1DA 4FLRA 1I2OA 1DE5A 1FQ0A 5LYRA 2R1NA 1PKNA 3LBOA 2XHYA 5JBFA 3VAWA 1T6MA 1YDOA 4LPCA 5C8BB 1EA0A 1VBRA 5H8PA 1W5OA 3NEHA 4F2BA 2C1HA 3R25A 4WJEA 1UA7A 1V0LA 3IJ8A 1QNOA 3PTMA 3SUWA 1NWUA 1L6SA 2CBUA 3WDRA 1TV5A 4MDOA 3UERA 2ZICA 3GUWA 1G0CA 5DMNA 2OT0A 5F4SA 2PPOA 4L1XA 3OIHA 4P8VA 2C1GA 1YADA 2WCSA 4KCUA 2WBGA 4ZODA 5DN1A 5CBJA 2KAUC 2D69A 4AX7A 3I65A 1D8CA 3DFPA 3MB9A 4M6PA 3GDTA 5A6BD 5DRIA 1POJA 1ONXA 3KM8A 4P7OA 1PZ1A 2RHGA 2XP5A 3QMSA 3PZ9A 2DSVA 3JR2A 1UASA 1THFD 4EPEC 3PSVA 4HQVA 2QHAA 4GJIA 3N25A 4WR3A 4LYKA 4JKLA 4XAPA 1MYRA 1VYSX 1GKQA 3RDKA 2XFRA 2YXXA 2NV9A 4IFKA 3C61A 4ZQOA 3MSYA 3HGOA 1UMLA 4XISA 4C02B 4YCPA 3CIWA 3AU2A 2RJGA 4LGXA 2J27A 4LUIA 1AQ0A 5HR6A 1M7OA 3NA8A 4ES4A 5FEXA 3T1GA 1YDYA 1ZPTA 2FZNA 1WAWA 3T0DA 2PDJA 3G1SA 1XLAA 1GG0A 2VNCA 1KM5A 3VA8A 3VD5A 1H7WA 2AWGA 2FFIA 4Z08A 4AISA 1H09A 4G7EB 4O1FA 1X97A 1W5MA 4OIFA 1EJSC 3RLUA 4Y6GA 4IUOA 2E77A 4O11A 2QCHA 4HZMA 1SR9A 1SGJA 2O92A 4NT0A 4KIEA 4GCAA 4N9BA 2VR2A 4PBGA 1EJRC 3CPUA 3IJIA 4WHBA 1GJWA 3HBLA 4DLMA 1LJYA 5D8ZA 1H11A 1JAEA 4DUXA 4M80A 1S5VA 1U1JA 2WBKA 2XIJA 4UR9A 1TREA 2WHKA 5BXSA 2BSLA 3R12A 2O9PA 4JDBA 4FPSA 2NXGA 4JIEA 4MSPA 4GY0A 3RCMA 3FYOA 1XIMA 1VIWA 3QMRA 3WQGA 2OZ3A 4PMQA 1GHRA 2MLXA 3FJNA 3MBFA 1PHWA 1B9BA 2KGJA 4FF7A 5E9XA 1QATA 5EMKA 3S4TA 5LIKX 2FZ9A 3P93A 4P8WA 5A5WA 3ZR5A 2VR5A 3L2MA 1OWQA 3QXBA 4A35A 4ZPTR 1CTNA 2TMDA 3BJFA 3RPMA 4FALA 2XISA 1XLFA 4J7RA 1OSEA 2PCQA 2ZR5A 9RUBA 4B5UA 3QM3A 2V5CA 3EWXA 4RR4A 2P0IA 4J1OA 3P8JA 3N04A 5I79A 2OEKA 3OZPA 4FLOA 1QDSA 5D9PA 4GI4A 4LS1A 1DHPA 4LH8A 3UXIA 4AHQA 3G8EA 4UOJA 3G0XA 3TCSA 2X0SA 4CQ9A 3VCNA 5FJRA 4GVHA 1F73A 4J3ZA 1EYWA 3W70A 1BYCA 4OVXA 2CLKA 1KGXA 3WMSA 5A6AA 3WIJA 3GNPA 4W7WA 1PX8A 1VH7A 1W1B1 4WY0F 4QJ3B 1QPNA 1TPH1 3GVVA 1QPKA 3PZVA 4RV3A 2WAGA 4CU7A 2XVKA 3KL5A 1UH3A 4JX4A 3BE7A 1TJ1A 1WBHA 3MUAA 4NP7A 3SB0A 3M0ZA 3H24A 3G6MA 3HGSA 6TAAA 3B4YA 3FJ4A 4QX4A 2W67A 1ITCA 3B97A 3F2DA 4YJ5A 3F2CA 2ISVA 1KWGA 3N4FA 1NSJA 4F0HA 2HS6A 4DJDA 3ARVA 3DKLA 1IT8A 3SY1A 4I7WA 3WQPA 1ISYA 1BVWA 1WDPA 1XIEA 4GXMA 3S1UA 1QNRA 4GUIA 2E6AA 4QP0A 5BRPA 2KE0A 1RXOB 3K4WA 3IVSA 1QCWA 2VC6A 3CU2A 1M7XA 3ARXA 5HPOA 1W9BM 3LCXA 3VNKA 1RY0A 1IWBA 3VTRA 1K6WA 3ANUA 4M0XA 3T05A 3V16A 3T0BA 3N11A 4NXKA 4C1NB 2QR6A 2OGJA 4OKDA 1MVYA 4DUVA 1KCKA 1KFCA 3WQDA 4JTCA 3W6MA 3UG4A 3W7MA 4JAWA 1IXQA 1V02A 1EGMA 3PUEA 3K8MA 4MPQA 1CXKA 2NQHA 2WZEA 1S3HA 1KCXA 1Q5MA 4ACZB 5IHSA 3OTRA 3H6OA 5JH1A 3I6TA 1SW7A 1JUBA 4LVBA 3PUDA 2ABBA 1KM2A 1GJPA 3T09A 1HL9A 1WXJA 3JYJA 1A5BA 3WD2A 2BY1A 2FAPA 2FIQA 3GFZA 4O8AA 4LRSA 4XUGA 3SRKA 3B8VA 2HZGA 1V3LA 5AVNA 3OHMB 1V6XA 3UNDA 3MHUA 3LXBA 4H01A 3S9ZA 2OO0A 3GIQA 4F66A 4FR6A 2NQ9A 1A50A 4HYWA 2ZXBA 3SCUA 3CEUA 1T7LA 1RQHA 2DQWA 4ZVJA 1W31A 1DIOA 2NT1A 3PAOA 4H9UA 2F23A 2XVNA 2GPTA 2QPXA 4MKSA 4GNJA 2RDUA 3FGCB 3QMTA 2DZAA 4CNUA 1W9DM 3TONA 3BSHA 2OX4A 4M82A 1UC5A 1ZUAX 4MTVA 4OHQA 1JCNA 2RDTA 4XKMA 4GLEA 4DLFA 3M47A 4NRRA 2VGFA 2IPGA 4UMBA 1LYXA 4GKTA 4C6QA 1H0IA 4K2SA 2O0TA 1ZNNA 2V6AA 3KABA 5FEPA 4J3SA 4WSJA 3RJXA 4DRSA 2BLEA 4Y9OA 3VNDA 1U5HA 5DANA 2GGHA 4CN6A 3IJDA 4GC3A 1TX2A 4IIFA 2WNQA 3ZQ9A 3RITA 2VT0A 3BLEA 1KBLA 2VDGA 3G1AA 3EZ4A 3CTTA 3MJYA 1XLCA 1PYFA 2O4MA 5K7JA 1NOFA 5CQ1A 2JZVA 4HBKA 1U83A 3L12A 1POKA 4IPJA 5LIYX 2QJNA 5C9ZA 3TYUA 2Z00A 1YPXA 2FDSA 6TIMA 1TWWA 4QISA 1CGYA 3O0FA 3U2CA 2CCRA 2DSZA 2NVAA 4AZCB 4GI9A 1XQKA 3F2BA 5CPSA 5HKGA 1IYXA 1D3CA 2WJEA 2Q8ZA 4NZ1A 1GTHA 2QV5A 3VNJA 1J10A 4KR0B 4LAOA 3CZGA 1A5LC 4GGHA 3NDYA 2UBPC 1XC6A 2QVHA 1FFRA 2J7FA 2IF4A 4ADUA 2ACQA 5EMLA 1K7FA 3HG3A 2QCDB 2CIPA 2CLLA 2IPJA 2B7OA 3TTQA 4ODRA 1SZGA 3VIPA 3BXWA 3SRHA 4X63A 2PDBA 3SO7A 4IMDA 1CB7B 1GVOA 3O5KA 2HXUA 5C6MA 2PC8A 4FOUA 2VKZG 2R82A 1U1UA 3W1XA 4P7NA 2X7VA 1EJWC 2VZVA 2HNHA 1S2WA 1FWDC 4KWWA 4IWWA 4US5A 4U84A 4X0NA 5J04A 5I2UA 1FWRA 1QASA 2DZUA 3HMJG 3NWRA 4X9SA 1A47A 4HNVA 1NELA 3PB2A 2XINA 1KGWA 1WA3A 3UJRA 2RUCA 1E6SM 5A8OA 1FUYA 3WQCA 2WQDA 4R9XA 2E8ZA 1UUMA 4P8UA 1VCVA 4GZ7A 3EB2A 4ZO8A 4KS0A 5AC8A 1OY0A 2HV5A 3NL6A 4F40A 1WUEA 3V0TA 5CG0A 2Z27A 3BZJA 4WGHA 4C6EA 2VCDA 1TRIA 4QQUA 1C91A 1JPKA 1H4PA 3VI2A 3ABZA 3VKKA 4HHMA 2X8RA 1Q6EA 3EEZA 1RCXB 4CQDA 4JKMA 2ZWZA 3DYPA 4ZQNA 1VCFA 3EB3A 3T55A 3LHVA 5A6MA 2W5FA 4Q8QA 3AZTA 3SM0A 2NQLA 4NZ5A 1LUCB 1Q6OA 1Z89A 1DKWA 1I2PA 4QLKA 1H1ZA 3QHNA 4XZLX 4EK7A 2VEKA 5TBOA 4YMZA 4JQAA 3G3DA 2FVMA 3LNPA 3H55A 3UZWA 2HJPA 2P8CA 3C3UA 1OG0A 5FSDC 1BKHA 1F74A 5CC6A 2B4GA 2DEPA 2KX9A 3TC5A 2J9XA 5GJNA 1RP8A 3IVTA 3IJ9A 1PDZA 2LPVA 2QDGA 1EP1A 4DF2A 1XBYA 1GVEA 4PEKA 1CEOA 3CGMA 4Y9NA 1TA3A 4ZOAA 2G4JA 2PTXA 3UI5A 2PURA 4J5NA 4AX6A 5DQPA 1HKJA 4M7SA 2OKTA 3ZIZA 3E2RA 3UEQA 2ZQTA 5JVLA 1K8ZA 1F07A 5FL1A 3AYVA 3W7NA 4FIRA 2DT2A 2XG9A 5CC3A 4JTEA 2GSHA 3LGGA 4LUSA 3KAIA 3N3MA 1T8QA 1UR2A 3NYZA 4DBSA 4C7FA 2E6DA 4Q4RA 1WKEA 1EWEA 3BLOA 1UBSA 1JQVA 3POHA 3QW3A 2PFHA 4NJKA 1S38A 1KFBA 4DBWA 3R8GA 2WMGA 1AZ2A 3UJFA 2W63A 5FJTA 3LQLA 2J78A 3TQPA 2FHFA 3BAJA 1F5ZA 2OCZA 3M7WA 3ES7A 1LZOA 2MUCA 4B2DD 3THQA 1U1HA 4Z0SA 3WQOA 1FHLA 4I6VA 3EOOA 1FHDA 1GQLA 1NDYA 4DX3A 3OVQA 2CLMA 1XYBA 4GQRA 3Q65A 3T78A 1WX0A 1WKDA 3HGRA 1EGVA 1XIFA 1W8SA 5J5DA 2ATSA 3AMGA 3G1VA 2PDUA 3PZGA 3KP0A 4QE1A 3KFTA 2PBCA 1TYGA 3A12A 4G50A 2WMKA 1LWJA 4LCQA 1ITQA 3O5LA 2Z0IA 3EX3A 4F9JA 4X61A 2CLHA 1MRAA 2X30A 2EJAA 2ITKA 3URBA 1W3JA 3QFWA 3H9RB 3IIOA 3RFAA 4E2OA 4KFOA 1Q7QA 5HNRA 3UWQA 3BLIA 4PBFA 2INEA 4U3CA 4J2MA 3B8IA 1XD0A 3U3HA 1N2VA 3WLIA 2W0UA 5T9BG 3CAQA 2K8IA 3S8HA 2FJUB 5CSSA 4A29A 9CGTA 5HQEA 3WKZA 4A8NA 3FAPA 2VX6A 4Q8WA 4C1LA 4NG3A 3NEVA 4D71A 1TV3A 2PDLA 1U30A 2PGEA 1IR1A 1J0ZA 4ZTYA 1JR1A 4WK9A 3PTDA 3SJNA 3WEMA 4UQBA 5ABFA 2PF0A 5D30A 5TD4A 1PZ3A 5I7GA 1I9CB 4F0RA 4DJEA 4HA3A 3AFBA 4MMWA 4C6FA 4DY1A 2YZRA 4QROA 1E0XA 3IS4A 3W1RA 1MEWA 1X7IA 2FPYA 4TV6A 4EX4A 3GVGA 5G1TA 5XIAA 2XIOA 2QPSA 4TVUA 1LBFA 4PTVA 2YCLA 2WZMA 1R7AA 1P6CA 4LOCA 5I3FA 5D04C 3L4VA 2ODOA 3A3XA 2VUNA 4DNMA 3OLGA 1RALA 2OOFA 4HPXA 2OEMA 1ME9A 3W00A 3VIIA 4CUCA 3LPGA 4HZ8A 2J7CA 4AC1X 3G0UA 4DH0A 1SPQA 4AHOA 2PPPA 4NX5A 3B8SA 3O3RA 3SN4A 3RO8A 3TSMA 4LS2A 1GVIA 3H53A 3EA2A 5DT7A 3LM3A 3UGRA 1E6XM 1GG1A 1OVDA 1EOMA 4GCXA 4HT3A 3UA4A 2SFPA 3QEZA 5L9FA 3V5FA 5I09A 4REQA 2VI0A 3VNLA 3VNYA 1V7YA 4J35A 3HPFA 1KWKA 3POCA 1MI3A 1M03A 1LL4A 4HBEA 3ANYA 1NDZA 3AMKA 5GNZA 4DYEA 4QSHA 1VJSA 2WSYA 3TW7A 1HO4A 4RE0A 5REQB 3UBPC 4ZXLA 2Z25A 2WVVA 1VF8A 2ZQSA 2H9AA 1R85A 1W3IA 2QCEA 3VGEA 5K9DA 1ZS2A 2V81A 3PVFA 4H9XA 3QSRA 1ZJAA 3LA4A 3P80A 2HPIA 1OX4A 2QULA 2NSXA 3WH6A 2B0MA 2Y85A 1WAUA 2FZBA 5DX7A 1FKHA 3XIMA 3M41A 2XFFA 1E3ZA 3T07A 2EPHA 1Z42A 1N7KA 1I1XA 1K8XA 4K68A 3PG9A 1OC7A 3TMLA 4OFCA 4HOZA 2J24A 3QZ6A 2E1DA 3KVLA 4X2PA 3GY1A 4IL0A 2IXVA 3GHSA 5CG7A 2P4VA 4WKAA 5M3WA 2V82A 4F0KA 4YN5A 3VNIA 3AYRA 3QY8A 4GE8A 5FJOA 1DIEA 3MZ2A 1I2QA 3WSUA 3MZNA 1V0MA 1TIWA 2HK0A 2VELA 3K1DA 2E5CA 2X42A 4ACYA 1ZP4A 1I4NA 4KEMA 2WZTA 3EKGA 1QVBA 2H8XA 2AOSA 2VD8A 4ZQCA 2YYTA 1CXEA 3OGRA 1BD0A 1A4MA 2GJXA 4XZNX 1O4UA 5LKYA 4IQJA 3LZ3A 1FDZA 4RE3A 4FXSA 1F3EA 1K77A 3W1MA 2ZE3A 3GBEA 3TIMA 5KTLA 1RK6A 5LIXX 1F8MA 1MEHA 3KUMA 4XD6A 2WK2A 5CCZA 5HMFA 1EZ2A 1TMLA 5G5IA 1GZ1A 1ZAIA 1IE7C 3SCPA 1W56A 3WDQA 5XIMA 1R3RA 4ODPA 3VKDA 3V7PA 1FKTA 3GHRA 4R88A 1HIZA 4FOKA 3UR8A 3PF3A 4IGHA 2OWWA 3LCFA 1LBLA 1M3UA 4XKYB 3JXVA 3OYXA 3M44A 3GQYA 4H8VA 2X0HA 3REQB 5ECVA 3CLWA 5TIMA 3MHGA 1QOPA 3CV1A 1VFMA 3H7RA 1UR4A 3W81A 2J66A 4Y7EA 1PSCA 2OO6A 3TWBA 3S6TA 2I1OA 3CV7A 1OADA 3GU1A 3COTA 4PFHA 4ECLA 4C6KA 3BJTA 1NDWA 3FSTA 1U5JA 3WZ0E 1TX0A 3ARZA 1ICQA 3W83A 4DZHA 3VUPA 4LBRA 2W9MA 3GW3A 2ZQ0A 3BO9A 3WLOA 3W1UA 1UD8A 1XL9A 1X1OA 2E6YA 4MM1A 2ZQVA 3MMUA 4DRMA 4LBSA 4QDPA 1TCDA 2JE8A 3GYCA 5KZMA 3GAKA 3QOMA 1QW9A 1A0DA 1S5NA 2CC0A 2P8BA 1GNXA 4BK9A 4Z2LA 4GYPC 1GOKA 3F5LA 2Y7FA 2XU2A 3FAWA 1E0WA 5RUBA 4LTSA 1FKLA 3SCWA 1NFGA 1T96A 4B3LA 1Q6FA 5G1MA 3RAOA 1O60A 3MVTA 2XUCA 3QC3A 2P76A 5D75A 3S0CA 3GDRA 1HKMA 2XJ7A 2YCIX 4TXEA 3GXMA 5E1QA 5HINA 7REQB 4UBPC 3AYSA 2EEXA 1FKKA 1RP9A 2GZXA 3QR0A 4S3CA 3NQCA 3C2EA 1S2TA 4MWAC 3C8NA 1S39A 3EXSA 1JRCA 3C6CA 2ZUNA 1ITXA 2CZFA 4DIPA 2VJXA 4Q8NA 1C8YA 4ZPWR 1OCBA 3QFEA 3WENA 1E70M 1X1NA 2Y6ZA 4O16A 4GVGA 3WNPA 4I7VA 4EPBC 3L68A 2G37A 3N4AA 4EWJA 1KR0A 3I6RA 2D9FA 2ISDA 3GXFA 1R2TA 4RW5A 1NF7A 3PG8A 3IKDA 3JVAA 1E4NA 4N9EA 2WSKA 3M4HA 2OU4A 1BRLA 1PIIA 1QW7A 3O5EA 3VM5A 1C8QA 1SO3A 3HMCA 1PZ0A 1A7XA 4AY7A 4DZAA 2C18A 3SFWA 3M0HA 3ZJ8A 3USBA 3FS2A 4AWTA 4CNPA 3IHZA 2CLPA 3GM8A 3UNTA 1TTIA 3CK5A 3UZXA 3T08A 3TZFA 1DJXA 2OQYA 2CLIA 4KEUA 1AH0A 1KBIA 1UMYA 2AQVA 2WVTA 1IZJA 2OX1A 3I3EA 4HMCA 4O17A 4O1BA 1BQCA 3H23A 3SIZA 3RK8A 3NURA 3VMNA 3WD0A 1NOWA 2HEJA 2P5NA 3AXXA 4AWEA 4PCTA 1J2BA 3PULA 4IL2A 3I6CA 4IFKB 5JQ9A 2GVGA 1E43A 2ZTJA 1EO5A 4C6JA 1PXGA 1A3WA 4EANA 3CGNA 4YHGA 3BCDA 3GG8A 1JCTA 4HCHA 2DUZA 4IICA 2ISSA 1XD1A 4V1YA 3DUGA 5DY2A 2ZUVA 4CQCA 5A6KA 2D0HA 2DH3A 1ALDA 1EJTC 2DFAA 3USZA 3N6HA 3H2OA 1F6KA 2OLSA 4Q32A 2VX5A 3WLJA 3MI3A 1R8LA 4GNKB 3TP4A 4DROA 1O66A 3KOWA 3TN3A 2D1ZA 1XDJA 2CERA 1JF5A 4TMCA 2EG8A 4C91A 5EMYA 4DEFA 2WHMA 1M53A 5FL0A 3W85A 2V8ZA 1M65A 5I07A 3E74A 1ZFJA 4HMDA 1YXYA 3H2CA 3VOCA 1EF3A 4LRTA 1J79A 1US0A 2BP1A 1AH4A 4HCDA 1DWJM 1YNQA 2O56A 5CLWA 3PAJA 4HKPA 3MKKA 1PBGA 3IIPA 5J6EA 4HA0A 1AG1O 4B5XA 3ZVHA 1MZHA 1P0DA 2DZVA 4HK6A 3R2GA 1P7TB 1BWLA 1AW2A 3DHDA 3AXHA 4R33A 3VO0A 4AFYA 3GXDA 4KW2A 2ALRA 4DPQA 4DBUA 4OE7A 2EJ1A 3EMZA 2GOUA 5GNXA 3M0VA 1EBGA 2ZRVA 3EWCA 3W75A 3RYSA 3C0JA 3K1GA 2YPIA 3GDMA 3CB8A 4O15A 4GD0A 2Q8LA 3TFXA 1UD5A 4JFMA 4FEZA 5CPNA 5LGXA 3GDKA 3C86A 3THUA 1LOLA 4PTWA 2PLKA 5H8UA 5BU6A 3TQVA 4B4FA 3H21A 3H4GA 1WE5A 1IEIA 3VE7A 4N4PA 1KNWA 1EDTA 3VINA 3CZJA 1TWDA 5D9OA 4DZ3A 5CEWA 3W7PA 1ZHAA 1OJXA 4RKAA 4INFA 1CLXA 2GLKA 2V68A 2NQ5A 3EX4A 2VXNA 1TPC1 1H7XA 4UTUA 4AD4A 3OZYA 4XTIA 2YKKA 2ZA2A 2TODA 1AD1A 1CPUA 2PWFA 1ZGDA 2GWGA 2WSQA 3ZR6A 1CIUA 2YA0A 1NM9A 5FA5A 4F4RA 2QCMA 3HQPA 1JDDA 2Y89A 4JYSA 3LHZA 4IPIA 1KLYA 3S1WA 1Z48A 2X40A 1OF6A 5C2GA 4LAMA 2X7WA 3A3HA 4JTQA 1XQLA 2Z6IA 3HA1A 2VZUA 4G7EA 1EZWA 1R9ZA 4J4NA 4EKJA 4L7ZA 4EACA 1WDRA 1U33A 3WLSA 4B2DA 1F6YA 4YIWA 2YX0A 1Y5XA 4H2HA 1FCQA 2GGJA 5AC4A 1YTDA 1FKXA 1ZBWA 1YDVA 4PODA 3ITGA 2DY3A 4FXJA 5DFAA 4DI8A 2DW7A 1ESWA 1W1IE 3FFSA 3O07A 4ZZ9A 5BWFA 1AVAA 3BMXA 4IQEA 4MNJA 1O1ZA 1K03A 2PBOA 3WK0A 4WDWA 1A5MC 3J7HA 4JBRA 3V5OA 3BAXA 3KRUA 5LHEA 4RE4A 1M01A 3UVAA 4MDPA 3MC5A 4UB9A 4AZGA 4NRSA 1VS1A 1Z8AA 3WD3A 3UVIA 3W02A 4D6CA 3KAHA 5FF3A 4QG8A 2DDXA 2HROA 1XHGA 3LPPA 3NO5A 3NPWA 1D8WA 1MRQA 4QJ4B 1ONEA 1PV8A 1ZJBA 4JTGA 1Z3NA 4XBSA 1RCOB 4W9PA 2IPFA 1JCXA 4DJDC 4AZBA 4G7FA 1W3TA 5HT1A 2V5BA 3W29A 4AD3A 4NZJA 3PZQA 1E15A 4AVFA 1GK8A 4ROQA 3VILA 1IR2A 1TV2A 4WKHA 3MDYB 3A24A 4B3ZA 1G9HA 4LYQA 2C6QA 3DHFA 4ZFMA 4GG9A 3UPBA 2VVNA 1FTXA 2GJRA 4KIRA 4L9YA 5BXPA 3M5ZA 1TB3A 4RJEA 3S6OA 3TNOA 2QEZA 4MLJA 3S5SA 3RLVA 1CXFA 2ZTKA 1XPGA 2FZDA 1TPVA 3S2LA 3U0HA 4UQEA 2VZTA 1H5VA 1TPB1 2WSPA 2PA6A 4NY2A 1Y7VA 3QZAA 3C8FA 4G1NA 3TTYA 3VD9A 3OVGA 3TU9A 1XLHA 3UY8A 1HTIA 1TR1A 1HXJA 1SSGA 4HSNA 4G2PA 1WDSA 1OFAA 4I6KA 3AO0A 3EWBX 2Q3RA 2QKFA 2F2KA 3R79A 4F8XA 5EBUA 4O1EA 2P53A 1R47A 1FRBA 3AROA 2INFA 3OU8A 1HKIA 3P60A 3MQTA 4ZS6A 4JKKA 4C1NA 1VYRA 2ZX9A 1R3SA 2PWGA 1F8AB 3KCJA 4DI9A 1BWVA 2J47A 2QJHA 5L6UA 2JGQA 4DWSB 4Z0JA 3RLGA 4JZ5A 4EOUA 5CC5A 5HWBA 4ASTA 4BQ2A 4IX0A 1F61A 1O95A 3ZLFA 1BF6A 4HU3A 2QAFA 5C9RA 2RUDA 2JKAA 1J0HA 1QFEA 3EOUA 2G95A 3DGBA 2IKGA 3D0CA 3TCEA 3L0GA 3CLMA 4CN4A 4PMNA 4U2ZA 4B9YA 4IP5A 1ECQA 2F6XA 2R6OA 1QPLA 1YLVA 4DN1A 3JZEA 4PFMA 1NJJA 1CXHA 1OK4A 2J6XA 3BPWA 2Z26A 2GQ3A 2D2GA 1PIFA 5DCEA 4BHYA 1EKOA 2PODA 2RSEA 1JI1A 3MV11 1JDEA 1A80A 3WK1A 4W93A 1UR0A 2ONEA 3WEOA 4D8LA 4K37A 2ZUMA 1JZ8A 1J96A 5DBUA 3WFLA 3LCIA 3KRZA 1W2VA 4HNCA 3W53A 4ZB5A 2IQDA 4Z2HA 3IIZA 3NQ6A 2Y7DA 4L4LA 1QJWA 1VGAA 3BMWA 4AD0A 1YNPA 4J3TA 4V28A 3DFOA 4QHRA 4YL2A 3WQFA 1AUSL 1YXCA 4IUGA 3W7EA 4KBXA 1UQZA 2YXGA 3JU2A 4RX0A 2FVLA 3WUGA 4JTAA 3PZUA 3O7UA 1FKJA 4WDXA 4Z2GA 3O63A 2Y7GA 2WPGA 3TW6A 3VIHA 3D6NA 3W26A 3T8LA 1TELA 5HMSA 2A6NA 3BW2A 5T91A 3L5LA 1KTBA 5G4EA 4BF8A 2CHNA 2J7HA 3C0LA 2EHHA 5HATA 4H9ZA 1TKKA 2A3AA 4X0VA 3WNKA 4W8AA 4K36A 4D6JA 1VBJA 3QYQA 1YHTA 4FB7A 5LNWA 4N6FA 1Q3NA 1UWRA 3HJEA 1XIJA 4A8IA 2VC9A 4JFLA 5D02A 1UW9A 1NP2A 3D3AA 5HWJA 5FCZA 1YIXA 5DIUA 3CB3A 3H22A 1S2VA 3BAYA 5K9XA 4PCPA 4Z2KA 3KW3A 1ML1A 3CZKA 4DF1A 3O6AA 1XBZA 1ROTA 3OA5A 1PWMA 3U6WA 5HPCA 2VGBA 5CGTA 2FHBA 5HA7A 3P67A 2XPKA 2CU0A 2I9EA 4TW6A 3ZT6A 3QGVA 3H54A 4AY8A 1UG6A 2Q6ZA 5K4ZA 1HKKA 3WLNA 1HGYA 3F1QA 4HHPA 4LFYA 1HP4A 4LC8A 1Q7ZA 4HN8A 3TUUA 4OT7A 4DRKA 4DWDA 2HTMA 4H9VA 3G5EA 3LTSA 4ICCX 1WOBA 2WPBA 3TDFA 4RDVA 1EHAA 4BA0A 3PA7A 5CSYA 4MIMA 4CQBA 4K1GA 3W3OA 4PUUA 4C65A 3CIVA 1VLWA 5DMYA 3H2MA 4XAGA 5I3KA 4JTTA 1OFPA 1GT8A 2FLIA 2PS2A 1RBOB 3IJQA 3V3WA 3F4CA 4OOUA 1XR2A 5C5YA 2QPUA 3TCZA 1E6PA 2PDXA 3ABQA 3BLLA 1YATA 3NSNA 4C6LA 3N73A 1UP2A 4RZ4A 2XVLA 1E4MM 1P43A 1QPFA 2PDNA 4AAJA 4ML4A 3QZEA 4IT1A 3NFUA 1GOIA 1K8CA 1FWTA 2VFGA 1XBVA 3LUOA 4RNHA 3EBVA 4E38A 2VGIA 2XP4A 2DZPA 3W1AA 3M5XA 4W5UA 5IBXC 3ITVA 1EP2A 1XLDA 4GABA 2QUTA 1RA0A 1SJCA 1BGGA 4KWSA 3VOGA 1TSIA 2VOTA 1GPFA 3KVMA 4JIHA 3TYCA 1FP9A 4UNIA 1QI0A 4GUHA 3I4KA 4DAIA 1KM1A 3LUTA 4JTIA 3RJYA 1QI2A 3PFMA 4NU7A 4LF1A 3GWQA 4A3RA 3R89A 2VCCA 8A3HA 5DO8A 1KXHA 3EX6A 1UWUA 2JBMA 3DCPA 1XX1A 4H6KA 5HWNA 1KV8A 2VZSA 4D6DA 3NQEA 5G2HA 3L65A 3W2UA 2XGZA 1L6GA 1AD4A 4JYDA 4LBUA 4UTJA 4RLIA 4N0RA 3CYJA 1OEPA 3THCA 1O68A 4L1GA 3ZT7A 4UTWC 2Y24A 4Q8PA 4JEQA 3W6YA 2MANA 3IRDA 1FDJA 1UIOA 3C2RA 4HD5A 4C5ZA 1VBGA 1GOWA 2NWSA 4QDMA 2E68A 3BW4A 4NJIA 3FA5A 1RA5A 3VU2A 3BCFA 1KRAC 3AUOA 5TQLA 3UESA 4O12A 3JS3A 3O5PA 2E09A 2GSJA 4JTJA 3MP3A 4LUJA 3E9AA 2ADAA 3FYPA 3EKZA 1OX6A 3HZ3A 2VURA 2DG9A 1MDRA 1XGZA 3AHYA 2OFJA 1ZQ5A 4PTNA 3SSJA 3CUZA 3FXGA 4K38A 2H3BA 1WV2A 1K9TA 1HJUA 1R9YA 2WWDA 3WH0A 4KH2A 5EY5A 1XYLA 2ZRUA 1E9IA 3FGCA 1RAKA 2XYLA 3GIYA 1NMWA 1DJNA 3W88A 4NYYA 1OIFA 4W85A 3PBVA 1LOSA 2J4GA 2RDWA 3DAQA 5LA2A 3W73A 1R9XA 5AYIA 1C9HA 2W27A 4AYSA 3QKEA 2XH7A 2EGZA 2PP3A 1BXCA 4OU1A 4C6NA 2RKXA 4HARA 1E56A 3KS5A 1NH6A 3DFNA 2VWTA 4Q33A 3VOJA 4XAYA 1JF6A 1LG2A 3OO2A 2HXTA 1GOMA 3AJ7A 3WK2A 4IQCA 3KAFA 3BGJA 2V2CA 1Y0OA 1Q13A 2HE5A 1ME8A 4N9CA 3HPZA 5DMMA 1JD7A 3LXCA 3SR7A 3GG7A 4KESA 2IMRA 5A2AA 3OW1A 3W76A 4G9PA 4IJCA 3IARA 3FJLA 2XDFA 5IHRA 3FKKA 3T0CA 1QNVA 3R4IA 3FDKA 3AALA 3HIJA 3T2QA 1X6LA 1GQIA 5FF7A 2OZ0A 3RIKA 2FJKA 3MPGA 2ZZ4A 5E93A 3IAQA 3U7BA 4XG1A 1IHIA 1VEOA 2A4AA 1GZGA 5E6YA 1ELSA 4AYGA 4RDYA 3QGKC 1R0MA 3W7HA 4WQ6A 2X1IA 2ZZ5A 1YW1A 1RJRA 2BMBA 3LPFA 3DENA 4RZBA 3VOFA 4XZIA 1WNOA 1Z44A 3HG4A 4JIQA 4XZWA 1NTHA 4R53A 2E0PA 1OFBA 4GQ0A 4XK2A 2PGWA 3WF1A 5FI8A 2GUBA 2V67A 1X39A 2ZVIA 3CV6A 4ZGYA 3LRKA 4X60A 3WLTA 2WNNA 1P0KA 2A1YA 3TFCA 3IGHX 1KXTA 4LUTB 2ZXDA 5H8MA 4E8CA 7CGTA 2C0HA 2D3NA 3N12A 3WFZA 2W4XA 5C54A 3G22A 3O2LA 2JEQA 3NGJA 1F76A 3S5OA 1REQA 3KDOA 3R5EA 4JFSA 4OECA 2V63A 4EAYA 4O28A 3QJAA 4WRHA 3ARSA 1DJYA 5GQBA 1VBUA 4S3JA 4M7TA 1VLIA 3RU8X 1SFSA 3WJWA 1QI5A 5G2WA 1F2JA 3T9PA 1DWIM 2PP1A 3JZUA 1B4EA 1YPFA 3L0KA 2CXGA 3BCJA 2WANA 3O9NA 3RGTA 2UZ9A 3IGSA 1TIMA 1P7TA 4LX4A 3T0TA 1UKSA 2V2HA 3VYLA 3FJ6A 1IT0A 3WDHA 1R5YA 2H3DA 1T11A 3XINA 3SJ3A 5I3HA 3MHFA 4CGTA 1XINA 4MZ8A 1RY8A 3LG3A 1CENA 4IGMA 2QJIA 1Y0EA 3BMBA 4O8RA 1ECEA 1J8VA 4JNMA 1E1EA 5AHNA 4IJRA 2W91A 2ZR4A 1ZJIA 3B7XA 4MY8A 2ZXQA 1EWDA 3V36A 4OWGA 1XIDA 1A5SA 1XRTA 4QT2A 3ISIX 4R7JA 4GZJA 3S46A 2QCGA 2WJDA 2Q01A 4KETA 4P7RA 3WUEA 3AHXA 2RGLA 1M68A 4LUSB 1A3XA 3S3GA 5DELA 2XIQA 1SFLA 3GFYA 4PTDA 2F84A 3M1ZA 1TE6A 2OTDA 2UY2A 3ELFA 3UY7A 3W1QA 3LM7A 5C9UA 1WXYA 1EQPA 1YTKA 1XH2A 2ZE0A 3BGAA 2GGEA 4PR4A 3QV7A 3GNDA 4BF7A 3VABA 1S1RA 3LSCA 3DBPA 2BGSA 4C90A 1BTMA 4UIOA 3DYMA 4W4QA 3APYA 3DG6A 1MO0A 4S2BA 4L9XA 1WPCA 3GNXA 5D2WA 1LLOA 2CHOA 4GGQA 4Q7NA 6A3HA 3EOLA 4PMXA 1XPYA 3MWCA 3VIJA 4BEUA 4RUBA 1JDCA 4JL2A 2AKZA 3K8KA 2TSYA 1XGEA 3MI2A 3PK7A 5JH2A 1IIGA 1A5AA 3OG3A 1D9EA 3CASA 3PM6A 3E0FA 2V5DA 3G77A 1ENUA 1JVWA 2OOGA 3PP7A 3UU0A 2DP3A 4AU0A 5I02A 4UFKA 4NILA 4BJHA 4G56A 1XLLA 3OZMA 1XRFA 3UF9A 2VFEA 2Z2AA 4FNUA 1F3WA 5CPLA 4PC8A 2ACSA 4C6BA 3DEQA 3M0LA 4S3FA 3GH5A 4P5UA 5LIUX 3E6EA 4LNYA 3S1XA 5I77A 4PBEA 4ZQRA 1XSIA 2VX4A 1YRRA 2J88A 3H8AA 3CQKA 3SURA 3NQDA 4LWWA 4ZOEA 5HW7A 1IXOA 2DZTA 3ICJA 4IQLA 3KCOA 1PB0A 4E4UA 4WEVX 4AZCA 3VGDA 1G6CA 2UY3A 4MYAA 3IPWA 3LTYA 4U33A 3QN3A 2M08A 2BZNA 4B4HA 2DIJA 4P7LA 3LERA 1F4HA 3VPLA 2ACUA 4YPJA 5BZAA 4U4MA 2ABAA 3KADA 2WV8A 1J5TA 1UKQA 3UJEA 3SW6A 3L5MA 1UJQA 1S2AA 1TFVA 3VDAA 3KWSA 2CESA 2QLYA 4YVVA 5E6ZA 1YMYA 3RR1A 4ZTXA 2FQIA 1TRDA 1J93A 3IANA 4AWUA 4O0ZA 1K6AA 2CYGA 1MQRA 4DRHA 3D5HA 3M64A 1QNQA 5BWAA 4YTRA 1FKBA 4FNTA 3RO6A 1DPMA 1B3ZA 2DPEA 2O4QA 3ATZA 5BYWA 3ABSA 4UQCA 2PGFA 3TOYA 4DRIA 1LWHA 4GNVA 4XIAA 3MMDA 1FWIC 4AMAA 4GY7A 3SUVA 1TR9A 1MNSA 4QZVB 2X1RA 3PRDA 4XV0A 3W1NA 2AAMA 3AISA 2NX1A 2WJFA 3AXIA 4JTUA 1XLIA 5HJLA 3B9AA 2YFOA 3ES8A 3QV8A 1BSLA 1NAL1 3LV5A 2C0AA 7REQA 1SM9A 3NZGA 4GOAA 3WLRA 2CLOA 1B57A 3MWAA 2ZCGA 3F4DA 5CZSA 5EGRA 1M5WA 5H1WA 3GXNA 3TC3A 4KGLA 3M0MA 3WBWA 1LRTA 2A0NA 1J01A 1DQWA 3QF0A 7ENLA 6PTDA 1GQKA 4D8AA 1ONRA 4YVXA 4V1XA 2G41A 4FS9A 1OCJA 3BICA 5C9WA 4HU4A 3RMJA 4IPLA 1QOXA 2F2DA 3AS3A 2QUMA 3KL0A 2I5GA 1X38A 3