4WKHA

Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (1mm) at 1.05 a resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
369
structure length
368
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTENDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitotriosidase-1
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 133
structure length 368
sequence length 369
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wkhA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wkhA01
2G3JA 1JYNA 3FY1A 4WLCA 4AC1X 2ZUVA 5CSYA 3OZOA 3SCTA 1KXHA 3ZSTA 2V38A 3VX1A 4P8XA 2BFGA 3VMOA 3F5KA 1I1XA 4LPCA 5I78A 1V3LA 2W66A 3GYCA 2DGAA 3MMWA 4EAMA 1BYCA 3UEQA 1AVAA 3WUFA 1TG7A 1JDCA 2DSZA 1D3CA 3LMYA 1OIMA 5D9OA 4GI8A 1LQ0A 5E6YA 5ECUA 1AQ0A 1UYQA 1E3ZA 3M6DA 1HNYA 4LYQA 1HJSA 2QMJA 1GQLA 1X6NA 3BCFA 1CGVA 4QP0A 1XSKA 1QBBA 2VMFA 1KBBA 4TVCA 3PZOA 1MYRA 2BY3A 3CH9A 3BAJA 4WSJA 3VDAA 1BGAA 1UKSA 1VBRA 3MV01 3CUFA 1TZ7A 2A3AA 4S3KA 3ARTA 4B3LA 4ATDA 1LJYA 3N17A 3ZT7A 1V3KA 1OD8A 2DH2A 3AIVA 5KEZA 1BFNA 1C93A 2VQUA 5C8BB 4XUYA 4TXEA 3VD5A 1CXHA 4LX4A 3OIHA 3LPPA 1QNPA 4CCDA 3VIPA 2WAGA 2WSPA 3L2LA 1I1WA 2WW5A 1D2KA 1K9TA 3VD7A 1KGUA 2EPOA 3IAPA 4H7VA 1CGTA 3CZGA 1W3LA 4GI6A 3VIKA 4J28A 4E8CA 1ODZA 3T2OA 2CEQA 1DWHM 3WH9A 4MB1A 1G5AA 2GJRA 3S2CA 3BAKA 1L0PA 2D0HA 4NI3A 2J7CA 4AZGA 1HJVA 4PMYA 3OLGA 3F5JA 3ZR5A 1C8XA 1V3MA 3WD3A 1V3JA 1D7FA 2E8YA 4JKKA 2E3ZA 5DO8A 5A8OA 1KWKA 3WF0A 3I3BA 5BRPA 3OGVA 1OD0A 2WMFA 1GHRA 3L4VA 4D6HA 3UG5A 3VGGA 4EK7A 2V3EA 3DHUA 1GOWA 1PPIA 4N0RA 3L2MA 4U5IA 1EIBA 1UH2A 2CBUA 5EFFA 1CWYA 3T0AA 4GIAA 4UZSA 1V6VA 3SEPA 3WFZA 4XZBA 1GCYA 2NT1A 4J3VA 1E55A 4ZE4A 4WKAA 3II1A 1XYZA 3VIIA 2JEPA 3BCDA 3F5LA 2A3BA 3WUEA 3PZ9A 1B9ZA 2XFRA 1A3HA 3RO8A 3L4ZA 3VIFA 1XH0A 4PMUA 3ARSA 4BQ2A 1R7AA 3W25A 4PMQA 1J0KA 2BY0A 2QPSA 3KL5A 1WDRA 2J8FA 1VFOA 2XPKA 2VT0A 1J0HA 4M1RA 1MFUA 3NCOA 4D6GA 3NSMA 2X2YA 1G0CA 1TE1A 1J0IA 3K8MA 2O9TA 1GZJA 5ABEA 3SUWA 3WN6A 1AQHA 2CKRA 3L4WA 3MMDA 1WZLA 3A47A 1HVQA 1UD4A 3K4AA 4IM4A 5ABHA 2OSYA 1UKOA 4QCFA 3W6LA 1VF8A 2BXYA 3WNNA 2YA2A 4NRRA 2VNCA 4AISA 2G3IA 1E6SM 4D6FA 2VX7A 1M01A 2CETA 1Q6DA 4PMRA 2E0PA 1CLVA 5I5RA 1TVPA 4TOQA 4AIEA 4HA1A 1A47A 3A4WA 3S6TA 1C3FA 3AIEA 1TUXA 4OOUA 2VCAA 2IXVA 3VKKA 2GSJA 3QOKA 2XVGA 2EXOA 2J77A 4GQRA 5A6BD 2CCRA 5HPOA 4U2ZA 4X0NA 1B2YA 5JIWA 3A4XA 2WBKA 3ARUA 1GOKA 2FGLA 4A3HA 1UA7A 2OYLA 1MWOA 1KBKA 1R85A 4YHEA 1V3IA 2IXUA 3OBAA 1E56A 2YLLA 1W1PA 2YOCA 1EQPA 3OLEA 1WNOA 2XM2A 1EH9A 4OBRA 2CBVA 2ZUNA 1H49A 3WF3A 3WQ4A 6A3HA 1RP9A 3MO4A 2YIHA 1H4PA 4W87A 3AMLA 1EOKA 1QHOA 4F8XA 3CUJA 1DWFM 4AZBA 2J7BA 3WDRA 4J3WA 2DSWA 2WWCA 1GORA 3QHMA 1KQZA 1RPKA 1KR0A 2XFYA 4QLLA 4B16A 3WEZA 1KXQA 3SCVA 2BY1A 3WDQA 2ZX8A 4JCLA 4DM2A 2VX4A 3MMUA 5CGMA 1FOBA 1PZ2A 2WLYA 3VUPA 4GXPA 3MUZ1 2W92A 3ALGA 1TVNA 2QV4A 1PIGA 3WL1A 1ZBKA 4EE9A 2WCAA 1B90A 1BVZA 5E9AA 1FP8A 3HJEA 3VOCA 2QHAA 5BWFA 1TFVA 2CESA 2X0YA 3RCNA 2EEXA 9CGTA 1XRVA 4MPKA 4HTYA 4OZOA 3WDPP 1LL6A 3KZSA 4ZXOA 4W86A 1FH7A 3WUBA 4UFLA 2EQDA 1KXTA 3A6OA 2VCBA 5C70A 1K9DA 4JZ5A 3BAIA 1E72M 2GK1B 5IHRA 4WJXA 3NYDA 3ARWA 4Z2IA 1LLOA 1CTNA 3ZJ6A 2WPGA 1QHPA 3WDIA 2XUCA 3LPOA 4KH2A 2J62A 4F66A 1HVXA 5JH8A 1DWIM 1E0XA 2WVTA 1I75A 7TAAA 4WK9A 1V02E 2YLAA 1P6WA 5A6MA 5CG0A 2EPNA 4AZ5A 1GONA 2BV9A 1W9BM 3AS0A 1UD5A 4ZFMA 1HP4A 4PMVA 4D6IA 1JGIA 3UG3A 1S46A 3ARZA 1LL7A 2VVSA 3OA5A 2PBOA 2W61A 3VM7A 4JFWA 4WIWA 4W93A 4HMDA 4GO9A 1ISYA 4UFHA 3GNRA 3AHXA 1KQYA 1FH9A 3K8KA 4EANA 3K4DA 2GJXB 3AFBA 4UR9A 2YBUA 1XGZA 2DH3A 1PBGA 5A1AA 4W7WA 1V0MA 1JYWA 2ZX7A 4KWUA 1MQRA 3HMCA 2RGMA 2VCCA 1J18A 1BVNP 2W62A 1W91A 3LPGA 2WMJA 2WZIA 1H0IA 5I77A 4H8VA 1LWJA 1XC6A 1QI0A 3AISA 3NDZA 1UG6A 4X9YA 4DUWA 4M8UA 1BTCA 4AD3A 4H41A 4DM1A 1EHNA 2JF6A 4PCTA 3BAYA 4FLRA 4PMNA 6TAAA 4DWSB 3T09A 2V3GA 1QNOA 5JBDA 3RJXA 1WZMA 3GH4A 2Y2WA 4JIEA 1WP6A 1XCXA 1OGBA 3AMGA 4FK9A 1PEZA 3GBEA 1F4AA 1XH2A 1E71M 4A4AA 4L4PA 3VD3A 4KMQA 1WO2A 2VZOA 1CDGA 3L4UA 1MXGA 1E6QM 2WXDM 3B9AA 1EGZA 4GZEA 2OSWA 5A95A 3T0DA 4LXFA 4D72A 4D1IA 4GPNA 4J7RA 3VU2A 5I3DA 1J10A 3WH8A 2FDMA 4AW7A 4Z2JA 4M24A 3U5UA 4J3XA 4XB3A 4MNLA 2VJXA 1NM9A 4K68A 1MW1A 2YDQA 1KFWA 1ITXA 3FXYA 2E40A 4P8WA 1U33A 1R86A 3DECA 3W24A 3CZ8A 3RM9A 3RMEA 1UZ4A 5A6SA 4PYSA 2J75A 4PUDA 2OLHA 1UR2A 3QOMA 1LWHA 3WD2A 1CGWA 1MW3A 1VRXA 5BXRA 4AZHA 3WEMA 2GDVA 1W9UA 2F2HA 2VTFA 4GZJA 4PTMA 1X6LA 2PWHA 3VTRA 1UR1A 2YL9A 2Z1SA 3PTQA 4GINA 4V28A 1DEDA 1VENA 1UWTA 1UH3A 2BHYA 4P8VA 1JAKA 5CPTA 1V02A 1HJWA 1JI2A 4MNJA 1VBUA 1UD8A 5CPSA 4A3YA 2DDXA 2ZUWA 3WQ5A 2JEQA 2ZWZA 2V5DA 1V08A 2JE8A 1VEOA 3MUIA 4LYPA 3GBDA 1XH1A 3MSGA 1ZU8A 1DWJM 5BXTA 1JZ4A 1Q6CA 3W38A 2X05A 3VGDA 4ML4A 2J4GA 3T2QA 2W67A 4P7NA 1L8NA 3WSUA 1JZ2A 5E0FA 2CXGA 2CBJA 4HOZA 3MSDA 1UKQA 4JFUA 2VZUA 2CNCA 4HMCA 4P7QA 4NZCA 1E43A 4H2CA 2XYLA 4B9YA 3WNMA 2VX5A 4XZWA 4UOQA 3RM4A 2WANA 3BMWA 3OG2A 3WEOA 1EDQA 1EXPA 3K1DA 1HL9A 4UOJA 1W3HA 1JIBA 3AXXA 4HU0A 4H8HA 5DT5A 2WWDA 1CNVA 3E1F1 4R27A 1BSIA 5EB8A 7A3HA 3MS8A 4DWSD 2X8RA 1KXVA 1LF1A 1UH4A 2ESCA 1U30A 2DSKA 3O9NA 2FHFA 5AY7A 1XSJA 3EMCA 3L4XA 5A2AA 1R8LA 3K8LA 4HZ8A 1W3JA 2WHMA 3CO4A 3WNPA 1E4IA 1JDDA 4HOXA 2O9PA 4GQQA 3WD4A 3PZMA 1HN1A 4PCSA 1GVIA 2ZIDA 4JFVA 1UWUA 3N13A 2WHLA 4AEEA 1VB9A 3WH7A 4HA3A 1B31A 3TP4A 4B15A 4UFJA 2AAAA 2HVMA 3VVGA 1GVYA 3AIWA 4NRSA 1XHGA 1V3HA 4HOWA 4E2OA 1JZ5A 4W7UA 3BLPX 2BXZA 3PTMA 1C91A 1JG9A 4PTWA 2QF8A 1ODUA 4UFMA 1ISXA 3AMKA 1J0YA 3CTTA 3ECQA 4CU6A 1OT2A 2CBIA 4LQ1A 1JZ7A 1JNEA 4UQDA 1OIFA 2WC4A 3RDKA 2UY5A 3AIBA 3W4RA 4BF7A 2E9MA 1E9LA 3WD1A 4X0VA 5A6BA 3AZTA 2WMGA 3PN8A 1OB0A 1DP0A 2V3FA 1QOXA 5GPRA 3WBEA 5DFAA 2J79A 3W0KA 1UA3A 4JAWA 1ESWA 4C7FA 1QI3A 4ZENA 4OJYA 3AXHA 6CGTA 3F4VA 2YBTA 5HNNA 1QNSA 4UTFA 3PZNA 3NIYA 1PX8A 3SUVA 1CGUA 1J9YA 1W2PA 3WQVA 3ZQ9A 3ZSSA 1F4HA 2PF0A 3EDKA 4ZXLA 5I2UA 8CGTA 2F61A 1HJQA 2WBGA 3ZT6A 2D22A 1E70M 5GNZA 2X09A 2WHKA 1NOFA 2VZVA 3UR8A 3NUKA 3RPMA 2AMGA 2XM1A 4FLSA 1HXJA 4DUVA 3VIJA 3ZJKA 1HL8A 2UWFA 4CD8A 1B0IA 4PSRA 1W2VA 3PZTA 1JL8A 4CU8A 3VDBA 4W88A 1VFMA 1C8YA 4M80A 3VNZA 2DT0A 3CMJA 1CZ1A 2E9LA 1UQZA 3SCRA 1QHZA 4PRWA 1J12A 1M53A 3W6MA 7CGTA 2ZICA 1MQQA 1E0VA 4V2XA 1XD0A 3BMVA 5CJ5A 2X0HA 4ATWA 2YL6A 3JUGA 4UQEA 4TTGA 4OKDA 3UERA 1TCMA 4QCEA 5ABFB 4B3KA 4IPNB 1E6XM 2J7GA 2XVLA 2BNJA 2G41A 4P7LA 4Z2LA 3BC9A 4BS0A 5FL1A 3GM8A 3WY1A 1TA3B 2XTKA 1W32A 2WYSA 1XYFA 4F9JA 2BHUA 2Y5EA 1HKIA 2CKSA 3PZVA 3WUGA 1FHDA 3WIJA 2D2OA 2J74A 3MKKA 2WKLA 4Z2GA 4IPLA 4C7GA 4N42A 1UR4A 3GXFA 1QPKA 2XG9A 2WCSA 4AZ7A 1UD6A 3O2LA 5AC4A 3W27A 3UG4A 3W26A 1CLXA 2V5CA 3WMBA 1KGXA 4WKFA 1VIWA 2A3EA 1JDAA 4HMEA 1O7AA 2CHOA 1VAHA 1CECA 1AQMA 4CN6A 1EO5A 3WENA 5F7UA 1M7XA 4E8DA 3ALFA 3VDCA 1JFHA 5A2BA 1V6WA 3CUGA 2OWCA 5HOSA 1ISWA 3RILA 4AZCB 1HF6A 1KWGA 1GW1A 1V0KA 3MANA 3FAWA 1M04A 1CGXA 1Q4NX 4RL3A 3B8SA 4RE2A 3AS1A 1MQPA 1VJSA 3N11A 2JALA 4UNIA 1E4LA 4CVWA 1J0JA 5GNXA 4AZIA 4MJ2A 1TMQA 2UY4A 3CMGA 3U57A 5BCAA 1B3VA 3ZMRA 4CVUA 2G4FA 2E4TA 2WVVB 4MDPA 1HJXA 1CIUA 3FNDA 4QLJA 4AIUA 5A6LA 2QPUA 1GJWA 1QI2A 4ZEPA 3O6AA 3AIQA 3CZEA 4H04A 2A3HA 2CYGA 2YDSA 4HPHA 1W9DM 1BLIA 3TONA 1QVBA 4ACZB 2D20A 5EFDA 3GNPA 2NW0A 4P7RA 2VVNA 3NSXA 3SUUA 3BAWA 2DEPA 2NSXA 3CIVA 2YKKA 3POCA 1HT6A 1Y7VA 2YA1A 1JZ3A 1G9HA 2JFEX 3WQ6A 2OWXA 1ECEA 3WMSA 2ZXQA 3MU7A 1DTUA 1C90A 1V0LA 3VGBA 1UD3A 2D3NA 3ZM8A 2ZX9A 5HXMA 2WK2A 3EMQA 1RP8A 3MUY1 1BGGA 4CD7A 5FCZA 5A8MA 3T0BA 4ACYA 5C71A 1DWGM 1HX0A 5EMYA 2GDUA 3RJYA 1NOWA 4DUXA 4HZ7A 4PMDA 3U5YA 5D9PA 1JI1A 2WNWA 3WBAA 4D71A 3IK2A 2UY2A 2VC9A 3CZJA 2VI0A 3KL0A 1KCKA 4GZIA 4AY1A 3SUTA 3A4AA 4PMOA 2WMHA 4PMZA 2Z1KA 1C92A 4U31A 1AMYA 2PC8A 5E6ZA 3VX0A 1E3XA 1EQCA 2PWGA 2W63A 3IJ8A 3ARQA 4AYSA 2PWEA 1EOMA 3WDJA 5FKYA 4JFSA 2PB1A 1H09A 3L4TA 2UY3A 3AIRA 2FH6A 3AQUA 2Y8VA 3W28A 4UFKA 3PZIA 2GUYA 4TVUA 2QMKA 1BQCA 1EHAA 1LG1A 2GK1A 2TAAA 3D3AA 3POHA 3AIUA 3WL0A 1Q6FA 3GH7A 4GO8A 1H11A 2XSAA 3M46A 1EDTA 4D6CA 3B9DA 3M07A 4YPJA 1V6UA 1K9EA 3J7HA 5D9MA 1UR9A 3SIMA 4AD2A 4PTVA 4UQCA 2BS9A 2PWDA 1FFRA 1E5NA 1CXLA 3AYSA 4CN1A 5LA2A 3RIKA 2XFFA 4CD6A 3EDJA 2D0FA 3PZGA 4GI9A 5D8WA 3KE0A 1NP0A 3AS3A 4HU8A 3CHDA 1XV8A 2PBGA 4CN4A 3PZUA 2VO5A 1WDSA 5FOOA 1UQYA 1JAEA 2XIBA 1E1FA 3AHZA 3FHAA 1FA2A 5JBFA 1BG9A 1K6AA 3WKZA 4YHGA 5BRQA 1HKJA 3GXMA 3WFLA 1QI4A 1NP2A 1G1YA 1UHVA 2GJXA 3M7SA 1NWSA 1WDPA 2OYMA 1WPCA 4AD5A 3FN9A 2WMIB 3SCOA 4URIA 4F9DA 2CHNA 4W5UA 1GQIA 3FAXA 1VEPA 2WZHA 4MB3A 2XHYA 4KGJA 4P7OA 2V3DA 1R87A 2YL5A 1J0ZA 2WCGA 1BPLB 1UWQA 2Y24A 3AZSA 5TD4A 1KR1A 5D9NA 4UCFA 1PX4A 2FHBA 5DF0A 3LPFA 1EA9C 1UKPA 2ZUTA 2QLYA 4AD0A 3WQ8A 3VD4A 5M3WA 3WMCA 4DWSA 3CUHA 2J47A 3DYPA 5DMYA 1E73M 2EBNA 2FH8A 4QAWA 3CUIA 3GTNA 4J3UA 4HA4A 5JIPA 5IFPA 3TTOA 2ZXAA 4NSBA 4YN5A 1OINA 3KL3A 5FL0A 1MVYA 1OGGA 2FGZA 5FD0A 3SCNA 2EPLX 1E1EA 3I3DA 4W8LA 2J7DA 1J11A 3BH4A 2JIWA 1OM0A 1ISZA 4V27A 1QNRA 1LG2A 3G6MA 4FLOA 2BVTA 2O92A 1SMAA 3GZAA 3DHPA 3DC0A 3ARPA 2A3CA 3SCWA 1X1NA 1UR8A 1KGWA 2ZX5A 4TVDA 4AZ6A 1E40A 4UOZA 4E4PA 4MNMA 1RH9A 4AMCA 3B9EA 4CD5A 3WH5A 3VIMA 1MW2A 2J25A 5A8NA 2YJQA 2O9OA 4QLKA 5D8ZA 1FH8A 3AJ7A 4Y7EA 3CBWA 3N12A 5GQBA 1JNDA 3L4YA 3U7BA 3EMZA 2ZUSA 1NWTA 5E70A 4JKMA 1WCGA 1IZKA 5KZ6A 1W9XA 1QW8A 1W1YA 4MAVA 4D1JA 3EDEA 1V0NA 3CHEA 2VURA 1TR1A 4MTVA 3CHCA 2BVYA 2C8NA 3GNOA 3WF2A 2VRKA 1E4MM 3PZQA 4U33A 2J7FA 1N82A 4ZE5A 3BLKA 3N1AA 5DT7A 2BVDA 5I6SA 4AXNA 3MV11 2WVSA 4KRUA 3N18A 2XGBA 1IZJA 3THCA 3ARXA 3AHTA 3T2PA 8A3HA 1DHKA 1JZ8A 5JUVA 2JIEA 1GQKA 5AYBA 1PIFA 4BA0A 3G6LA 5E0CA 1B3YA 1C8QA 2VX6A 3OGRA 3SCQA 3TTYA 1JF5A 1CXKA 5AC5A 2Y4SA 2VOTA 1BAGA 5CGTA 2BY2A 1UWRA 1JF6A 1JFXA 5CLTA 3WD0A 3OLDA 1CYGA 2VR4A 3UESA 4CUCA 1SMDA 2ZUUA 3UR7A 2DPEA 1WKYA 4CGTA 5D4YA 2EJ1A 3DYMA 3BSHA 4WF7A 4OIFA 4LGXA 1HKKA 1GOQA 3ZIZA 2CERA 3D5HA 3SCUA 4JHOA 3VPLA 4AIOA 1GPFA 1LL4A 4R5EA 5HBFA 3GH5A 3WH6A 1BYAA 1QI5A 5IFTA 1EDGA 1HIZA 1W1VA 3IJ9A 4MNKA 4XV0A 2XJ7A 1ZBCA 1NQ6A 2ZOXA 2OSXA 1YQ2A 1MXDA 2D1ZA 2WSKA 4OOZA 2DSVA 2OYKA 4CU7A 1BYDA 5A6JA 1V6XA 4BZYA 2OWWA 1W3KA 3VDHA 4EKJA 4MADA 2XSBA 4CCCA 1FHLA 5CXPA 2EO7A 4WSKA 3AOFA 4LYRA 1B3ZA 4PTXA 1CENA 4JCMA 4UQAA 4NF7A 3U7VA 1NWUA 5BXSA 4HPGA 5LA1A 2XWEA 3VILA 5BXPA 2VZTA 3KWXA 2XGIA 3WNLA 4IISA 2B31A 3IJ7A 3HU7A 3KEHA 2VR5A 4QFUA 3AROA 1WAWA 1OSEA 2YDRA 1MW0A 4Z2KA 3VIOA 3ZJ8A 1W1TA 3NDYA 3QHNA 3AS2A 5BROA 2YL8A 1UWSA 3CLWA 4BQ4A 2ZX6A 4CD4A 3VGHA 1NARA 5M5DA 1ISVA 3ZR6A 2DT1A 1OT1A 3QHOA 1QNQA 2CITA 1JYVA 4CCEA 2Q8XA 5IDIA 5I79A 2DSUA 3NSNA 3W82A 4DWSC 2HISA 4L4OA 2XVKA 2VZSA 4W7VA 1CXFA 4TX6A 1HKMA 3A3HA 4UZUA 1NOUA 3ARYA 3AMDA 4JHZA 1OWQA 4TUFA 4U3AA 1VEMA 1V03A 2RGLA 5DEZA 4GKLA 1GJUA 5HDRA 3W29A 1IT0A 3VIGA 3VD9A 1WZAA 2WHJA 1NWRA 2CPUA 3ZOAA 2J78A 5A3HA 1JD7A 1WB0A 1GOMA 4XX6A 2ZXDA 1NH6A 1WE5A 4B9ZA 4Q22A 4U2YA 3EDFA 5A69A 4FMVA 4TTUA 3GXDA 5ABFA 2ZWYA 4W5ZA 4F79A 2W91A 5EBAA 1CXEA 2ZUMA 5A6KA 1SFSA 1V6YA 4JL1A 2GJPA 3GXIA 3W81A 3SCPA 3QR3A 1TA3A 1ZJAA 3WF4A 4ATLA 3DYOA 3W53A 4MAZA 1FP9A 1VFFA 1B3WA 1K9FA 2Y8KA 1SYTA 4PN2A 3N15A 1G01A 5LA0A 5HPCA 1GQJA 1OCQA 1ZBWA 3IAQA 5BYWA 3BGAA 1ZJBA 2E9BA 1H0GA 3GDBA 1E6NA 1UWIA 2J7EA 1GUVA 1G94A 4JFTA 4M56A 3WNKA 1UD2A 2WVUA 4P8UA 4W85A 2YA0A 1C7TA 4PMXA 3APGA 3WQWA 3SUSA 1W9PA 1E6PA 4J3TA 4U3CA 2WLZA 3TOPA 4M29A 4RE4A 1BHGA 3CZKA 4FLQA 3EYPA 2F8QA 3WELA 4UQBA 1JXJA 3NJ3A 4W8BA 4AEFA 2PI6A 1IV8A 2ZE0A 1E4NA 1H2JA 5CZKA 4AZCA 1GOIA 1H3GA 1GHSA 1ZL1A 3CGTA 1Z32X 3VO0A 4OUEA 3BSGA 5CPQA 3FW6A 4H8UA 3ZJ7A 1Q6GA 2BHZA 2EPMX 5I24A 1BG4A 1HP5A 1FFQA 3K46A 4W84A 4TX8A 2W4XA 2WMKA 2WVVA 1JYXA 2DQXA 2IUZA 3VMPA 3EDDA 1ZB5A 3ARVA 1CEOA 1UR0A 3AHVA 2G8ZA 4OBSA 4Z2HA 5ABGA 3VGEA 4ACZA 5A6AA 3SURA 1MFVA 2X1IA 4KGLA 1HJUA 5A8PA 4UFIA 2VQTA 3TA9A 3VNYA 5A8QA 4BCEA 5E09A 4D6EA 1JZ6A 1CPUA 4AWEA 2VRQA 3ARRA 4U5KA 2GVYA 4KRTA 3T08A 1CBGA 3VGFA 1PJ9A 2XVPA 3N04A 3BXWA 4MB4A 3EBVA 3UETA 5A2CA 3OZPA 3OGSA 4C7DA 4PUEA 1E0WA 5IXEA 3AXIA 2O9RA 2C7FA 3CPUA 2NT0A 1B30A 2E8ZA 1VJZA 1XD1A 4AD1A 2WC3A 2JF7A 1W9VA 1C7SA 2D0GA 4D6DA 3AMCA 4PBGA 1QW9A 1WZKA 2C0HA 2DIJA 5CQ1A 5M03A 1OBAA 2D23A 2WB5A 5GNYA 4JL2A 4IUGA 5CSUA 3THDA 2G3MA 5CLWA 1UKTA 2AOSA 3WF1A 1US2A 3WNOA 3AYRA 1UZ1A 1BYBA 4HZ6A 3RM8A 2DT3A 1VFUA 2DT2A 2XIIA 1J01A 1XSIA 1B3XA 3IANA 1H41A 1JD9A 2WM0A 1CGYA 1KCLA 1PAMA 2WC7A 4BQ3A 4Q7NA 3TTSA 1SR0A 4FF5A 4JKLA 2J8GA 3OLIA 3ZO9A 2VUYA 3QGVA 4WKHA 2D24A 3SCSA 5AYIA 3N9KA 4MJ4A 2J7HA 5JBEA 2PWFA 4M82A 1ZBVA 2G3NA 2XWDA 4HP5A 4MDOA 1OGSA 4W8AA 1H5VA 5LYRA 1UUQA 2EPKX 3VM5A 1XCWA 2VRJA 1H1NA 1BF2A 1EO7A 2D3LA 3ZT5A 2VL4A 4J27A 1E6RA 4S3JA 3PBGA 4PEEA 4UQ9A 4CKQA 4D6JA 1RD6A 4RE3A 3W37A 4MB5A 3AHYA 5I0DA 3CZLA 3MUAA 5FIPA 3AZRA 3CHFA 3FHQA 1GNXA 5I23A 1US3A 1PX3A 3I3EA 4PSPA 1KB3A 1U2YA 2XVNA 1PZ3A 1R7OA 3BAXA 5A94A 1ZS2A 2CIPA 1ITCA 2GFTA 3WDHA 3AI0A 2WKGA 4BQ5A 2DIEA 1E15A 1WDQA 1JXKA 1Q6EA 1E6ZA 5M17A 3VMNA 3AICA 2ZXBA 4J3SA 3UCQA 4AD4A 1B1YA 1O6IA 2W5FA 1QBAA 3PHAA 1M03A 1GOOA 1CXIA 4W89A 3PTKA 3VIHA 3TTQA 2WZEA 1DWAM 3OB8A 1E5JA 5IHSA 4M81A 4QDMA 3HN3A 2FHCA 2MANA 1UOKA 3VINA 2WMIA 1YHTA
chains in the Genus database with same CATH superfamily
2QW5A 2NX3A 2ZUVA 1KXHA 1QPLA 2V38A 3QBUA 4N9DA 5E9XA 3EPOA 2Y7EA 3GYCA 2DGAA 1MUMA 1XIFA 2FMOA 2PRHA 2DSZA 1ALDA 4O1AA 1OIMA 5D9OA 1ADOA 4ZFCA 2ATMA 4H8NA 1ZCOA 4U28A 3GPKA 1AQ0A 1UYQA 3NL3A 4G1KA 3DBPA 4B90A 4H19A 1HNYA 1XDLA 3UF9A 1GQLA 4ZO8A 4DRNA 3BCFA 1QBBA 2DP3A 4TVCA 3E3HA 2HJPA 1BD0A 3K1GA 1VBRA 2XFWA 2ODOA 2A3AA 4TYOA 2PF8A 1P5QA 1YE6A 1EJVC 1LJYA 4KQZA 2DH2A 4S3BA 2OGYA 5KEZA 3W7EA 2DW6A 1A5SA 2REQB 3KVKA 3S6OA 4ZQPA 4MYXA 1QNPA 4CCDA 1JR1A 4NNCA 3QSRA 2KZHA 3VKBA 4QR6A 3MWAA 2WW5A 4GXWA 1G7UA 1D2KA 1K9TA 4TNSA 4NX5A 4A29A 4KERA 1W3LA 1LBFA 4GI6A 4J28A 1DWHM 3GR4A 3WH9A 3O5RA 2QDHA 4GWEA 3MZNA 4AVOA 4ZTXA 3LA4A 2JGQA 4NI3A 3S47A 1C9DA 1O1ZA 1TWWA 3PVFA 3A13A 5LIKX 3ZR5A 3UZYA 4WVXA 1FKKA 3VABA 4QG9A 3I6TA 2E3ZA 1BWVA 1XLJA 5DO8A 3NAVA 2TMDA 2WMFA 3N2TA 1Q66A 3UG5A 2CXEA 4G8TA 3W1MA 4DF2A 4B5VA 1EJWC 5D38A 1EIBA 3UVIA 3HO8A 4HK5A 3T0AA 4GIAA 2Y85A 1PO9A 1PKLA 4XZBA 2ZQSA 1S3TC 3LX9A 1ECQA 4NP7A 3RITA 1GVEA 3LLXA 2G0WA 3LK6A 4ZE4A 1OG6A 1VC4A 1AW2A 4NYYA 3QN3A 1VPXA 3RLGA 2YCIX 5LSMA 2NX9A 2B7OA 5F2IA 2GSHA 2XFRA 6REQA 4AEOA 1KRMA 3HPXA 4YL2A 3K13A 1N7KA 1ONWA 3IIZA 4AWTA 4QAIA 5JH2A 3SRFA 3A24A 1YNYA 4PMQA 3TC7A 1CX9A 1VFOA 1OC5A 2QGYA 1V77A 3MT1A 3PG9A 3NCOA 1TIMA 4H3DA 4L6DA 3S9IA 2Z27A 3F1QA 1XCFA 3V7PA 2P3EA 4REQB 1GZJA 4IWWA 3SUWA 1JPKA 3MMDA 1LUCB 4LCRA 1HVQA 1UD4A 3NPVA 4PUUA 2OSYA 1UKOA 3M7WA 1VPYA 3INPA 3WNNA 4NRRA 2PTYA 3TXZA 1PV8A 4XZLX 1JCNA 3TMLA 2NXIA 1ADSA 1E6SM 3ES7A 2VX7A 4E0CA 2E0PA 1OFPA 1I45A 4TOQA 1FWAC 1A47A 3S6TA 3JVAA 3AIEA 3WJZA 5DBUA 1RJPA 1NSGA 1UP3A 4AVFA 4QSHA 2CCRA 4U2ZA 5JIWA 1Z41A 1GOKA 3HBLA 4RX0A 2OYLA 3ANVA 1MDLA 3LQLA 1TPEA 4LVBA 1R85A 1V3IA 1WUEA 3MYOA 4Q33A 3N2OA 3OVGA 3NURA 2YLLA 3L2IA 1TR9A 2CBVA 2ZUNA 6A3HA 1I0DA 4HSNA 5FEZA 2YIHA 2VEGA 3AMLA 4IGHA 4F8XA 1VFSA 4EAYA 4JTKA 3CUJA 4LUJA 3BOLA 5K9CA 3TAOA 2WWCA 3G8RA 1KQZA 2QKFA 3RF9A 3WEZA 1KXQA 1UC4A 3WDQA 3QYQA 4DM2A 4GX9A 1PZ2A 3S83A 3H2MA 4GXPA 3MUZ1 1TCDA 3ALGA 2OEKA 4S2CA 3SJ3A 2QIWA 4ZO7A 3BLLA 2W27A 3LV5A 3EX3A 1FP8A 4MUPA 2QHAA 3E12A 4WHBA 3UYIA 3GDLA 2LLEA 3TV8A 2EEXA 1XBXA 4QEEA 2R1MA 4L4MA 4MPKA 4OZOA 3KZSA 4IT4A 5EPDA 4W86A 1XIEA 3SSJA 1S2WA 1MMFA 3M5VA 2EQDA 3M43A 4IPIA 2ALRA 4LAXA 1K9DA 4JZ5A 3BAIA 5FJUA 1Q1CA 4LYKA 2XP4A 2ZRUA 5IHRA 3NYDA 3STFA 3NQEA 4XZHA 4BKNA 2FVMA 3GFYA 1LLOA 2ZDSA 4W9TA 2WSYA 4GVHA 2CZDA 2ZA1A 2AAMA 1QHPA 3TVAA 3BDKA 4KH2A 4HJWA 4PZVA 4R9OA 4F66A 4RK8A 4NZ4A 1UR3M 4AQLA 1RQEA 1TRIA 1SW0A 1I75A 3M0LA 1V02E 4R33A 2QR6A 2BV9A 1W9BM 4DJEC 3WK0A 2D73A 1NSJA 3OOQA 4LU0A 4YYFA 1YW1A 3UG3A 2PBOA 1TTPA 1KM2A 4JFWA 3EXTA 3NQMA 2NQ9A 4FIQA 3GNRA 4N19A 7PTDA 2BWGA 4UR9A 2NLYA 4POCA 3BJTA 1UUOA 3UR5A 2QDGA 5D2XA 3M1ZA 4ERIA 1MQRA 5DCBA 1J18A 2W62A 1H0IA 4K36A 4H8VA 1LWJA 2QJJA 3Q65A 2HPMA 4CQBA 1XC6A 1L2UA 4LUTA 4DUWA 4M8UA 1HO1A 3IGXA 4MSPA 1TPC1 4FLRA 2QZRA 3U0HA 1FWGC 3B8VA 2P0OA 3RJXA 4BI7A 1WP6A 1OGBA 4IPXA 3AMGA 4FK9A 1ZRQA 1Q7QA 3LENA 4MMWA 1DQXA 1MEHA 5EY5A 3VD3A 3L4UA 1OX4B 3IGUA 3SQSA 1F9CA 1PXGA 4UR8A 3T0DA 4LXFA 2YCLB 4HU4A 3QV9A 4GPNA 1J10A 1QZ2A 5GJMA 5DXYA 4M24A 1EB3A 5C55A 3U5UA 4LALA 5MKGB 4S3FA 1Q6OA 2NQLA 2V2DA 1EEPA 2VHLA 4P8WA 1U33A 3W24A 3EWZA 4FPSA 4DEFA 4PYSA 2J75A 4PUDA 4L65A 1QPQA 3LN3A 4ZB5A 3TTEA 1TPWA 4L7ZA 4M51A 1B9BA 1DJGA 1VRXA 4ZOCA 4MFDA 5BXRA 1SO6A 1P1XA 4IMCA 4ONVA 1VCGA 2DZUA 3TW7A 4GZJA 4JTGA 2PLMA 1X7FA 1X6UA 2Z1SA 3VKDA 3RGTA 4JQ2A 4LUSB 4P61A 4S23A 3NWRA 3LUTA 1VS1A 3UQIA 4W4QA 1HJWA 3MQTA 1LLWA 2NV1A 5HJXA 2HK0A 2ZWZA 2V5DA 1V08A 4LYPA 4XUGA 1XH1A 4XAFA 3QLLA 2ZR5A 2DZAA 3EOUA 3ZLGA 3LRMA 4MG4A 3VGDA 1AA1B 1X8CA 5E0FA 2F23A 4JTCA 5AZ1A 3K30A 3UF8A 5K9DA 5AZ0A 3QH2A 5D32A 2Y78A 4HMCA 3DI0A 3KBSA 4P7QA 4IP4A 1TQXA 4B9YA 4UTWC 3LCHA 3WNMA 4XZWA 1KM6A 1FKLA 1TJRA 2HE5A 1JPHA 3WEOA 3LY0A 5EU9A 3P3BA 3XISA 3EB3A 3GDTA 2FPVA 1W3HA 2QS8A 3G3MA 4ROQA 3AXXA 2WWDA 5EB8A 3E1F1 4OUIA 4R27A 3QZAA 4K38A 1ITQA 2X8RA 1LF1A 4TQTA 3L0GA 4NI8A 2H8XA 3O9NA 4DXVA 1XSJA 4CEXC 2CZEA 3F4DA 3L4XA 4HZ8A 1W3JA 5AC6A 1E4IA 1JDDA 3CYJA 4HOXA 2O9PA 4GQQA 1PYFA 3PM6A 1ZZMA 1Q7ZA 2WPBA 2QEZA 1NY1A 2Q6ZA 2ZIDA 1UZHA 1I6NA 2WHLA 3GXPA 5BNKA 1IIHA 1N1AA 1B31A 4WX2A 4UFJA 4DXKA 2X1TA 3VVGA 5FEWA 2G95A 3EWXA 4ES4A 4G5DA 1GT8A 4GVGA 4IMGA 4WOZA 4GRSA 4TMCA 5EMKA 1O5KA 1JRBA 2FZ9A 3BLPX 1VYSX 5HA7A 3UWYA 2Y62A 4UCGA 5FJIA 3CTTA 4B91A 2RHGA 4CU6A 2CBIA 4GXMA 1JZ7A 5CJMA 2REQA 2UY5A 3EEZA 4C6JA 1WXZA 3KRZA 2PDPA 1S2CA 3GXNA 4IL0A 3P67A 1O5RA 4O53A 1XKJA 2ON3A 4IIGA 8TIMA 4F2BA 4JAWA 2FZNA 1JDEA 4JTJA 4GOAA 3IIVA 3AXHA 4JTAA 5HNNA 2HK1A 3PZNA 3W3OA 3KRBA 3ZQ9A 4GHRA 4CNSA 3VK5A 2HE8A 4L72B 5HT1A 5C9WA 2F61A 4JN7A 1NOFA 2VZVA 4MUZA 1SW7A 1VZWA 3ITVA 4C91A 4DBWA 1I2PA 1HXJA 2JK2A 4H00A 4H83A 2UWFA 3ODKA 2IPFA 4XKYB 4C1NB 1XQKA 4LAKA 5HW8A 4W88A 4M80A 4Z17A 2E9LA 1V5XA 1QHZA 1IT8A 4JN6A 3W6MA 4UNLA 2ZICA 3GR7A 3NEVA 1XD0A 3FVMA 2X0HA 2YL6A 4DRIA 1XWYA 3HF3A 4UQEA 5FJRA 4TTGA 3UERA 3OG3A 2PODA 3G18A 1ME7A 1I60A 3N34A 4O10A 3EX4A 3MI6A 1OHLA 2GUBA 2E6FA 2PS2A 3WY1A 1TA3B 2A6LA 3Q37A 2CLLA 3ANYA 2Q5AA 3MWCA 3SDOA 3WUGA 3RUBL 1GG1A 1FHDA 1YDOA 2V81A 1MEWA 3GXFA 1QPKA 3GS6A 4HCDA 3LU2A 3W27A 3UG4A 3W26A 2V5CA 1XDJA 3B06A 4ZSUA 1JDAA 2HPIA 3NTPA 2CHOA 3E9AA 4ZPVR 2Y89A 4REQA 1VAHA 2HQAA 3CL7A 1UP0A 4DELA 1LUCA 1BKHA 4B5NA 3EPNA 3C8NA 3C2EA 5F7UA 4AU0A 4E8DA 3DG7A 3GU9A 4LB4A 4R53A 5J5RA 1V6WA 4IF2A 1LTDA 1XBYA 1LRNA 4GA8A 5D2WA 3FGCB 1T96A 4CNOA 1W17A 4N4PA 1IR2A 3PBWA 3GVWA 4Y8FA 1F3EA 1MQPA 1E4LA 1U1UA 5GNXA 1SZFA 2VENA 3OBKA 3RU8X 4Y90A 3CB3A 4B5UA 1HZYA 5BCAA 2GGEA 3OO2A 3RO6A 2E4TA 3W73A 1HJXA 3FNDA 4AIUA 4C6LA 5L9FA 4V1YA 4ODRA 1QI2A 4XVDA 4FX6M 3USBA 3O6AA 3CZEA 1S2VA 3CEUA 3TONA 1QVBA 3SADA 2D20A 3LHUA 4X60A 3SY1A 1LYXA 3W84A 4BFAA 5CAKA 3WLIA 1R46A 5F4XA 2YKKA 2QJHA 4DY1A 1R38A 4ZOBA 2PDKA 4ZVJA 6ENLA 2OWXA 1PTAA 4XG1A 1XBZA 3WMSA 3NO1A 2ZXQA 3IVTA 3MU7A 1C90A 4UTIA 4BK9A 3SGUA 3ZM8A 4X63A 1W1B1 3T0BA 4ACYA 1DWGM 1HX0A 2GOUA 4DUXA 4HZ7A 1TB3A 4QG6A 2X1RA 2BOGX 2WSQA 4Q8QA 2JGYA 2Z1BA 2PDJA 1FHVA 2VC9A 3CZJA 4L56A 2DUZA 4FXSA 3CQJA 4IGSA 3WQEA 2PDHA 3A4AA 2PDGA 4HNOA 4IGMA 2Z1KA 1R3QA 1FWCC 4UTJA 4MZ8A 2WSRA 2EHHA 3MDUA 1AMYA 3KS5A 4KFPA 2PC8A 3F4CA 1E3XA 2PWGA 3BZGA 5EA9A 2FZBA 1KFEA 1VH7A 5HWBA 4JFSA 5DCEA 1VLWA 4RZ5A 1Q8AA 4U85A 1JVNA 1Y0EA 3PZIA 3KS6A 1UJPA 1BQCA 5AB3A 1KLZA 3D3AA 1N2VA 2NX1A 2XSAA 3UGRA 4D6CA 2UV8G 3B9DA 1V6UA 1GVQA 4MYAA 4UQCA 2PWDA 3NQVA 1YBQB 3R8RA 4CN1A 3RIKA 3EDJA 1XYAA 5HW7A 1A50A 4GI9A 1S2AA 1IIGA 4HU8A 2ZA2A 4Q4KA 3TW9A 5B7ZA 5KMYA 3K4WA 1P48A 1FUYA 4OBTA 2VFIA 4PL1A 5G4WA 1P0KA 4ZTYA 1BG9A 1K6AA 4ZBCA 4MLRA 3GXMA 3MUCA 4EP8C 1NP2A 2J88A 4O8AA 1WDPA 3FN9A 4URIA 3TJLA 5IOBA 3GHTA 1XLHA 2XHYA 4S3GA 1D8WA 3BOFA 1J0ZA 2YL5A 4QJ4B 2Y24A 2FTYA 3CAVA 5C7VA 4IXHA 4IJBA 3DGBA 4EPEC 1B4KA 1F40A 1EA9C 3LG3A 4C6IA 1S5NA 5HUPA 3V1HA 3DAQA 3VD4A 3L0KA 1TPFA 4GYJA 4NJGA 3KAHA 3VI2A 3CUHA 4W9OA 3KACA 5C7HA 3LHTA 3P81A 1DJNA 2FH8A 2FQIA 1JCXA 3OHIA 5D2TA 3GG1A 1QW7A 1TRDA 4QAWA 3URQA 3UWWA 3GTNA 2HVOA 3URBA 5HWMA 5JIPA 3R79A 3KTSA 4GE8A 1MUCA 4NT0A 1S1RA 4NSBA 1OINA 3MA8A 3CH0A 4IXXA 3KL3A 5FL0A 4O28A 3L0NA 4RV8A 1MVYA 1OX4A 4TW6A 1LORA 1SO3A 1HXVA 1PDYA 1XGEA 1FJDA 4Y6GA 2EAWA 3BSMA 2I5QA 3I6RA 2YCLA 3PJWA 3TC3A 1XJBA 4FLOA 5C5YA 3QM3A 4GJ1A 5TQLA 4DIAA 2O92A 2WJEA 3AALA 1GKQA 3DC0A 4P2VA 4F2UA 5F4WA 5MKGA 3SCWA 1X1NA 1UR8A 4ZQMA 4XIMA 3OVQA 2ZX5A 5LIYX 4UIOA 4UOZA 1T99A 4O50A 1RH9A 3C5QA 2F9RA 4CD5A 3WH0A 3R5EA 1GJPA 5A8NA 5H91A 3JW7A 2BX7A 2O9OA 1TWZA 4QLKA 2TODA 3SQLA 3F4WA 2FKEA 3O5QA 3CBWA 4XBSA 3ZWSA 4ALDA 5LGZA 3KADA 4LAWA 2PP0A 3EOEA 5LNWA 3IKDA 4FSAA 1G67A 3W1RA 2ZUSA 3ABZA 4KIEA 1Q6QA 5EYWA 4JKMA 4LUSA 5KZ6A 1M5WA 2J6XA 2V0TA 3EDEA 1F8IA 2GVLA 4ORIA 4JTLA 4BI6A 1F6PA 4LUYA 3MB9A 2VRKA 3NRKA 4U33A 5FEXA 1N82A 5XINA 3DFPA 1SQ7A 1JCTA 3BLKA 5MHBA 3RRAA 3OZYA 5I6SA 2H6RA 3MV11 3QTPA 4KRUA 2ZZ5A 3THCA 2RAGA 3TC5A 3L67A 3NQ2A 3USZA 8A3HA 1JZ8A 1FXQA 4KCUA 4HNCA 1GQKA 2NVDA 3HQ1A 4FXRA 5E0CA 3FYOA 2VX6A 2VR2A 1TV3A 1X97A 3SM0A 2X1UA 1K77A 1JCMP 2Y4SA 2ZE3A 5CGTA 1K1DA 2RSEA 5HNUA 1JF6A 3DFOA 1AH4A 1CYGA 2VR4A 3UESA 4DHGA 1FWWA 4EPKA 1E9IA 1XFCA 4LF1A 1PINA 1TV4A 3A9IA 4TMBA 4NJHA 2ZUUA 4JTDA 2DPEA 2ISWA 2Z24A 1WKYA 4W9PA 1ML1A 3BSHA 3W2NA 3HG3A 4PFHA 4LGXA 5FA5A 1ZQ5A 3WQOA 1XW8A 1OYCA 3SCUA 5I00A 3N4EA 4JHOA 1LL4A 3H53A 3BTNA 3N2CA 2HTMA 4DO4A 1WKDA 4OHQA 2VWSA 3IJ9A 4Q8PA 5AOUA 3E2RA 2OSXA 1YQ2A 4CQDA 4I90A 4CU7A 2XP9A 1BYDA 2ITKA 4JX6A 3OJGA 4EKJA 1B5TA 3M0IA 3VCCA 1TJPA 3AOFA 4LYRA 1CENA 4UQAA 2ZZ4A 4OT7A 1NWUA 1HGYA 2QJNA 3CEPA 3HZ3A 3W2LA 2XGIA 4RNFA 3EEGA 1UP2A 1KBLA 1BRLB 1ONXA 2XIMA 3UPWA 1WAWA 4TW7A 3H2EA 3N19B 1W5OA 4H9XA 3EA1A 1P4CA 1JCJA 3QHNA 3AS2A 3HPZA 2Q8LA 1GYMA 4S2BA 3CLWA 2PD9A 4BQ4A 4C5ZA 2R1KA 1KTCA 1NARA 5M5DA 3A23A 3THAA 4H2HA 1OT1A 2BB0A 1EX5A 2R24A 3ZLFA 5I79A 1A5CA 2KE0A 3NSNA 5ECVA 2HISA 3O3RA 3P7YA 4LY4A 4ZQRA 4W7VA 1HKMA 1UIOA 1QCWA 1OWQA 3L5AA 4TUFA 4U3AA 2RGLA 4GKLA 3BG5A 4XKYA 4C1LA 4HYRA 1ZJIA 4LV9A 5REQB 5EMJA 4C1NA 1IT0A 2DZXA 4PODA 3PANA 3SW6A 1FWTA 1WB0A 1RY0A 1XG4A 4B2DA 2H90A 1V93A 2AKMA 3UQAA 1NH6A 1P0BA 2R1LA 1DJQA 5CPLA 3QR0A 4Q22A 1Q65A 5LHFA 4FNUA 4FMVA 1AMKA 3PUDA 3PULA 2GQ8A 3PS7A 3QW3A 1CLKA 4YYCA 2ZUMA 1F07A 3EY6A 1SFSA 3L68A 4A35A 3V0TA 3GWQA 4PL2A 2I5GA 1TA3A 4ATLA 4RXFA 4MAZA 4GY0A 1E0UA 4Q8MA 1RVGA 3IUIA 4JR5A 5XIAA 4L9ZA 1OCQA 4YVXA 1H0GA 4EVZA 1Q85A 3DKLA 4O8RA 1UWIA 1GUVA 1BXCA 2GQAA 4IIBA 4F0HA 1EQ3A 1GGOA 3TNBA 1QFEA 3B4YA 1W3IA 4WDXA 2DZPA 3W71A 3EWUA 4A8IA 4WDUA 2GJLA 1UBPC 2FJUB 1IZCA 1W9PA 3FFSA 3STPA 1HFBA 1EXBA 1SO4A 3GTFA 5HQMA 3TOPA 4Q4QA 2QJGA 3WELA 4JQAA 4QJ5B 2VFHA 3GK0A 3RXZA 4AEFA 2PI6A 3MI2A 2FMNA 3CNYA 2A4AA 3FGCA 1I2RA 1DJWA 1GTHA 4B4HA 3TK7A 3M5XA 1X98A 1XFBA 5AC7A 5CKSA 5EL1A 3ABQA 2FYMA 4XAYA 1PKMA 1ZY9A 3E0LA 3FW6A 1Q6GA 4RZBA 5FF4A 3DUGA 2W4XA 3C2FA 4LB3A 3KVJA 1ZB5A 2VM8A 4GYKA 4JY9A 3A3WA 2ZR4A 3GKAA 3LOTA 3DHFA 4O14A 3EX1A 1OFBA 1CEOA 3AHVA 2G8ZA 1XC4A 2Q09A 5ABGA 4KGLA 4LCSA 5CPOA 4UFIA 2Y7FA 3G1DA 4BCEA 5E09A 5E1QA 2YW3A 1TTIA 4R34A 5D03A 4L64A 2VRQA 4U5KA 4X2PA 2YB1A 3IJ6A 3T08A 4O1BA 3KOYA 3GLCA 5C9XA 4G7EB 1TV7A 3BXWA 1W3NA 3OGSA 4XTIA 4C7DA 2ZZ3A 1K8XA 2C7FA 3CPUA 5HULA 1VJZA 1XD1A 5HK4A 1C7SA 2D0GA 3KCLA 3AMCA 1QW9A 3VE7A 4RW5A 2C0HA 2DIJA 1EUAA 5M03A 1OBAA 3AUOA 5TBOA 3FEMA 4IZGA 3BV4A 4QS5A 4JL2A 5AFDA 4AH7A 5CLWA 4Z0SA 3PAOA 1US2A 3AYRA 1GKRA 3SGGA 4WR3A 4JQ1A 1R2SA 3RX2A 3QSTA 1NF0A 1J01A 1GVOA 3IANA 4PEKA 1KCLA 4BQ3A 4Q7NA 3MUXA 1XKYA 4Q8UA 1SR0A 1VCVA 2VELA 4JKLA 1DKWA 1RK5A 3OLIA 4WSHA 3CLMA 3GG7A 2PTWA 2PWFA 3D0CA 2TPSA 1MEIA 4MDOA 1OZMA 2EPKX 4GNVA 3GG0A 3IJIA 1V8EA 2CU0A 1E6RA 4S3JA 4UQ9A 2EGZA 4MB5A 3AHYA 3GAKA 2C1GA 5FIPA 2NUWA 1UBSA 1YBQA 3FHQA 4C6NA 4DF0A 1US3A 4PSPA 4XZMX 3AXKA 1PZ3A 3BAXA 2WJZA 2YBVA 4KPLA 2WQPA 2CIPA 3VNDA 4F0RA 4YTSA 3C2VA 2B7PA 3FKRA 2GPTA 3F7JA 7TIMA 3AI0A 4BQ5A 1QT1A 4L1GA 3MHFA 3BLEA 1JXKA 1Q6EA 1E6ZA 1SJAA 2P8BA 1T8XA 3AICA 3I4KA 4PTNA 4NZ1A 1B1YA 3NO5A 3MI3A 4GABA 1LT7A 2QF7A 4W89A 2E77A 3W88A 4NJJA 1E5JA 4M81A 3HN3A 2FHCA 5U7SA 2MANA 3V35A 2PDBA 3TCSA 3E2VA 3GTYX 2G3JA 3HV9A 1JYNA 4AC1X 3SCTA 5EBUA 4R7OA 3VMOA 1SZNA 3W07A 4U84A 5I78A 1YTDA 1V3LA 1DJXA 5I09A 4RE0A 4GNKB 2ACQA 1BL4A 3UEQA 5IRPA 3NDOA 2B81A 3WUFA 1P7TB 1D3CA 2HZGA 3LMYA 4XD6A 3NZPA 4YIWA 3B8DA 1XP3A 4GI8A 4BWLC 1A80A 3ZVHB 1UC5A 1E3ZA 3M6DA 3UZXA 4KWOA 4LYQA 2OEMA 1HJSA 4O52A 1HL2A 4BF9A 1X6NA 4N9BA 4QP0A 4CQ8A 3IK4A 3S1WA 5CJNA 1FKFA 3PZOA 1MYRA 1KRBC 4WSJA 5F2MA 3QZEA 3NL2A 4IP5A 3SI9A 1TZ9A 3L5MA 2YB4A 4Q4OA 1VBJA 3T6CA 2RQSA 3UW6A 4LBRA 2PFHA 3LHWA 1OFEA 1C93A 2ZKMX 4AC7C 4GYFA 2VUNA 2VGBA 3V0UA 4QTGA 2O56A 2WSPA 1IEWA 3VC6A 7ODCA 1E51A 3UD6A 4A3QA 1KGUA 2EPOA 3IAPA 2VDHA 3CZGA 4E3TA 4E8CA 1ODZA 2CEQA 3BW2A 4GY7A 1ZAIA 4MB1A 1MNSA 4ZO6A 2LJ4A 4GYPA 1PZ1A 4O4WA 3FS2A 1HJVA 1UJQA 3OHMB 2BMBA 3F5JA 1FBAA 3NPXA 1C8XA 5A6TC 1FKSA 2E8YA 4JKKA 3KLKA 4QIBA 1DHPA 1KWKA 4JNYA 3WF0A 4AX7A 3I3BA 3SQMA 5BRPA 1V79A 3R43A 1OD0A 1R5YA 1GHRA 2WV8A 1FKWA 4D6HA 3RCMA 2V3EA 3DN5A 2LGOA 4HNVA 3DHUA 3N3TA 4ZA0A 3O5GA 4IFKB 4U5IA 1UH2A 3M47A 5EFFA 1CWYA 2MPHA 1OYAA 1DORA 1NDVA 2NT1A 3WZ0E 4UTTC 4O2TA 3EXRA 2XPAA 1VPQA 2JEPA 4LT9A 1KCXA 5SWUA 3WLOA 1B9ZA 3E0FA 4DZ5A 1BVWA 1G6CA 3KBMA 5F1VA 4QM1A 2X7WA 3UI5A 2OT0A 5EMUA 3KVLA 1AW1A 2F6KA 2OO0A 1R7AA 4Q4SA 2ZADA 4GD0A 2XP3A 2BY0A 2VEIA 1WDRA 2XPKA 3NZGA 2W79A 5IM51 2X2YA 3TMQA 4LNCA 2M1IA 2PDMA 1J0IA 3FXGA 2OO6A 1C8VA 3K8MA 2O9TA 2CKRA 1DE5A 1UIPA 1RHCA 2C6QA 2BGNE 2DG3A 4US5A 4I5XA 3W6LA 2HMCA 4GQ0A 3DIPA 1M7PA 4A8NA 1OFRA 2PU1A 2H3BA 4D6FA 4LRSA 4DRHA 1FHUA 4AIEA 5HATA 1XYCA 2R14A 2A7NA 2Y1HA 5I3FA 1TUXA 4JX5A 4OOUA 1F73A 2IXVA 2VCAA 4GGQA 3QOKA 1RD5A 2VEMA 1YMYA 2J77A 4GQRA 4LAMA 5HANA 1T8QA 5HPOA 1B2YA 3CPRA 1TTJA 3QPEA 2GDQA 1NFPA 3P84A 2FGLA 3R0DA 3TSDA 2ETNA 4B5WA 3CUXA 4HN8A 4NL1A 3OBAA 2IXUA 3SN4A 1DIEA 3CV7A 3GX9A 1OF6A 3GC4A 4UMBA 3RX3A 1W1PA 1Z6KA 1I8JA 3W87A 1EH9A 1NFBA 1H49A 3WQ4A 3PPHA 1RP9A 3MO4A 1H4PA 1H50A 1T6MA 1WV2A 1DWFM 3BQ5A 2EF9A 4AZBA 2J7BA 3BGJA 2DSWA 3RG6A 1KR0A 2OQHA 2EJAA 2ZX8A 1M5YA 3B0UX 2IKGA 5CGMA 3M0YA 1Q63A 2OGJA 4O1CA 1FKIA 4M6QA 4DROA 2QV4A 1GOXA 1IEVA 5REQA 1K7XA 3O6DA 1BVZA 5E9AA 2R9RA 3HJEA 4TV6A 3VOCA 1QO5A 4K2SA 4OQVA 4LVAA 1KRCC 2CESA 2C1HA 3S5ZA 4JTTA 4C6EA 9CGTA 4IQEA 4RW3A 5FF3A 4NYUA 1LL6A 2HRWA 4HGXA 4ZXOA 2INEA 1FH7A 1EC9A 3GVGA 4ORMA 5FF0A 5G2IA 2A5HA 3A6OA 2QUNA 1Z89A 2WNZA 3CL6A 3L65A 4KT2A 1Y5VA 1U5JA 3IGSA 2BGQA 4NZ3A 4IICA 3WQCA 4K8HA 2GK1B 4WJXA 3V1PA 3ARWA 5D02A 5KETA 4J1OA 3M5ZA 3LNPA 3KBVA 4Z2IA 4UBPC 3MSYA 3E02A 3LPOA 4DWDA 4GIEA 1E0XA 4I6VA 3DH7A 7TAAA 2IMRA 3BG9A 2Z28A 4LJ3A 3LI1A 3LHVA 2J9ZA 4NZFA 2PEVA 3HA1A 1RJRA 4J40A 4ZODA 2EPNA 4O0ZA 2HNHA 3JR2A 3DX5A 1S5VA 1HP4A 2L5HA 3HMJG 1A4LA 3OA5A 4ODLA 4W93A 3EOSA 1TE6A 4FXFA 5GJPA 2E6AA 4HMDA 4GO9A 2BVWA 5AN7A 3W7JA 4UFHA 2QYGA 1TV8A 4KWVA 3AHXA 1KQYA 3N2XA 1K8YA 3SO7A 2P88A 4GJIA 1XLAA 4G6CA 2DH3A 3ZVIA 3R12A 4W7WA 5BOFA 3NXLA 3AU2A 2ZX7A 4KWUA 2RGMA 2VCCA 3MP3A 3LPGA 4NZJA 1RJQA 1TJ0A 1EJUC 3AYTA 4EOUA 4H41A 1EHNA 2JF6A 2BXVA 4ADUA 4DWSB 1ZJHA 2V3GA 4PUKA 4GUJA 1WZMA 3GH4A 4JIEA 3T05A 4NNAA 3APTA 1PEZA 3P80A 4AAJA 1YNPA 3LGDA 2DVUA 3DU0A 3GNDA 1DJHA 4X2RA 4G7EA 3ITGA 3SRDA 4ZPWR 1HKWA 1VQTA 1OFQA 4GZEA 2OSWA 2CZFA 3DENA 4CLMA 2MLYA 4M19A 1E9ZB 3FKKA 1XYBA 3C6CA 3WH8A 4AW7A 3S5NA 3T81A 4XB3A 2V30A 2VJXA 1NM9A 4KFOA 1MW1A 4UXDA 1Q5MA 3FXYA 4IIHA 3T0CA 1R86A 3DECA 1SZRA 4WGHA 3CZ8A 3RM9A 4HU3A 5A6SA 3KW3A 2C91A 5K9XA 2V8ZA 3OU8A 2OLHA 4H6KA 3BWWA 4E2BA 4WRHA 4AZHA 3GE7A 3BANA 4GX8A 3SFKA 5FESA 4PTMA 1X6LA 3QJAA 2PWHA 3PTQA 4GINA 4HPXA 1VENA 2CHRA 1UH3A 4JD4A 3QFWA 1NMWA 1JI2A 3VCRA 2ZUWA 4DI9A 3LNMA 2XP7A 3HG5A 1IWBA 3MUIA 2RUDA 4YXGA 1A3XA 3ONCA 3MSGA 1ZU8A 1DWJM 1TV2A 3EAUA 5BXTA 4J9JA 1Q6CA 3W38A 2X05A 1GVRA 1MSSA 4JDBA 4ML4A 1ZAJA 4P7NA 1L8NA 1AD4A 1QMLA 4ROPA 2DIKA 1Q6UA 4HOZA 4IFRA 1REQA 1YRRA 5H8PA 4TR9A 3ME3A 3UWQA 2VX5A 4UOQA 3MC5A 4KEMA 1TTQA 3W1UA 3RM4A 2PZ0A 2WANA 5FACA 2WNQA 1EDQA 4NHVA 4DI8A 1U1HA 5DIUA 1RCQA 3O5MA 1HL9A 3PP7A 1JIBA 3STEA 5DT5A 2GSEA 4HQVA 1UH4A 2ESCA 1M6JA 2QIIA 3KFTA 3RR1A 2FHFA 1XQLA 4ZGYA 3K8LA 2WHMA 3CO4A 3O6YX 1W1ZA 1I2NA 1P7TA 2YXXA 4D2JA 3RYSA 3ATYA 4GJJA 5BOOA 1X38A 1YTEA 4O57A 3ZVHA 3JZUA 3B8WA 4UNKA 4PCSA 2G5WA 4AEEA 2FFCA 1VB9A 5FAGA 3WK3A 4HA3A 4KFNA 4IT1A 3M64A 1AFSA 2HVMA 2J24A 4NRSA 2LKNA 1XHGA 2ZC8A 3WLQA 4EXAA 2VFEA 1UW9A 4QIUA 4E2OA 1W26A 3LGGA 4F0KA 3PFMA 1W1A1 1E0TA 2WKJA 2BXZA 3PTMA 1C91A 1JG9A 4PTWA 3O5IA 3U4FA 1RA0A 1ODUA 4UFMA 1ISXA 5CZJA 3M9YA 1TPDA 4DH0A 2TRSA 1XIJA 1FWIC 1JNEA 4UQDA 2WC4A 4XQ6A 3AIBA 3W4RA 2E9MA 1E9LA 1IGWA 3PN8A 4PCPA 2V3FA 2OB3A 2G50A 1QOXA 3WBEA 5DFAA 5I7GA 2J79A 1TREA 3W0KA 1L6YA 4HKPA 1Q6IA 1UA3A 2ZRXA 3TQ0A 4C7FA 1QI3A 2C1IA 1O5QA 3F4VA 4Y8EA 5BU6A 4UTFA 3EOOA 3NIYA 5DMNA 1PX8A 1FCUA 1A5BA 1XIHA 2PF0A 4FX7A 4AHQA 2YDAA 3D3FA 1A5UA 2WBGA 3ZT6A 3JYMA 2D22A 1E70M 2X09A 2WHKA 3PAJA 3OYXA 4C90A 2AMGA 2XM1A 1MUWA 4OTKA 2BASA 3ZJKA 1OCJA 1HL8A 3D46A 2I14A 4HB7A 3W1XA 3GDRA 1RZMA 2KGJA 3QC0A 4DO7A 3PZTA 1C8YA 3MO7A 4WJ8A 2DT0A 1CZ1A 4IFKA 1HUVA 3OODA 5FSDC 3DGRA 5BW6A 4GCXA 1PZ0A 4EPBC 1PE1A 2OKTA 4GGHA 5CJ5A 4ATWA 1XLGA 3JUGA 3AUJA 1TCMA 5ABFB 2C71A 4B3KA 4RV3A 1U79A 1BEUA 2J7GA 5CZSA 1EP2A 3B9OA 1JCYA 3H55A 5FL1A 1LCOA 3GM8A 1XYFA 4F9JA 5MF5A 2M2AA 4QHRA 3BG3A 3ABSA 3O5LA 2Y5EA 3OPSA 3ZLHA 1K7EA 4ZL1A 2D2OA 3QQWA 2OZ3A 1FWHC 3LM7A 4C7GA 1UR4A 2I5IA 2WCSA 1UD6A 2DG9A 3O2LA 3PBYA 4QT3A 1OYBA 3O8AA 1FWNA 2YZRA 2DQWA 3BQ6A 4WKFA 5HUAA 3A5VA 3CQHA 4I7WA 4AIBA 4JS3A 2WOQA 4ODMA 3P61A 1H63A 1Q6HA 3VOJA 3U2EA 1T7LA 4CN6A 1X39A 3LCIA 1LP6A 4MKNA 4ODOA 1OQFA 2VGFA 1M7XA 3S0CA 4I9TA 3NPWA 5A2BA 2OWCA 3GW3A 4DNMA 2BDQA 1AW5A 3VCNA 1V0KA 3NNTA 3MANA 3FAWA 2ZDRA 3QTGA 1CGXA 4RL3A 3AS1A 1H5YA 4C02B 1DBTA 3OBEA 4MJ2A 4E8GA 4JIHA 1K70A 2XZ7A 1POJA 4UTWA 1TMQA 1O95A 2QCLA 1P5BA 4GCAA 3ZMRA 1EGVA 3BZJA 4MDPA 1CIUA 3NQ6A 2QPUA 2IQDA 1HGWA 3AIQA 1R3VA 1DXEA 4HPHA 2OCZA 1BLIA 1FKGA 4LBSA 5EFDA 1C9HA 3SRHA 4AXKA 4EACA 3T9PA 2VVNA 1Q6RA 3HURA 3VKJA 3KUMA 4KCWA 2DFAA 1B57A 3FDKA 4DJFA 1L6WA 4HYVA 1P1MA 1S39A 4HD5A 4DZAA 3T0TA 2P0IA 3PBVA 1Y7VA 5HJLA 1G9HA 2MNTA 4WD0A 1ECEA 1W1IE 3I6EA 3IRSA 2HROA 2G37A 3IKGA 1V0LA 1UD3A 4MGGA 3M4HA 2ZX9A 5HXMA 1OX5A 1BGGA 5TIMA 3CWNA 5EMYA 3B9NA 4DT4A 4PMDA 3U5YA 1FKHA 4KKXA 3KHJA 3A21A 4B2DD 3FA3A 1JCHB 1L9WA 1XXXA 3HQNA 2OXNA 5I98A 4TV5A 2PDNA 3KL0A 2V69A 3TR9A 1OADA 2I56A 4AY1A 3SUTA 4PMOA 2WMHA 3LUOA 3HM7A 4U31A 1ROTA 4QSFA 2OMAA 1EQCA 3V5FA 3RGCA 4HVXA 1JQXA 2AL2B 1NF7A 1WBHA 4NNBA 2PB1A 1H09A 3L4TA 3LBCA 1QTWA 3FJ4A 1D7KA 4MZ1A 3KXQA 1XX1A 2GK1A 2TAAA 3B04A 3AIUA 4LSBA 4DZ2A 1SU5A 3GH7A 3OVPA 1H11A 2QGHA 1ZP4A 4AUBA 1EDTA 2KFWA 4YPJA 4RJEA 4DZ3A 3J7HA 2QCEA 4F0LA 2GVJA 3IIXA 1E5NA 1CXLA 5LA2A 3TYUA 1WDDA 2GL5A 2D0FA 3KE0A 1R3SA 3AS3A 4LBUA 3HPSA 4LFYA 3ELFA 4MIMA 2CWXA 4WY0F 1Q2SA 5G1MA 3PA7A 1HKJA 3WFLA 1TCOC 2QDEA 1QI4A 1UHVA 3M7SA 3S2LA 3LRLA 4AD5A 1TX0A 5H8UA 2RH9A 4F9DA 1QUMA 1THFD 5T8GA 3N4FA 4MB3A 1HKVA 4LANA 2OX4A 2WCGA 1BPLB 1U5VA 3AZSA 3W23A 2R6OA 1KR1A 4MWAC 5D9NA 3PC0A 1PX4A 5DF0A 2PGFA 2RUCA 2PV1A 3O5EA 1RUSA 5LHEA 3P6LA 2QLYA 3WFAA 3WQ8A 4JYDA 5M3WA 3AYVA 3WMCA 4DWSA 3W72A 2J47A 2ZRZA 5DMYA 1ONEA 4H01A 5PTDA 3CUIA 4O0KA 3IS4A 3EX6A 1EZ2A 3DZ1A 2ZXAA 4PA8A 4YN5A 4GUFA 3C2OA 2V5JA 3I3DA 2DV0A 3JZEA 1X8FA 1N8IA 1G69A 1J11A 3BH4A 4AF0B 1OM0A 4DRMA 3NA8A 2HVNA 1J5SA 5E0KA 3QRHA 2UBPC 4YVVA 4DBUA 3B0VC 3WLTA 3LSCA 5DY3A 1I2OA 3DHPA 3AXMA 1V4YA 4XO7A 2AL1A 1BXBA 3B3DA 2D2GA 3GW0A 1KGWA 4LAOA 4E4PA 3KDNA 4MJMA 3B9EA 5H1WA 4K39A 3VIMA 1MW2A 1TIWA 2CZVA 4FIRA 4HNTA 4GISA 1FH8A 4Y7EA 5CBIA 2I7GA 4H7ZA 3M0HA 4L3NA 5D05A 5J5DA 1L8PA 3L4YA 3PB2A 3EMZA 4A8LA 3DCPA 3M6YA 1NWTA 1H7XA 3WJWA 3BUVA 3G0XA 4D1JA 4MAVA 3CHEA 4YLWA 5CGQA 4MVAA 3F03K 2C8NA 3WF2A 3GVVA 3H4WA 5BXJA 5AHNA 2ZRYA 4WXYA 2V9DA 3R2GA 2GGHA 3N1AA 4GFIA 3NOYA 2ZZ6A 1OF8A 1EBGA 2XGBA 1IZJA 1K8ZA 3NPUA 3T2PA 1XLKA 1TQJA 1A7XA 2PRLA 2JIEA 5AYBA 4QNEA 1FX6A 1C8QA 1L6GA 3SCQA 3TTYA 3CJPA 1NJJA 2ZVRA 3AC0A 3TAKA 4HHMA 3BJFA 1H61A 1UWRA 3JRKA 1J4IA 3GTHA 4XD4A 2ATSA 2P4VA 3B0YA 3CT2A 4N7QA 4N9EA 1UWAA 3DYMA 3FIGA 1VD6A 4OIFA 2RUQA 2J6VA 4CQAA 3HGRA 3LLDA 1RCXB 1O94A 4H6RA 2CERA 1FWSA 2X42A 3D5HA 1ZTVA 1TPVA 1TWDA 2ASHA 1GPFA 3PPCA 3LLFA 3GTIA 5HQLA 3WH6A 4EXQA 1BYAA 2FJKA 1HIZA 4PE8A 4N02A 4MNKA 1VP5A 2OQLA 3GHUA 3CC1A 1NQ6A 4UDMA 3A22A 3VXGA 2D1ZA 1MXDA 2WSKA 4OOZA 4LVGA 2OYKA 4PC8A 1PBKA 5A6JA 1SR9A 1IWPA 1RLDA 4CCCA 3MHUA 4H9ZA 3GXTA 5CXPA 2EO7A 3H26A 2O7QA 1VHCA 3G1VA 2RJHA 4JCMA 1AQFA 3W70A 1YPXA 3S1VA 1LOLA 3U7VA 5BXSA 4HPGA 1TKKA 4H9YA 1JCLA 2VZTA 3RK8A 4TX9A 3IJ7A 4FEZA 3LXBA 3KAGA 2VR5A 3LS9A 4FO4A 5F1UA 1OSEA 1BKSA 2YDRA 4L6OA 4Z2KA 3ZJ8A 4GQBA 3CXOA 4IH3A 3EKLA 4ZB0A 2F38A 5BROA 1YXCA 2CLMA 1ZCCA 1ROUA 2ZX6A 3NYZA 4GNJA 3VGHA 4CD4A 3AAMA 4H9VA 2X41A 5BRBA 4HJFA 3P5ZA 4CCEA 2R1NA 3LV6A 5A8GA 3PF3A 4K37A 4DRKA 1M65A 2PCQA 5B8IC 2VZSA 1CXFA 4LAUA 3A3HA 1NOUA 3KBNA 1DXFA 4QDWA 5AKQA 3IV3A 1VEMA 2OOGA 3GTXA 2RDXA 3UGVA 1GJUA 5HDRA 4WOQA 1CW2A 3VD9A 2WHJA 4CQCA 3IRDA 4ICNA 3QQ0A 1J93A 1JD7A 3U2ZA 4TIMA 2OODA 1W37A 1M9HA 2ZXDA 3PRAA 3EXSA 1DJZA 1UCWA 1WDWA 4DYEA 4B9ZA 4R7JA 3A64A 4IJCA 4U2YA 3EDFA 1PB0A 3S9ZA 3TZFA 1NAL1 5ABFA 4F79A 2PZNA 2QUTA 3EZ4A 4F48A 1QWKA 4Z1AA 1V6YA 2CZ5A 1PL9A 2GJPA 3SCPA 3DYOA 2GGJA 1ENUA 4JNMA 1SGJA 2O55A 3QV8A 4IUOA 3GNXA 3SFWA 1B3WA 2Y8KA 4PN2A 3N15A 3H4XA 5LA0A 3O5JA 5B80A 2G96A 1YPIA 3N73A 3O5FA 2E9BA 4C6PA 3LCFA 3QY8A 3R10A 2C18A 2WQDA 3GDBA 3TE9A 1CT5A 4US5D 1G94A 4M56A 5IBXA 3TU9A 2A79A 1UD2A 3VUSA 4G9PA 1C7TA 4AVNA 1TJ1A 1E1CB 4X61A 1CI1A 1V7AA 4J3TA 3T4WA 2WLZA 4M29A 2G97A 3OA3A 1BHGA 2XN2A 4FLQA 5HMSA 4F0MA 3WBYA 4UQBA 1KM0A 2PC4A 4IGNA 4KQNA 3NJ3A 4W8BA 2ZE0A 3EWCA 1IEIA 3TJXA 1H3GA 1ZL1A 3EA2A 4O1EA 8RUCA 3CGTA 3T07A 3NOEA 2DU2A 3VO0A 3BSGA 3QEZA 4FR6A 1FWRA 4PB5A 5TNVA 2BHZA 2EPMX 4Q32A 4KIRA 4N4QA 1HP5A 4DBDA 4A8RA 1IQ8A 4TX8A 3RLVA 2WMKA 1ZGDA 3SBFA 3R94A 4GUIA 2BTMA 2PP1A 2H9AB 1PKYA 2M08A 4Z0JA 4Z2HA 3KTCA 1PSCA 1C29A 3KM8A 2HEJA 1HJUA 3GYEA 3MDYB 2VQTA 3KOWA 1A0EA 4JICA 1JZ6A 2NUYA 1CPUA 4IQ2A 3MJMA 1CBGA 3NM3A 4V15A 3N04A 2HS6A 4MB4A 3UETA 4ZQOA 1XPYA 4L6HA 4WXZA 3W7QA 1RA5A 4MJZA 3AXIA 4GBDA 1XYLA 3ABOA 3TW6A 3HGJA 2NT0A 2E8ZA 4J35A 2GQ3A 2JF7A 3MCNA 1CB7B 5RUBA 3QLDA 1Z3NA 2H3DA 4PBGA 4PBFA 1KW1A 3WMLA 1WZKA 4FS9A 2WJDA 4J5NA 1XIGA 1WUFA 3IEBA 5I3GA 5HMDA 1DJIA 2I9UA 5HAOA 4GLEA 3NFUA 1FDJA 3UXKA 3E96A 4L1WA 2QCNA 2PP3A 4BEQA 4G2DA 1BYBA 5FAJA 3ITTA 5LKYA 3QQ1A 2RFGA 2DT3A 3HB9A 1KLYA 2DT2A 4RPPA 1D8CA 4HK6A 1B3XA 2QULA 3W2KA 1H41A 5LNSA 1XLBA 3P62A 4A6GA 4MPQA 4B3ZA 1OJXA 4ASTA 5CCZA 3TTSA 1F8MA 4YCOA 2AL2A 1IXNA 2Y88A 4BI5A 2J8GA 3DBNA 2ZYFA 1QRQA 3SCSA 5AYIA 3N9KA 2PCEA 1EPXA 4ADSA 5JBEA 4LUIA 4M82A 1ZBVA 1H5VA 1UUQA 4U4MA 2OOFA 3BLFA 4C6FA 1UROA 2D3LA 3ZT5A 4J27A 2GGGA 2XPBA 4CKQA 4FOJA 1RD6A 4RE3A 4DZHA 1UMLA 3WK2A 3CZLA 3AZRA 2ZQ0A 1GNXA 4G50A 4NVTA 1PX3A 3I3EA 1TUFA 2XVNA 4C60A 4O15A 5A94A 2B4GA 4ENLA 2OZ8A 5CC6A 2NXGA 2EULA 2GFTA 2CFFA 2D2JA 8XIMA 2WKGA 4GY1A 3KZ7A 2BBFA 1WDQA 2CC0A 1LZOA 3VNJA 4XISA 4BF5A 1TYGA 5DCDA 2DVXA 3R1ZA 2ZXBA 4J3SA 2AQVA 1W6TA 2W5FA 1VBGA 1QBAA 4DRJA 3B0XA 1S38A 3PHAA 4O18A 1CXIA 3VIHA 3PTKA 2ZQUA 3TTQA 3A12A 2QPXA 4RXGA 4UTUA 1Q3NA 5I06A 1UOKA 3VINA 5K2ZA 1XPGA 3UXLA 3V36A 3B8TA 3OZOA 4P8XA 4NQ1A 2X1SA 4DO6A 4HHPA 3F5KA 4LPCA 1IWAA 4Y96A 2BOFX 3MMWA 3C0QA 1AVAA 1TG7A 1JDCA 5E6YA 3FA4A 2W0UA 5ECUA 3MY9A 2BOEX 4M3PA 1TMLA 3MP4A 2PDCA 1FQ0A 3MW7A 1UMYA 1CGVA 3UWVA 1V51A 2VMFA 4Q8TA 4MWAE 1KBBA 2BY3A 3VDAA 2PDXA 3C86A 1BGAA 4B5SA 3N14A 4AF0A 2P76A 2YYTA 3CUFA 1TZ7A 5BOEA 2MLZA 4S3KA 1FRBA 1TPB1 2QV5A 4CNPA 2Z4GA 2QCCA 5FJOA 4ATDA 3UXAA 4R3UA 1V3KA 1OD8A 2LPVA 4KBXA 3U4AA 5C8BB 4XUYA 4TXEA 3VD5A 1M68A 4UTMA 1CXHA 1KFCA 4LX4A 5D33A 2N87A 3OIHA 2Y61A 3VIPA 1XYMA 2J13A 3G77A 3I68A 3WCZA 3VD7A 4D8ZA 4YTRA 4H7VA 1W5QA 3VIKA 1QWGA 2E1WA 3UYCA 1ITUA 1B3OA 3TQPA 2E6YA 3CQ0A 3S2CA 4WQ6A 2D0HA 2VDGA 3F4NA 1AZ2A 3PPFA 4OE7A 4PMYA 2E5BA 3OLGA 1KRAC 2OU4A 4OGZA 2PPPA 3WD3A 1V3JA 3NVDA 3GU1A 3R6IA 2PTXA 3PG8A 3OGVA 2PTZA 1S2TA 3L4VA 3M41A 2Z2BA 3VGGA 3UJFA 1N8WA 4EK7A 5DLCA 4QXIA 2NLIA 4WJEA 3WLLA 4JBRA 3TKFA 2ALDA 1FCVA 1W0MA 3QFEA 2DZSA 3CAKA 3RNDA 3O5PA 2F2DA 1GCYA 1VIZA 3HOJA 3CAQA 4WKAA 5DMLA 1XYZA 3VIIA 2PGWA 2EG6A 3PB0A 3BCDA 4DQWA 3E2QA 2Z1VA 3H21A 3PZ9A 3G24A 3RO8A 5XIMA 3GDKA 2INZA 3MKCA 3QY6A 1XH0A 3ITLA 4M7SA 1YNQA 4PMUA 5AHMA 1W31A 1BXNA 3W25A 1J0KA 2QPSA 3KL5A 2AQOA 3H9RB 3IVSA 4M1RA 1MFUA 1U83A 4D6GA 4Q8VA 2KAUC 1G0CA 5FF2A 1TE1A 5EMMA 1POKA 2OR2A 2Z2UA 3IIOA 4ICCX 5ABEA 1ZLPA 1V6TA 3IARA 3DG6A 4QEHA 3T55A 3E49A 4R85A 1F6KA 3A47A 2GJNA 3K4AA 4LH8A 5HMEA 4JTHA 1IGSA 4QCFA 4JTQA 4IFOA 3EIPA 3P8JA 2YA2A 3VOFA 1DJYA 4D9PA 4AISA 1M01A 2CETA 4QRNA 4M6UA 3W7CA 1ZK6A 1KM1A 2QCDB 4PULA 1TVPA 3DDMA 4HA1A 4FX8A 3JS3A 1C3FA 4IP7A 3UPBA 3EWYA 2HXUA 4I9MA 3UY8A 4QGCA 4A05A 4UMCA 3A4XA 1UZDA 3TCEA 4G7FA 2QT3A 3TEVA 2CLEA 3ARUA 1ELSA 1UA7A 1FXPA 1F5ZA 1KBKA 3L9CA 4ZCWA 3P5YA 2PN0A 4Q7BA 2YOCA 3OLEA 1WNOA 2V82A 2OG9A 3LDVA 2XM2A 2ABBA 4OBRA 5ABTA 1XIMA 5C54A 1PWLA 1K3UA 3QMTA 2CLFA 4W87A 3U48A 3HIJA 1EOKA 3QPYA 3WDRA 4J3WA 4BWLA 3QHMA 4QE4A 1RPKA 1SZGA 3TXVA 4JFJA 3MYPA 3C8FA 2BY1A 4C6BA 1OFDA 4JCLA 3TOYA 4FOKA 1IE7C 2AWGA 3NQGA 4MHBA 3VUPA 3KAIA 1TVNA 4G1NA 4TO8A 1PIGA 4RNJA 4AB4A 2B7QA 1ZBKA 1OZQA 2YGYA 4EF9A 2IKJA 2V5BA 5KZDA 2OPJA 5BWFA 2XN1A 1TFVA 2X0YA 3LHYA 4R0XA 3RCNA 2XZ9A 3TIMA 1YIXA 1MDRA 5AVNA 4HTYA 2Z2AA 3WDPP 3LMZA 3IUHA 3N2MA 4GIYA 2ZCGA 1A4MA 3CASA 2ACSA 3BURA 3WUBA 4UFLA 1KXTA 3HFTA 3W9ZA 1UUMA 1J2WA 3UJSA 1TX2A 5DN1A 4DN1A 1GWJA 1E72M 2NUXA 4PGLA 2ZFAA 3VE9A 2POTA 2Q02A 2WO5A 4XZ9A 1EJXC 1CTNA 3KX6A 1SJCA 2WPGA 1SJBA 3WDIA 1DIKA 2XUCA 3H7VA 1HVXA 1FAPA 5JH8A 3KABA 1YADA 5AHEA 3W7OA 1LM1A 2ZVIA 3E38A 2YCJA 2YZ5A 1NDZA 4HA0A 5A6MA 4MM1A 4AZ5A 5LNRA 1GONA 4MKSA 4PRRA 3GIYA 4PMVA 4D6IA 1JGIA 4N6FA 3ARZA 1LL7A 2VVSA 1E1CA 3H70A 3VM7A 1GEQA 4WIWA 3KOFA 3OP2A 1NU5A 2X0SA 5G1TA 1LBMA 3IVUA 2HSAA 4LC8A 4YJ5A 1FH9A 1JJKA 1G4EA 2GJXB 2ISFA 4LOCA 3MHGA 3RFAA 4UTTA 1PBGA 1WXJA 3SJNA 5A1AA 3DESA 1NTHA 1V0MA 1JYWA 5J8LA 1QU4A 4PB4A 3KP1A 4HBKA 1RV8A 5KITA 1BVNP 1PCWA 1X1OA 3A9BA 2WZIA 5HJYA 4C6CA 1PWMA 2VC7A 5HQEA 3WYZA 5FJTA 1QI0A 3AISA 1Q45A 4X9YA 1RSCA 4DM1A 4PCTA 2H9AA 3PWAA 4DJFD 4HZMA 2A7RA 4TU1A 6TAAA 3T09A 1A5NC 3RHGA 3OTRA 4UTKA 3H2AA 5CAHA 2PGEA 1O1HA 1F4AA 2XH4A 4XAZA 4L4PA 4KMQA 1WO2A 4LEFA 2VZOA 1MXGA 4WDTA 1E6QM 2WXDM 3O16A 3B9AA 2YSWA 3BK0A 1EGZA 5A95A 1X1ZA 2Z25A 2XH2A 2XGZA 1ZALA 4RNIA 4MY8A 3M0MA 3GHSA 3VU2A 1Y5XA 4S3EA 1JPDX 3P0WA 4Z2JA 4WCJA 1A53A 2VDIA 3ZS4A 1AODA 5D09A 1XS2A 4J3XA 1XLCA 1A0DA 4MNLA 4F3HA 2J66A 3G8EA 2PRMA 4S1FA 1KFWA 1ITXA 2TSYA 4DVOA 2E40A 3QKZA 2PGRA 1J96A 2BLEA 4HNNA 2Y7DA 3RMEA 4QITA 4KCVA 5CC7A 4Q3MA 3C2YA 4RDVA 3GD6A 3PJXA 3NQDA 4CEUC 2C15A 3GY1A 3WD2A 3WBXA 1JULA 1CGWA 1H7NA 3WEMA 4JTIA 2F2HA 3K2GA 2VTFA 1OX6A 2F6UA 3PJUA 4OECA 2YL9A 5KZMA 3VAWA 1LWIA 1DEDA 4RR4A 1SSGA 4V28A 3F2BA 1DQWA 3LD5A 1ZHAA 1JAKA 5HINA 5CPTA 4MNJA 3CQIA 3O06A 1I9CB 1XUZA 2E6DA 5CPSA 2DDXA 3WQ5A 5C9UA 2DZVA 2Z00A 2JE8A 3R11A 2DUAA 3QR1A 4RKAA 3PNZA 1EJTC 3TN3A 3ABRA 4WUIA 3FA5A 2J4GA 3TCZA 4Y9MA 3CB8A 1FWJC 4E38A 3V4BA 1XRFA 3WSUA 5FF7A 1O5XA 4EIVA 3TJ4A 5JQ9A 2YXOA 3APYA 1UKQA 3MSDA 4JFUA 2VZUA 1W56A 1UASA 3BL3A 5FEPA 3CAWA 2E67A 2BG5A 4H2CA 3UZJA 1HQTA 5LXXA 4O1FA 2PDQA 3WLMA 2FTPA 3BW3A 3FEQA 4Z1YA 5KSWA 1VYPX 4KEVA 1EXPA 3K1DA 2GLKA 3GAYA 1JPMA 4WDWA 4OV4A 4LC6A 4YCPA 2V63A 3BLDA 2FB2A 2PPGA 4HU0A 7A3HA 3G3DA 1BSIA 4DWSD 3C0SA 1KXVA 1ME9A 1X96A 3UU0A 1U30A 3SN1A 3HPFA 3M16A 2VP8A 1WOBA 5AY7A 2QVHA 1R8LA 1EZWA 4IJRA 1SFLA 4IOTA 1PHWA 5HMFA 2FTWA 3TYAA 4RNHA 4YTQA 4RZ6A 4JFVA 3GSMA 2V67A 1H7RA 2VD9A 3WH7A 5IDZA 2DZBA 4B15A 3CK5A 2AAAA 2Y8UA 6XIMA 1GVYA 5H2ZA 2J9XA 2ISVA 3W7DA 1ZUAX 3BW4A 3WJSA 1V3HA 3D47A 5GJNA 4HBOA 3C3NA 4W7UA 2QUUA 3LTSA 1CB2A 1M7OA 2PWUA 2QF8A 1ZFJA 3AMKA 1M3UA 3ECQA 4K8EA 1EYEA 9RUBA 1OT2A 1QATA 5G2HA 3RDKA 3W2MA 3LTYA 4BF7A 3WD1A 5A6BA 1GYNA 3MP5A 1OB0A 2HS8A 3O63A 1OFAA 3S2JA 5M2FX 2R1PA 3FCPA 4DO5A 5GVJA 3VNIA 1F05A 4MWAB 3T7VA 5I03A 3O07A 3A3XA 1J4RA 2O7SA 1QK2A 4IHCA 1DIDA 3O5OA 4OJYA 4S3AA 9XIAA 3QV7A 3W7KA 3IUDA 3P74A 1KT1A 1CGUA 4O0QA 3SUVA 1J9YA 1Y5WA 3AU6A 3WLJA 1M41A 3N4AA 5GNZA 3VOHA 1D3HA 4N2YA 4I8DA 1B6CA 4FLSA 4DUVA 3VIJA 3CUZA 4HPJA 3TN4A 3NM1A 1B0IA 2PUZA 4JIPA 4PSRA 4Q8NA 1W2VA 4RPQA 3LHZA 1I4NA 3VDBA