4WKHA

Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (1mm) at 1.05 a resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
369
structure length
368
Chain Sequence
b'AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTENDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitotriosidase-1
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 133
structure length 368
sequence length 369
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wkhA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wkhA01
3ZIZA 1EQCA 5C71A 5IFPA 4H8HA 1OD8A 4P8WA 1LG1A 1XD1A 2CBVA 1B2YA 3SCWA 3WEZA 4TVUA 1EXPA 4WKFA 5JUVA 3L2LA 3QHOA 1JG9A 3BH4A 4ATLA 4Z2GA 4V27A 3UERA 1BQCA 2WC3A 1BYBA 2VCBA 1XV8A 3PZVA 2G41A 1DWAM 1C91A 1C93A 1E6RA 2IXUA 2J47A 4AZ6A 1UQZA 1QHPA 2JEQA 1KCLA 1JYVA 3CUHA 1JL8A 4ZXOA 1BGGA 1H0IA 1EO7A 5BRQA 2A3CA 3BAYA 4ATWA 3KL0A 5CSYA 4MNMA 4JL2A 1KGWA 1SFSA 1V0MA 4ATDA 1E55A 2PF0A 3SCRA 1J9YA 2EPNA 1UWRA 3TP4A 3ALFA 1C8YA 1CXEA 1SR0A 4UTFA 3WY1A 1W3JA 1TMQA 1VIWA 1DWHM 2NSXA 1KB3A 4BCEA 1BYDA 3DYPA 1ZBVA 5I2UA 4WKHA 1PBGA 3BAJA 1JZ5A 1VENA 3K46A 3THCA 2EBNA 4ACZA 3N1AA 1LJYA 2EXOA 2VX5A 3SCUA 1XSKA 3W38A 3AZRA 3AIVA 2A3AA 3OLIA 2FHBA 1XGZA 1UD8A 2XTKA 4Z2HA 1GORA 5A2CA 1GOWA 1BLIA 4NF7A 1EHNA 3PTMA 1JD9A 1CGVA 4W85A 3DC0A 2G4FA 1UWTA 2WLYA 4AMCA 1WCGA 5D8WA 2G3NA 4F66A 2BVYA 1DWGM 2YDSA 4E8CA 1E6NA 2VCAA 4WKAA 5I6SA 2VOTA 3N11A 1LF1A 3F5LA 3VO0A 1UH2A 4DUXA 1QHZA 2A3BA 1OIMA 1OT1A 2VZSA 3WSUA 3ZT7A 3VD9A 1D2KA 5JBFA 2V3GA 2BY1A 3CZGA 1HL8A 2GSJA 2WBKA 3ALGA 3CHCA 1PJ9A 3M7SA 4NI3A 5GNYA 3RIKA 2XHYA 3SCTA 2CCRA 2JIWA 1KGUA 3L4VA 1GOOA 2XIBA 4NRSA 5DO8A 3AMCA 1O7AA 1JI2A 2EPMX 1W3LA 1XC6A 2OWCA 3U5YA 5E9AA 5TD4A 2ZXQA 3I3DA 4ZFMA 1MQPA 4MPKA 1FHLA 1ZJBA 2C7FA 3CZKA 1BYCA 4CU6A 4LPCA 3B8SA 1K9DA 2FHFA 1JXJA 3AZTA 3WENA 3O2LA 1E0VA 1CXLA 3VX0A 5EMYA 3PZIA 1B9ZA 1R7OA 3GXMA 5I79A 4JFSA 5HBFA 1L8NA 2XVKA 3VTRA 2ZX8A 1UYQA 3WDHA 2OSXA 4B15A 3TONA 2UWFA 3AZSA 2ZX9A 3EMQA 2XUCA 3RCNA 4AZGA 4OJYA 5I23A 4AIOA 6CGTA 2XYLA 1E15A 2OLHA 4CD6A 1XYFA 1UKSA 1R8LA 3IJ9A 1KWGA 4ZXLA 2D3NA 2PWEA 2W62A 4W87A 3NSXA 1RP8A 3WQ8A 1Q6FA 3OB8A 3AMDA 4J7RA 1E1FA 2YLLA 2WMHA 3RILA 2ZUUA 4HMEA 1UWUA 1K9EA 2D2OA 1V02A 3ARTA 1LWHA 2CITA 2WVTA 3PBGA 3WNNA 2YIHA 4PCTA 1NARA 2GJXB 2X05A 2BV9A 4QP0A 2WHLA 3CO4A 3WF0A 1CNVA 2JFEX 1JAKA 2J8GA 4LYPA 5HOSA 3W25A 1UA3A 1U30A 2X09A 1NH6A 1TUXA 2XPKA 4QLLA 4JKKA 1E6QM 4RE3A 4PYSA 1ITXA 4H8VA 1M53A 3W82A 1RD6A 1UG6A 4DWSC 3VD3A 2CIPA 1WDPA 4B3KA 4Z2IA 3K8MA 2FDMA 4HOXA 2VC9A 2Y8VA 1W1TA 1CDGA 3KE0A 1KXTA 4ACYA 4GINA 1UH4A 1UHVA 4P8XA 1CWYA 3AIUA 4YPJA 2J78A 2BFGA 1G0CA 4MAZA 1EGZA 5ABEA 1KXHA 3W53A 2EEXA 1UKQA 1FA2A 3QOKA 2WHKA 3FHAA 1PPIA 3WFLA 4W7VA 3AHYA 1HIZA 2CPUA 3HMCA 1DEDA 2WKLA 2D22A 4QAWA 2XIIA 1JD7A 1UR4A 5IHRA 3UG4A 4PMNA 1SYTA 1KQYA 3MV01 5BRPA 4C7DA 2RGMA 5A6AA 4PSPA 1QPKA 4MB3A 3MMUA 1OSEA 3WQ4A 3GH5A 1VFOA 5A8MA 5BROA 4CVWA 5LA1A 3L2MA 1KBKA 1E3ZA 1NQ6A 1KGXA 1ODZA 4HU8A 4PN2A 3IANA 4BA0A 4XV0A 1B3VA 2E0PA 2VUYA 5ABFB 4GIAA 2DSZA 1BG4A 1HKIA 1ZS2A 2V5CA 4MB1A 5EFDA 3AXHA 1V6VA 5A6KA 2DH2A 4JKMA 4HOWA 4DWSD 2CNCA 3AOFA 4HU0A 3EMCA 4BQ3A 5A8QA 1NP0A 3CGTA 5E6ZA 2XGIA 3WF2A 3GXDA 5EFFA 1LL6A 4W89A 4J3XA 2Y8KA 4JL1A 3VU2A 3SCNA 4NZCA 4GQQA 1E72M 2DT0A 4BF7A 3JUGA 1U2YA 4GI9A 4AZ7A 1P6WA 3VIMA 1JFXA 3A47A 4CU7A 3W29A 5AY7A 1BG9A 2WMKA 3MUY1 3PZMA 4PMYA 1FFRA 3WL1A 1GOMA 2XM2A 2DDXA 3BXWA 3WQVA 1EH9A 1GW1A 4CD8A 3BCFA 4E2OA 4OOZA 2CBIA 3BGAA 1LQ0A 2C0HA 2WHMA 4P7OA 4EAMA 1NWRA 1WKYA 3WMSA 1XCWA 3VIKA 2BS9A 4J3WA 2DQXA 5I78A 1H5VA 1JYXA 1ESWA 1XH1A 4GKLA 3SUUA 3DHPA 1B3XA 1H09A 3CMJA 3W26A 1WB0A 1C7SA 1OWQA 1BVZA 4WJXA 2BXYA 2PWDA 1MYRA 4W84A 3AHVA 3GXFA 5JBEA 1HP4A 2CXGA 2CHOA 1UD2A 3AJ7A 5GNZA 4CCEA 1Q6CA 1UD3A 1A3HA 3T2OA 4WF7A 1GVYA 4GXPA 5IFTA 3EDDA 1NM9A 1LWJA 3L4TA 2UY5A 2EPKX 1W3HA 8A3HA 1CLVA 1DWFM 3AHXA 3MMDA 1H1NA 4X0VA 1VRXA 1W9XA 2YA1A 2J75A 3N12A 4PRWA 5CXPA 2CKSA 4H41A 4TXEA 4UOZA 1ISVA 1TR1A 4XX6A 3RM9A 2ZUWA 5A2AA 3VMOA 2VURA 2XWEA 5LYRA 1H4PA 4JIEA 2JEPA 2F8QA 1H49A 4H7VA 4MAVA 1C90A 5LA0A 4D6CA 2GFTA 2GJRA 4CKQA 1E4MM 1MXGA 1UA7A 3AXIA 3QGVA 3CHDA 5AYBA 4AEEA 5A6MA 2Y2WA 1JYWA 3KZSA 3PZ9A 2DH3A 3II1A 2W61A 2YL5A 2MANA 4PTMA 3S2CA 1PZ2A 2XSAA 4M82A 5DF0A 1OBAA 2AOSA 2BY3A 3N17A 4N0RA 2B31A 1J11A 4OBRA 1VB9A 3DHUA 1V6YA 1ZL1A 5A6SA 1JF5A 3IAPA 5DT5A 2WK2A 4PUEA 3ARPA 4HMCA 5DFAA 1JGIA 4PMXA 4BS0A 2X2YA 2WZEA 3AHZA 3QHNA 5D9PA 3U7BA 4AD1A 1B3ZA 1QVBA 2WWDA 2PB1A 3AYRA 5FOOA 3LPGA 3A4AA 2Y4SA 4J3VA 1UR9A 1AQ0A 2WPGA 2HISA 4M81A 3VKKA 4OBSA 4TX8A 2ZX5A 4GO8A 1FOBA 2FGZA 3OG2A 4QCFA 3VIOA 4M80A 3SCQA 3IK2A 4M8UA 4UZSA 4B9YA 3SCPA 1W9DM 4BZYA 1G94A 3VVGA 4DM1A 1OINA 5GPRA 1H3GA 2E4TA 2VO5A 3VNZA 3VX1A 1PX8A 4OKDA 5HDRA 2XFFA 3VD5A 4W8LA 3WF4A 5CPSA 2WYSA 3EDJA 3PZTA 4MNJA 1MXDA 3CUFA 3KEHA 4MNKA 3THDA 2PBGA 1AMYA 1HXJA 4CD4A 1E73M 2YLAA 1UD5A 4HA1A 3FY1A 2Y5EA 3EYPA 1A47A 3VDHA 1UWIA 3T2PA 5A2BA 2E9LA 4JKLA 2W67A 4RE2A 4PBGA 3M07A 1FH8A 4EANA 1W9UA 4XZWA 2QPSA 4NRRA 4CU8A 2CETA 4A3HA 2IXVA 1I1XA 2E9BA 1XRVA 4HZ6A 2UY2A 4U2YA 1HJVA 2ZWYA 3W4RA 3VGGA 3AISA 3OZOA 3UG5A 3PTQA 4P7RA 4P7LA 1JNEA 4IISA 4BQ5A 1B3WA 5A6LA 1VFFA 2WM0A 1Q4NX 4UQAA 3UR7A 1TE1A 3POCA 5DEZA 4QCEA 4D6FA 4JHOA 5A8OA 4M24A 3ARSA 1V6WA 1QI5A 3WFZA 3WL0A 3BMWA 5BCAA 3AICA 3VGHA 3CMGA 1R7AA 4AZIA 3GXIA 2D24A 4IUGA 3AS1A 7TAAA 3K8LA 1E0WA 2VZTA 3RM4A 5JIPA 2WLZA 5BXRA 2ZXAA 3FW6A 1ZB5A 1BSIA 2CESA 1RPKA 5E09A 2DT2A 3RO8A 3GNPA 1HL9A 3CZ8A 3KL5A 1JAEA 1XHGA 1V0LA 1HJSA 2WWCA 2DT3A 2WVVA 3ZT5A 4BQ2A 3WDIA 1EO5A 1JI1A 2BXZA 3DECA 2CYGA 2XM1A 1Z32X 1ZBKA 5IXEA 3OLDA 3VD4A 1CXHA 4HOZA 4CN1A 5BXPA 1TA3A 5EB8A 3CUIA 4F8XA 1O6IA 1MW2A 2CERA 4KRUA 2PBOA 3WIJA 2WMIB 5DMYA 4MADA 3PHAA 1TVNA 4CCCA 3QOMA 3VIHA 1E6XM 2ZUMA 4TOQA 1UKPA 1BAGA 4C7GA 2DSUA 1QHOA 2ZE0A 1R85A 1HJQA 1ZU8A 2OSYA 1V3JA 4OIFA 3VGDA 3CHFA 3CZJA 3MUIA 2VR5A 5A6BA 2X8RA 4W7WA 1HKMA 4TVDA 1EDGA 3GTNA 1XSJA 4CVUA 5GNXA 5C70A 2O92A 4CCDA 1J0ZA 4YHEA 1CXKA 3GYCA 2XJ7A 3AMKA 1OT2A 5D9NA 3FAWA 2PWGA 1J12A 3B9DA 2DIEA 1GJWA 4D1JA 2BHUA 2WMFA 4J3SA 4GI8A 3VINA 5M17A 5HXMA 4AY1A 2YBUA 4FLOA 2WHJA 3AMGA 3VD7A 3UEQA 4PMQA 1B0IA 4LX4A 1TZ7A 3ZSSA 2PWFA 5A8PA 4W5UA 3VIFA 5ABGA 1X6NA 4PMOA 5I5RA 1KFWA 3WD2A 1W1YA 3W37A 2DSKA 1E40A 1KXVA 3O9NA 3UETA 1QOXA 2ZOXA 4UOJA 1UD6A 1V03A 3EDKA 1G5AA 4FF5A 5JBDA 1HKJA 2Z1SA 1HX0A 4TVCA 3RDKA 1V6UA 2ZUTA 4HTYA 4AYSA 4B9ZA 3F4VA 4IPLA 3BAKA 3WNKA 3RMEA 3VGFA 1JYNA 2TAAA 3OBAA 2G3JA 4J27A 2VX4A 3L4WA 3VPLA 4M56A 1UZ4A 3AS0A 2C8NA 1BHGA 1MW3A 4QLJA 1GQJA 1W9BM 1U33A 1Q6EA 4W93A 5I3DA 4PTXA 3FHQA 1M01A 4PTVA 5A94A 1OM0A 1B30A 3PZNA 2YL8A 2J25A 1IT0A 4UFLA 2J7DA 2EPLX 5LA2A 4Z2JA 1ISYA 3ARYA 1QBBA 1HJWA 1M04A 1IZKA 3ARWA 3BSHA 4K68A 1Q6GA 4LYQA 4W7UA 2JALA 1GOKA 1GQIA 4FLQA 4WK9A 1B31A 3MV11 4ZE4A 2WMGA 5BWFA 2F2HA 4XZBA 1UR2A 3WMBA 1E5JA 1NWTA 4GPNA 3VUPA 4S3JA 4GI6A 1CBGA 2WCSA 3GBDA 1NOFA 4CD5A 2J77A 3IJ8A 3MS8A 3OGSA 2D1ZA 1FP9A 4V28A 4D6EA 2JIEA 5IHSA 4LGXA 3QR3A 4D1IA 4J28A 1UR0A 3BLPX 1VEMA 3UG3A 3L4YA 4J3TA 3WNLA 4Y7EA 1EOMA 4D6DA 5A69A 1B1YA 1US2A 3DYMA 1GQLA 2RGLA 1JNDA 8CGTA 2ZICA 4AIEA 4FLSA 2X0YA 2ZIDA 3AYSA 4PMUA 4LXFA 5KEZA 3W28A 1CECA 3CHEA 3VIIA 3ARQA 3S6TA 3MSGA 2JF6A 1I1WA 2J7FA 4AZHA 4QFUA 4MJ2A 1OGSA 4UQEA 5D9MA 1CGYA 4H8UA 4TX6A 4PEEA 2VJXA 3VMPA 2W63A 1BTCA 3ZT6A 2YKKA 1J0HA 5FCZA 2D0HA 2VQTA 3ZJ8A 5BYWA 2VCCA 4OUEA 2ESCA 3CZEA 1CTNA 3AIQA 4CN4A 2VVNA 3WUGA 1E4LA 4P7NA 1G01A 4UFIA 3CUGA 1PAMA 1HVXA 1WZLA 4FLRA 3WNMA 3GM8A 1W1VA 3PZUA 3VILA 3WDQA 1FP8A 1E56A 3PTKA 1E71M 1BFNA 1UD4A 1MW1A 3WUFA 5CZKA 3G6LA 3EDEA 3NDZA 1F4HA 3D3AA 3CBWA 4UCFA 4AXNA 5ABHA 3O6AA 5A1AA 3IAQA 3W6LA 4FMVA 3WMCA 4TTGA 3NCOA 4PUDA 2J7HA 4AD4A 4A4AA 5E6YA 1W3KA 3SCOA 3KL3A 1HVQA 3FN9A 3LPOA 1C8XA 1XYZA 3VIJA 4U5KA 4OZOA 3W81A 3FXYA 1NWSA 4JCLA 3ZO9A 2OWXA 5AC5A 2G8ZA 2W66A 3WBAA 2XWDA 2ZX6A 1AQHA 2WMIA 4HPGA 4P8VA 1CGXA 4UNIA 1UR1A 1S46A 2A3HA 1MWOA 3SUVA 3VM7A 3WQ5A 1V6XA 1LLOA 4KMQA 4AIUA 3NUKA 1G9HA 3LPFA 4UOQA 3WDRA 1QI3A 2VT0A 4ZE5A 3PZQA 5HPOA 5AC4A 4X0NA 2CBJA 2UY4A 1MFUA 3WH8A 3ZOAA 4R5EA 2V3FA 1J0YA 2W4XA 4UQCA 3CZLA 3T2QA 4TUFA 2Z1KA 3MSDA 1QBAA 3I3EA 4M1RA 1E4IA 1HN1A 1RP9A 2D20A 3K1DA 4D6HA 4AD2A 2Y24A 4W8AA 1V3HA 3AIBA 4U3AA 1UOKA 4BQ4A 3POHA 2BVDA 1DP0A 5E0CA 3WUBA 3A6OA 1XD0A 1W91A 1ITCA 2V3DA 1JXKA 4IPNB 1UQYA 1LL7A 4HZ7A 2WW5A 3CUJA 3ARRA 1GZJA 1QNRA 1BPLB 2WZHA 3WDPP 1GPFA 1FFQA 4CGTA 2J8FA 2WB5A 1EOKA 1YQ2A 4LQ1A 1VFMA 2IUZA 3NDYA 3ARUA 3CLWA 1SMAA 4XB3A 3WELA 3D5HA 2W5FA 1W9VA 4U31A 3TA9A 2ZWZA 4EE9A 3VGBA 1KCKA 2W92A 1EIBA 4HPHA 3OGRA 5DT7A 2D0FA 2VI0A 2DSVA 3T0AA 1MQQA 1K9TA 3K4DA 1E9LA 1UR8A 1QNSA 4Q7NA 5A3HA 1VBRA 1MVYA 2GJXA 5CGTA 1PIGA 3SUTA 1BVNP 5ECUA 1V3KA 1GOIA 5JIWA 4AWEA 3AS3A 4HA4A 3ARVA 3W0KA 2YJQA 3QHMA 4L4PA 2E8ZA 1KBBA 4GQRA 4U2ZA 1GNXA 3WD0A 1M03A 1FH9A 2X0HA 1QW8A 2OSWA 1V0KA 2WSKA 1GQKA 3WH6A 2WVSA 3VIGA 3WUEA 3BCDA 3MANA 5CLTA 2YBTA 1E70M 2WBGA 3M6DA 4UFKA 2WCAA 5CGMA 2BHZA 3N9KA 2VMFA 4JFTA 5D8ZA 1HNYA 3ZJ7A 3ZQ9A 3VNYA 4OOUA 3T08A 2J7GA 4P7QA 3WNOA 2ZUVA 1GCYA 4MDOA 3WF1A 4MTVA 1Y7VA 1VF8A 1SMDA 1JZ8A 1CENA 2FH6A 1WDSA 4DWSB 3W27A 2XGBA 1TCMA 1CPUA 1OGBA 2UY3A 4JZ5A 3BAXA 4F9DA 3AFBA 1ODUA 4Z2KA 4F9JA 2WVUA 2J74A 5CG0A 4GZJA 5GQBA 1WZMA 4JAWA 4WSJA 1G1YA 7A3HA 1KR0A 5FIPA 1UKTA 1TVPA 3ZM8A 1JZ3A 5HNNA 1V3IA 2XSBA 2PWHA 6TAAA 2NW0A 1UKOA 2WZIA 3TTSA 1ZJAA 3BMVA 4JCMA 5FL0A 5ABFA 5FD0A 1HJUA 3NIYA 4WIWA 3KWXA 3FNDA 1C3FA 2GK1B 5C8BB 3VDBA 3NSMA 2VL4A 5A8NA 2XFYA 3PZOA 3PZGA 5I77A 2O9RA 1EHAA 3ECQA 5EBAA 1W1PA 1X6LA 3U5UA 3ZSTA 1V08A 4AISA 4IM4A 5M3WA 2WAGA 1JDCA 3MKKA 3RM8A 3NYDA 2QMJA 3J7HA 3A4XA 3VOCA 4U5IA 1IZJA 1E3XA 4MB5A 3ZMRA 3VDAA 2VRKA 4DM2A 1PX3A 4CD7A 5BXSA 1VAHA 1VBUA 1W2PA 1J0IA 3SURA 1J0JA 4B3LA 2E3ZA 1VJSA 3TTOA 1WO2A 1H2JA 1H11A 4MB4A 4CN6A 4RE4A 1WE5A 3WD3A 3OIHA 2E9MA 4AD0A 2EQDA 1EA9C 1ISXA 3CIVA 1UWSA 1JFHA 2WKGA 2GDVA 1PEZA 2X1IA 3PN8A 4TTUA 4AC1X 2V5DA 2J7BA 3AXXA 4A3YA 2QPUA 4JFUA 3N13A 2W91A 1E6ZA 1QI4A 1J01A 2EO7A 2FH8A 3GH4A 3ZJKA 1FHDA 3UESA 3GH7A 3B9EA 1CYGA 2O9PA 4H2CA 2ZUNA 3BC9A 1V02E 3UCQA 1KR1A 1JF6A 3SCVA 2DGAA 3BLKA 4PSRA 2EPOA 4CUCA 1UH3A 1BF2A 1US3A 2J7CA 2JF7A 2ZX7A 1VEOA 4UQDA 5I0DA 1CXIA 2WMJA 2ZXDA 3WDJA 2EJ1A 3L4ZA 2AAAA 4PMVA 2VX7A 2WCGA 1QNPA 1WPCA 3TOPA 3LPPA 1V3LA 4AZCB 5F7UA 2VZOA 3GNRA 1CZ1A 2F61A 1AVAA 1K6AA 2YOCA 5BXTA 1GUVA 3AHTA 5IDIA 2CEQA 4DUWA 4MNLA 3WQWA 4GZEA 5E0FA 2OYLA 1CXFA 4W86A 4RL3A 3T09A 3HJEA 5HPCA 3MUAA 1MFVA 4D6IA 4L4OA 1JIBA 2GUYA 3B9AA 5A6BD 3SIMA 3A3HA 1QI2A 3N15A 2XVGA 2OWWA 3F5KA 3CPUA 2O9TA 2V3EA 4AZ5A 1V3MA 4W8BA 3LMYA 1DWIM 3HN3A 1HKKA 3RPMA 2BHYA 4WLCA 3BAIA 5CPQA 5CSUA 1CLXA 1WZKA 2VRJA 2WANA 1LL4A 1C8QA 1PX4A 4W5ZA 2NT1A 1ZBCA 1ISZA 3NJ3A 4PMDA 3WNPA 6A3HA 2DEPA 2WXDM 3T0BA 1ECEA 1OIFA 3AIEA 2VZVA 4UFHA 3RJYA 1E6SM 3WEOA 3G6MA 1XSIA 1DWJM 3L4XA 1CGWA 4HMDA 1XCXA 3FAXA 1DTUA 1I75A 2YA2A 4AD5A 2DT1A 2OYMA 2FHCA 3U7VA 1BYAA 3T0DA 3WF3A 3M46A 2A3EA 4PCSA 1ISWA 2YDRA 4EKJA 2E40A 3EBVA 1WDRA 4AW7A 3VDCA 2QHAA 2O9OA 3K4AA 5KZ6A 1GOQA 3ZR6A 2WSPA 4ZENA 1QNOA 3L4UA 1NWUA 2VR4A 3F5JA 4B16A 1PIFA 1JDDA 4Q22A 4UQBA 2QV4A 1E6PA 3OGVA 3NSNA 2DPEA 1WAWA 4AD3A 4DUVA 4MJ4A 5D4YA 3W6MA 4DWSA 1J0KA 4AEFA 4PMZA 4PTWA 4D6JA 4C7FA 1CEOA 3TTYA 1NOUA 1JZ7A 1DHKA 4JFVA 1TFVA 1JZ4A 1OB0A 3AIWA 2BY0A 3ARXA 1E1EA 4V2XA 1GJUA 4W88A 1IV8A 3GBEA 3GNOA 4KRTA 1L0PA 2HVMA 1HJXA 5A95A 3I3BA 3HU7A 3SUSA 4PMRA 5CJ5A 2GK1A 2AMGA 1CGTA 3UR8A 2JE8A 1EDQA 7CGTA 2DIJA 3N04A 1WP6A 4GZIA 1VEPA 4F79A 1ZBWA 1UWQA 4U3CA 5I24A 3W24A 3MMWA 1Q6DA 2GDUA 3WH5A 2BY2A 1W2VA 2NT0A 1H41A 2GJPA 1F4AA 1KQZA 1E43A 1BGAA 3EMZA 4LYRA 1W32A 2WNWA 1QW9A 2G3MA 1CGUA 4JHZA 4ACZB 2J7EA 1CIUA 2WC4A 1B3YA 2ZXBA 2YL6A 1OD0A 4QLKA 3BAWA 1X1NA 1LG2A 3SCSA 4KGJA 2QF8A 1EDTA 3OLEA 1GHSA 1J10A 4ML4A 1GONA 1M7XA 3VMNA 1AQMA 4KH2A 1MW0A 3AI0A 2VTFA 1HP5A 4UR9A 1UUQA 4WSKA 2WVVB 1MQRA 2QLYA 2VQUA 3GDBA 3TTQA 1OCQA 3WBEA 1XH2A 4S3KA 4X9YA 5M03A 2FGLA 2PC8A 3AIRA 5CPTA 1H0GA 3GZAA 1C7TA 1YHTA 2E8YA 4YHGA 1R86A 1TA3B 1WZAA 3AMLA 1UZ1A 2CHNA 3OZPA 5JH8A 2D23A 3DYOA 5AYIA 4P8UA 1OGGA 2ZUSA 1B90A 2BNJA 4J3UA 3BSGA 3AQUA 3WEMA 4E8DA 1RH9A 1QNQA 1NOWA 3WKZA 3AS2A 4URIA 3OA5A 4NSBA 3N18A 1J18A 3ZJ6A 1GVIA 4KGLA 3VM5A 2QMKA 4M29A 1JDAA 1HF6A 4D71A 3SUWA 2VZUA 4GO9A 3VIPA 3VGEA 4AZCA 4YN5A 5FKYA 1QI0A 1WDQA 2YL9A 1PZ3A 3MUZ1 4N42A 2VX6A 4JFWA 1D3CA 2Q8XA 3WQ6A 2G3IA 1VJZA 4H04A 3WH9A 1EQPA 2OYKA 3OLGA 4UZUA 2VVSA 2YDQA 3ZR5A 3RJXA 4E4PA 5CQ1A 3WH7A 1JZ6A 4KWUA 3AROA 1K9FA 3E1F1 3ARZA 2YA0A 4U33A 1R87A 2V38A 1D7FA 2DSWA 2XVPA 5M5DA 1KWKA 5FL1A 4UFJA 3CH9A 5A6JA 1VFUA 3SEPA 1NP2A 1V0NA 1E5NA 2XVLA 5D9OA 4Z2LA 1XH0A 3MU7A 4D72A 3MO4A 1C92A 1E4NA 3CTTA 1TG7A 2BVTA 3EDFA 1N82A 3U57A 4D6GA 3IJ7A 4AZBA 2CBUA 4HZ8A 2D3LA 2J4GA 2J79A 5E70A 1W9PA 2PI6A 4XUYA 4QDMA 3WD4A 4HP5A 4HA3A 2CKRA 3K8KA 2XVNA 1GHRA 4UFMA 2VNCA 3A4WA 4UQ9A 1E0XA 2VRQA 2GVYA 2XG9A 4R27A 4EK7A 3WD1A 1HT6A 4ZEPA 4FK9A 2XFRA 1JZ2A 2J62A 1FH7A 2D0GA 9CGTA 1WNOA 2WC7A 3APGA 5CLWA 3WN6A 4MDPA 1KXQA
chains in the Genus database with same CATH superfamily
4IIGA 1MXSA 1KNWA 4KR0B 4TV5A 5C71A 2XH2A 3ATZA 4HU4A 1B2YA 3SCWA 3GDMA 9XIAA 3S9YA 4Q8UA 3TYEA 4LUJA 1UB3A 3BH4A 3EA1A 3HG3A 1Q6OA 4V27A 2KE0A 5FJUA 2G41A 5I00A 2WZMA 1E6RA 1MZHA 3GR4A 4REQB 3M7WA 5I3IA 3E0FA 3CUHA 2QJNA 1V7YA 4JS3A 4ZXOA 1IXQA 2Z7GA 1BGGA 1H0IA 1Y65A 4QDPA 3BAYA 4DRJA 1QPQA 3KL0A 3N9SA 5CSYA 4EF8A 1J79A 4J5NA 3UY7A 1Z42A 1KGWA 1SFSA 5GJNA 3U4FA 1JUBA 4R7JA 3LTPA 5IBXC 3SCRA 2B4GA 2A5HA 1UWRA 2YCKX 4IGMA 1P0KA 1CXEA 1SR0A 3MP5A 4M19A 5DCDA 1YE6A 1TMQA 1DWHM 2ETNA 2PTZA 3UQNA 3AWOA 4YYCA 1BYDA 2ABAA 3L0NA 5I2UA 4O8AA 4WKHA 5EU9A 2PP1A 5HR7A 1PBGA 3C56A 4NZ1A 2EBNA 4ACZA 4GH3A 2EXOA 3KABA 3SCUA 3AZRA 2A3AA 3K4WA 1WX0A 1UD8A 1A5MC 4R9XA 3IIPA 2XTKA 5E93A 3LNPA 1GORA 4GGHA 3FA5A 2PPOA 4LAMA 3FJ4A 3OEXA 3ZVHB 4G8TA 5CBBA 3WBWA 1CGVA 1P7TA 4RV8A 3WYZA 4W85A 5HR6A 1KM0A 2WLYA 1WCGA 1XLMA 1ZCOA 1LCOA 1VGAA 4BJHA 2ONEA 1NDZA 2XH7A 1R5YA 4K2SA 4UWMA 3N11A 5FJRA 1LF1A 1EUNA 1R9XA 4IFRA 4PFMA 1QHZA 4PULA 1KM4A 5KMYA 2A3BA 1LWIA 3WBYA 3IWPA 3TW9A 4EPDC 3M16A 3H24A 1J8VA 1NDWA 4FAMA 3CAWA 2OQYA 2ATMA 3ALGA 1PL9A 4GFSA 3COTA 3SCTA 1ZHAA 5K9XA 4YU1A 2B7QA 3AMCA 3DFSA 3GG1A 1O7AA 3GHSA 1JI2A 3W86A 2EPMX 1XC6A 4IIEA 3ITXA 4PODA 4H9YA 3JR2A 3I3DA 2YFNA 1MQPA 4MPKA 2ZTKA 4QHRA 1I2RA 1ZJBA 4DROA 1JCJA 4JEQA 5TBOA 3TN4A 3MHGA 1H51A 4DO4A 1YPFA 1R2TA 4LPCA 4RKAA 2DP3A 3BE7A 3H4GA 1D7JA 4RDVA 1CXLA 4E2BA 1B9ZA 7TIMA 4UTJA 1FRBA 3RRXA 3GXMA 4JFSA 2A3LA 4LC8A 4ZQRA 3W7JA 1N8IA 1UYQA 3HB9A 4HN8A 1UPMB 4O14A 3LXAA 2C13A 2XUCA 2YB4A 4GYPA 5BWAA 2QGYA 5HTGA 5I23A 1YXCA 2W3ZA 3QN3A 2MF9A 1NJJA 2QAFA 3W1UA 4IQCA 3OVGA 4CD6A 4L5ZA 3P80A 2Z0IA 1KWGA 4ZXLA 1DJIA 2MLYA 4LUIA 4W87A 2EULA 2POZA 1RBAA 1PKMA 3G24A 4J7RA 1PZ1A 2O7QA 1UPPA 2WMHA 2E28A 4PCFA 4G7FA 4Q8MA 4H7ZA 1LWHA 3MKVA 2R14A 5D38A 3AU2A 2GJXB 1S2WA 4IJCA 4PL2A 3SN4A 3SN1A 2JFEX 2CLFA 1F3WA 2V5JA 2J8GA 5C9UA 3G1RA 4LYPA 1UA3A 1U30A 1XBZA 1NH6A 1TUXA 2Y8UA 2I5IA 2XPKA 1XBXA 2PRMA 3HV9A 3CWOX 1YW5A 3F03K 4EPEC 4Q4RA 2Y7FA 4H8VA 1TREA 1RD6A 3W82A 4DWSC 3AYTA 4AWTA 1YBQA 2OFJA 3DFPA 1WDPA 4JYEA 5CG7A 4O54A 4QS6A 2Y8VA 3OODA 2I16A 1UH4A 3HV8A 1UHVA 3AIUA 1JCNA 4B2DD 1G0CA 3NQMA 3O0FA 2R1LA 4O18A 1KXHA 3W53A 2EEXA 4ROQA 4GIVA 5DXXA 2WHKA 1N8WA 1NFBA 2D22A 5IHRA 3G77A 3LU2A 3DUGA 2HE5A 3MV01 4QGCA 2Z6JA 4C7DA 4C5ZA 4Z0JA 2K8IA 3UYCA 1XXXA 4MB3A 2YZRA 4EACA 3WQ4A 4R7OA 4XZHA 5A8MA 4S3AA 3E3HA 5HUPA 3LB0A 5BROA 4NZJA 2KI3A 4CVWA 4PB5A 3L2MA 4JFKA 4O52A 4HU8A 3GR7A 3PF3A 4PN2A 4K36A 4BA0A 1B3VA 1MI3A 2MPHA 3M0KA 2VN1A 1BG4A 4MKVA 1HKIA 1ZS2A 2IQTA 5A6KA 5DIVA 4JKMA 3A23A 3URBA 3AOFA 2J6VA 4BQ3A 1YDYA 5A8QA 5DY2A 3EB3A 3K2GA 1UASA 4YIWA 4O53A 3LDVA 5BOOA 3GXDA 5LXEA 4WY0B 1WDDA 4XTDA 4H9MA 3NZGA 1LBMA 2AGTA 2BOGX 3HURA 2DVUA 5ECVA 4DELA 4NZCA 2PDUA 4GQQA 1E72M 4LSBA 3DFTA 4BF8A 4GI9A 2Q01A 4JY8A 4L4MA 4AZ7A 1P6WA 3VIMA 3A47A 2OLAA 2WMKA 2EGZA 3PC0A 3MC5A 2OO6A 2NQJA 3PRAA 4XIAA 2FKEA 1TPWA 4KQZA 3EKGA 2Q8ZA 1N1AA 3B0UX 1T41A 2CBIA 4DBWA 3LLXA 2F6KA 2C0HA 4P7OA 1NWRA 1TCDA 1WKYA 1TO3A 1XCWA 3VIKA 2JBMA 3NDOA 4J3WA 2RDWA 2DQXA 4P2VA 5I78A 3PP7A 3CV6A 1JYXA 4OUIA 4GKLA 5LIYX 1PIIA 1B3XA 4INFA 4OGZA 5TAOA 3W26A 1TSIA 1ZQ5A 1OQFA 3DN5A 1C7SA 4IP4A 4AQLA 2PWDA 5K9DA 2VCDA 1ZK6A 3EPOA 4G2PA 4ZO9A 1HP4A 4DRKA 4Q3MA 1UD2A 5BW6A 3G0XA 5D2XA 5BU6A 5GNZA 4WF7A 4S23A 4HNCA 4GXPA 3BMXA 5D2WA 3EDDA 4KCWA 4YTTA 3LHUA 2UY5A 2EPKX 5C0QA 3GTFA 5K4ZA 5CH9A 5C7HA 3PY2A 1NU5A 1W9XA 2YA1A 1POKA 4KIRA 1U83A 2XIQA 5HANA 4IX0A 2QJIA 3KTCA 1J6OA 2VFEA 4IT1A 3M0LA 1F6KA 3ELFA 4HU3A 2CKSA 4H41A 4TXEA 3A3WA 3CMFA 4AWUA 1TR1A 4XX6A 3UXDA 2ZUWA 2VURA 4AVNA 4LY8A 2F8QA 4PFHA 4H7VA 3B0VC 1E4MM 3GFXA 3W85A 2ZQUA 3PZ9A 2DH3A 4FP1A 4WDTA 1HZYA 3KADA 2W61A 1KM1A 1K6WA 2GQAA 1MMFA 3NOEA 3O63A 1PZ2A 4M82A 4KERA 3IKGA 4GYJA 4N0RA 3KCEA 4YCOA 2Q3OA 4IP5A 3WK1A 1PZ0A 3QSRA 3H26A 3LRLA 3W7PA 5A6SA 4DBUA 2WK2A 3E9AA 4PUEA 1RCXB 4HMCA 2FZ9A 2Y61A 1T40A 2WZEA 3C8NA 1W5QA 2D73A 5D9PA 3FGCA 3AYRA 1FKLA 3LPGA 2Y4SA 3UI6A 1S5NA 2WPGA 5G2WA 3CUZA 1HXVA 4M81A 3FS2A 1T96A 3VKKA 1J4RA 4I90A 2I56A 1FOBA 1RBLA 4XZNX 1Q85A 1XLFA 3OVQA 4XKYB 3SCPA 3W73A 4DM1A 3VVGA 1BL4A 1TJ2A 3KTSA 3VNZA 2LGOA 3GW0A 3VD5A 3B8TA 4GISA 4W8LA 3RU6A 4Q6XA 3KS6A 4GJIA 3RF9A 1BWKA 1AH4A 4WDUA 4TW6A 3MZ2A 1M1BA 1WQ5A 3MYOA 2YLAA 3LGGA 1UD5A 3FY1A 2QEZA 3CASA 2IKJA 3NEHA 2E9LA 4PBGA 5DITA 3O5QA 2QPSA 3K5XA 3SSZA 1CW2A 2E9BA 4D9PA 1HJVA 1K7FA 2EAWA 4MZYA 3VGGA 3AISA 3W7QA 3A64A 2HMCA 4RDWA 1XS2A 5C2CA 2Y5SA 1VFFA 2WM0A 4F40A 4HNLA 1ME8A 3SDOA 4HNTA 4ODKA 3RCMA 1I6NA 1JUEA 3KAHA 5A8OA 4M24A 4JIHA 3WFZA 4M7TA 1LDCA 3LZ3A 4Q4KA 5EGRA 1R7AA 4AZIA 4IUGA 7TAAA 5JIPA 2V67A 3LOTA 5CEWA 2ZXAA 2Z24A 1F40A 2CESA 1RPKA 2HK0A 1V0LA 5MF5A 3PG9A 4Z1YA 1JI1A 2BXZA 2ALRA 2M08A 1PYFA 2LJ4A 2XN0A 1GYMA 1C29A 3CUIA 1LM1A 1JQVA 1O6IA 1EBHA 3W7NA 3M0JA 3R10A 5KINA 1LOLA 1T8QA 3VIHA 2ZUMA 1BAGA 5HWNA 2DSUA 3G1FA 1ZU8A 4OIFA 4I7UA 3IGSA 1W3IA 4B5WA 1Q5MA 4H9TA 4Y8FA 4FNSA 4GVGA 2VR5A 4TVDA 3NFUA 3HGOA 4LUSA 4WZHA 1KFBA 1TX2A 4YHEA 3GYCA 1RJPA 3CL8A 3O5EA 4OV9A 1O94A 3KOYA 1UR3M 4D1JA 1QATA 1XG3A 4GI8A 3H54A 3EOSA 4AY1A 1WBHA 2ZZ3A 4UR7A 3EWBX 3XISA 4NJKA 4L6OA 3AMGA 4E2DA 2FVMA 2PWFA 3IUHA 1I2NA 2PPGA 3HQOA 4J9JA 5ABGA 4HCLA 4YMZA 2BMBA 4PMOA 3WD2A 3BMBA 2DSKA 3UETA 1KXVA 1QOXA 1UD6A 1V03A 3RRAA 1LLZA 2CU0A 2PGRA 4B5UA 1QT1A 3WQGA 5AFDA 1O5KA 3IS4A 1KRCC 4FZIA 1V6UA 1OFEA 3BW3A 3F4VA 3SRHA 1F76A 4O50A 2WQPA 1F8MA 3OBAA 4LRTA 5C54A 2BSLA 3VA8A 4KEUA 2EJAA 4QITA 5LNVA 1XLLA 1MW3A 1UW9A 1W9BM 1U33A 1Q6EA 4JQAA 3RLVA 4PTXA 3FHQA 1M01A 3SJ3A 2REQB 3Q58A 5G1YA 4ZSUA 3UZXA 5A94A 3U8GA 4UNKA 2J25A 1IT0A 1HQTA 2X7WA 2YCEA 4JTFA 4Z2JA 3L67A 1IZKA 4WK9A 3MV11 5LXXA 5BWFA 2F2HA 3WMBA 3FSTA 5CCZA 2VYOA 3EPNA 3N6QA 4GI6A 3YPIA 1CBGA 1FUYA 3IJIA 1J2BA 1NOFA 2J77A 4ZPWR 4GD0A 2JIEA 2PDWA 1SZRA 1VEMA 3L4YA 3N9RA 5DLCA 3UZYA 3WNLA 2OOGA 3EXSA 4B4HA 1US2A 2XP7A 1QWKA 1K70A 4XKMA 2RGLA 2KZHA 3LNMA 2ZIDA 4GUHA 3N4AA 1TPUA 3ITGA 3W28A 4AYGA 4E2VA 2BZNA 3RPDA 4Z0SA 1TZZA 3N2MA 3S6TA 2ZCGA 2XPAA 2OZTA 5DBTA 5H8PA 1OGSA 1ONWA 2O7SA 4UQEA 5D9MA 3UWQA 3FA4A 3LM7A 2J8TA 4C6BA 2IPJA 3VKAA 4PEEA 2A2IA 2VJXA 3HBLA 1BTCA 3ZT6A 1V51A 2RHGA 2RDXA 4S2BA 5FCZA 3LGEA 3ZJ8A 2WKJA 1FX6A 3AIQA 5E0KA 2VVNA 1TPFA 1E4LA 1G01A 3DFYA 4NX5A 2OPJA 1PAMA 3UWWA 4Q4QA 1Z9AA 3TAKA 1WZLA 2E7FA 3W1NA 2FDSA 3W07A 3VILA 3PTKA 1E71M 1UD4A 1FDZA 1MW1A 3W2JA 4Y96A 3T05A 1S5TA 1YRRA 3NDZA 3R8RA 1LQAA 3NZPA 1VKFA 4UCFA 4Y6GA 2HPMA 3RK8A 5A1AA 3IAQA 3DBPA 4C02B 3W9ZA 3M64A 4FMVA 2WSYA 2BTMA 4NYYA 4GMEA 3BOFA 3KP0A 3M44A 3NL5A 3I68A 4LVGA 2PD5A 5AZ0A 4C60A 4IQLA 4JHMA 4ODMA 5JQ9A 3IV8A 3W81A 2CLOA 2OWXA 3IEBA 4LUTA 2G8ZA 1Q7QA 1ALDA 2NXHA 1DJQA 3O1NA 3S1UA 4GUJA 1EJWC 3L5AA 2ZX6A 3SZ8A 4JTRA 3EOOA 4HPGA 1CGXA 3LSCA 2FFCA 4XZLX 3AAMA 1UR1A 3D47A 3UXLA 3VM7A 4NJIA 1JQXA 1LLOA 1UP3A 6PTDA 3G1XA 3NUKA 3TW6A 2CLLA 4DJED 3ITOA 3GYEA 3USZA 1XQKA 2VFDA 1A49A 2OX1A 4GCXA 4IQDA 1HW6A 2F7FA 1MFUA 3WH8A 1PCKA 2V3FA 2W0UA 3M1ZA 1J0YA 3WJZA 2W4XA 4X3ZA 5H6HA 4O1BA 4IPJA 2GZXA 2G4JA 4ML9A 2OQHA 3LX9A 1Q7MA 2TODA 3NO3A 1RP9A 3O06A 4O1DA 4AD2A 1QAPA 2Y24A 4W8AA 2RKXA 4DB7A 4OECA 4YWSA 3POHA 5C2XA 2M2AA 3TXVA 2OT1A 4XAPA 3E02A 2DG4A 3NZ1A 2WW5A 3L12A 1B3OA 2XP4A 3R11A 2E1WA 4R34A 1Q65A 4LQ1A 2YR1A 4B5SA 1PINA 3NDYA 3NTYA 4JIIX 4XAGA 1KRBC 3WELA 1W9VA 1FXQA 3B4YA 3L9CA 2Z7KA 1EIBA 2ZFAA 1L2QA 1Q7ZA 3OGRA 5DT7A 2D0FA 2VI0A 2DSVA 1QZ2A 4A05A 2OTDA 3C2VA 3C86A 1RALA 1EYWA 4Q7NA 1ZJIA 1VBRA 4TX0A 3EY6A 1RV8A 1PWMA 5CGTA 2RQSA 1BVNP 5ECUA 1PBKA 2QYGA 5JIWA 3AS3A 4HA4A 3ARVA 2ISWA 4NZFA 4EIVA 1PWLA 4L4PA 4G1NA 1XDMA 1QOQA 4TYOA 1EUAA 4GQRA 1X6UA 1GNXA 4ZCWA 5BMXA 2X0HA 4W9PA 3QZEA 2C91A 4HPNA 1QCWA 5TQLA 4JTUA 2I7GA 1X98A 1E70M 2WBGA 4RNFA 1FWIC 3N9KA 1HNYA 3ZQ9A 3VNYA 3T08A 3WNOA 3LCGA 5D09A 1GCYA 4MDOA 4Z1DA 1SMDA 2QKFA 3HZ3A 4HCHA 4XD3A 1TCMA 1CPUA 1ICQA 2PDQA 5H8UA 1DL3A 5DCBA 1A5CA 2J74A 3LHVA 4GBDA 4WSJA 1V7AA 3TSBA 1KR0A 3A5FA 3ZM8A 1G4PA 3B8DA 4P5UA 4MWAD 4US5A 1WXJA 1K1DA 4NXKA 3HPFA 1O1ZA 2YX0A 3CH0A 1ZJAA 4L61A 1ZCCA 1FDJA 4JCMA 3W7LA 4DIAA 2RDTA 2GVGA 3KWXA 3MA8A 3F2CA 4G50A 3GLCA 5A8NA 2XFYA 3L0KA 1TE6A 2OELA 1DJYA 4ONVA 3U5UA 1MUCA 4AISA 3T42A 4HK7A 2PU0A 4IM4A 1JDCA 3W83A 4GGQA 5IBXA 3NI6A 2QMJA 1FKTA 3OTRA 1YIXA 3KBSA 1Q3NA 3UI4A 4ZR8A 1E3XA 1KLZA 1FKSA 1PX3A 3EX2A 1RXOB 5BXSA 4N4QA 3L7RA 1J0IA 2C1IA 3C8FA 2GWNA 2E3ZA 4R88A 1VJSA 4XISA 1H2JA 3PAJA 3TTEA 1H11A 4CN6A 1H1YA 1WE5A 4RE4A 4QQ3A 2AAMA 3KAGA 2HWGA 3OQEA 1EL3A 4GNKB 2HK1A 5E9XA 4S3EA 3TH6A 3PN8A 4FX6M 1ADOA 4JTKA 2V5DA 5IDZA 4QSFA 1P43A 1R6WA 4JFUA 4HNVA 3N13A 1F05A 2W91A 2QDHA 2GVEA 3W1RA 3TAOA 2FH8A 4X2RA 1TYGA 5AYXA 1BXNA 3GH7A 3W7RA 2O9PA 3URAA 1V02E 2FTWA 2VFIA 1JF6A 1B4EA 4PSRA 2PZNA 1W6TA 5FI8A 4LFYA 1BKSA 2JF7A 1KFCA 1CXIA 4WUIA 3U9IA 5I02A 2ZA3A 2ZXDA 3L4ZA 3PBMA 4DY1A 4ZQPA 1EB3A 2VX7A 4XAFA 3IIXA 3NQAA 4MF4A 4I9TA 3TOPA 5XIMA 1MRAA 5LIUX 1CZ1A 2F61A 4Z1AA 1K6AA 2OQLA 1GUVA 1E9IA 5IDIA 1RLCL 1POJA 4DUWA 4MNLA 5E0FA 4HZMA 1NDYA 3U2EA 4JXCA 1VFSA 1H61A 1VLWA 3KCOA 3MUAA 2WM1A 1L1PA 3A3HA 1JVWA 1GKRA 3C3NA 1QK0A 4TIMA 2V3EA 1NIUA 4F0HA 3LI1A 3W71A 3BW4A 2ITKA 1TTJA 4W8BA 3LMYA 5LGZA 4WLCA 4R33A 1DJHA 1SJDA 5I09A 4HYWA 1KC7A 1EJTC 3IRSA 3UD6A 4FOKA 3EWUA 2DEPA 2WOQA 3T0BA 3O07A 1X96A 1PYMA 2VZVA 3WEOA 1YTDA 4F0SA 2XSXA 1OYBA 3L68A 1EJXC 3FXGA 2V30A 1DE5A 2QPXA 4IOTA 5E1QA 2XIMA 3D0CA 3TWBA 4C6KA 1NDVA 3LK6A 2F2KA 2OKTA 4ZOCA 2GUUA 3PM6A 5G4HC 1LZOA 4IMDA 3TSDA 1R9YA 4B5TA 2VWTA 3L4UA 5HAOA 3QVQA 3F5JA 4B16A 1PIFA 4L9YA 5D02A 2VC7A 3UCDA 2DPEA 1SR9A 3GNNA 2TMDA 4GG9A 2ADAA 3PPHA 3OW1A 4DWSA 3GC4A 5F1UA 5G1TA 4PMZA 4NIRA 3NQGA 1CEOA 3UXAA 3TTYA 3MUXA 3TR9A 1NOUA 5DMNA 3PUDA 4DJFD 4BY3A 4MY8A 2Y70A 1DVJA 2BY0A 2P8BA 4DZ5A 3TC6A 2G96A 4V2XA 3QF0A 3FX4A 4LWWA 1DYSA 2NWRA 4O11A 1P5QA 2GYIA 8RUCA 1PHQA 3PSVA 2GK1A 2NVCA 1SVDA 2AMGA 2Q02A 3B03A 3UZJA 3UR8A 2WNZA 1EXBA 4F79A 2GGGA 4MY1A 2XP8A 5HJYA 5I24A 3W24A 4J2PA 1CX9A 3ES7A 1A5UA 2OGYA 1W2VA 3CQIA 2GOUA 4LYRA 3EPMA 1CGUA 4ACZB 3UPMA 1CIUA 1EC9A 2YL6A 3NM3A 4G5DA 4DRNA 3GU1A 3ZLHA 3QKEA 4N9EA 5AHMA 3N25A 4QLKA 3BAWA 3O5DA 1W1ZA 5CC6A 1LG2A 2V5BA 4KGJA 3UF8A 3JS3A 3CIXA 1DHPA 1GHSA 4PCNA 4ML4A 1P7TB 1M7XA 4IQEA 1AQMA 4KH2A 2FLIA 1JRBA 4Q4MA 3ERPA 3KBMA 2ASHA 2FKPA 3TYCA 1UUQA 2FZ8A 1MQRA 8XIAA 3TTQA 2J66A 3TN6A 4LAVA 2PC8A 4KBXA 2ZDRA 1H0GA 6ENLA 3UPWA 5L9FA 2MUCA 3R0UA 5FJJA 1WZAA 3AMLA 1UZ1A 4JOMA 1FCQA 2PCEA 5HMEA 2D23A 1O95A 4OWGA 1CI1A 3CAVA 3UZ5A 1UJPA 4DVOA 3MHUA 1TQXA 3S5OA 3W7DA 3LRKA 1OCNA 3QGKC 4E8DA 3QFWA 1RH9A 4PCPA 3AS2A 1JEZA 2L5HA 3DH7A 4JTEA 4UTKA 2C1HA 3BGJA 3QYQA 3N18A 5C2GA 3KVMA 3FV9A 2QMKA 4M29A 3PWIA 1JDAA 4R0XA 3UWUA 4I7WA 3H21A 1R3WA 3S42A 2C71A 3G1VA 4AZCA 3P74A 3UVAA 1SFTA 3DESA 4U28A 2G0WA 4O1FA 1VJZA 1B57A 3UGRA 1IWBA 3FEQA 1U5HA 2OYKA 4ZTXA 3OLGA 3VC6A 1OEPA 3ZWSA 3RJXA 3QBUA 3GD6A 2NQHA 2XPBA 4O28A 1IEIA 1A50A 5HK4A 1JUKA 4AFYA 1D7FA 2DSWA 4LCRA 1BRLA 5M5DA 5A6JA 3C4UA 3SEPA 4C1LA 1V0NA 1E5NA 3GB6A 4PUKA 3NL2A 2ZYFA 3PG8A 3I7SA 3DBNA 1TJ0A 5D75A 3BJFA 4ZB0A 4YJ5A 1MDRA 4LVBA 3DCPA 1OCJA 3IJ6A 2EG8A 1E4NA 4G6CA 4G9PA 3S5ZA 3CTTA 3C2FA 2BVTA 1N82A 2V2DA 2VR2A 3WX7A 2Z27A 3WQCA 1IX5A 5FACA 3N29A 3LMZA 3AO0A 5KETA 4OVXA 4HA3A 3IJLA 1OFOA 4S39A 3MTWA 4YTUA 5D2VA 3A4WA 4CCZA 3AALA 2XG9A 1GYLA 4HARA 4K7VA 3UJEA 2IW0A 1VPXA 3WD1A 4ZEPA 2ZADA 3PBVA 3O5IA 3ONBA 4FK9A 3SECA 5C6MA 4M6VA 2XFRA 1JZ2A 1XISA 1RVKA 4L3NA 4QE5A 9CGTA 3APGA 2QCNA 2GPTA 1DXIA 3V5OA 1Q6IA 1LLWA 4TNSA 5GJPA 3ZS4A 1UC5A 1LG1A 1XD1A 4R7WA 3WEZA 3JXVA 4WKFA 2BLEA 1E1CB 3G22A 4FX8A 4O57A 3CV7A 1VZWA 1XIEA 3XINA 3SADA 1BQCA 4DYJA 3DG3A 2E25A 3G1HA 4I8YA 4AZ6A 3EEZA 1ZFJA 3TQVA 1KCLA 2ZE3A 3QR1A 1JYVA 2WZTA 1YKWA 2H9AB 3R13A 4NHVA 4ATWA 3PNZA 4WSHA 4C90A 3HG2A 3GDKA 1Z6KA 4MNMA 4J4NA 3P2VA 1TCOC 1XLIA 2BP1A 1E55A 2EPNA 4ENLA 4GRSA 1FKXA 5HUOA 4DNHA 1NQKA 3IVTA 3SN0A 4DX3A 1HKWA 2ZRWA 1FKWA 4PZVA 4C6PA 2ZVIA 4RJEA 1FXPA 1ZBVA 3BQ5A 3HQPA 1QK2A 3I6CA 3BLIA 4DBEA 1VENA 4DI8A 3THCA 4L1GA 3N1AA 2CZFA 3AIVA 3H2MA 3OLIA 4V33A 3V0UA 3KTXA 4EXAA 2DZPA 1ICSA 2JGQA 2WSQA 3LG3A 4H6KA 1GOWA 2ON3A 3BURA 1U1HA 4TU1A 3N4EA 4LANA 3DC0A 1XIGA 4PUJA 4PGLA 5D8WA 4DBSA 4F66A 1DWGM 1O5XA 2YDSA 3NA8A 1XLJA 4ZTYA 3IV3A 3N4FA 2ALDA 1IZCA 4DXXA 3RR1A 4Y90A 1UH2A 4DUXA 3TW7A 4ZB2A 3U3HA 1WKDA 4OE7A 3ZZ1A 1OIMA 4FS9A 2B7PA 3WSUA 1WOBA 4GH1A 1D2KA 2I17A 3GHUA 4QQUA 5AHFA 2GSJA 1QNVA 3CHCA 3KRZA 3CQJA 2VFGA 1QU4A 5GNYA 2XHYA 3QMRA 2JIWA 3L4VA 4AUBA 3MI2A 5DO8A 3BUVA 2DFAA 3PSWA 4JTHA 5BXJA 1W3LA 1LT7A 5E9AA 2ZZ5A 1BWVA 4ZFMA 3BG9A 4JICA 4H4IA 3MP3A 3UW6A 2DIKA 3P62A 1JR1A 3B8SA 2FHFA 1JXJA 3AZTA 3WENA 3WQEA 4IG2A 4WQ6A 3VX0A 3HTWA 5EMYA 1EGVA 1GPWA 3OO2A 2CZDA 1Q45A 1L8NA 1A80A 2ZVRA 3WDHA 4XG1A 3TONA 2QGHA 3C2YA 1I2QA 2DU2A 2DW6A 2PU1A 3CS2A 3DENA 1ECQA 3QQ1A 1XYFA 1UKSA 3CQHA 3IJ9A 5L6UA 2PWEA 1OK4A 2W62A 3TX9A 1O68A 4U86A 3TUUA 3BLDA 2R1PA 1Q6FA 1D7KA 2Q3RA 3AMDA 1E1FA 3SB0A 4DXVA 2AQOA 4GJ1A 3KWSA 4NXSA 3UNDA 1VHNA 4MMWA 2D2OA 2AKZA 3N2XA 3PBGA 2CITA 4PCTA 4E0CA 3GW3A 2BV9A 4GX8A 2FPVA 3WF0A 1JAKA 3FGCB 3LCHA 5CPLA 4CQDA 4LH8A 3H53A 3MJMA 3VABA 1X1OA 2CWXA 4H6RA 2DZTA 2QW5A 4PUMA 1KTCA 2HXUA 3S2JA 4DF2A 1CDGA 4ACYA 4E5TA 1I2OA 4P8XA 4RPQA 4DO5A 5F2GA 4YPJA 3W2KA 4ZFCA 4MAZA 3BG3A 1VS1A 1RJRA 1UKQA 2CWNA 2OO0A 2YCJA 5C9ZA 1DJZA 1HIZA 3B0PA 1AD1A 3QPEA 2WKLA 3A12A 5IOBA 3W1MA 2XIIA 1XR2A 1KD0A 1ADSA 2RUDA 3FEMA 3LSBA 4PMNA 5BRPA 2UV8G 2RGMA 2B0MA 1QPKA 2ZQTA 2R1MA 1VFOA 3MP4A 4ASTA 4ODQA 4UTMA 3F1QA 2NX9A 1VCGA 3UQIA 1NQ6A 5ABTA 1NVMA 4LV9A 2VUYA 1ROTA 5ABFB 2V5CA 3N14A 2DH2A 1OY0A 3GK0A 5EL1A 4BWLC 2CNCA 3H70A 1IXNA 4HU0A 4Y2WA 3CGTA 5E6ZA 1EIXA 1XUUA 2LKNA 2XGIA 1OX5A 3GAYA 5CZJA 1W0MA 1T7LA 3LCLA 4K37A 4UBPC 4W89A 1R2SA 3FVMA 5HQLA 1ZP3A 4HPXA 1HTIA 4WGHA 3VU2A 2ANUA 3NZRA 4KWWA 2TPSA 2DJXA 5REQA 1JFXA 4CU7A 4BF9A 4LF1A 5FA5A 3KVJA 3RPTA 3WL1A 4JN8A 1XUZA 3K30A 4JQ2A 1TELA 4IGHA 2DJLA 2XM2A 4QJ5B 3OZYA 4WEVX 3BXWA 1P6CA 4AVOA 1GW1A 1MZRA 3BGAA 4GIRA 1M68A 5T9CE 1EYEA 4HVXA 2AL2B 2FZMA 2JK2A 3MY9A 3W2UA 5TIMA 4GCAA 3SUUA 1PHWA 1H09A 1K8CA 3RFAA 2GQ8A 3M4HA 3STGA 2A7RA 2BXYA 1MYRA 1R9ZA 1YNQA 3QZAA 4LCQA 4W84A 3CO8A 3R2GA 3H4XA 4LUSB 2CHOA 2FAPA 2KGJA 1OVDA 2NLYA 2FVLA 4CCEA 1Q6CA 1UD3A 3HGJA 3T2OA 1GVYA 4N02A 4IJBA 1LWJA 3U48A 5XIAA 3L21A 1W3HA 2IKIA 4ZO6A 3G2GA 3IIZA 8A3HA 1XLKA 1CLVA 1DXEA 1H1NA 4MOZA 1UCWA 2QQ6A 1K8XA 4MJZA 1DORA 2J75A 2A0NA 3N12A 4PRWA 3TQKA 3WLKX 2PDNA 5CXPA 1JPDX 1VH7A 3VMOA 2C15A 1H4PA 3SAZA 4ODOA 2JEPA 3DKLA 4WJEA 4WCJA 1H49A 3SO7A 2OZ0A 1UIOA 3R1ZA 4S38A 4D6CA 1JCLA 2R6OA 1UA7A 3AXIA 3LTSA 3QGVA 5AYBA 2YXGA 3TZFA 5M2FX 4PE8A 4QIBA 1V79A 9RUBA 2YL5A 2MANA 1U1UA 4R9OA 3S2CA 3P0WA 3KZPA 1AL7A 1TPB1 1OBAA 3CIWA 4IGNA 4MHBA 1FWFC 2BY3A 4H6QA 2B31A 1LQ2A 1MUWA 1VB9A 5JMUA 1ZL1A 3DGRA 3ARPA 2HS6A 3BZJA 4PMXA 3BW2A 2Z6IA 1TX0A 5J04A 3HPZA 3AHZA 3UYIA 4QRNA 2WWDA 2PB1A 2XINA 3EWWA 4NKCA 4J3VA 4JTAA 4DZ3A 3QPZA 2FTPA 1FVPA 4MUPA 4XVDA 4TX8A 4GO8A 4ODNA 3A21A 3PJXA 1EZWA 4O1EA 4M80A 3SCQA 4NAEB 4F48A 3IK2A 3M0IA 1W9DM 1TKKA 1H3GA 1FWBC 4S2CA 3VOFA 5HDRA 3KX6A 2GGJA 3PPGA 3CB8A 1FDYA 5CC7A 1MXDA 3CUFA 3NQCA 1SO6A 5I06A 3NPVA 5EKYA 5D33A 3ID7A 1HXJA 1EP1A 1E73M 3E5BA 2Y5EA 1EQ3A 1KM6A 4ZO8A 3IGUA 3BCJA 1ML1A 1W9UA 2IXVA 2Y63A 4J3ZA 4HZ6A 4U2YA 1JULA 4ICNA 1TV8A 2ZWYA 3W1AA 3W4RA 4JGDA 3KRUA 3OZOA 3UG5A 1A5BA 4YVVA 4P7LA 1JNEA 4IISA 2ZR5A 3GKAA 2B81A 1B3WA 4XAZA 3W7CA 2EPHA 1XPGA 4M1BA 2XH4A 3O6CA 3POCA 2OZ3A 1K03A 5DEZA 3DFQA 4AIBA 4PA8A 3ARSA 3EA2A 1V6WA 4DZIA 2V81A 5BCAA 3AICA 3KOZA 4MLJA 4E8GA 1RBOB 3PRDA 3GXIA 1YXDA 4CLMA 1EPVA 3K8LA 2VZTA 1QTWA 3KAFA 1ZB5A 4I5UA 4YVXA 4Q4OA 1EF2A 3RO8A 2R24A 5HJLA 4PTDA 1HJSA 2WWCA 1I9CB 4H1ZA 2PAJA 3WJSA 1HFBA 1PVNA 3QLLA 3P6LA 4PUNA 3PFRA 5GPGA 4AU0A 4RR4A 3S6DA 3VD4A 6REQA 4HOZA 4DAIA 2HE8A 4MG4A 4JFLA 4LUTB 3RMJA 2X16A 4F8XA 2MNRA 4S3CA 1NMVA 4KRUA 3WIJA 3MKCA 4ZPVR 4MADA 5HNTA 1TVNA 4CCCA 3QOMA 2HJPA 3ZWTA 1FWTA 1UKPA 3NVDA 4C7GA 1WYIA 1XGEA 2OSYA 3M5YA 4L9XA 3VGDA 1FKHA 3CTLA 1KKOA 3T8LA 2Z26A 4W7WA 1EDGA 1XSJA 1Q2SA 4L65A 2V82A 3GR8A 1SSGA 2X41A 4CCDA 5AYZA 2XJ7A 1Z69A 1OT2A 3SW6A 3WLLA 1J12A 4IMCA 3B9DA 2RAGA 3TFXA 1GJWA 5HQMA 2WMFA 3O5LA 1QFEA 3G1DA 3UZZA 4QDWA 2QUTA 3H2FA 3NO1A 2IS7A 2H8XA 3UEQA 4PMQA 4C6IA 4TR9A 2I57A 1XLHA 2PPNA 3VIFA 4J2MA 3R94A 4HHMA 4O15A 2PGFA 5I5RA 2ZQVA 1W1YA 4XBJA 2OJPA 5LNSA 2HSAA 2ZOXA 3WLIA 2FVKA 2HDJA 5HJXA 6XIMA 1G5AA 4FF5A 3PPFA 4A22A 3TEVA 4TVCA 4ZMGA 1OCBA 3RDKA 5HMSA 5AHNA 4L6DA 3CNYA 2DG3A 4AYSA 4B9ZA 5JU6A 3ME3A 2E5CA 3VGFA 2BASA 1Y8BA 2F4EA 2YXOA 1D7HA 1YNPA 2CLEA 4M56A 5CSRA 2C8NA 1BHGA 1TPC1 4QLJA 1GQJA 4UC5A 1E44A 1RA5A 3W02A 5I3DA 2IKGA 1TB3A 4PTVA 1F6PA 1PKYA 2QCCA 2FMOA 2YL8A 1PO9A 5LA2A 3ARYA 4C6NA 3Q2DA 1HJWA 3BSHA 3OHMB 4K68A 3WLNA 3N34A 1IEQA 1GGOA 4E3TA 3CB3A 3IVSA 4NX0A 1B31A 5G2IA 4ZE4A 4PBEA 2WMGA 3BDKA 4HB7A 2H3BA 4XZBA 1Z41A 1NWTA 5KSWA 1CCWB 4PR4A 3T40A 4GPNA 1FWHC 4S3JA 1PV8A 2PDHA 1KCZA 2QCLA 4CD5A 3JVAA 4UTLA 3GO2A 4D6EA 4LGXA 2FZNA 3RN6A 2P0IA 4J28A 1UR0A 2BXVA 3BLPX 3WMLA 2J9ZA 2VP8A 4D6DA 1EOMA 4EXQA 3DYMA 3RLGA 4L4LA 4ZGYA 4O4VA 1JNDA 2ZICA 2TYSA 3SGZA 2X0YA 3TCEA 4AY8A 1CECA 2BOFX 3VE7A 3CHEA 3I65A 3VIIA 3ARQA 1KM3A 4C6DA 3GHTA 3MSGA 1I1WA 3S3GA 2V2HA 1A3XA 4MJ2A 5BOFA 1V4YA 2RFGA 1CGYA 1Q8JA 4PB3A 4TX6A 4W9TA 2W63A 2O4QA 1J0HA 2YYUA 1G4SA 3APYA 5BYWA 4WOQA 2VCCA 1GVFA 4OUEA 4B5NA 3CV1A 4M51A 2QCEA 3H12A 3GQYA 1HVXA 1SO5A 3NQBA 4B91A 3GWQA 4FLRA 2ICSA 2UBPC 1Z89A 3PZUA 1YMYA 3CQKA 1FP8A 1IT7A 1E0TA 1E56A 3D6NA 3PANA 2PEVA 1ZENA 3R8HA 3MQTA 5FF0A 5CZKA 2YXXA 2X1TA 3CLMA 1JDEA 3ZVHA 5A6TC 2AMXA 3MDUA 2OODA 3KDNA 1HVQA 4ZODA 2OEJA 3LPOA 5AB3A 1A5NC 1C8XA 3VIJA 4U5KA 4O4WA 4R53A 2NV1A 3BK0A 1FY6A 4JCLA 4B92A 4C6LA 2OT0A 1IIGA 1LORA 4S3GA 3BOLA 4NZ5A 4A8RA 3G5EA 4P8VA 2VEKA 9XIMA 1RCOB 1WUFA 4UNIA 1DQWA 1MWOA 3SUVA 1V6XA 3CWHA 4AIUA 2H8ZA 4LAYA 1EPXA 1QI3A 1UOZA 3CPRA 5EY5A 2VT0A 4RXGA 3MCNA 3ZOAA 4HSOA 2ZRXA 1YYAA 4MSPA 3S1VA 2QR6A 3QMTA 1I0BA 1ROUA 2PC4A 4TUFA 3I3EA 4M1RA 4ICMA 3C61A 3K1DA 4F0KA 3AIBA 3GIQA 1V8EA 1VPQA 3QQ0A 4KCVA 3LXCA 3PA7A 2BVDA 3IJDA 5E0CA 3GUWA 4QSHA 4GY0A 1RZMA 3TQPA 1GKPA 1W91A 1T6MA 1XYMA 1JXKA 4IPNB 1UQYA 4YCPA 5HW6A 2OG9A 3VNMA 1MDLA 2Z25A 2WZHA 4A3QA 4XUGA 4GVFA 4UDMA 2IUZA 4JFIA 3CLWA 1SMAA 3TA9A 4FNRA 3VGBA 2W92A 4HPHA 4JIPA 2QF7A 4KEZA 3FYOA 3T0AA 1MQQA 1EA0A 1K9TA 3K4DA 2HV5A 1E9LA 3DOPA 1UR8A 3P8IA 1MVYA 4H83A 4NNRA 1JDFA 2GJXA 3N2BA 2E6YA 1GOIA 3UJSA 1MNSA 2JQXA 3STPA 4K7YA 3QLDA 3RG6A 3WK3A 1ZTVA 2DUAA 4OQVA 1AZ2A 4B3ZA 1KBBA 1VQTA 3DHDA 4U2ZA 3TVAA 3TFCA 4JTDA 2VGGA 4HK5A 1XYBA 1QW8A 3KOWA 4QEHA 1GQKA 3WLSA 3WUEA 4DJDD 3BCDA 4HIBA 3MANA 4IXXA 1G4EA 3Q4DA 4UFKA 3M6DA 3R0KA 3L66A 5CGMA 1XKJA 4A3RA 4CQBA 3ORWA 4JFTA 3UQBA 2D69A 3VOHA 2R82A 3S9ZA 1I60A 1OF8A 2PRLA 3HPSA 3TV8A 3WF1A 4ADTA 1NAL1 1M7PA 1Z8AA 1WDSA 4DWSB 3W27A 2UY3A 2PTXA 3AFBA 4KW2A 4F9JA 5CG0A 5DMLA 5GQBA 1WZMA 2A6LA 1G1YA 3P61A 2Y88A 1OJXA 3SGUA 2VFFA 4EP8C 5FIPA 5IRPA 3LI0A 1JZ3A 5HNNA 2UZ5A 1A3WA 2XSBA 3ZLFA 2PWHA 1B6CA 1K4HA 6TAAA 1P6BA 1W56A 3P84A 2WZIA 3TTSA 3HO8A 1XI3A 4AHQA 2C79A 3NIYA 4WIWA 2XP9A 3FNDA 2GK1B 5HULA 3PR2A 3BJSA 5C8BB 3LBCA 2YSWA 3M0ZA 3CL7A 3PZOA 3NZQA 5K7JA 1TIWA 2Q8LA 1W1PA 1LTDA 3ZSTA 1V08A 4WY0A 3GTIA 4LV4A 4UR8A 4MIMA 4Q7BA 2PDLA 1B54A 3TQ0A 1BTMA 4N9BA 3S5NA 3NYDA 1L6FA 3VOCA 3A4XA 1QRQA 4U5IA 1IZJA 3GRIA 3OU8A 1UZDA 4ODRA 1F3TA 4ERAA 4LBUA 4DM2A 4CD7A 4A2RA 3SURA 1J0JA 1Q6LA 4B3LA 2XN2A 3O15A 3W70A 3TTOA 3S8HA 4MB4A 3V0TA 2P5NA 2GJLA 3OIHA 4DI9A 2E77A 2EQDA 1EA9C 1DIKA 1JFHA 3WLTA 1D6OA 3W7HA 1FKBA 1PEZA 2X1IA 3FLUA 3A22A 4AC1X 2NVDA 4B90A 4BK9A 1F2JA 5CSSA 1E6ZA 2EO7A 4AX7A 3GH4A 4H00A 2DW7A 1FHDA 5MKGA 1R47A 1SFJA 4RW5A 4H2CA 2CZVA 2QVNA 3HPXA 3BC9A 1VC4A 4I7VA 1XG4A 3W72A 4RNHA 2J7CA 1RUSA 3KZ7A 3BV7A 3ZFHA 3VZYA 4MM1A 3BLOA 4HJWA 3SQLA 3WDJA 2P4VA 2WCGA 1IWPA 2W27A 5HNRA 5DELA 4NU7A 4ZBCA 2ACUA 1OFBA 4AZCB 2PSNA 2VZOA 1LRQA 3RX3A 4TMCA 3NO5A 2VDIA 1ZAIA 4GYPC 2ISDA 1PDYA 4W86A 4RL3A 2HS8A 4I9AA 4KIEA 4O8RA 3HJEA 1X7IA 4O16A 2HRWA 5U7SA 4DZHA 2GUYA 5DRCA 5A6BD 1L6WA 4GYKA 3SIMA 3S1GA 1QI2A 2A79A 4DBDA 3N15A 2R8WA 2ZTJA 3UJFA 4AZ5A 1V3MA 1U5JA 4JPGA 1AW5A 1AA1B 1DWIM 2Q5AA 5CPOA 4HTBA 3PJUA 1N2VA 4JYDA 4IQ2A 3O05A 1CLXA 2WANA 3VCNA 4UTHA 1C8QA 1PX4A 4W5ZA 3C0JA 1ISZA 4DJFC 3NJ3A 4PMDA 1ECEA 1FWDC 3AXMA 1ZLPA 4K8GA 3RJYA 4B2DA 3G6MA 1XSIA 4J35A 3L4XA 1CGWA 4HMDA 3W2LA 1Y5XA 5C9RA 1DTUA 2DT1A 1BYAA 1JCHB 5KITA 2A3EA 2FTYA 3EBVA 1WDRA 3QC3A 4AW7A 3I6RA 3K4AA 1I8JA 3V7PA 4XKYA 1GOQA 3ZR6A 1TUFA 4ZENA 3QM3A 2OX4A 1P0NA 6ALDA 1YXYA 4Q22A 1FWWA 1PSCA 3AYVA 4UQBA 1R38A 1TTIA 1V77A 3OGVA 4FIQA 3A13A 3NSNA 3GDRA 3CHVA 1WAWA 2PA6A 1N8FA 4MJ4A 5D4YA 3W6MA 3CQ0A 4MUZA 1J0KA 4AEFA 1XCFA 4IIHA 4PTWA 1E0UA 5D37A 1G4TA 5EMLA 1X1ZA 3G1YA 1JZ7A 4IF2A 1DHKA 3DG6A 3C0SA 3T55A 2OMAA 1EWEA 4GXWA 3LUTA 5AKQA 4YLWA 3ARXA 3VNIA 2LPVA 3MHFA 4LBRA 1UUOA 1B4KA 3U4AA 2OB3A 1IV8A 1V93A 3GNOA 4KRTA 2P50A 1L0PA 2HVMA 3I3BA 4QEEA 3SUSA 3G8EA 4PMRA 4RUBA 5CJ5A 2FZDA 4ERGA 2GDQA 3IUDA 7CGTA 2HBXA 2DIJA 3F2DA 1WP6A 4BHYA 3QZ6A 4I5RA 2VEMA 2QDGA 1Q6DA 4EPBC 3CU2A 1H41A 4ERIA 1E43A 4GYFA 4WXYA 2G3MA 4V1XA 2J7EA 1R3TA 4BWLA 1OF6A 2WC4A 1B3YA 4H9UA 3SSJA 3O6YX 3BSMA 3I6TA 4OBTA 1E51A 2GLKA 1AD4A 4O19A 4EF9A 4UMAA 3WLHA 4XAKA 1GONA 3T07A 1OX6A 2VTFA 2Y7DA 4NUWA 5FAJA 4UR9A 4AWSA 2WVVB 2NZLA 2DUXA 1M5YA 3WBEA 4KESA 3LCFA 1JVNA 2AQVA 4X9YA 2XISA 2YW3A 5CPTA 1MRQA 5JVLA 1RQBA 1YHTA 2E8YA 1TA3B 4F3HA 3ITVA 3GNDA 5FF4A 5JH8A 3QV9A 4QJ4B 4NZ3A 1OGGA 1SFLA 1VCVA 3BZGA 4JTSA 4ZO7A 3EKLA 2QNEA 1QNQA 3KW3A 4URIA 1LUCA 1DV7A 3K13A 4DRSA 4A8IA 4QJ1A 4M3PA 4C5YA 3S0CA 2IPGA 3VM5A 4WD0A 4LB4A 1KW1A 2WNQA 4D71A 3UXKA 2WO5A 3LHYA 1YTEA 6XIAA 1Q2RA 5FKYA 3EOLA 1PZ3A 4Y9PA 3ANUA 1D3CA 3R12A 5LIXX 5I3KA 3B3DA 3NEVA 1LP6A 1EQPA 4IG2B 4UZUA 2FB3A 4JFMA 2J9XA 2RUQA 1IWAA 3IARA 5CQ1A 3WH7A 5FJOA 5DN1A 1JZ6A 4DPQA 1VBGA 3AROA 3ARZA 3URQA 2XVPA 4JQ3A 4UFJA 4NNCA 4WX2A 3W1PA 2J27A 4ODPA 1GKQA 1NP2A 4CQCA 2XVLA 2HROA 3BQ6A 3E38A 5D9OA 1NF0A 3ZVIA 1FCBA 3MU7A 4UCGA 3T4WA 3EX3A 3E0WA 4BFAA 3MO4A 2REQA 2HPIA 3HOJA 1LYXA 3W01A 5BRBA 3SY8A 1OFDA 2QV5A 4HZ8A 4W9OA 2D3LA 2J4GA 1RJQA 1S2VA 2PI6A 2GGHA 4QDMA 4Y9NA 3G0UA 4I9JA 4HP5A 2CKRA 5CZ0A 2I14A 1TWWA 2XVNA 1GHRA 4XBKA 5I3HA 4UQ9A 3MT1A 2PDXA 2L2SA 1E0XA 4DF1A 1KV5A 4EK7A 2DORA 4F0RA 4YVPA 1TTPA 1OC5A 5HINA 1W8GA 4GXMA 2QUUA 2J62A 1FH7A 2F9RA 1WNOA 2WC7A 5CLWA 4MDPA 3SBFA 3TC3A 1XYCA 3S2MA 5IFPA 4LC6A 4P8WA 4YYFA 4FNPA 3DERA 4TVUA 4DWDA 4KWOA 4XD5A 4OFCA 4KF1A 1Y0OA 3L2LA 1LRNA 3QHOA 3S1WA 4ATLA 3UERA 3STCA 2VCBA 3DI1A 3PZVA 1C91A 1C93A 2IXUA 2J47A 1QHPA 2JEQA 1YADA 4JFJA 3V5FA 4RLIA 1J5TA 2X7VA 1PKNA 4JIRA 5EA9A 1T99A 3C0LA 1EJRC 4JL2A 1F8AB 1V0MA 3JU2A 2DQWA 3NXFA 4WDXA 3ALFA 1F07A 4NI8A 4Q32A 3WY1A 2JKAA 1VIWA 2PGWA 2YCLB 1KB3A 4CNSA 3FKKA 4LJ3A 3GNXA 2NUYA 4U85A 1LOSA 3UA3A 2O55A 3K46A 1EP3A 4JTLA 1LJYA 1XSKA 2X2GA 1TWZA 4GZ7A 4ORMA 4Z08A 3MW7A 3QR0A 2FHBA 1XGZA 4QM1A 4J4KA 1FWNA 2VEIA 3WQOA 1EX5A 2P88A 4FOJA 5EYWA 3Q67A 3VK5A 1OFQA 4LAOA 4NF7A 1EHNA 2OGJA 3HMJG 3GY1A 1KO0A 3NQ7A 1UWTA 1HO4A 1A5SA 1S2TA 2DV0A 4LYKA 4RZ5A 3V5CA 3UY8A 3MZNA 3EEGA 1IGWA 1E6NA 1M41A 1SW3A 2VCAA 1EWDA 4WKAA 2IPFA 2VOTA 4IQJA 3F5LA 3VO0A 2P1FA 2GSEA 2B7OA 3L5MA 1GVEA 3NPWA 2Y7EA 3U0HA 2GGIA 2VZSA 1H7PA 2EKCA 3TMQA 5JBFA 4GY1A 1SPQA 4IP7A 3PB0A 1OC7A 2BY1A 1HL8A 4FNQA 5AVHA 2YW4A 2ISFA 2WBKA 5G2HA 1TRDA 3LLFA 1H7WA 1XL9A 1PJ9A 3M7SA 4NI3A 5CGQA 3RIKA 1SJBA 1O12A 5CPNA 4C6OA 1AUSL 5LIWX 3THUA 2WPBA 3G1SA 2Z1BA 1SW0A 3K1GA 4LS1A 3E2QA 5MHBA 1TV3A 3ANYA 4BI5A 5D2TA 2VD9A 3ABZA 1P0BA 3CZKA 1BYCA 3VNLA 4CU6A 1W3TA 1E0VA 2QZRA 3GVQA 4UXDA 1L2UA 1R7OA 3IIVA 1XM3A 2VC6A 2XVKA 3VCRA 2ZX8A 2OSXA 5KZEA 4S3BA 2ZX9A 3EMQA 4GVHA 4OJYA 5DRIA 1VP5A 4FF7A 4AIOA 1NFGA 4DO7A 4IZGA 2D3NA 4I3GA 4J1OA 1VCFA 1RP8A 3WQ8A 1PTGA 3MPGA 3OB8A 1J96A 5F2LA 5SWUA 2Y85A 5XINA 5F2MA 3M43A 1LROA 4HMEA 1UWUA 1YTKA 2WVTA 3WNNA 3MB9A 3NL6A 5CC5A 3EB4A 4A6GA 4UTWC 1XX1A 2X05A 5C9WA 1T5AA 4QP0A 2WHLA 3IK8A 3CL6A 1CNVA 3WLJA 3EWXA 3APTA 3GE7A 4QNEA 2HCVA 2ZRUA 1CT5A 4JKKA 3MJYA 3B0XA 4RE3A 3NQ2A 3W84A 3E0LA 4PBFA 1UG6A 1E9YB 4X2PA 4AF0B 5CC3A 2PDYA 3VD3A 3W23A 2CIPA 1SU5A 3PBYA 4Z2IA 4B3KA 3K8MA 2FDMA 2XP5A 1P1MA 1TRIA 5HKGA 5FF7A 3W3OA 1KXTA 3UCCA 4GINA 1CLKA 4X60A 3QTGA 2J78A 4H19A 5EMMA 5ABEA 2ZA2A 2Z29A 5DX7A 1UP0A 3OP2A 1PPIA 3WFLA 1DEDA 3Q94A 4QAWA 3AU6A 1EGMA 4MKNA 3UG4A 4C6CA 5KZMA 1SYTA 1ZPTA 5A6AA 4PSPA 2PGEA 1OSEA 2WJZA 3EX4A 4HBKA 4K6AA 4JNYA 2NXGA 3QTPA 1XLEA 4RPPA 3VXGA 4N9DA 5LA1A 1KBKA 1ODZA 3IANA 3H9RB 4XV0A 2E0PA 4I8DA 2DSZA 4Z1CA 3H55A 1I0DA 4L1XA 4MB1A 1V6VA 4HOWA 4HGXA 4WDWA 3EMCA 2ZA1A 2ZZ2A 1FWGC 2HZGA 1AH3A 4ZS6A 2CXEA 3WF2A 3HM7A 5EFFA 4UTTC 4O17A 4ORIA 5TF0A 4DN1A 3DZ1A 2Y8KA 3SCNA 3DXIA 4DJEA 2DT0A 2QVHA 1XLAA 3JUGA 4IIDA 2E68A 4IIFA 3TJIA 1U2YA 4DO6A 3O5OA 3PPCA 2N87A 3W29A 3PS7A 1JRCA 1BG9A 4ZPTR 3PZMA 4PMYA 1KBLA 1GOMA 1IEWA 1DPMA 4WR3A 2AL1A 1OC6A 1EH9A 4WGXA 2NSOA 3TSMA 2SFPA 4QG8A 4CD8A 4E2OA 3REQB 1LQ0A 2WHMA 4EAMA 1Z7AA 1NELA 1ZY9A 2BS9A 1EX1A 2VOMA 2X0SA 1W3NA 4AEOA 1XH1A 2VWSA 4GOAA 4ROPA 1YPXA 4JY9A 4UUIA 2INFA 3DHPA 1W26A 3C3UA 3DFHA 1S38A 3CMJA 1MEWA 2F21A 2OOFA 2CLHA 2GSHA 1TMLA 1BVZA 1GTHA 3VOGA 1H62A 1Y5VA 1OHLA 1K02A 4G2DA 3GXFA 1GT8A 2HNEA 2TRSA 1RA0A 1F7BA 3UG8A 5D05A 3H7VA 3I4EA 4DF0A 3RYSA 2DUZA 4NILA 4YL2A 1NM9A 4F2TA 1AZ1A 3VZXA 3MMDA 4X0VA 5HQEA 1VYSX 1QPOA 5FF3A 1F5ZA 2BGNE 1R2RA 1FKDA 2AWGA 3VNJA 1GYNA 2FPYA 4TO8A 3ODKA 2Y89A 1LBFA 2I9EA 2VKZG 4UOZA 2Z2UA 4IMAA 1ISVA 4NJGA 3RM9A 3JW7A 5A2AA 4LVAA 2XWEA 3PWAA 4MYXA 1UP2A 4JIEA 2PLKA 4MAVA 4A29A 1C90A 3RX2A 3H7UA 5LA0A 3ZLGA 4CKQA 1MXGA 1J6PA 4AEEA 2Y2WA 3KZSA 1PKLA 2INEA 4N2YA 3EWYA 4JBRA 3E6EA 1TTQA 3C5QA 4I9MA 5I3JA 3ENLA 4O2TA 1RK5A 3OYZA 3T81A 5DF0A 3N17A 3UQAA 3B04A 4OBRA 3DHUA 1AJ0A 4ILSA 3WJXA 3LRMA 1V6YA 4GA8A 1XDLA 1XFBA 1JF5A 4CQAA 2G97A 3IAPA 5DT5A 2X2YA 3E12A 2INZA 3B06A 3OOBA 4NT0A 3T8QA 2GJNA 1B3ZA 1QVBA 4WXZA 4Q8TA 4Q8WA 3A5VA 3GXNA 3R58A 5FOOA 4EPKA 1UR9A 2E6AA 3VOIA 4M6PA 2OFNA 3GG7A 2GVJA 2HISA 2PDBA 4OBSA 2ZX5A 2OCZA 1KA9F 4MWAA 3EGJA 3UR5A 4YNGA 2FGZA 4IUOA 1Z44A 5HWMA 3TYZA 4QCFA 3C2EA 4F2BA 1FKJA 3BV4A 1G94A 1YEYA 4CNPA 1RD5A 5GPRA 2E4TA 2PP3A 3VX1A 3ABSA 3W7OA 3PR9A 4FSAA 4Q8NA 1Y0EA 2XFFA 3ITYA 4F2UA 1HO1A 3WF4A 1PE1A 1J4EA 2WYSA 1REQB 4L80A 2FFIA 4I5XA 1F61A 3DAQA 1OK6A 7XIMA 1F6YA 3THDA 2E67A 3DX5A 3RXZA 3MWAA 1TPEA 5G4EA 5HA7A 3MSRA 1A47A 3VDHA 4YS1A 3H4WA 2W67A 4CQ9A 3M07A 1FH8A 4NRRA 3NQVA 4A3HA 1I1XA 3KHDA 1IXOA 3S2LA 3L0GA 5G1MA 3MYPA 4BF5A 4Y9AA 5PTDA 4BQ5A 1VBHA 2NLIA 2RJHA 5A6LA 2IQ0A 1KV8A 1Q4NX 4TW7A 4LAWA 1ADDA 3UR7A 1TE1A 2P3EA 3TKFA 4QCEA 4PEKA 4JHOA 4D6FA 3EX1A 3L23A 2DZBA 1QI5A 3WL0A 3GVRA 2AGKA 1GEQA 3ES8A 3VGHA 3CMGA 1BXCA 3TN3A 3UXIA 1M9HA 3E2VA 2D24A 4ZL1A 3RM4A 5BXRA 2V6AA 3QXBA 1FWEC 1BSIA 4LEFA 4YTQA 2DT2A 5CKSA 3WLQA 1SW7A 3GZ3A 7REQB 1HL9A 1XHGA 3QRHA 2DT3A 3PBUA 4XZ9A 3WFAA 2ZQSA 2PURA 3ZT5A 4BQ2A 3WDIA 1A4MA 1EO5A 3DECA 5G5IA 2CYGA 3M0VA 2WV8A 2XM1A 1WOAA 7ENLA 1Z32X 1KT0A 1CB2A 3OLDA 1CXHA 4TW8A 4KFPA 4CN1A 1ZJHA 5BXPA 4GUIA 3TYAA 1U22A 2V63A 1EKOA 2CERA 4H8NA 2X30A 2AQWA 2PBOA 3FYYA 5E5CA 4XVEA 5I7GA 4OU1A 4KETA 3E74A 1QHOA 5FEZA 1GZ1A 1HJQA 1P0DA 2DZUA 1V3JA 4DYKA 3N19B 3CHFA 4L6HA 3AUOA 3MUIA 1OX4A 1DJXA 1FKFA 3GTNA 2PDIA 3SGGA 5C70A 4RK8A 1XGDA 5F2IA 2O92A 2I5GA 1G69A 4XTIA 4IPPA 1J0ZA 1CXKA 2VD8A 3AMKA 4QBXA 3T9PA 2DIEA 1ICPA 4DRMA 3FYPA 2RUCA 4J3SA 3KFTA 3VINA 3WZ0E 4LAXA 5M17A 5CZTA 5HXMA