4WKHA

Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (1mm) at 1.05 a resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
369
structure length
368
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTENDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Chitotriosidase-1
total genus 133
structure length 368
sequence length 369
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wkhA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wkhA01
3AMKA 1W9XA 3PHAA 4H2CA 3U7BA 4U31A 1VFOA 3ZSTA 1NP0A 3PZUA 3ARYA 2WLZA 1TE1A 4LXFA 2W61A 4W87A 3VM7A 2XWEA 4D6GA 2DH2A 1E6ZA 4L4PA 3SCTA 1XCWA 1PX8A 2WWCA 5IXEA 1W9BM 4AIEA 4UZUA 4X0NA 5E0FA 4P7LA 4M1RA 2OLHA 2J7GA 1J0JA 1JZ6A 3ZJ6A 2UWFA 4P7OA 4N42A 4H8UA 1FP8A 3IAPA 4P8UA 4WSJA 2G3MA 3BAWA 4TVDA 3T08A 4F9DA 1B0IA 2OYMA 3VIPA 3B9DA 4MPKA 1GOKA 1W3HA 4JFWA 3AIUA 3WNKA 2BFGA 2WC4A 4E4PA 5DT5A 5KEZA 1UWRA 1W9UA 3CTTA 1LWHA 1VFUA 3FHQA 4A4AA 1GOWA 4KH2A 1UD6A 2XVLA 3AS3A 1E4MM 4PUEA 3CHEA 4BS0A 1GJUA 1NH6A 1EIBA 3CZ8A 5HNNA 3UR8A 1X6NA 1J0KA 5FCZA 2VX7A 3THCA 3WBEA 5JBEA 3OA5A 2C8NA 4QFUA 1GQLA 1TG7A 4UTFA 1BAGA 2YBUA 4AD4A 2WW5A 1WPCA 1GJWA 1BHGA 4QCFA 3AHTA 3WNPA 3RCNA 5HXMA 4OZOA 1HJSA 1VJZA 2YBTA 5I0DA 2VVNA 1E0XA 1W9DM 4AD0A 3OGRA 1YQ2A 3B9AA 1FH9A 3TTOA 1HVXA 2PWHA 4JCLA 1G94A 5EFFA 4QP0A 1A47A 1XHGA 3DHUA 1GW1A 1H09A 4BF7A 1TA3B 2WMGA 1ZB5A 1VAHA 2X0HA 1XSKA 1EOKA 3GNOA 1W32A 2CHNA 2QLYA 3OLGA 1UH3A 2BXYA 4JFVA 5D9PA 2V5CA 2Y4SA 6A3HA 1JZ4A 3WH7A 3L4YA 4Z2GA 4FLQA 1E43A 3AQUA 1MW0A 4BZYA 1W1YA 1VEOA 4MDOA 3W4RA 4W8AA 4GQRA 2WSKA 3T2OA 4UFJA 3EMQA 4A3HA 1AQ0A 3WD0A 2PF0A 3EDJA 3WL0A 1E3XA 4J27A 3O9NA 2WVSA 1I75A 3VD9A 3WH8A 3RM4A 2DIEA 2AOSA 1EGZA 2ZXBA 3N11A 1NWTA 2BY1A 2QPUA 5LA0A 2D0FA 3SURA 3FHAA 1JYXA 1DP0A 3ZSSA 2HISA 4CD6A 1BFNA 1MQPA 4UCFA 3W0KA 1MQRA 4GKLA 2PI6A 1WZMA 1UR8A 4P7NA 2IXUA 1VEPA 4EANA 4JIEA 1H11A 3DYMA 4OOZA 4HA1A 2J77A 1NWSA 1ZS2A 3VILA 1LQ0A 2DT1A 1UKTA 1GQJA 5BXRA 2XVNA 2WMIB 2VL4A 4URIA 2G3JA 3SCVA 4GQQA 4YHEA 4GI6A 4K68A 4HMDA 1GQIA 4OBRA 5CPQA 3RIKA 4EAMA 1W91A 2VCBA 2E3ZA 3N15A 4UOJA 3WUBA 2D2OA 1CGWA 2DIJA 2BXZA 3D5HA 1DWFM 2GDVA 1Q6CA 1WZAA 3DECA 4JFSA 5GNZA 1MXGA 5D9OA 4JZ5A 5CPTA 1SR0A 1GHRA 1WAWA 2A3EA 1UZ1A 1JZ2A 3VMNA 3AIVA 3IAQA 2XWDA 4FF5A 3VTRA 1JNDA 3PZTA 2E8ZA 2CCRA 1QHOA 1ZJAA 5A94A 1GPFA 1OGSA 1SMAA 3F4VA 2YL9A 3W37A 5CG0A 2BVYA 4C7DA 5A6SA 3WDPP 1V3LA 3M46A 4P8XA 2V38A 2ZX7A 1WDPA 1HN1A 3MUIA 3MUAA 4M82A 4HOXA 1K9FA 1V6UA 2WAGA 2BY3A 3IK2A 3O2LA 3QOMA 4GZIA 3RO8A 3AOFA 1BVZA 4PMUA 4LYPA 3SUSA 1PIFA 2Y8KA 4ZFMA 4OUEA 3SUVA 1J10A 2JIWA 1U33A 5A8NA 2DH3A 2GJXB 2WKLA 1NP2A 5AC5A 2XG9A 2FH8A 3A4XA 4B3KA 4MJ2A 3VPLA 3L4XA 4KRTA 7A3HA 1EDGA 3GNRA 4AW7A 4AC1X 4C7FA 1UA7A 4UFMA 1XD0A 2FHBA 4MJ4A 2VZTA 2XFRA 5M3WA 5CXPA 3N1AA 3W53A 2GSJA 2YKKA 1B2YA 2CBIA 5BXTA 4J3XA 3NSMA 3W26A 3BSHA 1BVNP 2XTKA 3VD7A 1LL7A 1AQHA 3IJ9A 1BGAA 2D23A 5IDIA 1E0WA 1QNQA 3AMDA 3HJEA 2W4XA 5A6JA 2J8FA 3ZT5A 2WMIA 3WD2A 4Z2HA 1HP5A 3AIRA 2XM1A 2J25A 1CECA 2CYGA 3VGFA 1E4IA 1DHKA 2C7FA 5HPOA 1BG9A 1E6XM 1MW1A 3VO0A 1NQ6A 2BHYA 2XGIA 4UFKA 2E8YA 1H49A 2A3AA 3PZMA 2O9OA 3PZNA 3ARWA 1E1EA 3W29A 2Z1SA 1VB9A 1GZJA 3LPGA 4ZENA 4QLJA 2ESCA 1JZ3A 2OWWA 6TAAA 4M81A 2W66A 1E6RA 2WHKA 1JYVA 3PTQA 3WDHA 3IJ7A 2D3NA 4P7RA 1E6PA 3PZIA 5I6SA 5CGTA 2XSAA 1V0KA 3AXIA 1CXKA 4B16A 4JL2A 2OYLA 3WMSA 2BY2A 4GIAA 1EO5A 3GNPA 5IHSA 4GZEA 4U2ZA 1VIWA 2ZXAA 2W91A 5CPSA 3ZT6A 1ISYA 1VBRA 2XIIA 3CUFA 3AS1A 4AIOA 1W3LA 2VZUA 4BQ3A 2D0GA 3SUTA 1EDQA 4MNLA 3OGSA 3ZOAA 3BCFA 3ZIZA 1KGWA 3VIIA 1KXVA 4RE4A 2G8ZA 2Y24A 1HJVA 2FGZA 2CBJA 2WMKA 3SUUA 1SYTA 2WXDM 3VVGA 1OGBA 3MMWA 4HOZA 2DPEA 2E40A 2VI0A 5A2BA 1H2JA 1UR9A 3K8KA 3M6DA 3DC0A 5E6YA 1H0GA 3UCQA 1H3GA 2W5FA 2FDMA 1GORA 1BYDA 3AI0A 2X09A 1PX4A 3LPOA 3SEPA 3CUHA 3FNDA 2PC8A 9CGTA 2EJ1A 1ITXA 1JDAA 2VQUA 3WD1A 4OIFA 2DSZA 1D3CA 3PZVA 2VX5A 2WMHA 3VMOA 3CBWA 3OLDA 2YL8A 5A3HA 1ODUA 1UOKA 4UNIA 1VJSA 1V02A 3VNYA 2YA0A 1KQZA 2D3LA 1OM0A 5E9AA 1BGGA 2DDXA 4N0RA 3CZEA 4WSKA 1BF2A 3WUGA 4MB4A 4CU7A 2OSYA 2VCCA 1W2VA 8CGTA 3BAXA 1UUQA 4D1IA 4D6HA 4NZCA 3I3DA 4KGJA 3NSNA 3WSUA 4JKLA 1GNXA 5A69A 4HZ6A 2J79A 2WBGA 1LL4A 1GUVA 1UQYA 4PSRA 2NT0A 1MQQA 1NOUA 2WVVB 1QHPA 2WMFA 2J7DA 4CVWA 2BVTA 4MAVA 4UFHA 3WY1A 1HJUA 4CCCA 3DYPA 5KZ6A 4XUYA 1JAKA 1H0IA 5C8BB 1GONA 2W63A 2PB1A 3VDBA 8A3HA 4ACZB 4CCDA 1GQKA 1C7SA 5BWFA 5M03A 1CLVA 4F66A 2CBVA 3BCDA 1MYRA 5GNYA 1UKQA 1WZKA 1E4NA 5JBFA 3PTMA 3WEZA 4AZGA 3S2CA 4YN5A 3UG5A 2V3EA 3RJYA 2WZEA 1TCMA 4H8VA 4TVUA 3AIBA 2CNCA 4GI9A 4PMRA 3UR7A 2VX6A 4J3UA 4CD7A 1V0MA 2J78A 2QF8A 4CD8A 3TA9A 1H41A 3PZOA 4QCEA 3UG4A 4PUDA 3WH5A 4H04A 1V6VA 2UY4A 3O6AA 4WK9A 1KR0A 1FP9A 2X0YA 5I2UA 1W9PA 4DWSD 2NT1A 3BC9A 4MDPA 1GOQA 3AHXA 4F79A 2VMFA 2CBUA 2J47A 2RGMA 3WH6A 3QGVA 3CZKA 4PMYA 5DMYA 1CLXA 1OD8A 1UWTA 1C8QA 2VZOA 4Q22A 2Y8VA 4CUCA 3GDBA 3A4WA 1JYNA 5D4YA 3CO4A 3BAKA 1CZ1A 5LYRA 5I24A 2GK1A 1CGYA 1UA3A 4J7RA 3MANA 4B9ZA 3WUEA 4B15A 1BYCA 1VENA 1C93A 5A8MA 2EO7A 2EBNA 4RE2A 1RP8A 1CGXA 2WANA 3AZSA 2IUZA 4KRUA 3W6MA 3WFLA 3WMBA 5BCAA 3WD4A 3IANA 4EK7A 1J0IA 2V3FA 3I3EA 1HF6A 3WNLA 4D71A 3TONA 3T09A 1VBUA 4DM1A 5JIWA 3WQVA 3GXDA 1MWOA 4XZBA 1XH0A 1JG9A 2E9MA 2HVMA 2XFYA 1C3FA 1KCLA 4AZ5A 3BAYA 3F5KA 3WQ8A 3OZOA 1XD1A 1M7XA 1A3HA 1DWAM 1QBAA 4D6EA 1V3HA 3ARPA 3WELA 3CMGA 3KE0A 2B31A 1V6XA 4DUWA 3ARQA 2VRKA 3TP4A 3AHVA 1EQCA 2E0PA 2J62A 4D1JA 2WKGA 3VGEA 4W7UA 1E72M 3WNNA 1CWYA 4F9JA 3NSXA 4W86A 1K9TA 4Q7NA 5D9MA 1PAMA 5ABEA 4U5IA 3KL0A 1UD8A 3GH7A 3I3BA 5EMYA 2A3CA 1R7AA 3AHZA 1ZBKA 1G5AA 2CIPA 3SCQA 5BROA 1LF1A 4S3JA 4PTWA 3RILA 5BRQA 1J0YA 3WDJA 4TUFA 1RD6A 1KGUA 4XV0A 3OLEA 4LX4A 1V3KA 3VDHA 1UZ4A 1LLOA 1QHZA 3AICA 1C91A 3VDAA 1CPUA 2EEXA 3CLWA 2VO5A 2GJPA 4YHGA 1PZ2A 1CTNA 4E8CA 3CGTA 1W9VA 4JCMA 1KWKA 5AYIA 1KR1A 2WK2A 4MNMA 2XVGA 1E15A 2Y2WA 4P8VA 3WKZA 4FLRA 4CD5A 4FK9A 4JKKA 1R87A 4PEEA 2EPNA 3SCNA 2WM0A 3AIEA 5LA2A 1JF6A 2G3NA 4TVCA 4WKFA 1KBKA 2O9RA 3N18A 2JF6A 1VEMA 3L4TA 2VOTA 5CQ1A 4AZHA 5A6AA 5I23A 1TVNA 2VCAA 1E9LA 2BHZA 1CGVA 1NM9A 2YOCA 4UOQA 1AQMA 1M04A 4UQCA 1JI2A 1PEZA 1XYZA 4HPHA 1UR4A 3BLPX 1LWJA 2VRQA 1WCGA 1QNOA 4BA0A 1OIFA 3WNOA 2CKRA 1Q6FA 1E55A 3M7SA 1JXKA 4PCTA 2OWCA 3ARTA 3RM9A 3VNZA 2YLLA 6CGTA 2QV4A 2O92A 1WDSA 1HKMA 3AMCA 4R27A 1OT2A 1JI1A 3AIQA 1GHSA 3L4UA 1Q4NX 3VIHA 2BY0A 1ECEA 3APGA 1E4LA 3HU7A 1UWSA 5DT7A 1VFMA 4UZSA 3RJXA 4AZ7A 4ZE4A 1SFSA 4J3VA 4UFIA 4MB3A 1X1NA 2CERA 5HBFA 1E6SM 1XH2A 1IV8A 1KXTA 1EH9A 1EHAA 1OWQA 3N9KA 3TOPA 2PBGA 2WZHA 2WSPA 3CUJA 2WBKA 3WL1A 3AISA 5FKYA 2UY2A 4AWEA 4J3SA 5I78A 1M53A 1BTCA 1W3KA 3MSGA 1UQZA 2FH6A 1KXQA 1EDTA 3WMCA 4XZWA 4PTXA 3ZJKA 2WCSA 4B9YA 3AS0A 1XCXA 5M17A 1OCQA 3QHMA 2D22A 1PBGA 2V5DA 5A2AA 3VD5A 4B3LA 1O6IA 4ACZA 3TTSA 5CGMA 4UQ9A 4GO8A 2C0HA 4TX6A 4W8BA 2EPOA 1QOXA 1QW8A 3MUY1 2J7BA 1OGGA 3OG2A 2W67A 2ZX6A 4D6DA 1UD4A 3QR3A 3GH5A 4U5KA 3ZJ7A 1CXHA 4X0VA 3K1DA 3NYDA 2XM2A 4RE3A 1HKIA 1ISZA 1QI4A 1FA2A 2QMKA 1UH2A 4ML4A 3L2MA 3EDKA 3SCRA 3VM5A 2VC9A 3AYRA 4AD2A 2WC7A 3HMCA 4IUGA 3VIKA 3CH9A 4UOZA 3ZO9A 1ZBWA 3PBGA 1FHLA 1BLIA 2YA2A 1KBBA 2CKSA 3MS8A 1HXJA 3AROA 3GXIA 1X6LA 4BCEA 3MMUA 4M56A 3W24A 1JD9A 3SCOA 1RP9A 1TMQA 3WEOA 5I77A 3N04A 3AIWA 2X8RA 2CPUA 2UY3A 1CGTA 2JF7A 3OGVA 4W7VA 1HIZA 4RL3A 4ZE5A 3THDA 2QHAA 5GPRA 1Z32X 5TD4A 4CU8A 3OBAA 5GNXA 1CBGA 3MO4A 3VGDA 3OB8A 4NRSA 4PBGA 1JYWA 1NWRA 2XYLA 4UR9A 4AXNA 4JHZA 3ALGA 1BYAA 1V6WA 3LMYA 1EHNA 3J7HA 4HA3A 2XPKA 1SMDA 3OIHA 2G41A 1UWQA 3FY1A 1E3ZA 3WENA 3W6LA 1ODZA 1BPLB 3L4WA 1GOIA 1HJXA 2PWEA 3VGGA 1CYGA 2WMJA 1WB0A 2XIBA 1V08A 1M01A 2WNWA 3N13A 1E73M 2YIHA 5HDRA 1J18A 3A47A 3ZT7A 4PMDA 1KFWA 1PX3A 3MV01 4BQ2A 1XH1A 1TVPA 2CITA 2YDSA 1GVYA 3GTNA 3FXYA 1GOOA 4XB3A 5ECUA 2DSUA 1B90A 4S3KA 1DWGM 2VQTA 4JAWA 4PYSA 4QLKA 5ABFB 1EQPA 2W62A 1OIMA 2FGLA 4DUXA 2ZWZA 4ATDA 3W25A 1CENA 4DUVA 2WHLA 3CZJA 1Q6GA 1FH8A 3K4DA 1TFVA 3W81A 1ZL1A 2WHJA 4LPCA 3RPMA 1Q6DA 3A3HA 1J0ZA 2J8GA 4BQ4A 3GYCA 1WO2A 4D6CA 1WKYA 3VDCA 3NDYA 1HL9A 3EDEA 1DWJM 4KMQA 1OT1A 2JE8A 1G01A 2PWDA 4X9YA 5ABHA 1PZ3A 2YLAA 4DWSC 1GCYA 4LGXA 1QNSA 2GJRA 3WQ6A 3NIYA 1CNVA 3WD3A 3WDQA 1KGXA 1XSJA 4LYRA 1R7OA 2O9TA 1R85A 1WDRA 1IT0A 3HN3A 5D9NA 1UHVA 4EKJA 2JALA 3ZR5A 1ZBVA 2A3BA 3AMGA 1MW3A 3VIFA 4WF7A 4CN1A 3EBVA 3FAXA 1KWGA 3ZM8A 4ACYA 2JEPA 3WFZA 1BSIA 3VUPA 1C90A 2J7HA 3VGHA 4E8DA 1E40A 3F5JA 4MB5A 2GUYA 3AXXA 3VIMA 2DEPA 5IFPA 4W85A 1HVQA 4FLSA 2ZXQA 4WJXA 4IPLA 4PCSA 1J01A 4MNKA 3II1A 4F8XA 3ARZA 1V0NA 4L4OA 1MFUA 1JF5A 4OJYA 5CLTA 2DQXA 5CSYA 3SCWA 3GXMA 3ARUA 2ZUMA 1HP4A 3U5YA 1EO7A 3VMPA 4CGTA 1D2KA 5LA1A 5FL0A 1TA3A 1H4PA 3MSDA 1CGUA 4JFTA 2DT2A 2XHYA 3WQ5A 4PMNA 5C70A 1U2YA 3N12A 4M80A 3ALFA 1M03A 1OSEA 1W3JA 1ISWA 1QW9A 3ECQA 1OINA 3CPUA 1CIUA 1G0CA 3G6LA 4HZ8A 1BQCA 4P7QA 3SCUA 2ZX5A 3WDIA 3MMDA 1J0HA 1CDGA 4U33A 5AYBA 4AD1A 5BRPA 3FW6A 4W93A 1V3MA 2DSKA 1B3VA 2WHMA 4PSPA 3QHNA 2JEQA 2ZUNA 3W82A 3UEQA 1QVBA 4J3TA 2G4FA 3VD3A 3ZJ8A 3WF0A 1E71M 1HJWA 2WC3A 2F61A 2D1ZA 4HZ7A 3OZPA 3VKKA 1E1FA 1BYBA 4TXEA 2PBOA 2VVSA 1UWUA 2J75A 3AHYA 4MAZA 3BAIA 3AYSA 1S46A 1JGIA 3NDZA 4V28A 1W1VA 1WE5A 2VZVA 5E6ZA 2UY5A 3S6TA 4EE9A 4IPNB 2Q8XA 3AMLA 3K46A 3SIMA 4W5UA 4W88A 2PWFA 3WF3A 3T0DA 4V2XA 3WBAA 3KL5A 4IM4A 4W5ZA 3NUKA 1PPIA 2CEQA 4CN6A 4XX6A 1JZ8A 3ZR6A 1US2A 3MKKA 3BSGA 2VRJA 2MANA 2VR5A 2YJQA 4UQEA 2BS9A 4AIUA 1LG2A 1ESWA 2BHUA 2WYSA 1UR0A 2E9BA 2YDRA 1DTUA 4GZJA 2WCAA 2XJ7A 1CXEA 4ZXLA 2WB5A 1L0PA 2EPMX 4D6JA 1FFRA 5D8WA 2J7CA 2WWDA 1F4AA 4PRWA 2E9LA 1BG4A 1KXHA 4WKHA 1ZJBA 1AMYA 2RGLA 4Y7EA 4PMOA 2V3GA 3L4ZA 4YPJA 1HT6A 1MFVA 1JNEA 2FHCA 3EDDA 3A4AA 1EA9C 1J9YA 1ISXA 4GXPA 1W1PA 4MNJA 3M07A 3EYPA 3SUWA 3CZLA 2XUCA 2VT0A 3MV11 4KWUA 1JZ7A 4OKDA 1WNOA 2IXVA 1F4HA 2NW0A 2D0HA 2GJXA 4LYQA 3U5UA 1U30A 5DFAA 3TTQA 4MADA 2A3HA 4AZBA 1E6QM 3B8SA 2ZE0A 3VINA 2VX4A 5A6MA 3CHCA 1JFHA 4Z2KA 2VTFA 3MU7A 1XRVA 5JUVA 3T0AA 2ZICA 2GDUA 2J7EA 2FHFA 3UERA 5FL1A 2YL6A 5E09A 2D20A 3VX0A 1QI2A 4OOUA 1IZKA 1UWIA 4PMZA 2WVVA 1V3JA 1E5JA 5CZKA 3PZGA 4WKAA 3FN9A 3RMEA 1WP6A 2J7FA 1JZ5A 2PWGA 5A6KA 3GH4A 1DEDA 2BNJA 2O9PA 2ZIDA 1V03A 4GI8A 4M8UA 1H1NA 3PZ9A 4UQBA 5DF0A 3EMCA 3WF1A 2EPLX 3TTYA 3CUGA 3D3AA 3QHOA 4HOWA 1HNYA 1ISVA 1P6WA 3VGBA 2Y5EA 3U57A 2WVUA 4WLCA 1VFFA 2EPKX 1OBAA 5A8OA 3NJ3A 1W1TA 4ZXOA 3CZGA 4DWSB 4QLLA 4HMEA 1TZ7A 3WN6A 1K9DA 4U2YA 4UQAA 5HOSA 3WNMA 1QI5A 4PTVA 1CXFA 5A95A 3WF4A 1QI3A 1ZBCA 3L2LA 3ZMRA 3LPPA 1B9ZA 1PIGA 4J28A 5GQBA 4JHOA 3NCOA 3WIJA 2YA1A 4NI3A 1Y7VA 1QNRA 1K6AA 1B30A 2DSWA 5I79A 1MW2A 3VD4A 3RDKA 1H5VA 4JKMA 1NOFA 2WVTA 2ZUTA 3DHPA 4PN2A 2G3IA 2CETA 1XYFA 4AMCA 4HU0A 4OBSA 3EMZA 1E6NA 4JFUA 4KGLA 2OSWA 3W27A 3KZSA 2ZUSA 4PTMA 2JIEA 1UH4A 1XGZA 4W89A 4U3CA 3CHFA 5I3DA 1RH9A 1CXLA 4CKQA 3UETA 2EXOA 3ZQ9A 2DT0A 5EB8A 2ZX9A 3PN8A 3BMWA 1V3IA 4D6IA 4QDMA 1E56A 2CHOA 1C8YA 1JIBA 3BMVA 2DSVA 1GOMA 1QI0A 3K8LA 4HMCA 4H8HA 2OWXA 3PZQA 4A3YA 2VZSA 3WEMA 5FD0A 3UG3A 1O7AA 1R86A 5IHRA 4V27A 1PJ9A 1RPKA 1WDQA 1V6YA 2VUYA 1JL8A 3VIGA 4AEFA 1I1XA 1JDDA 1EXPA 2BVDA 1UD2A 4AZ6A 3GXFA 3PTKA 5DEZA 2ZUWA 1CXIA 4CU6A 1VRXA 3BH4A 1HX0A 1LL6A 4PMQA 1LG1A 4H7VA 1DWIM 3BAJA 3KEHA 2X1IA 2E4TA 4NF7A 2XVKA 5ABFA 4P8WA 3GBDA 4WIWA 1N82A 2DGAA 2QMJA 4MTVA 3W28A 3QOKA 3AZRA 1E70M 1UG6A 3EDFA 3POCA 4AEEA 3L4VA 3AS2A 4NSBA 3KL3A 4DWSA 4U3AA 7TAAA 4FMVA 4CN4A 3VIOA 1C92A 3FAWA 2XGBA 1OB0A 1K9EA 1GVIA 4AZIA 1EOMA 1L8NA 4UFLA 7CGTA 1UD5A 1B3XA 1HKJA 5AC4A 3VIJA 1UR1A 1C8XA 5JH8A 1TR1A 1KCKA 2ZOXA 3CMJA 3AJ7A 5M5DA 1AVAA 3MUZ1 4J3WA 1J11A 5JIPA 2WPGA 4W84A 2ZUUA 1NOWA 2F2HA 3B9EA 4MB1A 1UKSA 5DO8A 3ARVA 3N17A 2WLYA 4AY1A 2YDQA 3K8MA 3IJ8A 5D8ZA 5A6BA 2JFEX 4W8LA 2WCGA 1FOBA 5E70A 4TX8A 1UKPA 1E5NA 3POHA 1QBBA 3ARXA 1LJYA 1US3A 3WF2A 4H41A 5CJ5A 1G9HA 3JUGA 3KWXA 3WDRA 3F5LA 4ATWA 4C7GA 4AD3A 1XSIA 1NARA 3VOCA 4BQ5A 2TAAA 2DT3A 1FH7A 2AAAA 4AYSA 2YL5A 1HJQA 4PMXA 4AISA 2CXGA 5EBAA 5EFDA 1YHTA 4AD5A 1WZLA 2X05A 1KQYA 1JXJA 4TOQA 3GM8A 5A6LA 3WQWA 1V0LA 2WZIA 1B1YA 2XVPA 3CHDA 1ZU8A 1I1WA 1XC6A 1B3ZA 3SCSA 1D7FA 1JD7A 3RM8A 1JFXA 2VNCA 2CESA 1HL8A 4JL1A 1G1YA 1HKKA 5FIPA 5F7UA 4CCEA 1B3YA 3AXHA 5E0CA 3WH9A 1W2PA 5A1AA 2ZWYA 5C71A 4E2OA 2VJXA 1TUXA 2XSBA 5IFTA 4Z2LA 1MVYA 5CLWA 5A6BD 4ATLA 3T0BA 5BYWA 2V3DA 2EQDA 1QNPA 4M24A 5ABGA 1V02E 2D24A 5CSUA 1UYQA 2GVYA 4GINA 5BXPA 5AY7A 1QPKA 3BGAA 5FOOA 2J4GA 1J12A 1UR2A 3T2PA 4AZCB 2ZX8A 5A8PA 3G6MA 4M29A 4D72A 4Z2JA 4DM2A 2VURA 3CUIA 3GBEA 1DWHM 3UESA 1UKOA 4ZEPA 4AZCA 4UQDA 1UD3A 5BXSA 3AFBA 4GO9A 2XFFA 4PMVA 3DYOA 2ZUVA 1R8LA 2Z1KA 5I5RA 1XV8A 1Q6EA 4HA4A 1MXDA 3A6OA 2GFTA 3SCPA 2GK1B 1B3WA 4HTYA 1JAEA 1FHDA 5JBDA 2F8QA 3AZTA 4D6FA 4CD4A 2X2YA 2QPSA 1FFQA 2J74A 2OSXA 2BV9A 3WQ4A 1NWUA 2W92A 3W38A 3ARSA 4W7WA 1OD0A 4TTGA 3VX1A 1CEOA 4QAWA 3U7VA 4GPNA 3T2QA 4HP5A 3ARRA 4Z2IA 3BXWA 3OLIA 4IISA 1KB3A 3K4AA 4LQ1A 5HPCA 3E1F1 3VU2A 3LPFA 2VR4A 4FLOA 4HPGA 1VF8A 3WUFA 2ZXDA 3BLKA 4NRRA 2OYKA 1B31A 1ITCA 4HU8A 1IZJA 5A2CA 5A8QA 3CIVA 4TTUA 1C7TA 4R5EA 4CVUA 1E0VA 3GZAA 2AMGA 2NSXA 1JDCA
chains in the Genus database with same CATH superfamily
1W9XA 5LIWX 2YFOA 4DF0A 3XIMA 1VFOA 3P74A 3EWDA 4IGSA 1ZHAA 2WLZA 2ZRUA 1TE1A 4DPPA 4LXFA 1YATA 4W87A 2XWEA 4DWDA 3URQA 4L4PA 3SCTA 1PX8A 3WQFA 4RKAA 4Q32A 5H2ZA 3C2FA 4DJED 4NNCA 4X0NA 3IJDA 3H2NA 2NXHA 1JZ6A 1FP8A 5D32A 4LUTA 2G3MA 1KCZA 3SR7A 3OZYA 4F9DA 1B0IA 3TMLA 1Q5MA 4RV8A 3G1XA 3WNKA 3HJZA 4E4PA 5KEZA 1IQ8A 3LSBA 5CC7A 1LWHA 4KH2A 2NX9A 1PWMA 4BS0A 2PMQA 1GJUA 3CZ8A 4M7TA 1J96A 7REQB 5FCZA 1IEIA 3KBNA 4N02A 1LTDA 4YVPA 1FWWA 3OA5A 3O5RA 3HPFA 4QFUA 4R9OA 3PWGA 4UTFA 4Q6JA 2OLSA 3NR0A 3ITCA 4AD4A 3NGJA 3NM1A 4EF9A 3GVGA 3GKFA 4QCFA 1OFRA 3AHTA 1F74A 3V16A 5HXMA 1OJXA 4OZOA 1HJSA 1VJZA 4JQ4A 3WJXA 1QO5A 2PWHA 2PD5A 3FXGA 3K5XA 2Z27A 3MHGA 1A47A 3MKVA 3G0SA 4C91A 2J6VA 1A5BA 3FJ6A 1AK5A 3UJ2A 2X0HA 3R4IA 1XSKA 4ZQMA 1Q8JA 4DBDA 3V18A 2OKOA 4H9UA 3GNOA 3QR0A 1W32A 4KRZA 2JBMA 3UXDA 1N8FA 2BXYA 1FCBA 1OX4B 4JFVA 3O5DA 6REQB 3TROA 5BU6A 4U10A 1RJPA 5KSWA 4IIBA 2DJLA 4UNKA 3L4YA 1ADSA 4FLQA 4AX7A 4O1BA 2P5NA 3UPBA 3AQUA 4HU4A 3GIPA 3M0VA 1VEOA 2CLFA 3BL3A 3PFRA 3SI9A 4ZS6A 4IFRA 4NJGA 2AQWA 1X96A 4HSOA 4A3HA 4TO8A 5CH9A 1AQ0A 2FQIA 4A05A 5LHFA 4YTQA 1ZLPA 3WH8A 4PA8A 3FHAA 4H9VA 3VDGA 1VD6A 1DL3A 1NSJA 1S3TC 5BWAA 1BFNA 4UCFA 3UZXA 2NV2A 1A5NC 1DJXA 1WZMA 3QY6A 1UR8A 1DIEA 1VEPA 3W1UA 4DUOA 4EANA 4C1LA 4LH8A 3H24A 3VAWA 4OOZA 4B5XA 4DBUA 5I06A 3OVRA 1NWSA 2ONEA 1GQJA 5XIMA 2WMIB 4HCDA 1OADA 3SCVA 1TMHA 4YHEA 3P81A 3UJSA 2Q01A 4H2HA 3RIKA 4EAMA 3EA2A 2GGIA 2VCBA 1PKLA 3BLIA 4UOJA 1EZWA 3DG6A 2PU0A 3VKAA 3D5HA 1QAPA 1WZAA 3DECA 4JFSA 2PP3A 3M5VA 5D9OA 4JZ5A 2C79A 5CPTA 1FWFC 8XIMA 3GU2A 3MYPA 1UZ1A 1JZ2A 1GG1A 3VMNA 3AIVA 4FF5A 2XWDA 3TJ4A 4ZSUA 1YRRA 4NVTA 1FKTA 3IRSA 1ZJAA 5A94A 3WLHA 2BBFA 4ZOEA 4DF2A 1FBAA 3R0KA 3M46A 2V38A 1KBJA 4ADTA 4IG2B 1TYGA 2PDGA 4PZVA 1V6UA 4GJJA 2BGQA 4DO5A 5C9ZA 1JQXA 3VXGA 3DBNA 1PHQA 5A6TC 3SUSA 2NQZA 2Y8KA 3NRKA 2ZRXA 4DI9A 4OUEA 1XWYA 3ZLFA 2HS6A 4YIWA 3FV9A 1U33A 5A8NA 3HG2A 5FF2A 1P1XA 4B3KA 3P3BA 3KHDA 1OC6A 2WZTA 4FNRA 4KRTA 3FYOA 4UR7A 2P0IA 3S2LA 4LUTB 2V69A 3UYIA 4WUIA 5LNRA 2FHBA 2XFRA 2V2DA 5M3WA 5CXPA 3N1AA 1TJ0A 1JEZA 1B2YA 2VOMA 1SJAA 5BXTA 3R1ZA 4J3XA 4XO7A 4QIBA 4DQWA 1EPVA 4XD5A 3VD7A 1LL7A 1NMVA 1PL9A 4MZ8A 1BGAA 4GGHA 1DQXA 1E0WA 3RO6A 5A6JA 2J8FA 1EXBA 4TW6A 1F40A 3UP8A 5KZMA 1HP5A 2MNRA 2XM1A 2PDFA 1CECA 5E0KA 4BEQA 3N9SA 2C7FA 4BY3A 2I5GA 3ATYA 2XGIA 3CL6A 2PPGA 4R7WA 3N6HA 3PZMA 3FKKA 3S46A 1ZCOA 2P10A 1FWSA 3WLQA 3NO3A 4QLJA 2ESCA 1YE6A 3I10A 1JZ3A 1L6WA 2QF7A 1Q6HA 3PTQA 1BKFA 3DFNA 2D3NA 1TJ1A 4BF9A 1E1CB 3HG4A 1FKXA 4LBRA 5I6SA 3LOTA 4JEJA 3AXIA 2OYLA 4GIAA 3UT0A 4A22A 4IF2A 1EO5A 3H2AA 3WLIA 4U2ZA 1VIWA 3QQ1A 2PGEA 4LCQA 2HXTA 2I9UA 2W91A 2BOGX 1ISYA 3AS1A 2AQOA 4GUHA 4CEXC 4BQ3A 1P0BA 4IFKA 5CG7A 3G5EA 2CLOA 1AFSA 2EG6A 2XIQA 3ZOAA 1XF0A 4FOJA 4J9JA 2PZNA 3VIIA 4TV6A 5CSSA 3KLKA 1DE5A 3TNOA 2CLIA 4KQZA 3W7EA 2G8ZA 4JIPA 2DG3A 4US5A 4Q8VA 1LCOA 1KO0A 3DUGA 4N4PA 4PBEA 4DX3A 4PUJA 2V0TA 2E40A 2BOEX 1H7OA 3V35A 3QV9A 3M6DA 3VZYA 3AWOA 1YXCA 1BYDA 4QHRA 5DITA 1SQ7A 3ELFA 2X09A 5G2IA 1PX4A 4QG8A 3LY0A 1UC4A 3P67A 2V9DA 1DJIA 3CUXA 4AVNA 1SU5A 2QZRA 4FP1A 2E5DA 3NL3A 3P2VA 2DSZA 2ZFAA 2YXGA 3R5EA 3LHTA 1OFOA 5I00A 1VJSA 4NX0A 4A35A 3VNYA 3NEHA 1SFTA 1KQZA 1OM0A 5E9AA 2DDXA 4C6OA 4DNMA 1J79A 4L61A 2ATSA 3WUGA 4MB4A 5F2IA 4UIOA 1Q7MA 1W2VA 1P7TA 1UUQA 5AHIA 3ITTA 4DRSA 3PF3A 3NVDA 2OZ8A 1D9EA 4RDVA 4TR9A 5A69A 4HZ6A 4LAKA 4AHQA 1MQQA 2PDJA 3PBVA 2ZR6A 2QCHA 1NOUA 5C9UA 2J7DA 3LS9A 3CHVA 2ACSA 4JBRA 4UFHA 1UOZA 1HJUA 2W63A 2G37A 2IQ0A 1XISA 3FCPA 1UPPA 4XBKA 2P8BA 4CCDA 2ZC8A 4UTLA 1XG4A 1XLMA 5HK4A 4IPXA 4F66A 2CBVA 4FALA 4U86A 4O0QA 1WZKA 2C19A 3E38A 5HWCA 3WJSA 2EJAA 3WEZA 3S2CA 4YN5A 3RJYA 3QMRA 3B06A 5REQA 4ZO7A 1WYIA 4MM1A 2OO6A 1FDYA 1POJA 4J3UA 1V0MA 4GQ0A 3JZEA 2J78A 2DU2A 3A13A 4HZMA 3UG4A 4IX0A 3WH5A 4REQA 1YPIA 2XDFA 1KR0A 2J24A 3S5ZA 4JY9A 3HG3A 1W9PA 4DWSD 3BC9A 2VMFA 3A9BA 2QYGA 4OGZA 3CZKA 3KX6A 1UWTA 4RZ6A 3CO8A 2VZOA 3LG3A 2WJFA 4C5ZA 2YCLB 2Q6ZA 3PC0A 3A4WA 4V1XA 1JYNA 3CO4A 3M0IA 2GL5A 2FGBA 5I24A 1UA3A 1D3HA 4IPIA 4B9ZA 4DF1A 2X1UA 1BYCA 3NQGA 1C93A 4GIEA 5A8MA 2EO7A 4G56A 3T81A 4NKCA 3TJXA 3IANA 5FEWA 1J0IA 3IGHX 4QM1A 3T09A 5JIWA 3WQVA 2QUMA 1B54A 1MWOA 4O18A 2HVMA 3LBOA 4LAVA 1C3FA 4AZ5A 3BAYA 3OZOA 1XD1A 3GNDA 4D6EA 3WELA 2B31A 3B05A 4DYJA 1VH7A 1LT8A 1OABA 3AHVA 1EQCA 3QH2A 2J62A 4IP4A 3VGEA 3V1HA 3WNNA 1UP3A 4JTTA 4B3ZA 1D7HA 2PD9A 2R94A 4G7FA 5B80A 4M6VA 5HR7A 3D47A 1UD8A 3PNZA 3QPEA 3WK3A 3TTEA 3W23A 1S2CA 3ITOA 3C86A 4POCA 2ZRVA 1ZBKA 4XD3A 4QTGA 5F2MA 4DRNA 1X97A 1HZYA 3KVKA 3G24A 1J0YA 1J4RA 3PJUA 4M51A 3RUBL 5CC6A 1KGUA 3OLEA 3S42A 3VC6A 4LX4A 1NQKA 3W1TA 1VBJA 1WDWA 1AW5A 1V3KA 3AICA 4CNOA 3KUMA 4YHGA 3CPGA 1ZCCA 3CGTA 2CXEA 1KWKA 1EEPA 4HCLA 5KITA 3LMZA 1KR1A 2WK2A 4L1WA 2TYSA 1E15A 2Y2WA 1XRTA 3DI0A 3WKZA 1SM9A 4FK9A 4JKKA 3QC0A 4ZPWR 4CNSA 1W17A 2WM0A 3AIEA 3SECA 3B0VC 4H19A 1IX5A 1JF6A 4W9OA 4WKFA 2CC0A 3E0LA 3N18A 1UUOA 2LGOA 1VEMA 3L4TA 2ACRA 3TDBA 5I23A 1BF6A 3I6CA 4Q8PA 1E9LA 2BHZA 3TV8A 1NM9A 1CGVA 3RLVA 4M3PA 2TODA 4ORIA 2FPYA 1X39A 1XYZA 5EA9A 3MSYA 4HPHA 1UR4A 3JR2A 2PF8A 1LWJA 1Z42A 2VRQA 4TU1A 3EEZA 3RCYA 2R1KA 4BA0A 3RR1A 3M7SA 1JXKA 1KM4A 3H7VA 3PAOA 3HA1A 2W9MA 3UY8A 3M5XA 3RK8A 1OT2A 4G6CA 3HO8A 4ZQNA 4DJEC 3O7UA 3KBSA 2PRLA 3LTYA 5DT7A 1VFMA 4UZSA 1N8WA 1TPDA 3E0WA 4KFOA 3N6QA 4ZE4A 1O1HA 3O05A 3T8QA 1O94A 2OZTA 2CERA 4NUWA 1LOSA 5HBFA 1GKQA 4JTGA 1FKGA 2AL2A 3LCIA 3EB3A 1KXTA 5M1TA 3LRMA 3DOPA 1IXQA 4EXAA 3HURA 1OWQA 3QW4B 5HWBA 5K9CA 4BI7A 4DRMA 3WL1A 1PKYA 3AISA 3DERA 2OEMA 5FKYA 6ALDA 5K9DA 4J3SA 5I78A 4LAXA 1TPC1 2CW6A 1M53A 2FVKA 3KVJA 2FH6A 3WMCA 4I9AA 1H7PA 5LIKX 4WR3A 2Z7KA 4EACA 1TV8A 4JR5A 3ZJKA 4MSSA 3CWNA 1RQHA 4MKNA 3UJRA 2D22A 1AG1O 1GEHA 2ANUA 3ITVA 4BF8A 1O6IA 1E0UA 4JGDA 1JPHA 3BLFA 4US6A 1TSIA 3KVLA 3IIXA 1JUKA 2SFPA 1HL2A 1QW8A 2J7BA 3OZMA 1OYAA 2PCEA 3PG8A 1FKBA 4KERA 3W2JA 2GVJA 4U5KA 1CXHA 4X0VA 3TQ0A 3Q94A 2XM2A 1TMLA 1HKIA 4NZJA 4LF1A 1FA2A 2YSWA 2QMKA 4ZO6A 2FB2A 1IXPA 3MPGA 3EDKA 2QR6A 3AYRA 2J88A 2WC7A 4X2RA 4NZ4A 4IUGA 2OODA 1ZFJA 4DVOA 1ZBWA 4AXKA 2Z6IA 3PBGA 4DAIA 1FHLA 2E6AA 1BLIA 2NX3A 4DZAA 3MS8A 3AROA 3O5KA 2NQ9A 3HQNA 1X6LA 4BCEA 2INEA 3MMUA 3TW9A 4MFEA 1JD9A 3SCOA 4RX0A 1RP9A 1HW6A 4CLMA 2PDCA 3QMTA 4JN8A 5FACA 2BX7A 2F2KA 2JF7A 2DZPA 3OGVA 4W7VA 1HIZA 4RL3A 4WEVX 1KBIA 3P5ZA 3W7HA 5B8IC 4YLWA 3VGDA 3PAJA 4PBGA 1NWRA 4JHZA 3IUIA 1EP3A 3SFKA 1EP2A 1AD1A 3DESA 2F21A 3ZLHA 4YTTA 5D09A 1EHNA 2V2HA 2DG4A 1SMDA 1JCXA 3OIHA 1PYFA 1UWQA 1K77A 3V5FA 3WENA 3NQCA 2A79A 2QCMA 1ODZA 1FVPA 1Q2RA 1ME9A 3E6EA 1LRQA 1GOIA 2PWUA 1JULA 1WA3A 2WNWA 3KLLA 2I1OA 3N13A 4IGHA 4L6HA 1PX3A 1OY0A 1XH1A 1LORA 2ISSA 3NQAA 2C16A 2CITA 3GTNA 4PUWA 1UMLA 5ECUA 1ZALA 2BZNA 4DRHA 5K2ZA 4AVFA 4M6UA 4QLKA 5AHNA 4JQ2A 2W62A 2FGLA 3RX4A 3I68A 4DUVA 3CZJA 5HULA 1R0MA 1O5KA 2FZBA 1FH8A 3K4DA 3A3WA 3WLPA 4HNCA 1ZL1A 1WAUA 1ZGDA 1LQAA 4BHYA 1RK5A 3RPMA 1Q6DA 3A3HA 4PRTA 5JH1A 3R13A 4D6CA 4N6EA 4Q4OA 1WKYA 3VDCA 2XIOA 1DWJM 1V7AA 1JJKA 4X9YA 1PZ3A 2YLAA 4DWSC 3VI2A 3BG3A 4LGXA 1PXGA 1CNVA 2Z0IA 3WD3A 4UTMA 4HBEA 4IPJA 1VCGA 1KGXA 1XSJA 4LYRA 3SO7A 3DG7A 1R7OA 2O9TA 1IT0A 2DUAA 4LAWA 4WHBA 1ZBVA 5F4SA 1B5TA 3W7RA 4WF7A 3LDVA 1KWGA 1QPQA 1C90A 3VIMA 2OFJA 1XIIA 3SRHA 2GGHA 3CXOA 3FAPA 6TIMA 1J01A 2WQDA 3W7NA 4R53A 3WCZA 2I9EA 2BGNE 3II1A 5EMKA 1FKRA 4IG2A 5CSYA 6XIAA 4RW5A 1M7PA 1HP4A 3PJTA 5C54A 4CQDA 1XI3A 5FL0A 4HYWA 1UUMA 1J5SA 2QULA 3MSDA 3R0DA 1POKA 3HTWA 2YCKX 2DT2A 2XHYA 3SY8A 2CU0A 3GRIA 3FA4A 3NQ7A 1K7XA 3OVPA 1M03A 1QW9A 5HR6A 4P7QA 1UASA 3WDIA 3MMDA 4KIRA 1D3GA 5HQEA 3Q65A 4J4OA 2DSKA 2VFDA 1M5WA 3VFCA 3QHNA 1REQB 2JEQA 2ZUNA 4UB9A 2TPSA 5G4EA 1MRAA 5HKGA 2G4FA 3VD3A 3H55A 4NAFB 2EGZA 1E71M 4O1DA 3KM8A 3C0SA 2VVSA 4NZ5A 8RUCA 1Q63A 4GFIA 3TSMA 1BRLB 4GBUA 1S46A 3NDZA 2VXNA 4RXFA 2PGRA 3S6TA 4EE9A 1TTQA 2Q8XA 3AMLA 3OOBA 1MSSA 3WZ0E 1QT1A 4ICMA 1LT7A 5CZ0A 2PWFA 2RKXA 1PPIA 3RGCA 1F3EA 4R88A 1XUZA 3ZR6A 3GO2A 2AGTA 4Q8UA 4MMWA 3PTDA 2VR5A 3KRSA 4ROQA 1FWNA 2BS9A 4C1NA 5F2LA 3ONBA 1UBSA 1R9HA 3MCOA 4O16A 2WYSA 1I2OA 4ODOA 4B91A 1YIXA 1I2NA 1CXEA 2WB5A 1Y65A 2R24A 3H2MA 1FFRA 5D8WA 2PTDA 3KACA 5K4ZA 2E9LA 3IIVA 3RFAA 5BZAA 3EX1A 4WKHA 1ZJBA 4HNNA 3H2CA 4PMOA 1MEHA 4ZODA 2QJMA 1KTCA 3PK7A 2YDAA 4Q8MA 4IOTA 2PV2A 4WXZA 2DZSA 3HV9A 1J9YA 3CQHA 4GXPA 1W1PA 3SUWA 3CZLA 2VT0A 3MV11 4INFA 3MHFA 1OYBA 1DHPA 4E6MA 1BKSA 4GUIA 1I2RA 4LYQA 3CAWA 1OF6A 4KEVA 3WK2A 3U5UA 4MADA 4LVBA 4JS3A 3VINA 1FDJA 4Y2WA 4JFJA 4LUJA 1SFJA 4PFMA 3P0XA 2J7EA 3UERA 3ABRA 3O6YX 4DXKA 5FL1A 4LSBA 2VEPA 1FCVA 1ZAJA 3VX0A 5HATA 1QI2A 6REQA 1IZKA 1UWIA 2OU4A 4PMZA 3S5YA 2A85A 4C6IA 3JS3A 1E5JA 3WLLA 4ZQPA 2GGGA 1ELSA 1OK4A 3RMEA 3W1LA 1JZ5A 2PWGA 3MUCA 4BR1A 1LUCA 2BNJA 2O9PA 1RBOB 2ZIDA 3AU2A 1G7UA 5HUPA 4AFYA 1H1NA 4DRKA 1VCVA 4HN8A 3WF1A 3D3AA 3QHOA 3SN1A 2O56A 3H9RB 1PBKA 1EUNA 4MWAA 3CWOX 3U57A 1VGAA 2WNNA 1VFFA 1A80A 4O52A 4FSAA 4OUIA 3ME3A 3S5OA 3W1XA 1VKFA 4MSPA 1IT7A 1FD9A 3KRUA 1QI5A 4OECA 4RCXA 1QPNA 5LZLA 1KFKA 3TEVA 1QI3A 1M41A 3DU0A 5KINA 3ZMRA 1FKIA 2C71A 3QZAA 4U4MA 4DJEA 5GQBA 3V75A 3AYVA 1XBVA 5TBOA 4JQ3A 5FF0A 4GIYA 4UR8A 2QW5A 1XQLA 4Y6GA 2YCEA 2A4AA 1FCUA 2OEKA 3RDKA 2ZUTA 3CQKA 3DHPA 1EP1A 1EX5A 5GJPA 2QIWA 4HMNA 4F0MA 5L9FA 1TRIA 1F8MA 3KZSA 2ZUSA 1PTAA 2P53A 4W89A 4GUGA 4U3CA 2AKZA 3IPWA 1SJDA 2VDIA 3H12A 2X0SA 3PJWA 3ZQ9A 7XIMA 1TTPA 3G8RA 3L9CA 4AWTA 2ZX9A 1SO5A 2IPWA 2MLZA 5HW7A 1V3IA 4GLEA 3L5AA 1NF7A 1C8YA 2OX4A 3K8LA 1YPFA 2OWXA 3PZQA 4A3YA 2VZSA 3WEMA 3BTNA 1X38A 2OZ3A 1O7AA 1F6YA 4V27A 3SW6A 2X7WA 4LRSA 3TZNA 4EPEC 1I2QA 1JL8A 3VIGA 2OLAA 4FX7A 3WX7A 4IZGA 1I2PA 1A5OC 1UD2A 1H1YA 4AZ6A 4OTKA 3U48A 4ODLA 5DEZA 3S2MA 1CXIA 4LWWA 4DRQA 3RRXA 4GHRA 4M6QA 3TK7A 2DZTA 1O95A 3W6YA 4PMQA 3I7QA 1C9HA 1M7JA 4PUUA 4NZFA 3LZ5A 3GWQA 4D2JA 1DIKA 4P8WA 3GBDA 2A1YA 3PRDA 2INFA 4CEUC 3W28A 3QOKA 3AZRA 1UG6A 3SAZA 1RA0A 2RJHA 3L4VA 4NSBA 3KL3A 3SN4A 2LLEA 7TAAA 2E5CA 5KZDA 1NAL1 3WQOA 5BMXA 4GVIA 2XGBA 1V77A 4FB7A 1H63A 3OODA 1QPLA 2CLHA 4JQAA 3LEPA 5D38A 3MC5A 3W02A 3PB0A 1UR1A 3UGRA 4NHVA 3E2QA 1VFLA 1GVRA 1K1DA 3DFYA 3R11A 2PDQA 3O5OA 1FAPA 5FEPA 4JOMA 3GZ3A 4I7VA 4L6OA 4MB1A 5DO8A 2C14A 4FHAA 1XBZA 3N17A 5C7HA 4JIHA 4DEFA 1FWEC 2YDQA 3K8MA 3IJ8A 4BWLA 2WCGA 1P4CA 4TX8A 4JFMA 4H83A 4NASA 4H41A 5CJ5A 3W1AA 2Y70A 3RPDA 3MO7A 4BQ5A 1S2TA 1SZGA 1TIMA 4IGNA 3BMXA 2YB1A 3UU0A 2Z1VA 1GTEA 4AISA 5LXXA 3NYZA 1KQYA 1JXJA 3WJYA 5A6LA 3PWIA 1L1PA 3CHDA 3LSCA 3NXFA 3H21A 2XP3A 1JFXA 4GCAA 3G1HA 2WQPA 2ETNA 1QUMA 1HKKA 1XLFA 5FIPA 4CCEA 3AXHA 3WH9A 4B4FA 1LP6A 3NQDA 1BVWA 3N73A 2ZWYA 2VJXA 4GNKB 1TUXA 5IFTA 2GQAA 5CLWA 5A6BD 4XKMA 3T0BA 2ISDA 4XAPA 5GPGA 2GPTA 4JTEA 2EQDA 1QNPA 2MUCA 3JVAA 4XBSA 1V02E 4XKYB 3EWYA 1GJPA 2PFHA 3SADA 1UYQA 5HANA 4C6NA 4Q8NA 2OGJA 4KKXA 2G95A 3T2PA 4AZCB 2XH4A 4M29A 1B4EA 2JKAA 3TAKA 1O5QA 2P50A 4LAOA 4JEQA 3ITLA 1NTHA 2Y7FA 4H6EA 3UYCA 4AZCA 4UQDA 1UD3A 3AFBA 1JPDX 1LUCB 3QYQA 3N2BA 2GFTA 3VKJA 7REQA 3SCPA 2H8XA 1JAEA 2K8IA 3ZLGA 5JBDA 3VNJA 2F8QA 3CV1A 3SJ3A 2A0NA 2CZEA 4D6FA 1NFBA 4NU7A 1FFQA 5FJIA 1HO4A 2F84A 1F7BA 3GC5A 2HBVA 1NWUA 3W38A 3TDFA 4OE7A 1OD0A 3ES7A 1Q66A 2QCFA 4BKNA 2BDQA 4GPNA 5TNVA 1EF3A 2BASA 4HP5A 1BXNA 3KTCA 3ARRA 3BXWA 4IQ2A 3K4AA 1J6OA 2ZBTA 4M1BA 5HPCA 3LPFA 4LS2A 4B92A 4V1YA 1OCNA 3GC4A 4Q8OA 2VR4A 4MOZA 3NZQA 3BW4A 1N55A 1VF8A 3H2FA 1IGWA 3CIXA 4LEFA 1KC7A 2NLIA 5IRPA 3WBXA 3CIVA 3V36A 3CGMA 2NSXA 1R2TA 1CLKA 4MY8A 1K7FA 4H2CA 3U7BA 3FGCA 1S1RA 3UA4A 1RJQA 3PZUA 5FJRA 2V81A 4MY1A 1H61A 4O28A 3W74A 4YYFA 2DH2A 4F2UA 3IK4A 1M9HA 1H7XA 3D3FA 1XCWA 1P0EA 1I45A 3V0TA 4UTHA 1Z44A 4AIEA 3G1DA 4I8DA 4HCHA 5E0FA 1Y8BA 4P7LA 2X40A 3N6JA 2ZRWA 2HWGA 4N42A 3ANYA 5DXXA 3T55A 4P8UA 4JFLA 3BAWA 3K2GA 3LGDA 1UP2A 2OYMA 2B7NA 3IV8A 4LAMA 3CV7A 4GE8A 3NQ6A 2X42A 4G2PA 3EOOA 1ZPTA 5HJYA 4Q4RA 3KABA 3FHQA 4A4AA 1XFCA 4ZFCA 2XVLA 3AS3A 1HTIA 4XISA 1EIBA 3LN3A 3DHFA 1ICQA 5HNNA 4JYEA 1X6NA 1J0KA 4TMBA 5C5YA 2Q02A 4P61A 4XZLX 3THCA 2PA6A 2HE5A 5JBEA 1DBTA 3F2CA 1R6WA 1SUXA 1TQJA 3AWNA 2O0TA 3K1GA 2PDWA 3GDMA 2OOFA 4GVGA 1BAGA 4REQB 4LUSB 4N9DA 1GJWA 5I0DA 2VVNA 1E0XA 1W9DM 4AD0A 1YNQA 3B9AA 1TPB1 3NOEA 3TTOA 1R3RA 6ENLA 4RW3A 1WOBA 1XHGA 1GW1A 4M5PA 4A3QA 4S3AA 4Q33A 5J5RA 1SVDA 4GH3A 4O17A 1RZMA 2H90A 1XKJA 1JCHB 2V5JA 4JIQA 3P84A 4IX2A 1UH3A 4MWAC 5D9PA 6A3HA 3T8LA 3CIWA 4HK7A 3C2RA 4HBOA 2Z1BA 3M47A 1MW0A 4BZYA 3L68A 3EEGA 4ODNA 4NJIA 3L5LA 1YE4A 2FLIA 3WD0A 2PF0A 1PVNA 3WL0A 1E3XA 1NU5A 5DANA 3O9NA 2WVSA 1I75A 3LBCA 3RLGA 3RM4A 2DIEA 2ZXBA 1P0KA 1NWTA 4C6JA 1F8AB 3ZSSA 2HISA 2A6LA 1MQRA 3QXBA 4GKLA 2PI6A 1XC4A 4Y8EA 2NLYA 4P7NA 2IXUA 4WSHA 1C8VA 1H11A 4JXCA 3S9YA 3BJTA 4HA1A 3SQLA 3IJ6A 3EOSA 4Z0JA 1LQ0A 2DT1A 1UKTA 1Z41A 4C6EA 4URIA 3M0YA 4TMCA 4DRJA 4K68A 3MJYA 4HMDA 3AUOA 2PPNA 4XSLA 1CB2A 1W91A 2E3ZA 3N15A 3W2KA 3IUDA 4W4QA 1DJWA 1Q45A 2ISVA 4H9MA 1MI3A 1CGWA 1XRSA 4IMCA 1DWFM 2GDVA 3TN5A 1Q6CA 4NZ1A 5GNZA 2HDJA 3G1FA 1YTEA 3GTFA 2V5BA 8XIAA 4ES4A 1KA9F 3IARA 2A3EA 1PTGA 4GQGA 2HNEA 3QJAA 4DZ5A 2NWRA 4K38A 1JNDA 4WX2A 1QHOA 2HRWA 4Z0SA 2VWSA 1GPFA 1OGSA 1SMAA 3F4DA 4KWSA 1JDFA 7PTDA 1G67A 2YL9A 1TJRA 4C7DA 5A6SA 3ABZA 3UQAA 3CGNA 3QV6A 1WDPA 4UTIA 1K9FA 2WAGA 3UA3A 4NIRA 2BY3A 2C18A 1NDVA 3IK2A 2LKNA 3TQPA 5LKYA 1TV2A 5E9XA 4GZIA 3AOFA 1BVZA 4PMUA 4DBSA 3M0JA 1VFSA 3GG8A 2UZ9A 4JTSA 2X30A 4WXYA 3AAMA 1WKDA 1LQ2A 3SUVA 2JIWA 4ICCX 4Y90A 3U0HA 3APYA 4HPJA 2Y7GA 3ZS4A 4UC5A 2WKLA 5AC5A 1O1ZA 3L4XA 3TAOA 1NDYA 2V30A 3GDLA 4I7WA 7A3HA 3LB0A 2PP1A 1WX0A 3R6IA 4IIGA 4BF5A 4UFMA 1AH4A 3LM7A 3VE9A 4MJ4A 2A2IA 3NGFA 1KM2A 1XLKA 4S3EA 2YKKA 3CH0A 4B5TA 3W26A 4G1KA 3SJNA 1BVNP 2XTKA 3EKZA 1CW2A 4LW7A 2D23A 1T0OA 3OA3A 5IDIA 3MP3A 1QNQA 3D0CA 3HJEA 2W4XA 1JUEA 3ZT5A 1KM6A 3WD2A 1DJYA 1SO6A 3AIRA 2Z24A 4ZL1A 2J25A 1H51A 4QE4A 5HPOA 4AC7C 1MW1A 1NQ6A 2PS2A 3BW2A 2E8YA 2YR1A 4F0HA 5F4WA 1Z3NA 4HHLA 2DIKA 3W1RA 4DRIA 1GZJA 3R8GA 3IJLA 4ZENA 3ABOA 3W2NA 2A5HA 2W66A 1JYVA 2E28A 3TU9A 4JTJA 4EVZA 3QR1A 3IJ7A 4LY8A 1R46A 4FO4A 4DNHA 5CGTA 4EX4A 4ZB5A 3BZJA 4B16A 3HPAA 1NVMA 3SQMA 3VE7A 2PTZA 4RNFA 4J4KA 2LPVA 4GZEA 1ZTVA 5IHSA 3R12A 2PDXA 5TIMA 3ZT6A 4NJJA 4RNIA 2YFNA 2ZRZA 4MKSA 3NL2A 2VZUA 1YBQA 3SUTA 3OGSA 3BCFA 1KGWA 1J2BA 1KXVA 2OXNA 4HYVA 3TE9A 1E9IA 4B5VA 1Q1CA 1XGDA 1YW1A 3SUUA 3QY8A 5GVJA 1SYTA 2WXDM 5DRIA 1OGBA 1SJCA 2BSLA 3KOZA 4GGBA 2ALRA 1TKKA 3TKFA 1F2JA 1UR9A 2E1DA 4JTCA 2B5UB 2KR7A 3EXRA 4OV4A 3UCQA 1BRLA 2ZTKA 2W5FA 1GORA 3LPOA 2FJUB 1Q4WA 3LQGA 4F0SA 5FJJA 3MI2A 4S1FA 2ON3A 2PDUA 5HJLA 2YX0A 2F6KA 3RU6A 2EJ1A 3B97A 3NPVA 2PLCA 2WM1A 5DMMA 3WD1A 2OR2A 2XISA 4ADSA 4JTFA 3KAFA 3CBWA 3OLDA 2YL8A 5LIXX 4R3UA 4XAGA 1IWAA 1VIZA 3MSRA 4E3TA 1TWWA 3BGJA 1BGGA 2QCNA 4IT4A 1BF2A 4CU7A 2OSYA 3HIJA 4HNUA 3GK0A 3GVRA 4D1IA 3VOFA 4NZCA 1FY6A 3NSNA 1A50A 3OJGA 2NV9A 4JKLA 3ERPA 4I3GA 1GUVA 1UQYA 3NURA 5CGQA 2NT0A 3GR7A 2VFEA 2WVVB 1QHPA 1ROTA 1RSCA 2BVTA 3LHUA 3WY1A 2YW4A 2D2HA 2OQYA 2Y8UA 4O1FA 4XUYA 3IIPA 3UD6A 3T40A 1U5HA 4D8ZA 1F3XA 8A3HA 4KT2A 3VA8A 3KDNA 4Y96A 1ITQA 1QATA 3SQSA 3W2UA 5M03A 2OJPA 3BCDA 5GNYA 1TWSA 2J9YA 3FDKA 3KWSA 3OOQA 4AZGA 1P48A 4A29A 4XSMA 2WZEA 4L4MA 3APTA 4B90A 1LLWA 2DUXA 2JKPA 1KBLA 2M08A 4PMRA 4LC8A 3M43A 2ISFA 3PSWA 2F6UA 1RR2A 3TA9A 4QCEA 4CNNA 2Q09A 3O6AA 1Z89A 1QDSA 3QN3A 2IPGA 5I2UA 2FTWA 2NT1A 3AHXA 5DLCA 1SSGA 4GJIA 4ODPA 3WH6A 5HMFA 3H4XA 3AC0A 1OD8A 1PE1A 3PUGA 2Y8VA 3OU8A 2E7FA 3GU9A 1TPWA 3GDBA 3IGSA 4ZOAA 3T78A 4QIUA 1FWGC 3FYYA 4HKPA 4PFHA 1CGYA 4J7RA 2WZMA 3ES8A 3CPRA 4B15A 3HOJA 3A4JA 4RE2A 1I8JA 1RP8A 2DW6A 2V8ZA 2WANA 3AZSA 3W6MA 3RYSA 3WLKX 4K1GA 4BFAA 1L9WA 2XP9A 4EK7A 4JICA 1EJVC 2V3FA 2QPXA 4NILA 2WJEA 5I09A 1YXYA 4D71A 3B8DA 2GLKA 4QT3A 3A9IA 1JG9A 2E9MA 3BGGA 3BWWA 2R1NA 3TQKA 3SDOA 3UQIA 1QBAA 5D02A 3ARPA 3CMGA 2EKCA 1ZJIA 3ARQA 2W0UA 2VRKA 3MDUA 3H8AA 2RDUA 2YCIX 3DN5A 2H3DA 4F9JA 3NSXA 2QDGA 1K9TA 4IFOA 4Q7NA 4QT2A 5DN1A 4V33A 4U5IA 2ZQTA 4O12A 3C8NA 3VYLA 1DIOA 4H6RA 2RFGA 2A3CA 3AHZA 3A12A 3SCQA 4IMGA 2Q5AA 5BROA 4XIAA 1AW2A 4PTWA 3RILA 4AIBA 3NQMA 5BRQA 3W72A 3KCEA 4DLFA 4L4LA 4PB3A 1RD6A 3L23A 3HPXA 2DORA 1J4IA 8TIMA 1YLVA 1LLOA 4PCNA 3CV2A 2A7RA 1BXCA 3VDAA 2DG9A 1XIEA 2G50A 1PZ2A 2BB0A 2P76A 1JNSA 1S5WA 4MNMA 3CJPA 4MFDA 4AG0A 3W87A 4GVFA 4K37A 1XLCA 4PEEA 3UXAA 3AXKA 5LA2A 4TVCA 5HT1A 2ISWA 3RX2A 3H54A 3U9IA 4O54A 4DYKA 4GUFA 5CQ1A 1D7IA 5B7YA 1TVNA 5KMYA 3SRKA 2DP3A 3W9ZA 1JI2A 3OQ8A 3ATZA 3TSDA 5EMUA 1S5MA 3BLPX 3FKRA 3SB0A 1KKRA 1WCGA 3LM3A 5AYZA 4H7ZA 4Q8QA 4H7CA 2CKRA 3JXVA 1E9ZB 2PV1A 1XDMA 1KFBA 2QS8A 3RN6A 3VNZA 4H3DA 2O92A 4ITZA 3HZ3A 1WDSA 4GC4A 3AMCA 1SFLA 3ODKA 3UQNA 3DEQA 1KFLA 1XYBA 1GGOA 3W22A 2GGEA 2E25A 1O4UA 2BY0A 1ECEA 1E4LA 1UWSA 3EB2A 3L65A 4AZ7A 3I6EA 7ENLA 4MGVA 4UFIA 3LXAA 1E6SM 4HVXA 5CSRA 5HUAA 3LYEA 3U2OA 1EHAA 3FK4A 1AH0A 4LCSA 3USZA 3N9KA 3TOPA 2VC6A 1ITUA 5D05A 2UY2A 4AWEA 3K30A 1W3KA 1R3VA 5AYYA 4PB5A 3LCGA 2HJPA 3UI4A 3T0TA 2ZC1A 3AS0A 5CJMA 5FJOA 4I9JA 1OCQA 3QHMA 2F7FA 3RMJA 1G7VA 3F4WA 3S83A 4JTHA 2V5DA 3VD5A 3WO8A 4QJ3B 4ACZA 2V82A 1ZSXA 2C0HA 4TX6A 5IDZA 4W8BA 3QV7A 1W56A 2Y5JA 4TQTA 2WO5A 2A7PA 4BK9A 3JRKA 3V1PA 2Q3RA 1UMYA 4ZB2A 3QR3A 4PE8A 3TJIA 3ZJ7A 5T9BG 3CT2A 1ISZA 3ITYA 3DG3A 1Q6QA 1UH2A 4B5WA 2QGHA 3L2MA 2YPIA 2VC9A 3FEMA 4QJ4B 2QV5A 5M2FX 1JDEA 3I7SA 1XIJA 4UOZA 4CQ8A 1AUSL 4LC6A 1FWRA 1BD0A 5DBUA 3RX3A 2YA2A 3VAVA 1KBBA 3GXIA 3CNYA 2YYTA 3IVUA 4MPQA 3W24A 1W1ZA 3C56A 3KDOA 3PBMA 3N04A 3AIWA 2CPUA 1Y0EA 4O8AA 1KNWA 3TN4A 4DIPA 4JFKA 4ZE5A 2QHAA 4DROA 5GPRA 4X2PA 4GFSA 3UWWA 4Q7IA 4CU8A 3LGEA 3OB8A 2WSYA 3SGZA 2HPMA 4AXNA 1V6WA 3LMYA 3TYBA 3E5BA 2XPKA 2HXUA 3QKZA 5KZEA 3FY1A 1RY0A 1E3ZA 4IQDA 1KW1A 4IMAA 1BPLB 3O63A 2VUNA 2YCJA 3VGGA 4GZ7A 1MUMA 3TCZA 2ALDA 1WB0A 4IGMA 1M01A 3QGKC 4LEQA 2W27A 3WQDA 3OHIA 3NOYA 1LRNA 3KP1A 4C6QA 1TVPA 4YMZA 5C7VA 3T07A 1GVYA 1GOOA 3EIPA 3F1QA 3HB9A 4S3KA 4MYXA 3UWYA 1DWGM 2YCLA 4JAWA 4PYSA 3C5QA 2FZNA 3N4FA 5ABFB 1OCJA 1OIMA 4DUXA 2ZWZA 3M5ZA 5J6EA 1CENA 2ZZ4A 4WQ6A 3IUHA 4LPCA 5K7JA 4H6KA 1J0ZA 4BQ4A 3GYCA 5G1MA 1X1OA 1HL9A 2B7OA 2FDSA 2VEKA 2PWDA 4JIRA 3LXCA 3O06A 3TYUA 4YYCA 1W54A 1M68A 1QNSA 3QEZA 1OYCA 1R85A 4TX9A 3MY9A 1TX0A 2P3ZA 2A3BA 5BOFA 5L6UA 3N2MA 1GQNA 3G8EA 4CN1A 1EUAA 1QNVA 4LS0A 3VGHA 5FF3A 3NZGA 4XD6A 3AXXA 1GKRA 2WJZA 2X16A 2AL1A 5JXQA 1AMKA 3BLOA 4L1GA 1LBLA 4W85A 3FA3A 4MWAE 3GDTA 1AA1B 4MNKA 1OX4A 1XIBA 1YW5A 4F8XA 5A5WA 4ILSA 4L4OA 5CLTA 2DQXA 3GXMA 2ZUMA 1FWDC 3ZZ1A 3USBA 3CC1A 3UWQA 4LF2A 2CLKA 5LNVA 1Y5WA 1CGUA 4XAZA 1JCYA 4JFTA 2BGSA 3WQ5A 2ZVRA 5C70A 3N12A 3SFWA 4FX8A 2PDBA 3W85A 4M80A 1T40A 3ECQA 4XVEA 1OINA 1S1PA 5I7GA 1G0CA 3SCUA 4KEMA 5TQLA 2B81A 1MNZA 5DCDA 1CDGA 4ODQA 3P61A 1UB3A 4DELA 2XPAA 1K70A 2WHMA 3IVSA 4PSPA 2CZFA 4C02B 5A8GA 2OG9A 4RZ5A 3R94A 4ZPVR 4M19A 3I6TA 1RLDA 4KEUA 4H8NA 1CCWB 4ERGA 2NUWA 4Q4SA 3TC3A 2RHGA 4DIAA 1HJWA 2WC3A 3W7OA 3NXLA 3OZPA 3VKKA 1BYBA 4TXEA 1N1AA 1UWUA 2X41A 2RUSA 1JGIA 1KKOA 1S2VA 2PPOA 1W1VA 1WE5A 2VZVA 3VNMA 2G0WA 4JTQA 5E6ZA 2VEFA 3KBJA 3CEUA 3VC5A 1S5TA 3UNDA 5HQLA 2QVHA 2KI3A 1F3WA 5DMLA 1DQUA 3WF3A 3T0DA 4V2XA 2VENA 3KL5A 1DIDA 1EJXC 4CN6A 2NXGA 4XX6A 1JZ8A 2XP5A 1US2A 4C90A 4LCRA 2YJQA 3STGA 3GIQA 1QU4A 3MP4A 4E4FA 1GZGA 1LG2A 4CQBA 2BHUA 1OFBA 2X1SA 2IQDA 4JYFA 1DTUA 1QZ2A 2WCAA 4S38A 2ICSA 3TXZA 4IXXA 1L0PA 2EPMX 4QDWA 3UCDA 1FHVA 3AALA 4PRWA 2VM8A 4OFCA 4NNRA 3NO1A 2AQVA 1AMYA 2RGLA 1T8XA 4E2BA 1EA0A 3PULA 1VYRA 5AOUA 3LLXA 3IJIA 3S9IA 4H01A 2YZ5A 1KV5A 2XUCA 3PFMA 5G2HA 3SM0A 1F4HA 4I6VA 1Q6RA 3E74A 1NY1A 2A3HA 2YYUA 4AZBA 1E6QM 2GSEA 5G4WA 4O2TA 3CHCA 1JFHA 4ZO8A 3RPTA 3DFSA 2ZDRA 1XRVA 2A21A 5JUVA 4FOKA 3KOXA 1MXSA 4HNVA 2E5BA 1TVLA 3M0ZA 4FX6M 4RNJA 2YL6A 1W31A 5DELA 2E67A 3PZGA 4A8RA 2RDWA 2IS7A 3W73A 4JDBA 2OZ0A 3A3XA 4O10A 1YTDA 3GH4A 2AMXA 1THFD 4IH3A 4MVAA 2A3LA 1RBLA 1TIWA 4UQBA 3EMCA 4HHMA 1KRMA 3CUGA 4R0XA 1HG3A 4LAYA 1ISVA 1P6WA 2RUDA 3H2OA 2Y5EA 3VGBA 7ODCA 3W1MA 4WLCA 2EPKX 5A8OA 1F8IA 3CU2A 1PSCA 4DWSB 2Z00A 5HMDA 3VOJA 4HMEA 4LUIA 1QR7A 1TZ7A 4PTVA 1CXFA 1MO0A 1XDJA 1ZBCA 2QKFA 3CQIA 3M7WA 4AX6A 1FKKA 3L2LA 2IKJA 4GWEA 4UXDA 4KIEA 4FXJA 3MHUA 5I3IA 3P8IA 3EPNA 1SW3A 1QNRA 2DSWA 4XZMX 1MW2A 5I79A 1H5VA 1NOFA 2V5LA 2KZHA 1OX5A 3GTXA 4NAEB 4KCTA 3Q45A 4OBSA 4HU0A 1T41A 1FJDA 3F4CA 4FAPA 4KWWA 4F0LA 4KGLA 2L5HA 1F3TA 3TH6A 4GX9A 3BURA 2I57A 4GX8A 1N2VA 4EPBC 4ERAA 2OGYA 5I3DA 1YADA 4ML9A 1CXLA 4CKQA 4GGQA 1GW9A 3UETA 3OVQA 1Z48A 1A4LA 2FKEA 2EXOA 1XIHA 3KTSA 3E3HA 1XS2A 4LY4A 4QDMA 2R1LA 2IPJA 1JRBA 3O3RA 1YX1A 3INPA 1JIBA 1QI0A 4H9ZA 2NZLA 4QQUA 5FD0A 4C1NB 3PUDA 4PRRA 5IHRA 4WY0F 4L3NA 1S5VA 1PJ9A 3JW7A 2VUYA 5C9WA 2KGJA 3GW3A 1YMYA 1Q13A 3S47A 1I1XA 1WXZA 2BVDA 5CPNA 1JCTA 1TRDA 3C8FA 3GX9A 4CU6A 1VRXA 3M64A 4WOQA 3BH4A 3EAUA 2GUBA 2W79A 3BAJA 1K8CA 4PL1A 2VELA 3UNTA 3IHZA 3BANA 3FSUA 4NAFA 4XBJA 3I65A 4NF7A 2XVKA 1IE7C 3NO5A 3BOXA 4HSHA 2DGAA 2FFCA 2PRMA 5D75A 4MTVA 3N25A 3AJXA 3EDFA 5H91A 3W7JA 1OZMA 3TC6A 3GB6A 3LCWA 1XYLA 3C0JA 4FMVA 4RE0A 1KCXA 3CV6A 3TR2A 5G1TA 3A22A 1OB0A 3HFYA 4HJWA 1K4HA 4KS0A 1EOMA 3UR2A 1L8NA 3HQ1A 4UFLA 7CGTA 1F6KA 5B7ZA 5AC4A 1XFBA 3VIJA 1KT1A 1C8XA 3GLCA 5JH8A 3WQCA 1KCKA 1DXFA 4IJRA 3AJ7A 1C29A 1W1IE 5M5DA 2V5KA 3MUZ1 4J3WA 1CI1A 1XLHA 3W7LA 1TO3A 4GMEA 4AEOA 3IGUA 1TE6A 1ZP4A 1T7LA 1NOWA 1UKSA 2OO0A 3ARVA 5K3VA 3M0XA 5D8ZA 1REQA 5A6BA 4W8LA 2FZ9A 1FOBA 2CLPA 2F9RA 3IS4A 2GUUA 2PURA 1US3A 4MF4A 1G9HA 3KWXA 4IQJA 1LOLA 1C9WA 3WDRA 2PP0A 3BCJA 1NARA 2DUZA 2TAAA 3EOEA 1XYCA 2DT3A 2NXIA 1EIXA 2YL5A 3C2EA 2ZYFA 1YHTA 4AD5A 3L0KA 1VBGA 1UROA 1KM1A 2WZIA 3NQ8A 1TV3A 2XVPA 3KBVA 3ZXWA 1EJTC 4C6CA 1XC6A 3WYZA 3SCSA 2Z29A 3NPXA 1D7FA 1XX1A 3RM8A 1IYXA 5I3JA 3W1NA 2CESA 4JL1A 3BO9A 1NF0A 3BARA 1Q7ZA 5E0CA 5MKGB 1W2PA 3LXBA 4QNEA 1IGSA 1K02A 4X9SA 4ZVJA 5T91A 2XH0A 2HZGA 2V3DA 2Z2AA 1BXBA 3MJMA 2KX9A 1C9DA 4KCWA 2NX1A 4GC3A 5LXEA 4GINA 3QRHA 1QPKA 3BGAA 3S1VA 5FOOA 1F6PA 2QDHA 2Z26A 1UR2A 3QGAC 3KCJA 4IIFA 3QZ6A 1IR1A 2L2SA 4D72A 4NYYA 2DW7A 4DM2A 3CUIA 1DWHM 3UESA 2VD8A 3KAHA 3H2EA 1XLEA 5BXSA 4GO9A 2XFFA 1NEYA 4Q4QA 5AHEA 2ZUVA 1R9ZA 3UQBA 2GJLA 1Q6EA 5PTDA 4HA4A 1MXDA 3A6OA 3CK5A 4LVGA 2IKGA 1SR9A 2H3BA 1FHDA 3QLLA 2BODX 2X2YA 2QPSA 2GQ8A 5FAJA 2FB3A 3W00A 1F76A 4YU1A 2W92A 3F7JA 3UFYA 4W7WA 4FF7A 3M0HA 4TTGA 3TCEA 4UTKA 1CEOA 4XZHA 3U7VA 1B3OA 3ZFHA 3LGGA 5IM51 4IISA 3QSRA 4LQ1A 4GY1A 3VU2A 4H9TA 1G69A 3R7MA 2XP4A 4HPGA 3PG9A 5DY2A 5REQB 4TV5A 4RZBA 5D2TA 1TREA 3RRAA 3HGSA 1ITCA 5A2CA 4TTUA 1DJHA 4K8EA 4O57A 3ORWA 1SZNA 3WLSA 3QBUA 2DQWA 3MTWA 3AMKA 4HK6A 4Z1BA 4U31A 4C6MA 3VOGA 3ZSTA 1R2RA 3UI6A 1W3TA 2PE4A 4I6KA 3EPOA 5JVLA 4QEEA 4D6GA 3N2OA 1HGYA 1V6TA 4ADUA 2NVAA 5AFDA 3O5EA 1EEXA 2WWCA 4OT7A 2VEIA 3S1GA 3P8JA 3CEPA 4JTDA 4UZUA 4M1RA 5AHLA 4FA3A 4ZCWA 2REQA 1G4TA 4KPLA 3ZJ6A 3LLFA 4IICA 4P7OA 2Q8ZA 3UF8A 2E09A 3IAPA 4M7SA 1XBXA 1P7TB 4GG9A 1SZFA 3LTPA 2GSHA 3LI1A 1ZAHA 4Z1CA 1W3HA 3AIUA 2Y1HA 3EA3A 3IJQA 4IIEA 4MKVA 5DT5A 2GZXA 3CTTA 4A21A 4IFKB 4FNTA 1QO2A 1VFUA 1GOWA 2XFWA 5DQPA 3IGXA 5GJNA 3CAVA 4UWMA 1X7IA 5HWJA 1TPFA 1IT8A 2VX7A 4QITA 1HQTA 2ZRYA 2I56A 3TVAA 2KE0A 1G6CA 4CNTA 1ZCNA 1U5JA 4ZQOA 3PSVA 4IP7A 4JNZA 1WPCA 1BHGA 3WNPA 3RCNA 3KOFA 4LT9A 4IT1A 3S1XA 3NQFA 3OGRA 1SZRA 1BEUA 2OFNA 1HVXA 4K3ZA 5EFFA 1G94A 4WD0A 3DHUA 1H09A 2DVXA 2WMGA 4ZTYA 4CQ9A 3OW1A 1ZB5A 3FX4A 1VAHA 4ZMGA 1ZP3A 1OC7A 4C60A 3R79A 4ZQCA 1Y5XA 4YCOA 2W3ZA 5BMWA 3LI0A 2V5CA 2Y4SA 4Z2GA 1RVGA 3LHYA 3R2GA 2MNTA 1E43A 2G96A 5DIVA 4GK8A 4MDOA 5DCBA 1RALA 4IMFA 4GQRA 2VDHA 1X8FA 4ZGYA 1PB0A 2V67A 3DI1A 1J6PA 3PM6A 1TUFA 4J27A 4RDYA 5E1QA 1QK2A 3W7IA 4JNYA 1EGZA 5U4NA 3G0UA 4LS1A 4C6DA 3N11A 2BY1A 2QPUA 3NM3A 1FRBA 2OT0A 1DP0A 4HTBA 4XAYA 3W0KA 2R6OA 4EXQA 1RCXB 4JIEA 2VGFA 3LCLA 1GEQA 5I02A 3CUZA 2J77A 1ZS2A 3VILA 3P0WA 2XVNA 3N34A 3NZPA 4O53A 1NJJA 2G3JA 4GI6A 3W1PA 3V3WA 2XGZA 4NZ3A 3UF9A 1Q85A 4LTSA 4Y9PA 3NL5A 2DIJA 3RLHA 3QLDA 3PBWA 2H9AB 3LV5A 1SR0A 4B4HA 1WAWA 2EKGA 4WY0B 1VFTA 3IAQA 3VTRA 2CWNA 4K2SA 3GS6A 1YDYA 1DVJA 2CCRA 2E8ZA 5F4XA 1V5XA 1NELA 1XPGA 4DXVA 1LM1A 4J2PA 4IIHA 1XIGA 3P93A 3F4VA 1R38A 3W37A 4RDWA 3STEA 1V3LA 4IJBA 4P8XA 3C61A 2O4QA 3MUIA 3BOLA 4CNPA 3MUAA 3PUOA 4HOXA 1JVNA 3E0IA 3HGOA 3O2LA 1FKLA 3ABXA 3CLMA 3QOMA 3RO8A 3O5JA 3GNNA 2YZRA 1WV2A 2XP8A 3R25A 4GIVA 4IQCA 1DJNA 3HG5A 1NP2A 3A4XA 2FH8A 5EMJA 5C6MA 3O15A 3VPLA 3PWAA 2VHLA 2V2CA 2HCVA 1EDGA 3GNRA 4AW7A 4C7FA 1OK6A 5BNKA 3RGTA 1PHWA 2OEJA 1XD0A 5HTGA 3W53A 2GSJA 2CBIA 3NSMA 3GAKA 1IEXA 3W01A 4F2TA 1XM3A 3GXTA 2DVUA 3NI6A 2EHHA 1R3QA 1AQHA 2Z25A 2CWXA 2I5IA 4J1OA 3G2GA 4X61A 2JK2A 2GOKA 1V79A 2YW3A 2WMIA 4PULA 3GFXA 3TIMA 5D33A 5CC5A 4Z2HA 3GUGA 1XLAA 4H1ZA 2CYGA 2HROA 1CB7B 3NA8A 1LBMA 1I0DA 1E6XM 1Q6UA 2Q71A 2BHYA 4ZZ9A 3O6DA 3GG0A 3P6LA 3UVAA 2AGKA 4BWLC 3MT1A 3ZYZA 2O9OA 5C9RA 1O12A 3PZNA 4OU1A 1H7RA 4DT4A 3W29A 2Z1SA 2TMDA 3LPGA 4LV9A 3S8HA 3W86A 2OWWA 6TAAA 2QEZA 1E6RA 2WHKA 1KT0A 2PV3A 3WDHA 2ODOA 3N4EA 4AF0B 3URNA 5D2XA 2YGYA 4P7RA 2J6XA 3COTA 3PY2A 2VDGA 2XSAA 1V0KA 1CXKA 4A3RA 1N8IA 4JIIX 2Z2BA 3CYJA 3GNPA 5LIYX 3OIXA 5CPSA 2XIIA 3CUFA 4AIOA 2HV5A 3UPWA 1W3LA 1H7WA 3EX6A 1PO9A 3AUJA 3UJFA 2QUUA 3ZIZA 3XINA 3UXIA 4RE4A 5CC3A 4AHPA 4XWUA 2Y24A 1M1BA 4H4IA 2FGZA 4O4WA 1IR2A 5HMSA 1AZ1A 3C2YA 5E5CA 4E0CA 3NPWA 2GWGA 3LQLA 3QPYA 2DPEA 2VI0A 1VPQA 3K8KA 3RG6A 3T9PA 3GNXA 4J35A 3DC0A 1O66A 5E6YA 2VD9A 1BTMA 1TWZA 4NP7A 4DZIA 1H0GA 1GYNA 3GR8A 2FDMA 2I14A 3L21A 2EPHA 1M65A 2P8CA 5HW6A 1DE6A 1OX6A 1F5ZA 9CGTA 2AWGA 1U1HA 2ZZ3A 1JDAA 2HE8A 5LSMA 2VQUA 4GBDA 4OIFA 1Q7QA 1EX1A 3PZVA 2WMHA 4MHBA 2FVMA 4I9TA 3RNDA 3I7RA 2YB4A 1V02A 1W5QA 3VNIA 2YA0A 3DKLA 3BV4A 2QT3A 3IRDA 1PIIA 4N0RA 5G4HC 3CZEA 3ABQA 4DZ2A 2HMCA 3Q4DA 3U3HA 4DN1A 1FKJA 3ZVHA 2VCCA 3L12A 5FESA 4QXIA 3BAXA 1DYSA 4BI6A 4U85A 4GABA 4D6HA 2Y85A 3KVMA 3I3DA 1SO4A 5CEWA 1QOQA 2RUCA 5AC7A 3WSUA 4E2DA 4QISA 1MDLA 1J4HA 3M0KA 1GNXA 3STPA 1EPXA 2WBGA 1EJRC 4PSRA 4MG4A 5EMMA 4PMJA 2WMFA 4MY9A 1Q3NA 1W3NA 4CVWA 4MAVA 5G1YA 4JY8A 4WDXA 4CCCA 3DYPA 4IHCA 4QGCA 5DCEA 3NTPA 1H0IA 5C8BB 1GONA 3BQ5A 2IMRA 3UWEA 1W5MA 1YKWA 1WDDA 3TLLA 1SW0A 4Q7BA 4QSHA 1C7SA 5BWFA 2QQ6A 1CLVA 4JTRA 1MYRA 3DH7A 3WFAA 5JBFA 1RQEA 3UG5A 3VCRA 1IXNA 2V3EA 3GIYA 4H8VA 3MYOA 2J66A 4CD7A 4LRTA 5K9XA 4GJ1A 2QCEA 4O4VA 2QAPA 1H41A 1KM5A 1QRQA 4PUDA 4GISA 4H04A 3TC7A 1V6VA 2UY4A 2EAWA 4WK9A 3FJNA 3IVTA 4YXGA 2X0YA 1MEIA 4MDPA 1XP3A 2J47A 4J3ZA 1QK0A 4FEZA 4L65A 2X2GA 3WLOA 3M44A 1CZ1A 2GK1A 1QPOA 4YTRA 3VABA 2NQJA 1FDZA 1S38A 2XPBA 1TPUA 4UTJA 4XTIA 1CGXA 4R34A 4HD5A 3HPSA 3L66A 3JU2A 4KRUA 3WMBA 2CZVA 4I90A 5FF7A 3R58A 1KD0A 1Z8AA 1KLZA 1L6SA 3I3EA 2W6RA 1HF6A 4QS6A 3U8GA 1VBUA 1DPMA 4DM1A 4AY7A 1VP5A 1EQ3A 1XH0A 4R33A 1OCBA 1ENUA 4PL2A 4HARA 3P7YA 1PDZA 3FYPA 4IL2A 1M7XA 1A3HA 2RURA 3KE0A 3RFWA 5JQ9A 4N9CA 3TSBA 3C3UA 1H1ZA 3A24A 2E0PA 2WNQA 1CX9A 3W76A 2WKGA 4W7UA 6PTDA 1CWYA 3NQ2A 2I5QA 1IEWA 4UTUA 3E02A 3QPZA 3NVTA 5F2GA 5D9MA 4N6FA 3W75A 5ABEA 1HGWA 3QSTA 3KL0A 1VHNA 5CAHA 3KBMA 3GH7A 3I3BA 4O1EA 3CMFA 5EMYA 1DTNA 1UW9A 1KV8A 3UZWA 3O07A 2CIPA 2XSXA 3WLRA 1VFHA 4S3JA 4TYOA 1DJGA 1EBHA 2HEJA 2R82A 3BZGA 3UCCA 4C65A 3PUEA 3S1UA 1AL8A 3OYXA 4XV0A 2WPBA 4I9MA 2IKHA 3VDHA 1QHZA 1TX2A 1C91A 2INZA 1UJPA 4KEZA 1CPUA 2EEXA 1QTWA 2VO5A 4E8CA 3LCXA 4JCMA 5AYIA 1EGMA 3SRFA 2C15A 2XVGA 3L0NA 2EG8A 4FXSA 4K6AA 4RPPA 4BJHA 2ZZ1A 4FLRA 4CD5A 4K1WA 2PWVA 1R87A 5AHMA 3THUA 3SCNA 3LD5A 5HWNA 4LALA 1EYEA 1PZ0A 1VYPX 3G22A 2A6NA 1KBKA 3AO0A 1BWKA 2O9RA 2PLJA 4NX5A 4Z1AA 2VOTA 3TCSA 4AZHA 3GHSA 5A6AA 3O16A 3BQ6A 1EBGA 4W9PA 1