4WKPA

Crystal structure of helicobacter pylori 5'-methylthioadenosine/s-adenosyl homocysteine nucleosidase (mtan) complexed with 2-(2-hydroxyethoxy)ethylthiomethyl-dadme-immucillin-a
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
230
structure length
230
Chain Sequence
VQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminodeoxyfutalosine nucleosidase
publication title New Antibiotic Candidates against Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase/hydrolase inhibitor
total genus 84
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wkpA00
2AC7A 3LA8A 5F7XA 1VHWA 2ON6A 3LGSA 4GMHA 1T0UA 1U1FA 2A0WA 4TTAA 1C3XA 2HN9A 1JE0A 1Z34A 3FUCA 3PHCA 3EUEA 5ETJA 3UAWA 4DAEA 3NBQA 4U2KA 1RXYA 1K27A 1V3QE 1PKEA 3O6VA 4G89A 2HWUA 1VMKA 4F2WA 4LZWA 4DANA 3KU4A 2IQ5A 1PK7A 1PR6A 3BL6A 1VHJA 2QPLA 4F3KA 3P0FA 1JDZA 3INYA 4WKPA 4OJTA 1JPVA 4MCHA 3SCZA 2QTTA 5F7ZA 5IFKA 1PR5A 1FXUA 1YRYE 4EB8A 2OECA 1PF7E 4L5YA 4MCIA 3DPSA 2OC4A 1RT9A 1Z35A 5CXSA 1V2HE 5DK6A 1ZOSA 4X24A 4YMLA 3OZCA 2AI2A 3OCCA 1RXUA 5F76A 2P4SA 1WTAA 4MARA 2BSXA 2A0YA 1ZL2A 4I2VA 1ODIA 3ONVA 1Z37A 4LKRA 1CG6A 1A9SA 3EMVA 4WKBA 1V45E 1YBFA 4DABA 3C74A 4TS9A 1PR2A 1OU4A 1Z36A 4M7WA 1A9RA 1TCVA 4L5AA 1Y1QA 3NM4A 3GGSA 4JOSA 4E1VA 5IU6A 2OXFA 4WKNA 5JPCA 5F78A 1TD1A 3PNPA 4TS3A 3KVRA 1TGVA 4L0MA 4R2WA 1A9TA 3K8QA 4NY1A 1VFNA 1A69A 4TXHA 2I8AA 4QARA 3KVYA 1TGYA 5B7GA 2AI3A 4LNAA 1OV6A 5F73A 1Y1TA 3TL6A 4OGLA 4OEHA 1U1CA 1RR6A 1SQ6A 3MB8A 5I3CA 3UAZA 5FAKA 1RXSA 2AI1A 4L5CA 3DF9A 5KB3A 3F8WA 1SD1A 4DARA 1NC1A 3PNSA 4WKCA 3PHBE 1PR4A 1Y1SA 5EPUA 4BMZA 4DA7A 1RXCA 4R31A 1NW4A 1Q1GA 1ECPA 4D8YA 1LX7A 4GLFA 4DA0A 3GB9A 3OOEA 1V41E 3DP9A 5CCEA 3P0EA 4DAOA 4LDNA 3KUKA 1RFGE 2A8YA 5EFOA 5EUBA 5K1ZA 3QPBA 5CYFA 1OTYA 1SD2A 3UT6A 4RJ2A 3FAZA 4L6IA 2GUWA 1ODKA 5CCDA 4D8VA 4LNHA 4TXMA 4QAQA 3OOHA 1Z38A 3LBAA 3OZBA 4KN5A 3ENZA 4R2XA 3DDOA 4DA8A 4TXNA 4QASA 1SJ9A 1PBNA 1Z5PA 1QE5A 3O4VA 1M73E 1JDVA 4D98A 4M1EA 1B8OA 1T8RA 1A9PA 1LV8A 3FB1A 3KVVA 1G2OA 3D1VA 1Y6RA 3K8OE 1JE1A 4UC0A 1CB0A 4D8XA 4QATA 3U40A 1JDUA 1OUMA 4F1WA 1Z39A 3NM5A 1RYZA 1JDSA 3IOMA 1PK9A 4P54A 4YNBA 1T8SA 2A0XA 2QDKA 4YJKA 5CXQA 1T8WA 2HSWA 4JWTA 3NM6B 4QEZA 2RJ3A 3MMSA 1Y1RA 4G41A 1Z33A 1ULBA 1K9SA 4JP5A 2HRDA 4OGKA 3FNQA 4QFBA 2XRFA 1ODLA 4G8JA 1I80A 2ISCA 3BGSA 1ULAA 3BSFA 4PR3A 4BN0A 3OF3A 1PR1A 4WKOA 4D9HA 3OZEA 4NS1A 2PGAA 3KHSA 1V48A 3EUFA 3E9ZA 4K6OA 4M3NA 1U1GA 4TXJA 4BMXA 3OPVA 5F77A 1PW7A 1B8NA 4TXLA 5C80A 3IEXA 1YQQA 1Y6QA 1JYSA 4ECEA 3UAVA 3EEIA 2I4TA 1U1EA 1TCUA 4TYMA 4F2PA 2OC9A 1A9QA 1RSZA 3FWPA 1JP7A 4IP0A 1U1DA 4PNPA 4FFSA 4GKAA 3ODGA 4NSNA 1Z5OA 2B94A 5F7JA 1A9OA 1PR0A 4BMYA 1PWYE 1OTXA 5B7QA 4F3CA 1XE3A 1T8YA 2QSUA 3E9RA 5CYGA 3FOWA 5F7OA 1NC3A 3BJEA 1Z5NA 4TTJA 1V4NA 3UAYA 4YO8A 1K3FA 2H8GA 4EARA 1N3IA 4H1TA 4OY3A 1JDTA 2QTGA 1LVUA 2Q7OE 3T94A 5B7PA 4GLJA 3DJFA 5B7NA 1ODJA 3UAXA 4DA6A 1OVGA 3OZDA 1YR3A 4OF4A 1RCTE 1YQUA 4TTIA 3E0QA
chains in the Genus database with same CATH superfamily
2OESA 2VSXA 2B4YA 2WYUA 4MWBA 1R9GA 3CNBA 3UCEA 1IJEA 3C4QA 3LPLA 2Z5GA 4D4LA 1T26A 5JSZB 1P0IA 1V11A 4MICA 4B6PA 4EQZA 3RAFC 2FKAA 5BMOA 1GPKA 2R97A 3S1AB 3ZXYA 3H97A 5FEUA 4COOA 3WKAA 5JFTA 3F6BX 2RH8A 4JQSA 2ZE8A 4BXOA 3K0AA 3KKNA 2H1HA 4L74A 4CM4B 2WIGA 5A4MS 5DBHX 1CUDA 2JIZD 5JCZA 1PKEA 3T12A 1AZLA 2F1RA 2A14A 4MW5A 4CE6A 2Q3LA 1PEKE 3TX6A 4F2WA 3TW4A 1J56A 3FFTA 3R8CA 3ZYCA 5EG5A 2UUPA 1ZGGA 4E2XA 1EFHA 3PNVA 2CSUA 4E3WA 5JD4A 2COEA 2IKSA 2NOAA 3GJZA 4UPDA 3PL1A 4FR5A 5J4LA 2W6CX 2D8AA 4O6VA 4OJTA 2QRPA 3MTQA 1EWRA 2XBMA 2IYZA 5C81A 1JDNA 5BMVA 4DLSA 1U3FA 3V8RA 3WB0A 5BVHA 4JP1A 4A6PA 1NMQA 4ENWA 5BSVA 4KBGA 3PTLA 3TJRA 4K6FA 5EE1A 4OH1A 1XR3A 5CEFA 1YRYE 4M86A 2GCOB 5JC1A 4V2UA 2J0SA 3AVQA 3GVIA 4U2DA 3HYTA 5DGXA 5JOQA 2H08A 4MPPA 1ATIA 2F43B 5TEWA 2KW5A 1TJ4A 3W6UA 1RADA 2NACA 4X1KA 4RD3A 5D5PA 3HYCA 3GEBA 4MCIA 4BV9A 4DNPA 4I4CA 4GKBA 3AJ9A 3MN1A 3WQSB 5L51A 2OC4A 4AQYB 1RT9A 3EA4A 3LUBA 4IH4A 3HKBB 4Q00A 2JH3A 1EK0A 2PKWA 3RVMA 5CG2A 1Y6FA 2IBTA 3ADPA 5KQMA 1JHUA 1XF1A 1SHUX 4RPLA 3ZI4A 1KRXA 3A14A 5KPJA 1PRYA 1DI0A 2W2XA 4IGKA 3KAKA 3MJCA 4LCJA 3ROQA 1TMYA 4W1RA 4U6QA 2DWQA 2KWIA 1C9YA 4Z9YA 3AEKB 2OK7A 3WADA 3OFVA 2P4SA 3FDJA 1WTAA 2P2ZA 2GJKA 3U4IA 4Q18A 4Y7DA 3U3XA 4D8WA 3NVAA 1HL3A 3THYA 4CLRB 1L4EA 3BL8A 3BXHA 1WPRA 2XODA 2A0YA 4JB8A 2DBRA 2BBWA 2C4WA 2Z57A 4U1RA 5T7BA 4I5IA 2JNWA 2OAGA 1A7KA 2P2CA 3C3CA 3FRIA 1QR2A 3QBDA 4JXKA 2J09A 3FPLA 4PQEA 4P38A 4RXUA 4N0QA 3W4JA 5ALEA 4HTFB 1BS1A 4AP5A 3ASYA 1W88A 1BKYA 3EXFB 2PZMA 1JL3A 2ZWAA 4LHYA 1A9SA 2P6MA 5EUQB 2C9CA 2Z8YM 3ADOA 2ZKLA 4R05A 1XTIA 3AC0A 4URZR 1V45E 4H6VA 1Q7CA 1J2UA 2ZVDA 3EDYA 4D4MA 4HN9A 1I14A 2BRUA 2W9XA 4TMTA 3L41A 3REQA 1G20B 4DG9A 3RT7A 2PMEA 1QIGA 1SVLA 5EEHA 3ST7A 2VJLA 3SYKA 4Z4CA 1CDEA 5AKGA 2PX6A 5EYPA 1JU4A 3I2GA 3SR4A 2RKBA 1Y1QA 4FBMA 3MAGA 5F3RA 4WFIA 1O0SA 1SG6A 2CZGA 2Z04A 3CKMA 4JBIA 1SVSA 4D4GA 5BW8A 3T7CA 3PFFA 4Q48A 2E18A 4XWKA 5IABA 5EE0A 5K8LA 1OH6A 3KDSE 4KIJA 4DR2B 2VTEA 1B41A 2EWMA 5I3ZA 2GFQA 1CDDA 4LC9A 4HDSA 1U6KA 3PNPA 3M5DA 1XTRA 1AZSC 1C0LA 1NW3A 2ZTVA 2R1VA 3FDFA 3P97A 3K70B 4RF2A 3G0OA 4EMBA 4L0MA 4RF4A 3I1JA 4YAIA 4O3FA 3SPXA 1LA2A 1CJVC 4N3BA 4DXAA 1AUQA 4RMJA 2I29A 3WE7A 3L4SO 3E27A 3BDIA 1IEWA 2R87A 2CNKA 3HVKA 2PMKA 3BHMA 1J0BA 1K8ZB 2XUIA 4W9MC 2C2ZA 1P2SA 2IIVA 1XJWA 1VJ0A 4EMTA 4AFNA 1M1ZA 3CURA 3L4BC 4RM3A 2F64A 4DIKA 4ARZB 4C89A 3FJ1A 4R8SA 1DTWB 2VDUE 5CB8A 2R2GA 1BHSA 1TA9A 3FCSB 4KRGA 3N8HA 4G5RA 3RASA 3RWBA 2AFHA 1SN7A 3B5EA 2P5TB 3GIDA 1YQGA 4NICA 5H9WA 2VDWA 2XY4A 3AJEA 3MD0A 3OLYA 2Z83A 1GA4A 2FMXA 4HQLA 3T0IA 3D0KA 4I50A 3ZIUA 3O2NA 4FT4A 1AK9A 4ALNA 3QXXA 4HSEA 3ICWA 3K5WA 4N0EA 1I7LA 1O9HA 3QI2A 1FBTA 3B6KA 3EVBA 4LSZA 3IBYA 1P17A 5IM4F 1FW6A 1NC1A 2PUBA 3PQCA 4HPJB 1HYEA 3CUWA 4D3YA 3IURA 5LP6A 3Q72A 1NPTO 3SX2A 3PHBE 2ZG6A 2BFFB 1V5EA 2RHGB 4XDHA 5KKAA 1JMYA 1GUDA 4AS3A 4FKMA 4R68A 2JG3A 4QT0A 2O5EA 4OCZA 1J21A 1JU9A 2UYYA 1YDWA 1HTBA 3B12A 4QUIA 4BASA 3WMFA 5C8DA 4FX2A 1XWIA 3G59A 1PVVA 1U9YA 2PNJA 1EB8A 1FYVA 1TJ5A 1ZNWA 3MMZA 1XMOB 3COJA 1L7BA 3I83A 4GRIA 3DP9A 3NEPX 4HNUA 1J9EA 2WWWA 4HL6A 4LOHA 5DHPA 5GONB 2GFIA 1IB6A 4S2EA 1WXGA 4KNYA 4KR2A 1PUXA 5HKAA 2XEDA 1NYTA 1IY0A 4PV7A 4Q3BA 1WXFA 1TZMA 5TF4A 4RHEA 2FWBA 4TUYA 2XMRA 1GL9B 1SMKA 1US8A 1UKAA 2J67A 3P52A 4QWMA 4B47A 2V7QA 3P0HA 1QCCA 3NTRA 4IDNA 3QHQA 1B8PA 1LI7A 2QMOA 2VOEA 1S2DA 1TM5E 2B8WA 1JIIA 2X41A 4IZ6A 4UUMA 5TQ0A 4BGVA 4D9IA 1ECGA 2J4FA 3I1YA 4YREA 3VHQA 4DIUA 2UU9B 5E9QA 2AGVA 4RTOA 4G5YA 1NVGA 3ET4A 3ABIA 3L46A 5FUMA 1DCMA 2Q5EA 4CF4A 3FZYA 1PJ3A 4JUDX 4JUAA 2P9CA 1N9ZA 3R9WA 2J5XA 2CYAA 1UR5A 1FTWA 2MR6A 3GGJA 2FE1A 4UARA 4L4ZA 1N9KA 3G17A 5BP7A 3JYOA 3THWB 3UN1A 5FOQA 4L9AA 2OEPA 1QHSA 2Z4TA 3ZQKA 4JP3A 5LA6B 3EC2A 1RXVA 3GT7A 3ONDA 4YC7A 4Z54A 4Z9BA 3GLFE 1WHSB 2EBHX 4RK0A 1BVRA 3DE3X 3USZA 4MUYA 5T4EA 3AGPA 3GLHE 1CRLA 1SJ9A 2VXCA 3P2KA 4IEEA 5E1OA 1G60A 3TL2A 1W36C 5LZ9A 2ZQYA 4AT1A 3L4KA 5LBIA 5G53C 4B81A 4BV2A 1JDVA 5KJEA 3UFXA 3WHPA 3AX6A 1CYEA 3FTPA 3ASVA 2NLOA 5DLQC 5H7XA 4O08A 4TTRA 2XUJA 2EP7A 3SC2A 1P0QA 4O59O 5JQGA 1F9EA 3EBLA 4IR7A 4JEMA 1K3UB 3V4SA 4AZ0B 5IN4A 2O0HA 2PRKA 3RT9A 3TPZA 3VUEA 3H99A 5ITVA 2NTYC 3U3KA 1OT5A 2FPPB 3DOCA 3O0TA 1D6JA 2CUTA 3WNZA 4FYVA 1MQSA 4RD0A 3O2QB 1X1QA 2XPCA 4O1IA 2ZM6B 3EAQA 4UVGA 3VR2D 1DRUA 1W30A 2L18A 3V4LA 1YAHA 2X8BA 5CX1B 3QENA 1DJNA 2I4NA 4KXUA 4FGUA 5AI4A 3ROMA 3MXTA 4FKBA 2M1XA 4K9PA 3VR3A 5EKSA 4KR3A 1J0EA 1EDOA 5AK0A 4M0PA 4KGDA 4Q1AA 1B1AA 3IHTA 3M7IA 4KQ2A 3TIIA 1KL7A 2HFKA 1J9GA 3RDPA 2FE4A 1I10A 2H4FA 1ZI6A 4B7XA 4PW0A 1AK2A 2UZ1A 2BTOA 4RW0A 3LK6A 3OOJA 1ML3A 4MUBA 4B4DA 2OUKA 4ES6A 3QBVA 5AW5A 2PS0A 5G0SA 3M89A 3NI2A 4DLWA 2FW8A 3PK0A 5H4HA 4MH0R 1W4CA 1E7WA 4DIDA 1ZHFA 4XCQA 2SCUB 4M1TA 2GRJA 1FMFA 2HC9A 4L8YA 4OAPA 1XTBA 1SU8A 4FYYA 4LS3A 3BWEA 1K6IA 2E5WA 1I24A 4XRRA 5D7BA 3NM6B 2IIBA 4XSHA 3T7KA 3CF6R 4E12A 4N03A 2V98A 5CCXA 5KJ6A 2MSEB 2ODTX 4ADSG 2JLAA 2D5IA 2QUBA 2HNKA 1IK4A 3KR2A 3QLVC 1GV1A 1IAQA 1OPXA 3MLBA 4OXYA 2VEDA 3RREA 3U56A 5L40A 3TFQA 1EGQA 3KYDA 3PNMA 4J7CA 4F4CA 2Y0DA 3IESA 2J5BA 2PL5A 1EVLA 1FNMA 1ZONA 5COAA 5KYWA 4A1OA 2ZRLA 3U48A 3E05A 1IEVA 1DBVO 5TE9A 4IDCA 4E5MA 1XPUA 3C3DA 2D1RA 4MKXA 1F8XA 5IP5A 5EJ6A 5EWLB 1JR6A 3R3VA 4A2WA 1ZBQA 3C14C 5A7GA 2H16A 3GY0A 3EGCA 3QVWA 4H2DA 1VXOA 3M70A 3OTGA 2WTNA 5AOCA 3G5AA 1T5LA 3A1WA 4HNGA 1BVYF 1MNQA 4KRXA 2Z8YA 3SZOA 1WD7A 3IAXA 4DR1B 1Z3IX 2FVYA 5KNDD 1I0IA 1T2NA 1KBZA 4WBNB 4HADA 5EI5A 3UUGA 3WLOA 4DN6A 2RBEA 2C9DA 2HD4A 3O5AA 1BJTA 4YDSA 5AICA 1RHUA 4F4UA 2GASA 2BM8A 4RTNA 2DJIA 3V8MA 3BGWA 4KL8S 4NZZA 2P4UA 2HO4A 3EIFA 2HDNB 5CD9A 3MJTA 4DJFC 4X44A 1Z5GA 3CG4A 4XQEA 5CYPA 2QHXA 3WHLA 5B5SA 1GU0A 4RUKA 4RHTA 3CISA 2JFFA 3L1JA 3S2IA 2CHEA 2DUMA 3SK0A 2UXBB 2QWXA 3GN1A 4O2LA 4JAVC 5FOTA 1JUDA 1H6CA 5DBEX 3CCCA 4JLKA 4DCGA 2V97A 3R5KA 5AKLA 3NANA 4FMCF 5HKLA 4DKXA 3C8UA 4J75A 5C34B 3VO2A 4AMUA 4N01A 2OWDA 2XOXA 2K6GA 5EKUA 5KS2A 2PS1A 3KLBA 1ZNQO 1C3OB 3C7DB 5HQJA 5DW0A 1IN1A 3DWGA 3NASA 2YRWA 3TGWA 4LKOA 3RQIA 5B12A 1LDYA 3CNOA 3RVNA 3CRW1 4FW8A 3DL2A 1R18A 2W8BA 4CKBA 4LRXA 2BBOA 2F2TA 3RM3A 3RUAA 5J2UB 5U9CA 1NDUA 1ZS9A 3DUFA 3ZG6A 1YFZA 4J90A 1MJHA 3C2QA 4QO8A 4AXBA 4L5JA 1FDIA 1PS0A 4JLWA 5E2IA 4MS4A 3SNHA 3KFLA 4FNMA 4PR0A 1ZAYA 4NC9A 2Y1WA 3CZCA 3GQBB 2HYDA 1Y9EA 3O38A 1CUUA 3ZCTA 5ADHA 2IEDA 4XWWA 3BMQA 4K3UA 1TAUA 3KJZA 1O54A 1UJNA 3EZ2A 2V7EA 5HUQA 4HLUC 4WLVA 2Z95A 5D8DA 3IMKA 3L6BA 4U8GA 5EJGA 1BE6A 1DJLA 2H0RA 5LD2B 3HP4A 2V7GA 3II6X 4H0NA 4Y2RA 1QYWA 2IOQA 4LMPA 2F90A 1NN0A 3B7GA 3HWX1 2ZBPA 3F5DA 2O54A 1EP2B 2BFEB 3KJXA 3LPMA 5AR1A 5F7JA 2DVMA 5FH9A 1NNI1 1Y6JA 3D3JA 3FI0A 1T36B 4YV7A 3OZWA 1T4BA 5TRTA 4EYGA 2G9UA 4RJTA 2YR0A 2IVFA 2W8ZA 4TV9F 3SDSA 4N48A 1P5FA 4U7WA 1EDDA 5TMDA 3E9RA 1Y3FE 3AV0B 4TYPA 3QVVA 2EFEB 3R0JA 1LI5A 2YNMD 1I4LD 1OJLA 2ACVA 3OT5A 1J1UA 1IOZA 4GXNA 1W6UA 3UJCA 3ZZ0A 1EEHA 1PFYA 1Z0IA 3CEMA 4KWHA 3A36A 4JBGA 2ZIAA 2MOKA 1UZMA 1C7ZA 2B7BA 2CMFA 2YNMA 5AJTA 1P3Y1 3MQ2A 1U7WA 2Y68A 3WSTA 4OYLA 1WNTA 4LZNA 3FPJA 2HMVA 2VPPA 3ELYA 2G07A 3GUHA 3PGVA 2EJWA 3PUHA 2NO6A 3QNWA 4QU9A 1SG9A 4E5YA 2W6OA 3KYCA 4ZAXA 1OVGA 3ETGA 3M34A 2QY9A 1K86A 2D7CA 2WJ3A 1L6RA 3O92A 2DT5A 5CFRA 3CEAA 4G1VA 1ND6A 1SKYE 1RAFA 4EG4A 3U4QB 4OL9A 3KG2A 1RZRD 5IBPA 3HY4A 4C05A 4CQLB 4PYJA 5INTA 3Q3IA 5AESA 2DPHA 1X8LA 2B4AA 4X1IB 4OFBA 3JARB 1QCYA 2QTVA 1AG9A 1JA0A 1MRSA 2DPMA 3HSSA 2O3QA 4GI5A 1RZRA 4JLJA 4MEBA 3LGSA 4MYTA 5ALFA 4C4OA 3IUYA 2C7RA 3UMSA 1YZGA 3KL2A 2FP4B 4DQDA 3RS4A 1E0AA 1JE0A 1J39A 3Q6IA 3TAHA 3UGQA 4YRZA 1CS0B 3AF1A 2B2CA 4NMHA 3P32A 3GJSA 4NE2A 1HYQA 1KH1A 4PYKA 3U9SA 5TLSA 2N42A 2GF0A 1SCUA 2IS4A 1GQRA 4YAKA 3KBOA 5LDHA 5CNIA 2ZR0A 4IGEA 4LQ4A 2C8JA 2YJ4A 1TQ2A 1M2OA 4W7IA 5IDVA 3W3AD 1O0CA 1G5PA 2E4WA 1L7RA 4J29A 4LY0A 5BWMA 1XRRA 2Y1DA 1HTTA 4ND8A 3QX9A 4J8PA 3RC2A 5KKCA 1JDZA 4KE6A 3UG7A 2WV7A 3G2HA 1TCBA 2CLFB 3QLTA 1ZINA 4BCCA 4DMFA 5JASA 3W3AA 2DBQA 2ADMA 2AC2A 4MCHA 5AJHA 3QVOA 3P9KA 4GYKA 4NJMA 3VMFA 4MZXA 3BIJA 4M1ZA 4TT8A 1IHDA 1XZAA 1GA6A 2E4ZA 3DBLB 1K8XB 3M6FA 5FEMA 2CLIB 2WMNB 1V96A 4I99A 2WB4A 5E2BA 3SF8B 1NYQA 3HWRA 2NXJA 1T15A 1N7HA 5IUNC 3H5TA 1QGUA 1TW3A 1OFIA 4Y1FA 4I1IA 2A88A 5EGSA 4WX2B 4TYQA 3T5AA 1ZVVA 1UPCA 2I22A 3IAS6 4TLDA 2VT2A 4UUQA 2YIVX 3ZDBA 4GUDA 1RI5A 4FYIA 5EPOA 2YCLA 5F3WB 5ALUA 1RU3A 1E1CB 1ZXXA 2RGDA 2ENUA 2J9FA 3PHLA 4J2OA 4R9UC 4RLQA 2VUSA 3FYUA 1UJ5A 4D3SA 3GLIB 4M7RA 2XTNA 2Q9CA 5E0KB 5BNWA 2XH8A 2C0CA 2IUSA 2BGGA 2MYTA 3D6VA 3OZCA 4P5EA 4R2LA 4JOBA 2GZMA 5EJIA 4XXHA 1RXUA 1P4RA 3ETEA 3SC3A 3RBVA 4OBXA 4QJ4A 2HO5A 4EEZA 1OFGA 4MARA 3BICA 2IGBA 2ZRMA 1Y5LA 3R2JA 3DZKA 5IK2D 1VHDA 2DPYA 3LDHA 3W8RA 5LP1A 4CLDA 3WRVA 1JFFB 1YV9A 3ITDA 4QSHA 3TW8A 1DS6A 4OIFA 1QZTA 4QEDA 2KPOA 3D1LA 4N9QA 4BIIA 2PTGA 4M9RA 5AFSA 4MW7A 2R751 2WSMA 1DKNA 3MEQA 4WOJA 1Z45A 3RO7A 3O4JA 5HZHA 3V4RA 5CJ2A 3FCAA 2W37A 3AXSA 4HH0A 2VSQA 3A26A 4UTOA 1NQUA 1YBFA 5FNZA 4DUZB 4TVKA 1PR2A 2VNJA 4FFMA 1FCJA 1FXWA 1I3NA 1T29A 2XAUA 2ZS7A 3BTOA 3C1TA 3QXHA 2YKGA 1GAWA 1ISIA 2IIQA 1B2LA 2R84A 3MA0A 4GP6A 4GVXA 1KJZA 4FFRA 4L73A 3W2HA 2AZMA 4DS3A 3MCVA 3UUEA 1JQEA 4GOMD 5M29A 2B98A 1WEHA 3F3KA 5L3ZA 5JRDS 4UJ3A 3UAGA 1JKXA 3ZK7A 1YULA 3E22A 4QRDA 3CYFA 2HF8A 3L06A 1W34A 4Z0TA 4AF6A 3K8ZA 5JY6A 3UOGA 3T9DA 1BN6A 1P7VA 1PGPA 1G8JA 3L1UA 3ESBA 5HE8A 3GEMA 4A2QA 1PU2A 1SXIA 4OB7A 5K8TA 3IE0A 3P27A 4HK4A 3R3HA 3JYPA 5IASA 3LPDA 3U7HB 1TO2E 1JKIA 2OD9A 1AQUA 2JFHA 2PVSA 1PS9A 4PLVA 4FCCA 4QARA 5I01A 4NFYA 5L4SA 3DL7A 1DP4A 4RNCA 1AKVA 1H8EA 4TPKA 4P7BA 1OY1A 4U0KA 2ZR9A 1ZUIA 1T5SA 4UEOA 1YFJA 2FLWA 1GPNA 1I4TD 3BILA 4H3KB 4MWCA 2O2GA 1FBNA 4HGZA 2OFXA 2P9YA 5C4IA 4U3JB 3J80A 2QRMA 3GPDG 2YH2A 3ZJVA 1V2GA 1PT5A 2MINB 3JY6A 5A1JA 2PXXA 2AJCA 5EZYF 1FUUA 2PPVA 1U4SA 2FDXA 1YS2X 3MCUA 3QU4A 5FPSA 4DV4B 3ZE7A 3KKLA 4KDFA 4B2PA 5K6TA 2HHCA 4PG7A 2BCEA 2DAPA 3B1VA 4DC1A 3O8OA 5H9VA 5KB3A 4MPJA 5IVHA 4J0DA 1MDBA 2R5FA 1T2VA 3T7EA 4HWPA 5J4KA 3K05A 3DAHA 1XD2B 2FPMA 3UJ8A 4J7UA 1LW7A 1MW9X 1DU4A 5FFNA 4RO0A 2VPTA 4EKIA 1RYEA 2GD1O 4Y2SA 3I5AA 3H7IA 1FPQA 1SXPA 3PPIA 1EFCA 5F35A 2C7VA 2NGRA 5B37A 4YDHB 2I6GA 3TE6A 5GV7A 2CVZA 1J97A 2Q3MA 1QLWA 2G6BA 2I33A 3JD3A 4L72A 1TUBB 3NHPA 1KMQA 4JYMA 4RBNA 1YL7A 3H9EO 4LPKA 4GLFA 4G1BA 4KSBA 3K0CA 4XKJA 3UO8B 3NOXA 3EG9B 3INNA 1G3IA 4P82A 1ZOLA 2H92A 3O73A 3G7SA 3R41A 4WUTA 4Z9XA 3HN2A 3SF0A 4EJSB 2IXEA 4TTVA 4EK9A 4QU5A 1HDRA 4J0QA 4BP1A 1BQ3A 1ZQ9A 1T8TA 2GM5A 3D31A 3EGVA 2V58A 4ONEA 2QRVB 4GZ6A 1FZTA 5EUBA 2OZPA 3OEWA 4D9CA 1XLVA 1O8CA 3UF0A 4RWZA 2XXJA 3TYXA 4IJ5A 3IP1A 4QA9A 1Z4KA 3EZYA 4CIBA 1RI3A 3L0YA 1Z6TA 3HR4A 2I6FA 1NVKA 1PD1A 2AFIE 4GMDA 3QWBA 1YCFA 1T4CA 4BGIA 1SY7A 4B3CA 1GXSA 2VUUA 2ZTSA 3H2HA 3FG9A 3N39C 2IP4A 2IOFA 1TFUA 2RB4A 1XQXA 5EE9A 4ZV9A 4YUWA 2I3ZA 3TRJA 4A5SA 5DN6D 1OAKA 1SUCA 4FLMA 5FPKA 1UBTS 1JNYA 1T3ZA 2QTBA 1JQBA 2LCQA 1Z4LA 1UJ4A 1ES9A 3PXEA 1ZZGA 1NBEA 1PJQA 5DP1A 5ILGA 4IZIA 1NLMA 5DN6A 4KXVA 2QTMA 1WUTA 2W2MA 3VPSA 1XZKA 2W6QA 3D1JA 5DYYA 1XVLA 5KEIA 4QM7A 1F2DA 5K2OA 3HJCA 1M83A 3KCNA 3O2JA 5BN3A 3EYAA 4P3PA 3FVQA 3HCOA 1LPNA 3ZI0A 2LBPA 1I2MA 4M8SA 4LE0A 4M0MA 5DHFA 4IEIA 3VNBA 4YI3A 3QXCA 2OHFA 3PNLA 4NHEA 1X14A 4PNZA 4B6RA 3WLHA 5EY5B 2WILA 1GKLA 2WP0A 4K81B 5BV7A 1CXZA 2CEKA 5E7IA 3R8XA 3ELUA 4BFXA 1FB5A 3F6EX 1MU0A 2PUWA 2P75A 1KI7A 2XIJA 1QVWA 2XBUA 1SHLA 3UKOA 3L4JA 1D2NA 3O7MA 3GMTA 5CHEA 3O95A 1Y6GA 3IV7A 3G6KA 2ZUBA 2ZSIA 2IDJA 4HPXB 4M60A 3A6EA 1QGDA 5JDCC 3RARA 4JI3B 1D04A 1Q92A 1SEVA 2CHUA 2V5AA 4U2EA 5K9ZA 2PZLA 5LJIA 2HMWA 3ZDFA 3DEJA 1ZVKA 2OZVA 3CKYA 4NCKA 4FZ3A 1H22A 3GELA 1YA8A 4QJ5A 3JALB 1M2HA 4IPTA 1ORHA 1PWHA 3ZJ5A 3WO0A 2NP6A 4IINA 2OSBA 1MHTA 1AF7A 1IU9A 4D0NA 1M6WA 1U7UA 3OO1A 5J4VA 3DVRX 5K5EA 4C2AA 3ZQ4A 1F8GA 4MA4A 1II8B 2OHIA 4P8RA 4UDNA 2Q5JA 5C1OA 4CV3A 4AI6A 4GT1A 1VE3A 3LPNA 3IT1A 5A1TA 5JS7A 1U2RA 1BAPA 1N3BA 1T8SA 3KFXA 3MYYA 4P31A 1CZOA 3ERCA 1B26A 2MSLA 3A9TA 3QV2A 1GADO 3HB7A 1WSDA 1FXSA 3G6WA 3E3OA 5BOSB 3DVQX 5C18A 2XZOA 2ALJA 2ROQA 4C88A 3IVCA 1JSCA 4MS1A 2X6RA 3RKRA 4YLYA 4X85A 3NDJA 3HMKA 1X74A 1QS0B 4QU8A 2FDCA 4QEZA 5BQPA 1DJPA 1K8YB 3PQ3A 3L6OO 4RA9B 3ZHRA 2WU1A 3HSYA 1E4OA 3I1FA 2QZ9A 1RP7A 1N2CB 4I3HA 4BNNA 1BROA 2AHRA 2O8NA 2BMEA 4WACA 4D96A 3F6PA 2OHGA 3PGA1 3RYCA 4KR7A 3Q0EA 2XAAA 1ICIA 3TSCA 4A0RA 4KVFA 2I7CA 4D57A 2Q0QA 1CV2A 3VDMA 5K0SA 3IPXA 3BH0A 3FPFA 4NZNA 1B23P 1GFIA 1ODCA 4YUVA 5SZKB 5LYJB 4MW2A 4FP9A 2RMKA 1EHCA 3WFJA 4YR9A 2BEVA 3JTEA 3MPOA 5HKBA 1JAXA 3EVTA 4E4TA 1GCIA 2IW1A 3DYBA 2QZSA 3ND6A 4G5SA 4ZO9A 5C37A 5KX5A 1G66A 1YI8A 2B9EA 3ILVA 1G7RA 2BFDB 2FYTA 3G5LA 2Q4OA 3AONB 3OTHA 4HH4A 4BAUA 2HHLA 2RBKA 1D03A 1SD5A 3QOYA 4MVJH 3KHSA 2QL9A 3T54A 3TQQA 3EUFA 3OOWA 4GX1A 4DTIA 5B3JA 1IM5A 1Q95A 3K7EA 3RADC 3L0OA 3ZD7A 5K8UA 3DAGA 2ZYGA 4EMUA 3G49A 2RHDA 3NNNA 4K9QA 4CR7A 1EUQA 1NW7A 2NU6A 5B1YA 5DO9A 4LGCA 2QRUA 2VI5A 2B3DA 1QH0A 1Q1EA 2XGJA 4AURA 1KEPA 1VBMA 4TL7A 1G5HA 4YMIA 3V4FA 4HX5A 2HJGA 5CVEA 4RVFA 4JLNA 1QQ5A 4JVSB 2O7RA 1RZ3A 4ZI2A 2IK8A 4RY8A 4PO1A 2GCIA 2JLQA 1RP1A 2FLVA 2MSNA 4Y2YA 4Y1RB 3GVXA 3E7WA 4GYJA 5DU2A 4EFMA 3AI3A 4RXTA 5JJKA 1WKVA 1L4HA 3GYBA 4ON9A 4ZVKA 1CULC 2FFJA 2WYWA 1ZD3A 4MHOA 5BWCA 1NR5A 1VL6A 1E61A 4IEFB 1OPRA 2O1SA 3BIFA 2VF8A 1TKRA 3JQDA 3WTCA 5C7YA 2EIHA 5I6DA 4JU8A 5DN9A 1BN7A 2PUAA 2Q4BA 3DHNA 3O9VA 3QFTA 1DEOA 4GP9A 1Z6GA 4Y2VA 2IBMA 2W48A 3RUEA 3W34A 3HJFA 1Q1AA 2IHKA 2XGMA 2JHPA 5LYJF 5KHAA 1C2YA 4M4SA 3EPPA 5DASA 3RIHA 3P2JA 4LNUA 1RACA 4BNWA 2PL1A 2C8KA 4PCVA 2VATA 1AK1A 3ESYA 3ITKA 4N8DA 5DYGA 5H4GA 3AIMA 4AICA 1H94A 1RJWA 1VBNA 1WUHS 9LDBA 1EX1A 2QD2A 5FADA 1BHQ1 2IWHA 2H85A 5JH7A 3H86A 2VJNA 4K5QA 4YP1A 2WIAA 3I09A 5G1NA 3ADDA 4M46A 1QU3A 2G08A 1A77A 1V3UA 1I4EB 1U8ZA 4LRYA 1F60A 1WM1A 1UP6A 3PZRA 4LHEA 4D3FA 5BPHA 3PR3A 2C54A 1F17A 1JXOA 1KYTA 3G0CA 1L5KA 2QQ0A 4KQMA 3U3JA 3V80A 5BSWA 3P4UA 1E7QA 2PKQO 1I3CA 2GN6A 3THXA 3MOGA 1QIFA 2DZDA 3GCGA 4JJ4A 4OXIA 2V6GA 4BKPA 1W76A 2XF2A 4Q9AA 2YWDA 3FSGD 4L50A 3S29A 1P62B 2XVZA 4OK6A 3PL5A 1KZ6A 1VHQA 2AR7A 1G7TA 4OLBA 1NWCA 5FI1B 5J3JA 1N8NA 3GUVA 3MGAA 5BYAA 1GN8A 1NRIA 1RWQA 1EVQA 1P9WA 2IYYA 2EV9A 3FSGA 4F3CA 1E92A 1WMDA 2A1UA 2W2TA 3G2PA 1UPBA 2H1RA 3HLTA 3PQDA 4MRVA 4F6RB 5JFGA 2DETA 1FYXA 2OGSA 3Q12A 1EQAA 4QUEA 1R0KA 4Q9HA 2NP7A 1VKOA 4YO8A 2DR2A 3LPCA 4EUKA 2I6UA 1HDOA 10MHA 1OB2A 1SBIA 3ULKA 4KXXA 4XUGB 3DZDA 4HN4B 3MJDA 2D0IA 1G41A 1NM5A 2BRUC 2G1JA 3D02A 3QUCA 3O8BA 2QXTA 2ZIXA 3NT4A 4W7SA 5TMPA 3OQIB 4V03A 4AS1A 1FSFA 3OZTA 5EUCA 4TMZA 1D5WA 1YQTA 5EMNA 2GBPA 3HXQA 4HRYA 2PLFA 3PE6A 3BB4A 3U09A 4A0QA 5CPFA 3TQSA 3IDZA 4KMRA 4YS6A 3Q5GA 1DOAA 3ENKA 5ABPA 1XYYA 1CD5A 2YWHA 5BMVB 2DRIA 2W2OA 3A3YA 4W9RA 4BZZA 4BO6A 3JQBA 4K6KA 1W4ZA 4IVQA 4NEGA 4P92A 3QEBZ 2CXHA 4MKFA 2HLNA 5FTMA 1LK5A 2YQ4A 4QTYA 2QIPA 5KTOA 1WETA 2GRUA 2J0UA 3FDIA 2NNWB 4LJYA 1XEWX 3KTDA 2DULA 5IC5A 5T64A 3QKWA 2CVOA 3IR5A 3IB3A 3IJPA 1DQYA 1LFAA 1GZ4A 1RRVA 3QMMA 5TGTA 3IRUA 3PHCA 1KQNA 1FUEA 1ADFA 1RWKA 3D4IA 2G0TA 1K92A 1PZHA 1VGVA 4MYCA 4ML3A 4UD2A 3DR3A 3TRDA 1CQZA 1YA6A 3CA8A 1PJAA 3NWJA 2UYCA 3P9SA 2GI4A 2G06A 3TFOA 4M2LA 2C4HA 1AB6A 1UMBB 1XG5A 4U2GA 1N78A 3WIVA 1JYFA 1GZSA 3AVPA 3EGDA 5KWSA 2J31A 2VHWA 4F8EA 1X15A 1Z8NA 2XE7A 1I2AA 1Y34E 4NXMB 1GG8A 3ZKWB 5IBQA 3ROTA 2UUAB 3LP6A 4J6FA 1CUFA 1X1BA 3Q8WA 3SKYA 1CR6A 2IOHA 3EXEA 5IT5A 4CCYB 1L5LA 4YRDA 3SCZA 5D1HA 1Y4UA 1SEPA 1W5TA 4ZXFA 1QHNA 5ALPA 1EX6A 1MKYA 1EBUA 2Q9BA 4HLQB 4FFWA 2WAYA 3OPQA 3WXMA 4XGKA 1MAUA 1QU2A 4L2IA 2G9ZA 1VC2A 2Z3ZA 3GT3A 1A9XB 3NHZA 4IICA 3BEDA 5C8YB 3T3NA 1THTA 1MAWA 5LP6C 1YB7A 3JSXA 2J87A 2ZANA 3GPLA 4N6OA 4RD6A 2FPUA 3DO8A 3TLKA 3K6SA 5HIIA 4DV2B 3KX2A 3U4HA 2XDWA 3EVGA 3G9TA 4YMHA 1JT2A 4UUBA 4B46A 3LA6A 1VLHA 2NVWA 1V16B 2H4YA 1FFCA 3HUTA 4IMJB 2MYUA 4WZBB 2C61A 3ZK9A 3U19A 4YYZA 4YCLA 4WXYB 3TRIA 1NUAA 3JAKA 5ED0A 3T95A 3WYDA 5IPFA 5AUPB 5JU6A 1Y42X 1HWYA 3ISTA 3JZDA 2ZYSA 2HLDD 5AKJA 4YX9A 2ZDQA 5M5BA 4BC1A 3Q7TA 4B17A 3HJHA 1PFGA 3BFKA 3AOGA 5G41A 4XSVA 1NT2A 1SB8A 4YRPA 1GGNA 2DP4E 5D85A 1DEKA 1NNEA 1UFOA 1DUSA 1H1DA 2C9OA 2O52A 3H9CA 1KQ3A 1ZC3A 2GVNA 1QRDA 1J8MF 3OE1A 2I2CA 4IYJA 1O95A 3HJRA 3N8GA 4K1LA 4K88A 2N75A 3EXAA 1ZQ1A 1DCTA 2DTEA 3DKKA 1RD4A 3ZNOA 5CNKA 3UCXA 5KKNB 5JYBA 2WF6A 5KHOC 3R0XA 4FVTA 4HMOA 5G3YA 3KWLA 5BQFA 4NG5A 7ADHA 1UOPA 1KMMA 2X0IA 1YMQA 1GAXA 3ZWKA 2EGUA 3LOUA 4MAMA 4B43A 5C8YF 4N7JA 1FDVA 3BM5A 3ROXA 1PLLA 3K0BA 1CQJA 1XF9A 2HLPA 1C1DA 5EKXA 1A9RA 1GPDG 3W7BA 1T0IA 2C94A 4RFVA 1A5ZA 1TCVA 4L5AA 3WHIA 3CGGA 3EEOA 4KR6A 4DDWA 3PFBA 4PSVA 3CPJB 3LX4A 3AZPA 2PBRA 3S5UA 1QP7A 4EFNA 2HAEA 2A0UA 2XYPA 4RACA 4B09A 4MVCA 3GF4A 5MN4A 1VI5A 4W5NA 1QB8A 1YC2A 1GTZA 3VSDA 3U4DA 3MS4A 4Q3AA 4R2WA 1A9TA 1OX6A 3I3SR 5FCDA 1UXIA 4YDQA 1VKNA 4F97A 3KEMA 3P9CA 3N76A 3OFKA 3AY6A 3IE1A 1ZH4A 4N3AA 2GZHA 1TVKA 4TXHA 4ZCPA 2B3TA 1PJ2A 1VG9B 1ZOPA 4I5GA 1VE7A 1ZK1A 2D2EA 4HQFA 2A0KA 3M6WA 4WJKB 2BUBA 3IQGX 5B7GA 1WV0A 1Y8QA 4HDOB 3B36A 4IXDA 4E13A 3RAEC 1E9SA 2BLLA 3SKXA 1BCSA 4S1WA 3T61A 3RU2A 4DLPA 2G88A 3MUFA 1Z22A 1TF2A 2OV8A 5FBLB 2YXNA 3L8FA 4QELA 1LDGA 2AX4A 5EIFA 2IPMA 3WBKA 1E6MA 4N41A 1JEAA 3KSUA 2CMKA 3PWSA 4DJTA 1LLQA 3HR8A 1YQ9A 4DLBA 4ALJA 2FUNB 2I7VA 2UV8A 3QSGA 4D0GA 1MABA 1NR1A 4F21A 7AT1A 2XCTB 4KIWA 1L4YA 3FX2A 3GBSA 2GZDA 4RFSB 3Q1LA 5C8XA 5ENDA 1NBMD 1GP2A 2BEJA 3MCAA 3TL3A 2C77A 3PNQA 3HGQA 2I4OA 6REQB 4P7GA 3E1GA 3L1HA 3IEKA 2X4DA 4M9UA 3GX1A 1JPNA 4QYXA 2O23A 3K30A 2A5LA 3CO0S 4W1PA 3GG2A 3VPXA 1NBMA 5A5EA 1G9XA 2VR1A 5A2QA 2X14A 4GR4A 4RY9A 3FGNA 2C58A 1SOVA 3QF4B 2GOYA 4KQJA 2AEJA 3LHKA 3NNSA 4V3CA 2IPAB 5K05A 1GNVA 3E7XA 4W8OA 4II7A 2YYZA 2WG0A 3FUUA 4TLEA 3RVKA 2WKRA 3UA4A 2I7XA 1SGWA 3D3NA 3KUCA 5TVKA 4BO4A 4DWOA 4KOAA 4XWYA 1R8JA 3LUAA 4CMJA 4D4IA 4FFNA 3WJ1A 5CVCA 2YOGA 1TT5B 2LKCA 1A8QA 4DAOA 5AUOB 5FORA 4BVBA 1BKDR 1Z17A 1W87A 3FPAA 3I2KA 4PANA 1RS0A 2D59A 2A8YA 5CLIA 5FA5A 2VJMB 4ZOAA 1X77A 1GDDA 2LCFA 1UMDB 1FFXB 4I9NA 3GYGA 5CYFA 3LDGA 3NCTA 1W581 4FEYA 5TY0A 4CMAA 2AXQA 3DCNA 3OG9A 1XEFA 3NGMA 4MHTA 2OXEA 3CR8A 1UK9A 4FXPA 4HATA 5BRNA 2VYVD 1WSBA 5LOVB 1V1MA 2AN3A 2ZWIA 1RKUA 1R0YA 3RSCA 2ZPAA 1ORWA 1LZLA 4JOCA 2IUYA 4LXHA 4NZPA 4XYEA 3ZWXA 1DKQA 2GBLA 2V8BA 3KYBA 5ALNA 4A8JA 2VYVA 2W42A 4Q3LA 4LMAA 1QK3A 4TTSA 4BTVA 3U1VA 1QG2A 1Z12A 2WLTA 4WFQA 3A1TA 5JANA 5CR9A 1Y9AA 4Q19A 3TDKA 3NIBA 5TNXA 3D5TA 1ICEA 4PQYA 4QDZA 4YP5A 5DBIA 5E3JA 3W8DA 4Z7NB 1AC5A 2NQ2C 2P9BA 3LBAA 4PIPA 1VIMA 1VFPA 2D2FA 2EEPA 3AI2A 1W29A 3O1LA 4XGRA 3STYA 4A82A 1HKUA 1L7PA 3EZXA 3IX7A 2I2WA 3FGPA 4GECA 5F12A 4OQPA 4LTNA 4RL4A 4PLWA 2ZJYA 1OBFO 3LT4A 2X7JA 3OQJA 4OLFA 2ZOSA 1T1RA 1YONA 1QE5A 2DWUA 2QD4A 2YYSA 4XJTA 5G1PA 2VDQB 2LIVA 4N39A 4Q39A 3W5HA 4A10A 2WUEA 3E3NA 3CRVA 3OCJA 4Y2QA 3TTVA 1AKTA 2AN9A 4Y30A 1E1DA 5L3SB 4M1EA 3G5MA 4UE6A 3VR5H 3W0LB 2CXPA 3X1XA 2WU4A 3RC7A 4MKIA 4MXDA 1HOXA 3IQDB 3H1GA 4Q9LA 5ERXA 2ZB8A 1XL1A 3MUNA 3S5JA 1LCIA 2JKYA 3V2UA 1QDLB 4EJFA 1GZHB 5AXAA 1N2OA 4YAFA 4D82A 3VH2A 3VKUA 4KLRA 1LV8A 3L01A 3ZBTA 4XWTA 5IKEA 4BMCA 4EHHA 1N0VC 4YY3B 2QD1A 1Z2DA 5J43A 3KVVA 1E9AA 4P4GA 1MO5A 1P19A 1WNFA 1ENOA 2NTNA 4Q6WA 1JG6A 3EEBA 3K4PA 4X95A 4DQ0A 5K45A 221PA 5LOVF 5K0LA 3I0ZA 3PJEA 4MUMA 5P8WA 4EY3A 5I9LA 1JE1A 3S8YA 2P40A 1CB0A 1ULHA 2ORVA 1E5XA 2W93A 2X0KA 1K9VF 3LCMA 4FHZA 1G63A 1QHXA 2LTAA 3COVA 3VYUB 4EQ6B 1Z39A 2WZCA 1UXKA 2XITA 1EDBA 1NI4B 4RA6B 4WADA 3JQCA 2VSNA 4XM1A 2E6KA 1Z0FA 2WFLB 4WN9A 2DF8A 2YYYA 3ZV4A 3EWNA 2R47A 5EEGA 4M76B 4RMHA 4EGSA 2ZJAA 5F23A 1Z5WA 4J2TA 5SICE 3DMFA 1SOAA 3PTZA 4MUHA 4IKEA 3EXIA 3K0EA 4UNIA 3PXCX 3T9EA 1U2GA 3QMPA 1FYEA 4XFKA 4LFCB 3P9XA 4UU7A 2X9LA 1EDEA 1VLMA 4MROA 1MZVA 1N6OA 4R3UC 13PKA 2EQBA 2FR8A 3Q5DA 4P0QB 4Q3DA 4NCAA 2YQZA 3UUWA 3C97A 4BEJA 2FWJA 3SBEA 4ZHQF 3ABOB 3AIOA 3HU3A 2CUKA 3IMCA 1XGKA 2TYSB 4HYTA 3HZRA 2IHZA 4WZAE 3RB8A 1U5BA 2BCGY 3VJLA 4X8HA 2MCFA 1NN3A 3HZZA 5I51A 3MMSA 1G1AA 3TLYA 1CUJA 4PLZA 3MJRA 4WLNA 3KE9A 1D2HA 1QF6A 1VSTA 4QG7A 3E9YA 3LXMA 1P45A 3BXEA 3LKDA 4KO8A 3V1KA 2J9RA 4FDVA 4ENPA 2YNMC 2PX5A 5I7RA 4JZYA 3NHJA 4IX1A 3FTEA 3I32A 4I19A 3TXAA 3DQQA 2CHGA 3HNRA 4AZ3B 2X1LA 3DMGA 3IPYA 5F98A 4YCJA 2GAIA 2K4MA 4YT5A 1MTZA 2F1OA 3PV0A 4JODA 2HA7A 3UB4A 2I1LA 5ALXA 4E33A 4LBYA 2GQ0A 5HOQA 3D0QA 3BSFA 4W5JA 2FR1A 4Z86A 4D6PA 4JI7B 1X3LA 4RH1A 1MVOA 5BSEA 2R4UA 3FMGA 3ILYA 4D9HA 2YMMA 1E7YA 1LDNA 1S4MA 5DTMA 2FSGA 4NBLA 4YP9A 3C8HA 4QUJA 4E51A 2XNKA 3ORQA 6Q21A 1A4RA 1WZIA 3N8NA 3HL0A 1RPNA 1FNBA 5EZ5A 3SXJA 4TYWA 1JEQB 2OAEA 3O93A 4K6OA 1P4GA 2J7PD 2JH8A 2YOFA 1UBEA 3OCWA 3N9IA 5BSGA 4FQ7A 2ZYDA 4QE3A 5K8IA 1U02A 4YDRA 4GM4A 2C8LA 3VBEA 1OCEA 1UMCA 5E6RB 1CZUA 2IHBA 1M34A 3CX3A 2J7PA 4PRYA 2HSJA 4MV4A 1KDZA 3LS2A 1CEXA 2HNAA 1UPUA 2BIFA 1LV7A 1KDVA 2FWRA 3VISA 1XLUA 2R44A 4BCDA 6ABPA 4J9VA 4I1PA 3BJIC 3O4IA 1U3WA 1K2VN 3D7LA 4IOLA 2LRHA 1VL8A 3C85A 3KE8A 3L8DA 2OMEA 5IARA 3ANSA 1TF7A 2Q4EA 4TRNA 1PJCA 1AV6A 2XYRA 2C9YA 5ELXA 3FBTA 5FL7D 3WJ7A 1J2YA 3UMGA 3GUZA 5BV2P 3IRVA 1JYSA 2CFOA 1CIPA 4BKRA 3ZWDA 3RFVA 1FW8A 1X9IA 3DQPA 3WLNA 2VRCD 5EXXA 5FL7A 3UAVA 3WY9A 1C8KA 3IC5A 2ZDGA 4WI1A 1B3RA 2P3QA 1CUEA 4LPSA 5CRIA 4AAYA 5EWJB 2EKDA 1SUWA 1E94E 3D5EA 2PN1A 4BKMA 5CM8B 3L7CA 2B20A 5C1DA 3H5VA 4YCSA 2FMTA 1XLWA 2W58A 4KGZA 3C6QA 4BB0A 1P2VA 4Y2PA 2ZRPA 3AB3A 1QBKC 4C7JA 2HX1A 2OLJA 3N2LA 2HPVA 3FNHA 4ZC8A 5H82A 5KAPA 2ZS8A 3VPHA 2B1IA 4BL5A 4GC9A 2NUPA 4DLLA 1JP7A 1P2BA 3V97A 3WOVA 4LG1A 3FYUC 2VHEA 3OT4A 4OP1A 4NK5A 3PFWO 5AWFC 3CKKA 3NRCA 4KQ9A 1HURA 5TVGA 4B71A 2DT8A 4J1TA 4D5GA 4DWWA 5IZCC 3GMDA 1FQKA 1GYQA 1YNOA 2JEZA 3GFGA 2WG2A 4ZO7A 3ZDDA 1W73A 1AKEA 1OGJA 1L1FA 3WICA 4DLKA 5CEJA 1EFDN 3I9KA 1YZNA 4X61A 2H59A 2HWKA 2QL6A 1DAKA 4X84A 2J07A 4BLSA 1CNFA 4MAFA 1N6RA 1N9GA 1T34A 1F8FA 3D7NA 1GRNA 4XJSA 2BD0A 4C1NA 1B7GO 2G9NA 3ZJUA 1CP2A 1YUMA 3Q88A 4WZAA 2WIJA 2Q9AA 2ZRCA 1G20E 4MW4A 3WNBA 1UM9A 3JU3A 5JCOA 3HBLA 3W1EA 4Z1MD 5HA5A 1UH5A 1PEDA 1DAFA 4H7DA 3E5RA 3ZQJA 1NQAO 2BMJA 2BC9A 2J0VA 2XUZA 3OWHA 3BZBA 3K0HA 4CI9A 4ROSA 3TBKA 2W22A 4H60A 5A02A 2HBYA 4ZI7F 3WL8A 5BWLA 1MC1A 4HP8A 2ZUFA 1FP4B 1LVUA 1TM7E 4N5IX 2GRAA 3AVOA 2VRNA 4TMWA 1BU5A 2O3SA 3P1JA 2AUMA 3KTAA 3OZ7A 1IZ8A 3SFTA 4QIHA 4HSGA 4DBLE 4IIHA 3H5OA 1Q14A 3E15A 4OKIA 4G2TA 2EYUA 3FPSA 4MW6A 1OR8A 4EATA 3N07A 2A9KA 4Y8VA 4B35A 2CMGA 5G4KB 4M1MA 1RCTE 4LJKA 5JSZA 3AF5A 1EVZA 2Z08A 1LJUA 3PKIA 3S1AA 4G1FA 4UTVA 3ANNA 5KYTA 3CNQS 4JVNA 3E7DA 4IJQA 3HKCB 3DONA 1A98A 3SYMA 4IHAA 3ZDZB 3ZTWA 2XTMA 2OZEA 3LC1O 1QTRA 4H3HB 1AS3A 4TN5A 2P5YA 4CM4A 1DRVA 2BTQB 3UPUA 1U1FA 2WWIA 1NKTA 3ZCPA 1YK0A 4DM7A 1LC0A 1YZKA 2AYYA 5FIUA 2HN9A 4C7VA 1U0JA 2J4DA 4P32A 1HORA 1KJJA 2XIQA 1AN0A 4Y6LA 4DZRA 3R7WB 3RBZA 1ABBA 3EUEA 2WVGA 4F5ZA 3W4KA 4ZCLA 5TSDA 2G76A 3E2IA 1FDSA 2FQXA 4PAGA 1HC7A 4B6EA 4DR4B 1HQDA 4LJLA 2IEIA 3U7JA 3A2KA 1T9DA 3BFJA 3H84A 5HIJA 4ECAA 4G89A 3D2AA 3TPFA 5KYYB 5HS6A 1VJDA 3NT2A 4FWBA 4N6GA 2AQKA 5FWAA 1ZY2A 3KU4A 3O8LA 5E4JA 5CB6A 1AH2A 1J6UA 2ZJ6A 4CL8A 3SBDA 3V55A 1MO2A 2PFKA 4MUKA 1TT7A 1VG1A 3LQYA 4BO5A 3TSAA 5ICEA 1XQ9A 1C80A 2GCOA 1YS4A 3QFHA 4P3YA 4RGBA 1T2DA 4J91A 5JPIA 3RFUA 1Z2OX 2Q6KA 3UHJA 4ZT6A 1N6NA 1M2EA 2INGX 3HKDA 1MO3A 2F43A 3EA5A 5CDFA 3S68A 4RTLA 1EWYA 4GQBA 3EIWA 3SQOA 4GZMA 3PUYA 3C3MA 2OCAA 1MB4A 2GCNA 3K73O 4BX9A 4E5DA 1LPPA 2H7CA 2Y1OA 3MT7A 3ZWPA 1SCKA 1U7DA 4F11A 4EGFA 5I7SA 2CJWB 3LP5A 1M66A 3NHWA 3P9IA 1I8TA 3OEHD 2YY5A 3EQ8A 5DMXA 2R2AA 1KJ9A 1BRTA 1UWVA 3EK2A 4TMKA 4LDRA 1JRLA 1F2TB 2XGGA 4QULA 5IDXA 2O3UA 5I8ZA 3TZCA 5B6PA 1JV2B 3JRWA 5P21A 1FDRA 3AEKA 4DV1B 1DPGA 4OX9B 5JSYA 3K0CC 2XT9A 2PQ0A 3OEHA 1OKKD 4AYXA 5L7YA 1IZZA 2Q2NA 3GEEA 3Q3GE 5FX2A 4CLRA 3C39A 4YMLA 3I9V6 1QH8B 5KDOA 1OF1A 1LDBA 3DOOA 4MS3B 1OKKA 4IWNA 1SA0B 1JXQA 4QHTA 3OSZA 4CTNA 3RHZA 2HQ1A 3VU9B 3A0RB 2BSXA 2Z56A 1PTJA 3EXFA 3FPHA 1X8KA 3SLRA 4BMNA 3MLAA 5PGMA 3AF2A 4G3XA 2SHKA 4HWTA 4O2BB 2WTXA 3R4VA 4QKQA 4JU9A 1UT5A 4QQ8A 1E4YA 1XZFA 2RHBA 4RZ2A 4UNSA 2V3CC 2A59A 2AOXA 4CQNA 3B6EA 3AJAA 4O8ZA 1G20A 2A9RA 4YFVA 4RE6A 1WZEA 2Q6IA 3ZCUA 3PFHA 1F8YA 1UOOA 2J3EA 3H5IA 3WL5A 4W5QA 2YV2A 3H6GA 4JMPA 3PXUA 3R6WA 1X13A 1JR2A 1ZX1A 2LWIA 2GN9A 1M1YE 1KFJB 1R16A 2FQWA 3ECCA 5IM4A 4PZCA 4LTDA 4OHCA 5K8CA 3CUYA 4ZT2A 3PTAA 1MJ5A 1VPTA 4BX2A 2L0XA 2O2SA 3K70D 3CVYA 4N3GA 5A0VA 3RJMA 4KYIB 1YRHA 4JR2A 3QUQA 1Q74A 4QTTB 4JI8B 5HCNA 1CETA 5GY7A 5TQVA 1FRZA 1VTKA 4K86A 2DE0X 3OCXA 3TMAA 4C03A 4CKZA 5JS6A 5DH9A 4KN6A 4CTOA 2JD1A 4REQB 1XRNA 2MJLA 2PX8A 4KPEC 3T1HB 4AZVA 2W2NA 1CR1A 3GJTA 5DSZA 3LLSA 3D81A 2COUA 3ZDQA 5GM1A 1ST2A 1UXJA 3QX7A 4RPKA 1RC0A 2V5VA 1K89A 1OIWA 3QU2A 2QSZA 1Q7BA 1GUFA 4OIMA 1JAHA 3GWGA 3I73A 4NJEB 2J3IA 4DRYA 4EY7A 1WCXA 1ZPDA 3SQMA 4MINA 4ARZA 4NY1A 2I1WA 3I0MA 3T4UA 3VR4H 4BBJA 5KDDA 2O0JA 3IMEA 3LJKA 4QGGA 1CZKA 1DTWA 1HE4A 4CMEA 4POOA 3FPGA 1A2OA 3HCWA 1G8PA 1JDPA 1XJ0A 3NHYA 3KCQA 1U5CA 5AT1A 3O2SB 4O2BF 1GAEO 1JR4A 4MJ3A 4BU0A 4H7HA 2HA5A 3DA8A 3FJOA 4IJMA 3A4YA 2YASA 4U2BA 1FY2A 1Y8AA 1F8UA 3AWIA 3QPWA 5FWDA 5DIFA 2ZCUA 2G4VA 2F8SA 1N0UA 5J63A 4RJJA 2D5CA 3DLBA 4EPXA 1DFGA 3P9NA 1HGXA 3B82A 2XHZA 3KQSA 1TLFA 1MVLA 3F0TA 3TUJC 2JK0A 5DI3B 5CB0A 4WY5A 3HCRA 1QOZA 3HEBA 1BWSA 3LRPA 3MB8A 2QPOA 3QFRA 2YHUA 4A73A 3L1IA 4EUNA 2B5VA 4MIYA 3UAZA 5CA0B 4Z7QB 4YCCA 2AN4A 4YACA 3IO3A 3GGCA 3UJ6A 2BFFA 5IN5A 4LJ8A 2ET6A 3RUIA 2EZTA 4G0XA 5A06A 5GIPE 4L4YA 2RCNA 1ORDA 3I4LA 1E2UA 1C14A 1ARZA 1RVDA 3IELA 3WK8A 4RS4A 4DARA 3BD7A 3R76A 4JJFA 2Q3DA 4LYDA 3JZIA 5T6BA 2PGDA 1USVA 2E7ZA 1NKVA 3AR4A 4R9RA 1T3HA 4M98A 4U6NA 5DBFA 2I4RA 1DB3A 5HGJA 4AJ2A 4UM5A 2OM2A 1VM6A 3LC0A 1KQPA 5GONA 3R9IA 2FPOA 1LI4A 4ZQGA 1I33A 4HNHA 1G42A 4MUXA 3UJAA 1BC5A 4CCAA 4I66A 1OREA 3G9XA 2YZMA 2OK8A 3O7WA 4PCAA 2JA1A 4UTXA 5T3YA 2TMDA 2Q27A 3TEMA 1IONA 5DXJA 3JR7A 3T99A 3X44A 3QSYA 1UJ2A 3HBAA 5FLYA 4BFCA 1GCAA 1JJ7A 1KKUA 2CXRA 2KB0A 4K87A 4EG5A 1L8AA 1UBOS 2WMYA 4IUDS 4RQAA 4BWVA 1FSGA 1SULA 1TFRA 2Z9BA 3FN4A 2GDZA 4U7DA 3QPBA 1B8UA 2C1ZA 3U37A 4QQFA 3ME5A 3NEYA 2Q1YA 3OTQA 2EC5A 3V46A 3N7TA 2D3WA 2H63A 3P2MA 6NULA 1ZZEA 4NV0A 1LLDA 3TBHA 3VHLB 4JIMA 4O5OA 3Q2IA 5G40A 2D0OB 3EGWA 3NOQA 2H5IA 4OJQA 1SK9A 3QEOA 5CA0F 1IBLB 3COZA 1KEUA 4CMGA 2WQ6A 5DHUA 3QLEA 5LA6A 5ED4A 4NMXB 4Z51A 5KYNA 3LW7A 5EKDA 5B3JC 2Q07A 3SHQA 1CQWA 4ZGBA 1MXFA 1WHSA 4TXMA 4ALLA 3ABZA 1W0KD 2H57A 4PPQA 4XB2A 3DKRA 4RC9A 1EE9A 4FJ2A 2QVZX 4RZHA 4ZYXA 3IERA 2ZXUA 1BFKA 5KQLA 1VPDA 3A11A 3FFAA 3IA2A 3QG5A 4GMFA 4OM8A 5EPEA 2QYTA 2MT9A 4CIDA 2BI8A 2O2HA 1W0KA 3AILA 3DDOA 1FQJA 3GVPA 1NVFA 3NU1A 5TX7A 3EODA 3EZGA 3OEYA 4KXNA 2JJ2D 4CV1A 4EEKA 4K6MA 4CFZA 3B3JA 2CE2X 2QMHA 1A5BB 4AZ0A 1W4RA 1ZJ6A 3VDXA 4E15A 5CLQA 4KWIA 2C7GA 1XCOA 1JQ3A 1Z0DA 2Q0SA 3UANA 5D3MB 2FPPA 3PB3A 2JJ2A 4MYHA 1Y3BE 4FS8A 5AK5A 4C0WA 4DDUA 2LP4Y 5EZSA 2IYPA 5K8VA 3W5JA 2IL1A 5DLPA 1GVNB 3B6MA 5CITA 1S2MA 5LFAA 2R7MA 4C0BA 3VAZA 2X22A 1UC8A 1B2RA 3N87A 1QIDA 1UAYA 4QDKA 3PGKA 5CX1A 2CBGA 1WWKA 5ERYA 4DM3A 4DMCA 3LUJA 5IFLA 3KZVA 2J6BA 4DHEA 5JJIA 4DSAA 4BVLA 3GLRA 4TX1A 3H7AA 5DPMA 2EATA 5GVSA 2I1QA 2YW2A 1G0NA 1HE8B 1TMGE 1TCCA 1VCOA 3DE6X 3R6GA 3ZE0B 5ISMA 4DV6B 4JI4B 3RS5A 3PC4A 4WZZA 4CQJA 3LO8A 4IHQA 1AO3A 5K6RA 4LHSA 4UC0A 3BWYA 2P9ZA 1WU8A 4QYIB 3F7TA 4E4RA 3AYZB 4MIKA 1P44A 3NAZA 3ONNA 1OUMA 5ALJA 1Z3CA 2DFKB 3O0DA 4AUMA 1Q2XA 4W5OA 3QKSA 3EY4A 1RYMA 1RWOA 4EKGA 4YQFA 3RSZA 4CMCA 4E7OA 2JBWA 1G6HA 1GPH1 3KZKA 3HV0A 4KRYA 4IIJB 2VDMB 3WK7A 1KNQA 1FUYB 2FZKA 2SCUA 3MB5A 3P0JA 3SSMA 5KJCA 2OV1A 1JXMA 1QE3A 2PT9A 4NS4A 4GBGA 1XZBA 4JLBA 1BO6A 2HKIA 3GC6A 4ZQIA 1N2IA 3LF1A 2SKEA 2I2FA 5J1TB 1Z83A 3A05A 3CX8A 4HCJA 2MSWA 3O26A 2JFZA 3VC1A 2C2GA 1TM4E 1R27A 3O31A 4YJDA 3J81A 4BWYA 1RKXA 1DJOA 2J85A 4JLVA 5JYDA 3OP4A 4IVRA 5CH5A 1KSFX 3AERB 1JVSA 2IXFA 2X3YA 3MNFA 5AJVB 2ZUWA 5CLFA 4UXIA 1H65A 3AW8A 2VK2A 4JBLA 3T34A 3W5AA 3Q6MA 4MA5A 2JGAA 2YXEA 3AM3A 2B0JA 3FY4A 5T4FA 1UBUS 3DXZA 3A31A 5EWLA 3TN7A 4MDFA 3ZZMA 1NM5C 1IY1A 3GMIA 4BNVA 5LYYA 2IY8A 4D5EA 3S2SA 2WNIA 5ANRB 2REOA 3PQ8A 3X2SA 1M2KA 1I80A 1Y9JA 2ID8A 3EQ2A 3KQNA 3E5HA 4YPOA 2XNDD 1YBAA 3S8MA 1PUJA 2R85A 2FFQA 4UQLA 5EIXA 4Z4IA 3QIVA 4FB5A 4NEQA 4Z7OB 4TYNA 4AYTA 4NJOA 3OZFA 4WBNA 3ICEA 3W2IA 5CIYA 1BS9A 3NJ4A 1NPDA 2RI0A 2XNDA 2FR0A 3JQBC 4LHZA 5ALYA 2N1MA 5CT5A 4IIJF 2P9QA 4DQUA 4R8MA 4X5OA 1H2BA 2YIMA 2YN4A 2GN0A 1QYRA 3WAJA 1DQNA 2BDTA 1RYYA 2D0DA 2B4QA 2D2VA 2FF7A 2VZ9A 4L22A 3THSA 4B3GA 4WE3A 2PL3A 1IXKA 4MUJA 2VK4A 3C48A 4WGFA 3AR7A 4QDUA 1RRMA 2VDNB 3I53A 4IDEA 5BUSA 3U61B 4WK4B 4Q1BA 1JG2A 1IBSA 2PQ2A 1T4MA 3TIGA 3M5CA 5ECDA 1RIFA 1K6EA 4R1SA 2CLKB 1H2HA 1ZN8A 3KL4A 2HRQA 4R1QA 3UVEA 4ZDJA 1C3OA 3ETNA 4MMZB 1ESEA 2BZ1A 1M6NA 1S2GA 3IUQA 2D74A 3RU7A 1YIDA 3VX3A 4UE3S 2HT6A 3HYRA 3KWMA 5AVJA 3ZDRA 4L6CA 4DILA 5JNUA 4LC0A 2J5KA 3C8ZA 3MIIA 4IDOA 2WT9A 4J16A 3GLSA 4R1MA 4U5QA 1KEKA 5J2UA 1N77A 4CR6A 2VWPA 5JEDA 5LDGA 2JLVA 1UPXA 4O4JB 1RM3A 2WWFA 1NQOA 1LLFA 3FGZA 1DIHA 2AE1A 2DFNA 3LLMA 2NAPA 1QZZA 3B1YA 3GQBA 3UMVA 3CPSA 4HDMB 2QM7A 3JATB 1Y33E 4GWGA 3SHWA 5CLGA 5SZHB 3CBQA 5E3HA 2B1JA 1YHYA 3FFWA 3WRXA 5LMUB 2YC4C 3M3DA 1HNXB 2AKYA 3DTYA 2AQ8A 1NX6A 3ZGLA 3GLIE 3EPRA 3LFHA 2A67A 3P5SA 4YAUA 5TEVA 4TTQA 1YVPA 2W0MA 4RHUA 2FZGA 2POCA 5AK3A 2OC9A 1JHMA 4G81A 5BSKA 1J49A 4Q1VA 4L28A 1YR1A 2BFEA 1NFQA 3CV3A 4FOSA 1ZSNA 3EZ7A 3VI4B 3IIIA 1A88A 1P2UA 5JXJA 1KKMA 3Q10A 4AG6A 1T36A 4QJBA 2YBEA 2E4AA 3BB1A 3KELA 2HL6A 2JZCA 3E1KA 4MX8A 4DNOA 1GZUA 2Y66A 4M9ZA 3SM9A 2XKBA 4DMUB 1K7EB 2P4EA 3EFOB 3LK7A 4CI0B 2C95A 2PWPA 3SXUB 5KYUB 4ARCA 2DHCA 1RCUA 3K3PA 2OAQ1 2P9EA 3F3YA 4UQPA 3ZVLA 4TZTA 4XX1A 1RQLA 1Z16A 4AJNA 4DJJA 3SEFA 3QXSA 3BH7A 4A0GA 2PLAA 4IQ4A 2JFXA 1N6IA 1QAOA 3ZGZA 1D9ZA 5EJ4A 3W5IA 3EASA 3HUEA 3KQLA 1FFSA 1H2AS 5HR5A 1FJ2A 2HDWA 5M34A 1QVRA 4MB6A 1AGNA 5JYEA 1IHUA 4YMUA 4DW8A 4LMBA 5ALLA 5BMVF 2BFNA 4RZQA 4TTJA 2ZT7A 4XJXA 4GLLA 1TU4A 1IJKA 2JJ1D 3HGMA 4ETIA 1NW9B 3X1DA 4XTCS 4OUDB 5LIRA 5ICMA 4QICA 3URKA 3X1MA 4O4JF 2R65A 3LUCA 3IJEB 1OI2A 2Q28A 1IUKA 1WX1A 1J0DA 2JJ1A 3U4QA 4EYSA 1IWOA 4AJOA 1SHJA 4F1JA 4IDGA 5B7NA 2PGNA 4OMUA 3RTGA 2AWOA 4ND1A 3LO5A 1U9ZA 2J3DA 2YCBA 4CQLA 3ND5A 3BBPA 4X1IA 3DB1A 3RODA 3WLQA 1C1YA 1UDXA 3JARA 3IHWA 1YR3A 3P0RA 1J1IA 1CJSA 1SC6A 2L17A 1GY8A 3AR9A 4DVGA 2BKEA 3HU1A 4M36A 5CPBA 4MLZA 1KEEA 3X1JA 2FP4A 4J0KA 4OKSA 4OLAA 2Q7DA 1XA3A 5F21A 2AC7A 1CS0A 2CNLA 2GK4A 3ETLA 1K98A 1RRGA 3N86A 5AI8A 5C31A 3ZXUB 2ZT8A 1VYUA 3SQWA 4G1MB 4I6JA 1C3XA 3SIXA 3PU6A 4KQGA 4DJ5X 3OJLA 1GGKA 1GUAA 4JHXA 1A8UA 4DNXA 2OBLA 3Q7IA 4D4HA 4KYUA 2FCAA 2RAUA 3CY6A 4J6EA 1H2XA 2FN3A 1P9RA 1WTCA 4XWAA 5L3RA 2I1VB 4PTYA 3HCFA 4AYWA 2BAGA 4CUZA 3WQQA 3DV0B 1ZICA 4HRXA 1Z74A 3SY8A 3VZPA 4AX8A 4CVNA 4R01A 3EEYA 4ER0A 1C50A 3F67A 4LVOA 5F4ZA 1UJMA 3UJNA 5K3OA 4X45A 2C3PA 4BRWA 3K94A 4A6XA 1JSLA 5IZ4A 1Q12A 3TKAA 5DM60 3E9MA 4LZWA 2SBTA 3AI1A 2Q50A 1EI9A 4YTEA 1EHIA 3I3OA 4IIVA 1EFAA 3IAHA 1X7ZA 5DP2A 5FA6A 3HLKA 2XVXA 4JITA 3FYTA 3DBLA 1LSOA 3SJ7A 2ZIFA 1KP3A 4F3KA 1CCWA 5KWVA 2WMOB 1WDKA 1O77A 2OCPA 4MP8A 5KTNA 5BV1A 3H9UA 1G3RA 3KQPA 1UXGA 3R3WA 1JPVA 5THKA 2HV9A 3V34A 3WMGA 5BPFA 2BGJA 1PN3A 2Q7XA 3RWMB 5ESXA 3VYTB 1XP8A 4DA9A 4HB0A 1FXUA 4WNYA 4UBOA 3MM4A 2M6KA 2PUHA 2WJGA 1GAQA 3NDPA 1F2VA 1E1CA 2G04A 4QQNA 3VNSA 3AM1A 1USKA 4HI0E 1Z06A 1NONA 1DO0A 3DDWA 3PDHA 3SYRA 2P9GA 2Q2QA 1KYYA 3IAM6 3PFIA 4PHGA 4DIMA 4I0WB 4AK9A 1NW6A 3QNUA 4Y1GA 4BQPA 4RK1A 3KR9A 4EJ2A 1YR6A 2BGIA 3AHJA 4K46A 2Y1GA 3HB1A 4GG1A 2XCQA 2Y9PB 3G8YA 2F1IA 4J1SA 1RYNA 4PNEA 1E2EA 1YNSA 1SCAA 2H1WA 1JQAA 3S81A 2YXLA 4QDOA 4YWHA 5IKPA 1PE0A 1JFFA 3WKBA 1XSEA 1KARA 2JF0A 2OFFA 2Q1TA 1B8VA 3F74A 4AJEA 3K20A 3D7KA 2E5LB 1LXCA 1BHO1 4BQRA 4GI3A 3RG2A 2VOJA 2XD9A 1SPXA 5LMCA 3OF2A 2WJIA 3F5FA 3NRBA 3GNQA 2XRMA 1SIUA 4C6RA 1K3TA 4ZU3A 3UG6A 4WUVA 3I9V1 2WHPA 3KYIB 3UBMA 4QL3A 5FWXA 1RWBA 2GBLC 4RZSA 3DEIA 3VAYA 2H1FA 3DOHA 4A8JC 2PGXA 1RJFA 1GOTA 2AKAB 4DV0B 2QG4A 4FS3A 2OBNA 2WD7B 4OB8A 1HNNA 5EAIA 5K3SA 4ZVTA 5TJ9A 5H81A 5HJ5A 2MWMA 1RYDA 4JBXA 3RYIB 1V0JA 5J2TB 1DT3A 4AROA 3PLRA 1YBVA 1W7AA 2PUEA 3M9LA 2R1UA 4FSDA 5CFLA 2O7NA 1L6IA 3OJFA 1BQ4A 5AM3A 3WLKX 3KR1A 3ZHTA 5AMXA 1IL0A 3GGSA 1XD9A 2ATVA 4WKNA 5ESWA 1R5JA 4MQUA 3CNEA 3DAOA 3GA0A 4EDHA 4YMWA 1GL3A 2YUTA 3UWKA 4A1FA 1KI2A 1NLZA 4UAUA 1RLTA 5HF6A 4A8PA 5KQRA 4HD8A 2E21A 3AMVA 3A9UA 1W96A 1EG2A 3TDMA 1U7PA 3N2KB 4M54A 4J76A 2O7QA 5TB5A 4LRUA 2OQ2A 1HFWA 4Q4JB 2XRZA 5CAEB 3PUIA 3TNYA 4NP6A 4JX8A 4RM2A 4UHEA 4EVIA 3F96A 1CYDA 3CB2A 2QTWB 2X2PA 3L8CA 3LUKA 2RAFA 4GICA 4JJEA 5DWQA 4ZOQI 1FTQA 1D7AA 1XMIA 4PCLA 2IPXA 4W1QA 3RSOA 4B3MB 3QXJA 1JEJA 4EAQA 3ZDYB 4U3JA 1DARA 1X1RA 2J8ZA 3FD8A 3TB6A 4CYMA 4JI0B 2MINA 2J33A 1P9LA 3I9LA 3JZFA 1Z63A 1FRNA 1IBMB 3WGTA 1TGYA 1RBYA 3UXHA 3CUUA 3T0GA 5CBKA 1RQXA 1NE7A 1LPOA 4JLDA 3BK7A 4LOAA 3V8QA 1PTKA 3PRJA 4IXWA 3TL6A 3EH1A 4PYLA 3B52X 3HFRA 3QVUA 2DH6A 2P5SA 2RI1A 2WINI 2X0JA 1WW3A 3AV3A 4JP8A 5G3ZA 1XD2A 1HDXA 3NHKA 4X97A 1EBFA 2X19A 1L8OA 4PSUA 5K2MA 1S96A 3OI7A 1Y3HA 4D4JA 4F45A 3DC2A 5J2TF 2VHTA 1U2GC 2L82A 4Y0NA 3CLVA 2UZAA 3D8UA 4YHBA 3TZ6A 1XU9A 4BMSA 4CGZA 4EB3A 3DSRA 2H7XA 4CMHA 2PA0A 2GTIA 2FR8C 2V7WA 4H7KA 1TUBA 5EMHA 1QYIA 2FB9A 5E4FA 2R48A 1RMYA 3EG9A 5K3CA 4ZMBA 5EJ9A 4BNDA 4TSRA 3ZKAA 2X2EA 4EJSA 3PEYA 3MRXA 2VF4X 1HQYE 3WFIA 1ZM9A 4BV3A 1KDPA 2QRVA 1KERA 3GFRA 3AKDA 4KI7A 4PYOA 1Z2EA 4AG3A 5B36A 4M22A 5B58C 1JH8A 3BAZA 4ZZ0A 3QLJA 5HMMA 1YMVA 2VEOA 4RMIA 4KKVA 1ADJA 3G85A 4JKIA 1HZZA 2F17A 3B1WA 2AEMA 2JGLA 1Q19A 3D6TB 2GERA 4K0RA 2JLXA 4X93A 3D4BA 2I2BA 2WNHA 4L3VA 4YRIA 3OO0A 4MGYR 3UEOA 1H23A 2P78A 5EQTA 1DEHA 4LYAA 3UJBA 4F8YA 2AUNA 2W2KB 3A9WA 3BTSA 3HA2A 5DI9A 1SD2A 3DDSA 3RT1A 3SS9X 3LUGA 2R8EA 2M6LA 1D6NA 1ETUA 3L8MA 5DISB 4BNZA 2WJZB 3FAZA 3FVRA 4PPNA 4BNIA 1U11A 3L4EA 2JDID 1ZIXA 4O4IB 4HFNA 1EBBA 4DT1B 4EOGA 3ETCA 1OXUA 2HMUA 4NOMA 1V39A 3SIWA 4AKIA 4YRSA 1XO1A 5C5DA 4YH1A 3KBBA 1GQOA 1LWNA 2AW5A 3DLHA 3ACCA 4BNUA 3P9QA 3HE3A 4NNOA 4L9WA 2JDIA 1XJQA 2QSYA 4HDAA 4QAQA 4XUDA 3WIDA 3P9ZA 2BFAA 3GLFB 4HEQA 4EO7A 1Y7HA 3N2YA 1D2RA 4FILA 5TARA 1U3TA 2I71A 1G6KA 1XCGB 1Y5IA 3GLHB 3GVHA 1Z38A 3P0IA 3AEXA 4ALKA 1CRPA 1G9TA 1E89A 2WJWA 3PNKA 4EG7A 4ZGWA 2AC4A 1FRQA 3N7AA 4HGOA 4MPDA 5ES3A 3U4AA 3T9BA 5AKXA 5IMBA 4PBSA 4QASA 3MJHA 1I0ZA 5HTOA 1ENPA 1ZH8A 2BHLA 5D3ZA 3K5IA 2BM9A 2UZ3A 2V74B 1QG6A 1M6HA 2H4WA 1DHTA 4ND3A 4BHTA 5DCYA 4QLBA 2JKZA 4ENVA 1B8OA 1VE9A 3W6ZA 4GKKB 3E70C 2ATIA 5AVRA 2C5GA 1SIWA 1V7CA 3JVIA 3JQ8B 5FNVB 4G86A 5CX4A 1GPBA 3NFYA 1ZA2A 1F20A 3WMRA 2PZAA 3WP0A 5E7JA 3AWDA 5I8PA 2WVJA 2CV1A 1JBQA 1SQSA 4IRMA 5TDHA 2HOQA 3JALA 5SYAA 4E08A 1ZCFA 4E14A 3Q7EA 3HCEA 2G8LA 3MYRA 2P8JA 2QGNA 3DKVA 3N0TA 1Y6RA 3Q8KA 3R1IA 3W05A 3PCTA 1WKBA 1YGPA 2FMUA 1II8A 1U8CB 1XTTA 3HKEB 4RTRA 3CR7A 1MZPA 5KQGA 3B9PA 4D0LB 3OH8A 1CJUC 4BNJA 3EGOA 6ADHA 1JJAA 1TTQB 1G3QA 2FZWA 4Q3OA 1YR7A 2WAOA 2X7XA 3FWZA 4KV9A 2AOTB 2XWQA 4N18A 4UHJA 3ER8A 4CL0A 2CN1A 2DFVA 5CLJA 1E18A 4RGVA 1JI3A 5JS1A 1NXWA 5K0NA 4A6EA 3GPCA 2H4ZA 3M49A 4Y1EA 4MV7A 1E6CA 4UTRA 3KR0A 1HO3A 3USES 4EPRA 1QS0A 5MDHA 3F98A 5JSUA 4YJKA 2YRXA 5JCXA 5LQDA 4TL6A 3SJCA 1JHYA 4RA9A 2JVIA 4O4HB 4CLOB 3RSFA 2WI8A 2OWEA 4JGBA 4RD2A 2XCIA 1UDWA 2SNIE 3A4IA 4HXFB 1BZYA 1N2CA 4PFJA 2R8XA 3ABQB 1JVNA 5EMJA 1G5IA 2B7LA 3BMXA 5DGIA 1D8TA 2RJ3A 3CINA 4RH0A 1J25A 3DBRB 2XTAA 3IXLA 3MMNA 4Z0HO 5IULC 1EFVB 1IZ9A 1Q0ZA 1WOMA 5AIAA 5JCOC 1TEZA 2DUJA 3CZAA 1HX7A 3P20A 3KV1A 4CF7A 3IUJA 4YBZA 4JP5A 1ONSA 4PZDA 2BHTA 3W9SA 2AK3A 1KY2A 4A5OA 4BFYA 4QFBA 3UH1A 5LYJA 3U3DA 2OOSA 2HA6A 3G0GA 4XOIA 3A6DA 2IYNA 1ILEA 1E1NA 3UV7A 3OKFA 1ORVA 3AR5A 5KQSA 1TYZA 3ZWNA 1XZDA 1NVBA 2C9ZA 3BMCB 4ZYTA 4L8VA 3UYLA 1IM8A 1VMDA 3VR5A 5B4TA 5HQ3B 2BFDA 4MA0A 1M0EA 4HEA6 4FHFA 4H77A 2CNWD 3CRMA 4FOOA 1B74A 1X19A 2PMBA 4JI2B 2XKAA 2B82A 1XMJA 4IIEA 1VI6A 3C7TA 1AIPA 1NF2A 2Z2ZA 3ROGA 3LSYA 4CR8A 1CDZA 1Y8ZA 3CE6A 4TVOA 1KAMA 2CE7A 4TGLA 1UWLA 3IUNA 4FTWA 2CNWA 3BL5A 1C2TA 1WXXA 4QECA 4ZCTA 1FP6A 1GPMA 3H1TA 3PUJA 4F5EA 3WGOA 1V48A 2IU0A 3ACBA 4YR7A 5I5EA 4DCMA 3LT1A 2REQA 3WGNA 1OZAA 5G1OA 2NSYA 3O8RA 3U80A 2I99A 3N3BC 3R9KA 4OBBA 4DWVA 2G28A 4Y1RA 4O4HF 2FEMA 3CBGA 4Y6SA 3ZLVA 3WNDA 3TLMA 2AR0A 2O8CA 4NKRA 3T1NA 3GDHA 3EQ9A 1PZXA 2QBYB 3CNHA 3WWCA 1B8NA 2VPYA 2GLUA 4JYBA 2GF2A 3DUWA 3E3LA 4OB6A 3OSUA 4H18A 4TKZA 3AFIA 4NMMA 4DMHA 1Z5UA 5AD1A 1D0SA 3BMOB 3OHSX 4PZYA 2BGKA 2BH9A 2YFKA 3EXG1 4CM8B 1ZKDA 3MTJA 4JFAA 3ZC3A 1DSSG 4HNVA 1E2BA 2FGKA 4DCOA 5AM1A 1PHPA 3CR3C 2M98A 3V8NA 1GITA 4HXEB 1DEXA 2IF0A 1O6ZA 1ZG3A 4Z8YA 2A78A 5EJFA 1QV7A 4HY3A 3R3ZA 2BUAA 2Q5HA 1KIMA 2VNAA 3LX5A 4ED9A 2KS6A 2YY7A 3IQHX 4F5WA 2FUKA 4HLCA 3U3ZA 1PJRA 1KZ1A 2B35A 1NJ5A 3M4XA 2WMDA 1SUEA 1BG6A 3I8OA 1OXMA 5I7WA 1P7YA 4EF6A 3D6MA 4KR0A 1MPTA 3KPVA 1JW9B 3ENQA 3KWFA 4XD7D 5I4BA 1MD9A 1MB2A 1J5EB 4IP0A 1WU7A 1EWKA 3A6FA 1V7PC 2QGZA 5AUNB 4JYZA 1ZRHA 5ICSA 1S8FA 2OILA 3R0VA 3ABRB 3BK1A 2NADA 1NVVR 4MR8B 3ZGOA 5JMTA 5HZGA 3KKKA 1SBHA 2PSSA 3ZCXA 4NI5A 2LD4A 3H1BA 4F6RA 5AHOA 4U6SA 3G2KA 1PTJC 1E1YA 4D92A 4ENRA 1PWYE 5LNK6 3W2FA 1IBCA 1M3SA 3DKIA 3A4NA 3CXRA 3PUKA 4LBVA 1YU6A 1DAMA 1MX9A 4JVOA 5JSHA 1NC3A 2ANBA 1R5BA 3LY9A 3OQIA 2VWGA 3VHRA 1G17A 3PKZA 1IZ0A 2J3KA 2RI6A 2ZP1A 1RYHA 1ZCAA 2BM1A 5LJLA 1RQNA 2FX2A 3FF4A 3OA2A 4NULA 1O6GA 5EIHA 4UFOA 2A1TR 1T9KA 4G4SO 4EPTA 4JC5A 1DAEA 1ZR2A 2ES4A 4MVYA 3EEQA 4P1ZA 3ZE2B 4R1PA 4BBPA 2DQZA 5EJ2A 3UJ7A 3BGDA 2HF9A 4ZEMA 1Z08A 2IYRA 3LQ4A 2LPMA 3LZDA 3A6JA 5TGZA 4F3NA 5WRFA 1Z25A 3K70C 2O4UX 4FC7A 3G8DA 4ZK6A 2XB2A 4DLUA 5A05A 5D6NA 2NUTB 4ASUD 2XVAA 3OD5A 4G26A 5HHTA 2ODWA 1AA9A 1MX3A 1E6EA 3A1EA 3R6TA 3LLVA 3F7NA 4TTIA 3H65A 2ZVPX 3CT6A 3V5NA 3ZX5A 5A6VA 1QHGA 2NXCA