4WKPA

Crystal structure of helicobacter pylori 5'-methylthioadenosine/s-adenosyl homocysteine nucleosidase (mtan) complexed with 2-(2-hydroxyethoxy)ethylthiomethyl-dadme-immucillin-a
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
230
structure length
230
Chain Sequence
VQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminodeoxyfutalosine nucleosidase
publication title New Antibiotic Candidates against Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase/hydrolase inhibitor
total genus 84
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wkpA00
2XRFA 1RXSA 1RR6A 2ON6A 1ZOSA 3P0EA 1A9SA 1OTYA 4EARA 1RXCA 1JE1A 3EUEA 1FXUA 1WTAA 1SD2A 1PKEA 4TYMA 1G2OA 2AC7A 5C80A 4OF4A 1NC3A 1VHWA 1Z36A 1V2HE 1K3FA 2HN9A 4QASA 4DANA 3UAZA 2OECA 5F7JA 1PBNA 4JWTA 1TCUA 3EEIA 3OZDA 4D8XA 4BMXA 4UC0A 5JPCA 2B94A 3QPBA 4E1VA 4MARA 1B8OA 1YRYE 1Z38A 1M73E 2HSWA 5F77A 4NSNA 5IFKA 1PF7E 4P54A 4GLJA 1PWYE 4WKOA 4L0MA 1YBFA 3PNSA 3KUKA 1PR6A 1Z5OA 1TCVA 1QE5A 4TXMA 4IP0A 1LVUA 4OGKA 3NM5A 5B7GA 4DA0A 1ODKA 4PNPA 4TS9A 3E9ZA 1Y1RA 1Y1TA 5DK6A 5F76A 4DABA 1Y1SA 3OOHA 3K8OE 3NM6B 5F7XA 3FWPA 4TXJA 3KVVA 1U1FA 1Y6QA 4JOSA 3FUCA 2OXFA 1JPVA 4OEHA 4TS3A 1RT9A 1OTXA 1PR1A 2PGAA 1JDVA 4MCIA 3UAYA 1U1CA 4DAOA 5B7NA 1TD1A 2QSUA 1T8YA 1U1EA 4U2KA 4RJ2A 1VHJA 5ETJA 3OZEA 4GMHA 2QTGA 4GKAA 4D98A 1U1GA 2IQ5A 1TGYA 3BL6A 3T94A 1PR2A 1PR0A 3LBAA 3DF9A 1Z37A 2AI1A 3MMSA 3OPVA 1JE0A 1ODJA 2HWUA 4QEZA 2H8GA 3O6VA 1N3IA 1JDTA 4WKCA 1CG6A 5FAKA 3BJEA 3IEXA 4H1TA 3KVYA 2QDKA 2RJ3A 4YMLA 4LNHA 1T0UA 4OGLA 1A9RA 4WKBA 3O4VA 3NM4A 4DA7A 1OU4A 4DA6A 4QATA 3EUFA 4R2XA 1RXYA 2BSXA 1JP7A 3KVRA 3PHBE 1T8RA 2Q7OE 1PR4A 3PNPA 1Z34A 4R31A 4M7WA 4F3CA 1Z5PA 5F7OA 1PK7A 4M1EA 3IOMA 4PR3A 3GGSA 3KHSA 3LA8A 4L5YA 5EUBA 4OJTA 4LDNA 5CCDA 3C74A 5EFOA 1RYZA 4NS1A 5F73A 5B7PA 4L6IA 3EMVA 4G41A 3GB9A 1SJ9A 4GLFA 1YQUA 1NC1A 1SD1A 1LX7A 5CYGA 1ODIA 1T8SA 3LGSA 4YJKA 1B8NA 3UAWA 1VFNA 4NY1A 1OUMA 4L5CA 3DPSA 1A9OA 3ENZA 4TTAA 1ECPA 4I2VA 1TGVA 4TTJA 1K9SA 4MCHA 5K1ZA 1YR3A 1PK9A 2A0YA 3ONVA 3OF3A 2P4SA 1U1DA 4M3NA 4DA8A 5CXSA 2QTTA 1OV6A 1A9TA 3E0QA 1PR5A 5CXQA 3U40A 1RCTE 3FOWA 5F78A 2I8AA 1ODLA 3OZBA 1V45E 3FB1A 1JDUA 2A0WA 2I4TA 2ISCA 3KU4A 1ULBA 4LNAA 4D8YA 4BMZA 1PW7A 3K8QA 2QPLA 3F8WA 1A9PA 3DJFA 4KN5A 3SCZA 1Z39A 1A69A 1RSZA 2A0XA 1JDZA 1Y6RA 1XE3A 1I80A 4WKNA 5IU6A 2AI2A 4K6OA 1Q1GA 1LV8A 3OCCA 3D1VA 1V48A 2OC4A 1ZL2A 4BMYA 1VMKA 4G8JA 3E9RA 4L5AA 4FFSA 4LKRA 5CYFA 4OY3A 1RFGE 4YO8A 4LZWA 3OZCA 1RXUA 4D8VA 4QAQA 1SQ6A 1T8WA 4QARA 4ECEA 3DDOA 1JDSA 4G89A 3MB8A 4QFBA 1NW4A 1V3QE 2AI3A 3BSFA 4TTIA 1K27A 4JP5A 5KB3A 4F3KA 3UT6A 5EPUA 4F2PA 1Y1QA 5CCEA 4TXLA 1JYSA 1ULAA 3ODGA 5I3CA 4BN0A 3P0FA 1A9QA 3UAVA 2HRDA 1Z5NA 3BGSA 4TXHA 5B7QA 3OOEA 5F7ZA 4R2WA 1Z33A 3TL6A 4X24A 1Z35A 4WKPA 1CB0A 1V4NA 4EB8A 3INYA 4F2WA 4YNBA 3NBQA 2OC9A 4TXNA 4DAEA 3FNQA 3DP9A 3PHCA 1V41E 1YQQA 4D9HA 4F1WA 3UAXA 4DARA 2A8YA 3FAZA 2GUWA 1OVGA 1C3XA
chains in the Genus database with same CATH superfamily
1M2GA 4RORA 1I7DA 3X1YA 3BHNA 3OTGA 1NAHA 3DE4X 3MG9A 1ZEJA 3U9LA 4FB4A 3PC8C 5U9CA 2V9ZA 1RM0A 1XEXB 2VBFA 3W06A 1OVMA 4OXNA 2Q50A 1GNVA 1GQFA 1VP9A 3MD9A 2P9TA 1LPOA 4ID9A 1FNSA 1OTYA 4PRKA 4ZC1A 1JILA 5AJVB 3GT0A 3MCZA 4ME6A 3UK6A 4XD7D 3K32A 1X70A 3WYFA 1R1DA 5E2IA 1FXUA 2FETA 2GHRA 3MFYA 2JIZA 3P9QA 1VGRA 3JX9A 4L16A 4MUYA 4CZ2A 1DCTA 1I7QB 3BRWA 4EG4A 2JD2A 3ZVKA 3BIXA 2VWQA 4BNVA 1NC3A 4Q4JA 5TIIA 1USIA 4PZDA 2W6JD 2C94A 2J3EA 3DSRA 5GPBA 2A5FA 3ILYA 3PTLA 2O8VA 5I7UA 4DWOA 5KU1A 4F1KA 1IEWA 1PQYA 2XMCA 4MSUA 1LD3A 4RO0A 1B1AA 5CM8B 3UHJA 1E5TA 5KX5B 5HG0A 2Y2UA 3VV2A 3SSMA 1NJGA 3I42A 5JYDA 3CUVA 5CDSA 5H7XA 1O57A 2GSWA 3R24A 5U1PA 3MWKA 3ADCA 1RCUA 3VXKA 2XF8A 3L6OO 4W63A 2B69A 3I5AA 3JQQA 1VKZA 1AT1A 1SC1A 4QYSA 5FWYB 4B1FA 1AKRA 1N75A 3I37X 4YLYA 1AGPA 3A2NA 1EK2A 3Q0IA 4LQLA 3MHPA 1D09A 2B9VA 3JYHA 2XWJI 4LVOA 4FC7A 1ZJZA 4G56A 4LZPA 4MVJD 4A5OA 3WJ1A 5CB4A 5ADUS 2FFAA 3IQHX 3IDQA 1YZKA 2HT6A 3WAKA 2W2NA 1JG6A 1D4AA 1QH9A 2FJPA 4RF3A 1SG6A 1QS0B 5F9HA 4CM7A 1NG1A 3RIXA 3LBNA 4DV3B 4JV5B 1DAIA 1Q84A 2VDVE 2JLSA 2H4HA 3DCIA 4TM8A 1OH6A 1CR2A 1G6Q1 3B53X 2BGWA 1Z56C 3N58A 2IV3A 1NTRA 4E21A 3LYHA 3SX0A 1J5XA 1FS6A 4IHJB 4C2BA 3PHGA 1PHRA 4A3SA 4KWEA 3DE2X 1TCVA 1AU9A 5FR1A 2L0XA 5IBRA 4ALLA 2GPBA 4WLNA 1A7UA 1ABFA 2CFRA 3ADBA 4A36A 1J4AA 1CUZA 2AOUA 5KYVA 5HFAA 4QXRA 3CNHA 3BSSA 3D7NA 4PNPA 3JU3A 3RANA 2NU6A 4U6QA 5FPYA 4Y6QA 4HTAA 4PC2A 3SWWA 1MHTA 2QQEA 3VO2A 2Z1DA 1SKUA 2YFKA 3QXGA 2G82A 3AEQA 5IWAB 3VH2A 4MULA 2Q5OA 1T0BA 3KOXA 3L6DA 3QITA 1Y1SA 5DK6A 4ZO4A 1FP6A 5DOZA 3SZ3A 3TQFA 2ATVA 4D2IA 5F7XA 4IIEA 4K3VA 5B2EA 3H0EA 3KYDB 1H0RA 1FJXA 4NPHA 4Z4GA 1NQWA 4A03A 3DXYA 1KFJB 3ZDZB 2YVAA 3IBGA 2VN8A 4JI0B 1SCUA 1CY2A 3ANMA 4C4OA 5HZKA 1KEKA 2WA2A 1WNFA 4ZAVA 3JWGA 2NUPB 2GMWA 2V54A 3EPKA 2VUSA 5K3FB 2XIQA 1EKXA 3MB5A 1RRFA 3KYJB 4H18A 4HLUA 4M76B 6GPBA 1ZUWA 4F3NA 4OEHA 3ES9A 2IYFA 2QS9A 4EA6A 1AA6A 4NIMA 1S3IA 1U7HA 4K1LA 1W29A 3VPHA 2EDAA 4Y0VA 5JASA 4W5HA 4J0DA 1U0HC 3O1IC 5E4FA 3X2FA 3WMWA 4I1UA 4KPYA 2H65A 4PW0A 2GYWA 4ZHQB 1XHEA 5BQOA 2VK8A 2GKOA 5KSOA 3PE3A 1LTQA 1V1RA 5ALEA 1QWOA 2C9MA 3JASA 3TN7A 3HXKA 1L3BA 4EPRA 5JU6A 1YRBA 4C7OB 3V8BA 4G5FA 4QOIA 2R6JA 3NHPA 5ICFA 2NO1A 4M7RA 2JAQA 1PFVA 1Y8RB 2VBIA 4F9TA 1UC9A 2B21A 1MIOB 2CNWA 2HJVA 3G49A 4IV8A 1Z17A 4OJMX 4QUJA 2O14A 2C7QA 2BGKA 1N2HA 1PUIA 3BD9A 2PFGA 4PXSA 5BMVA 1XTQA 3OQOA 2VATA 3CH6A 5L7YA 3LP5A 1JV2B 4XVRA 3DPUA 4A15A 2E5FA 2R87A 5GP1A 2D0DA 1QZZA 3IKLA 4RABA 4UU0A 4PN3A 5CFZA 4OHYA 3GF4A 5JATA 4UHHA 3QELB 1QOPB 2XKAA 4N65A 3R8XA 4UU8A 5CLGA 2P2CA 3LI2A 4JUBA 1SMKA 1ZGJA 1GARA 4KCGA 1Y9ZA 3SVZA 5HUQA 2C83A 3D1LA 2FZVA 2IHZA 1M2VB 1V1JA 2AX3A 2GNOA 2XDYA 3E9DA 3G0DA 3NAGA 4KI0A 4KKXB 2C29D 1I51A 2F90A 4ER3A 5TQJA 4D9BA 1VL6A 5EHGA 1N0IA 1CC1S 3VTKA 2N46A 1CY8A 2G0TA 3LY8A 4B82A 1Z37A 4P4TA 4Q1CA 5HBRA 3S3TA 4C7VA 1N3YA 2HK9A 2G25A 4I5FA 1QFZA 4QPCA 2IDJA 5FA5A 4II7A 3NVKI 1COZA 1V96A 4KXXA 5I9NA 4ZK6A 2JD1A 1XMIA 2XR1A 1AUOA 2YHUA 2V7EA 3Q98A 2QY6A 4WKCA 5BQXA 3KVOA 1O8BA 2Q2NA 2D0PB 4DZTA 3ZQ6A 5ANRB 4YDRA 4CIBA 2GEFA 3LAWA 4PFKA 4OQDA 1M6EX 2C2WA 3D3JA 3WWYA 1M0EA 1ISIA 1QO0D 5ICMA 4QGGA 1QGYA 4MLPA 3VHLB 1HNXB 4F7DA 1KSFX 3AVUA 1P7PA 3RAGA 3PDJA 1F8FA 1KC1A 2XH8A 1A2QA 4REOA 3AKZA 5JD5A 2VG8A 4CLRA 5GOZA 2FQ1A 4RH1A 1ND5A 2YV1A 4J03A 4LX0A 4MRPA 4TSKA 3SPXA 4WNAA 4I1VA 3Q3CA 4P84A 3PWKA 2DKNA 1IQUA 1EWRA 1IN7A 4R2XA 5GVRA 2JGIA 1OAKA 1NULA 4MGHA 3F74A 4E11A 5KOJB 2VDQB 5AW7A 5EZYB 3QX7A 2C84A 2P27A 3LHIA 2YYYA 4HDMA 1DAPA 1K68A 2LXNA 4N82A 5T8KC 1PR4A 3W04A 3EXHA 3K6JA 2PLFA 3HYTA 4JCCA 2PX3A 1VYVA 3S40A 2WYWA 4UTPA 3ZKWB 4KR7A 5C8YA 1VKOA 5AM2A 2O8DB 1E32A 2O48X 2J7PD 1K3UB 2VDLB 4H35A 2HMSA 1EX9A 3HLYA 4FEYA 2Y9MB 1BN6A 3H1PA 4TS4A 3ZWBA 4DXAA 3CCCA 2P7HA 3B5EA 3O26A 2EFJA 2A57A 2B4QA 2HMWA 1XTSA 4MVJH 1GTJ1 2WJAA 1QQ6A 2WV9A 1B0PA 1ONNA 2E87A 1X8XA 3KAQA 3KHSA 3LA8A 3OZAA 4UEWA 4AZ0A 2PH7A 1JIXA 1HX7A 4O4IB 2HKIA 5CA1A 5TQVA 2XUZA 3M49A 4NJOA 1SD5A 2QPAA 3FPFA 1OY1A 4MVCA 5A9TA 4JHXA 5KTYA 1MN6A 4HUQA 2ZVQX 3E8SA 3KKEA 4D92A 1R8XA 4HN9A 1GV1A 4RK5A 4D82A 4YX9A 3ZE0B 1DKUA 2Q21A 4X5OA 3U48A 3WSWA 3CZPA 5G53C 2PZFA 2VWGA 3IFSA 2HY7A 5KOIA 3B78A 3PDIB 1RWKA 5HZMA 2DPYA 2J4CA 1QUFA 2OP1A 1J0EA 1KFBB 1P2FA 3N2YA 4I6JA 5P21A 4M9UA 5FL7A 3PT5A 4QYTA 3PPYA 4QXPA 3C3JA 1C7JA 3AYXB 4DMCA 2Q4EA 2F17A 3IRVA 3NX4A 3PX3A 4GT1A 4TM7A 4K46A 5FTNA 2FRDC 4XJVA 3ZZ0A 3L2OB 4EABA 3UAWA 1ZCFA 5IM4F 3K70D 2JLYA 1P1KA 5KJCA 3UT5B 3D7LA 1JTVA 1WCYA 2HD4A 3AETB 4GUDA 4JGBA 5DNWA 5SZJA 1UBCA 3VPSA 2N9UA 1TF5A 2ZBPA 4Y6SA 4ALMA 1BWSA 3DPSA 5EJ5A 3BE6A 5BQ3A 2WUWE 2J9FA 5SYAA 3LDFA 1YVUA 3A4YA 1NGSA 4RKWA 3U7FB 2OL4A 3ECSA 3DFKA 1G55A 2AOWA 4LI3X 2LUOA 2QXUA 2OORC 2AYXA 3OM9A 3QFTA 3OF3A 4E70A 4POOA 5BVGB 1NAIA 1JNXX 1NXPA 2I87A 3O0TA 2X14A 1RHJA 3CX8A 1QV9A 2A3NA 3L7JA 5DHFA 1KQNA 3CNQS 4ANFA 4ZRNA 4M3NA 4NBNA 1RAGA 4IZOA 4XXHA 5AYVA 4OQFA 1G20A 3CUTA 1Y80A 1ICEA 3L02A 4HQ0A 4G67A 2W5UA 2H3HA 5BPFA 1TMGE 6YASA 2XOKA 3FOWA 1UMDA 4EKGA 1FVHA 1ID1A 4I08A 1HDXA 1QP8A 1RYDA 1V5GA 2O52A 4RDCA 3LQ2A 4KEAA 2H1OA 1EZ1A 3MGKA 2YVUA 3QLEA 2CFIA 3IQGX 3ZQJA 4DLKA 3ZXXA 3PC4A 2RK4A 4X94A 3DT6A 1C9KA 1ORTA 5CLJA 2A0WA 2P30A 4DQ0A 1EGHA 1CE8B 4YGXB 2YUIA 2ZBGA 1GPDG 2XUKA 4R4JA 2JLAA 3SSNA 3SXPA 1H1LA 2ZPAA 3NFRA 2QTRA 3FTCA 3L77A 4YMWA 1YBHA 3CJRA 4WHMA 4X0EA 4AP9A 1WVIA 2JASA 5J5AA 2O2CA 4O25A 5DSZA 1L5KA 5HHTA 2ZJ7A 2HF2A 5KBYA 2WP0A 1G21A 1BMTA 2BM0A 2EHDA 1JBQA 5KYTA 1QAMA 3RIGA 2A58A 3BC1A 3AR7A 3GA7A 2PZKA 5IDVA 3NEYA 4BBPA 4CWAA 2ZQYA 4GF5A 1SOAA 5CNJA 3JALA 4FDAA 2X0FA 1U3TA 4M21A 4XE5A 3IS3A 4EG8A 1UK6A 5I8PA 1UODA 2PEZA 5BWBA 2ZSIA 2I6FA 3O3OB 4PGMA 2FFHA 3A7EA 1Z82A 1JIVA 3T9BA 3GQVA 5NULA 5IAOA 4NOMA 3L0CA 4RY8A 2AEFA 1VJCA 3IP6A 3GVXA 2OLKA 3T35A 2XE4A 3LUHA 3T7AA 1EG7A 4CMEA 2WIDA 3KT6A 3KYIB 2O0HA 1I5EA 3LCUA 4LZLA 3NAZA 1PG2A 2ARKA 3PQ4A 2JRCA 3QMWA 4HDSB 1WDKA 3J81A 2QZPA 3NANA 1NZDA 3TQSA 2GJKA 2VHJA 1MIHA 1U9JA 3O9ZA 4H6PA 2X0NA 4RNDB 3ZY3A 1IM2A 1RE0A 2C5BA 4J6FA 2BR3A 3LQ1A 4MDHA 2PY6A 1T9GR 3MWEB 1R6TA 4H4EA 1RWBA 3W8FA 4JI8B 1SOUA 3EZLA 4D5GA 2H9AA 3K94A 3OUZA 3OX3A 3SDSA 3DDSA 2WD7B 2LBPA 5IARA 1Y8ZA 3ABRB 3HKCA 3BWEA 2WA1A 3UVEA 4CMGA 3WB0A 4DLNA 1EVZA 3OJEA 4XM2A 3MJFA 5JNSA 4WJKB 1O0SA 2H0AA 3AKEA 4OQEA 3CWQA 4I7EA 3RUIA 3W4IA 5EIHA 4PGHA 4AZWA 5JJBA 1M1YA 4P82A 2YV5A 5ALNA 3T9DA 3U81A 2FFBA 3H9GA 4V0RA 5AK0A 3ZHQA 1W25A 2V74B 4HEHA 2QVLA 4MGEA 4AJJA 3O7MA 2BGGA 2FFJA 1DRKA 1YONA 1QR2A 1QZ3A 1OHHA 2ZT7A 3COSA 4QAQA 2OO5A 4ML3A 1LNZA 4AURA 1HTTA 3M4NA 4AECA 2GBFA 5H3LA 5FPQA 1L4LA 1S3FA 1JHVA 3B60A 5LMZA 4JJ8A 1TMYA 1EG2A 2IP1A 1RRGA 2WJGA 4UXJA 2IWRA 3BJRA 3HDTA 1K27A 1GRNA 3D9QX 2NXEA 2YWGA 1U4NA 3TMAA 2ET6A 3KM0A 3GZNA 1M6YA 1TCBA 2IE8A 3LECA 3ZUPA 4XB2A 4Q4CA 3DMFA 3TXAA 3RRZA 3CLSC 4CHTA 3X2EA 1HDYA 1R8JA 5BYJA 3T61A 5LPNA 2GZ1A 1WD7A 4FNMA 4DQXA 5DFAA 3N74A 4PICA 2WU4A 1AX9A 1TJ4A 1NQOA 2OPBA 5EINA 1H23A 3D3QA 3K2QA 5EWMB 5CCEA 3EVZA 1JYSA 4RNCA 1T9GS 1DQPA 4RVUA 2R4TA 3VDNB 5I3CA 2XDQA 4GSLA 3E7XA 4NF2A 5COBA 3MELA 3PXAA 1PQ4A 1TECE 2ORVA 1JIIA 3KYCA 4NTZA 1MTOA 4BNMA 1L4BA 2A1UB 4U7JA 2ZEJA 3JRNA 2GTHA 2HRDA 2ZXFA 4IVNA 1Q1BA 1ZVJA 4YRDA 4ZCRA 4AI6A 4QL3A 2R96A 1OLSA 2R8ZA 5A0FA 4WXRA 4PE5B 1YK0A 3DOOA 1LX6A 4HPXB 3SHWA 4WBNF 3SZLA 1E62A 4HZGA 3V9PA 3WGGA 1W46A 4AN4A 1DKOA 4PQYA 1HORA 4YGYA 4B2PA 4RIEA 1MDBA 2WHPB 3DLAA 3UWKA 3FTEA 1NRJB 4MR9B 4LBYA 3ZHTA 1C80A 3HXTA 4JOCA 4ZODA 1TTQB 4K0RA 1F20A 1XZQA 4J4TA 1UEJA 3GBVA 2Z2JA 3LKZA 3Q2OA 3D0RA 3PLRA 3NBQA 2V98A 4P32A 2HCJB 3QE4A 5HEKA 4OLBA 1F60A 2FMKA 2BT4A 3FB4A 3WWPA 1R16A 3DV0B 4BJHB 1YMUA 3E5MA 3OZGA 1JT9A 3RYCA 3D2BA 1GZVA 1OAOC 5B1DA 1DI0A 1E2LA 4WY5A 1XZDA 3LBFA 2I6TA 1B42A 2O4CA 5AHWA 1XSEA 3R76A 3RVBA 4BRWA 1C81A 3EGVA 4NR0A 3O4IA 2OM6A 2ZTUA 2GAJA 4ARAA 2DUNA 1M2JA 5HA5A 3OD5A 3LXUX 4HAOA 3TM4A 3FPEA 1VOTA 2GK4A 1CRPA 1X1EA 5GQSA 2DFVA 5BSHA 1EESA 3GPCA 5K6AC 1IEVA 2OLJA 2ILTA 3I72A 3DLPX 1US8B 4B75A 3AL2A 4HUTA 1ZI8A 1QPZA 5D51S 1RKVA 3QFCA 3LLUA 4BC0A 3JZMA 3CTMA 3IIEA 1C3JA 3H11B 3VZPA 1PDVA 1GAJA 1GPWB 2VJDA 3EASA 4DG9A 2IS6A 3VNVA 4YCMA 1VGQA 2V5VA 2WVGA 2JAUA 5JNLA 1GUYA 4PAOA 4R1SA 1G2QA 2PXCA 1RI2A 3BRWD 1M2EA 2F1HA 2DWPA 1PK8A 1DWPA 2BPOA 2WJHA 3LF2A 1PX0A 3N07A 4BLRA 4RC9A 3EVAA 4BE9A 4DOMA 1P2TA 1LNSA 3CIFA 4C6TB 3GFFA 4QASA 3D4NA 4LBVA 4PZAA 4YC7A 4KBFA 4S12A 1H5QA 1WXIA 2K7FA 2ATEA 4XIGS 1T4CB 4ND4A 3GPLA 2RI0A 4KVFA 4JDPA 4ZMBA 4HEA1 1ADCA 3A4LA 3OMXA 5JI3E 2ADOA 1RKXA 2IRWA 4U5QA 1B1CA 2BMJA 3R77A 1EJ6A 2BZGA 1LFDB 3VC3A 1N0VC 1EK0A 2Q3HA 5ALXA 3VU9A 4EYOA 1NI4A 4DRYA 4LJ5A 1SBZA 4BTVA 1L7EA 5FPKA 1ESNA 3N6VA 4DEVA 3OG9A 3IJRA 3W1EA 1T2DA 3F7NA 4GL2A 1NY6A 4O4LB 3W3ZB 5LIPA 5IUNC 1PJCA 3W5DA 2O8BA 4Z3DA 5REQA 5T6BA 4A4DA 3QPBA 3VR1A 2G6TA 2Q7XA 2QL9A 1R6AA 3ACCA 3D7MA 1JA0A 2YHIB 3HJHA 3JXEA 3AVQA 4Q18A 3U7QA 4ZICA 1Z38A 3HH8A 3ZIDA 1J56A 1XAJA 1GQSA 1TYDE 2AOTA 3NTVA 4MYCA 1G8AA 1TVMA 3H1AA 5EWJA 3C48A 3ZGLA 4LF8B 4JR0A 1DXQA 3W4KA 5A5EA 2HA4A 1SVWA 1N6RA 2E21A 3BE5A 3JQGB 3L06A 2VXOA 3AEUB 4X1YA 2R44A 3ZJ4A 4OL9A 1YZ3A 1A3CA 3WO0A 4ZYVA 3PNLA 2OFOA 3NBUA 1DIBA 2CV2A 1ZP6A 4TXMA 2HRZA 1NLMA 1ZWKA 5FO0A 3AI7A 1KYVA 5JQGF 3UW3A 1XZPA 3QX8A 3DUFB 3UB3A 2ZUFA 4KG7A 1T6NA 1Z18A 1G4HA 2G71A 2I5PO 2YMQA 1TAHA 2DBQA 3FRHA 1OYWA 3K5WA 2R86A 3QI7A 4TWRA 4US2R 4GHWA 3A4VA 5FBHA 3ZGVA 4A5SA 5BOSA 3A6GA 3A6DA 4W8HA 2OXTA 4JKIA 1KIFA 1XU4A 2ZI7A 4CCAA 4DC0A 2V8BA 3PJEA 3RKUA 1S3GA 3EWIA 2LTAA 4JELA 1D1TA 3B38A 3TPFA 4NBLA 5BWOA 3GEIA 3R5JA 4UJ3A 2DT5A 2Y1LA 2OFWA 3GGDA 3KQOA 4LE1A 1YR8A 4LXTA 4PNHA 4US1R 2P2ZA 3JAKA 1U1FA 1Z26A 3GJTA 3K2EA 4RMGA 3TFOA 1YNOA 3UHAA 2NSHA 4MKRA 1WSWA 4BRUA 3HB1A 1IPHA 2QLLA 3O92A 2NZXA 3GIWA 4CV2A 4G1VA 4ZVNA 1TO6A 3RK1A 1E9FA 1OE0A 2E4WA 2GBPA 4N54A 4DIFA 2NQ2C 3REOA 4C1BA 4HD8A 4J91A 4JIGA 4RWEA 4X97A 1H9BA 4IZ6A 2I34A 5H9WA 1B76A 3EGCA 1I7NA 4N6NA 5FUWA 3I9NA 4HATA 3DMPA 1KU6A 1VQ1A 3OTIA 1J21A 4IDCA 3IMFA 4Q1FA 5FBZA 3CF4A 1LU9A 3TQIA 5C3UA 2F4NA 1ZM2A 4YWJA 4TX1A 5BW4A 4UD2A 2JGKA 4JLOA 2IH2A 3IESA 1K8RA 1YZHA 1JHQA 4FN5A 2W7TA 1U6IA 2AMFA 5ALKA 1VL1A 1Y9JA 2ZB3A 1H0KA 3SSAA 1ONBA 1E60A 2JZCA 3G8YA 2GA8A 3JZFA 1YJ8A 2NGRA 3KDSE 4MV9A 5AQEA 5JXGA 4DR7B 3T95A 1AV6A 4P86A 5DB4A 1QLHA 1MFPA 3FVTA 1DKNA 2CNWD 1MV5A 3BMNA 3FKQA 4R98A 4LCEA 1Q19A 3R0JA 4HS4A 5JSHA 3AM1A 3GCGA 1BS2A 4N7JA 3H2YA 3NGXA 3PD7A 3IHTA 3PUJA 2NVOA 4IDGA 4WKGA 3ZH9B 3LCVB 1KSGA 1HEYA 1EIZA 3E4DA 4DMHA 1ZQ1A 4PAWA 4UREA 1C30B 1LBSA 3OX1A 1E3WB 2QI9F 3S8YA 1RADA 2BEWB 3CSDA 4U7PB 5I7OA 4B6RA 4UAJA 5JS8A 2DQYA 3H6GA 6CHYA 3KZOA 4TQAA 2DTXA 4DCPA 5CURA 3QLUC 3DXFA 4RQTA 2DHRA 2LP4Y 2DMRA 1R4MB 1Y5LA 1NATA 4ES6A 2WILA 4L6AA 3SDBA 3VPAA 3WIUA 1ZK0A 3F5SA 1Q16A 4E32A 2XT0A 5E3HA 1NSFA 3ZHVA 3KV3O 3SK0A 3ETGA 1NUTA 3UXEA 2VHWA 5E1BA 1QKJA 2IHKA 4NJMB 4WFKA 2AJCA 1YFZA 2AN9A 3JQ9A 4Q9DA 5EJIA 1NJSA 1XKQA 3EEQA 4QEZA 3TDKA 5HIMA 4F6LA 3FY4A 4AW9A 1U4SA 4R7TA 5EMJA 1J8MF 1UPXA 2G5TA 3H5RA 1CG6A 1PT6A 1X2EA 4FR0A 3WL7A 1LDBA 2V6IA 3BCRA 2JFFA 3F5FA 4ILKA 2P75A 1RRMA 3GEEA 3VKUA 1ZJJA 2BYTA 4ZI5A 3SXUB 2RKWA 4LC9A 2XJ9A 1QHNA 3ZI7A 4E2YA 3L7CA 1WDWB 3V1LA 4Z4CA 4EW2A 1XZCA 3E27A 5A9RA 4E03A 1ONSA 2E55A 4M8IA 3IMCA 2BH9A 2FPLA 3EGXA 3GCZA 3WRWA 3ZN2A 2FMFA 4KLAA 3TGPA 3KR2A 3CUUA 1T43A 2QVBA 1FLNA 3COZA 4RPHA 4MMYB 2DLDA 2BSXA 1UQTA 4HFRA 4HS9A 4WCFA 4RGVA 1W73A 3F71A 2JRLA 4F85A 4LJYA 1IWOA 3VSCA 3IA2A 13PKA 3G23A 2VLBA 3GNLA 4HLDA 5EXDA 3K9FC 3OFVA 1AKYA 3DVLA 4YV1A 4OGGA 4D4LA 2ZRDA 3UBMA 1KP3A 3ZWDA 2YZ7A 4OHXA 4MLCA 3LUCA 5FFFA 4GX2A 3TIGA 3FLAA 4CEIA 4YRMA 3UMFA 3G9UA 3AQIA 2WFMA 1GNQA 2IIQA 2WWRA 4LJKA 4Q4JB 3P1JA 4RVHA 5LB4A 2H5JA 3ETHA 5DTQA 1FP2A 2BMVA 4B6PA 3I9FA 4XTRA 4ZV4A 2JLZA 4R0MA 1GYQA 2VSOA 3C74A 4M6WA 5HRAA 3KB2A 5CJJA 1FVXA 4M0EA 4NS1A 2VJBA 3QEMA 4Q00A 1C8VB 4ER7A 3PDWA 1IOVA 3C41J 1WP9A 4KQKA 2V03A 2Y0CA 3BBPA 1N5RA 3TTVA 1JKFA 1HG0A 4CM8B 4RACA 1HZZA 1RPJA 9ABPA 2VJNA 3R7DA 3U4DA 1P7YA 1R0RE 1R0XA 4MRVA 3BIJA 1T8SA 3E1SA 5FL7D 1ORRA 3WLOA 3KALA 3NIDB 5LZ7A 2NT3A 4R2KA 1E2JA 4HB4A 4YJKA 4YYZA 2X58A 4D79A 1P73A 3RODA 1R3DA 3FA2A 3JQ8B 1PVDA 3T12A 3ORSA 3UHFA 3ZY5A 4F84A 5CB4B 1FF9A 2PD6A 1PNRA 4RZXA 1CJUC 1CUBA 4FOLA 4QX6A 5LWHA 1XDDA 1FY2A 1TXGA 3AKCA 1B3BA 4L5CA 5J43A 2WYIA 3FF1A 3EZFA 4LRXA 4L22A 4TZTA 3WYEA 2H92A 4FSHA 2AE1A 2CW5A 1SUWA 3L07A 3Q10A 4A8HA 1ICIA 5JO9A 3P32A 2CSXA 2P41A 1JEQA 1XTJA 3F4BA 3SYNA 4MCHA 4IQFA 2UZ3A 4NDNE 2SNIE 4N5DA 3B1XA 2VZLA 3OC0A 2FE4A 1P4SA 2IHJA 4M9QA 4OXXA 5IJXA 3F73A 1WB9A 3ESDA 4G24A 4CCWA 4LK3A 3TLGB 4J75A 3ZS9A 2J5RA 4DDUA 1IDOA 4KKVA 1UBHS 4O6VA 5LNK6 1J5PA 1LW6E 4UCFA 3K6SA 3KOOA 1BX1A 3JZAA 4XLLA 4W6ZA 2QTNA 1LZLA 4G85A 2NU6B 3LDUA 4EI8A 2CHQA 2BGJA 2GZSA 4MUAA 4PGFA 4CQLA 4XX0A 2XOKD 3F9IA 1Q1AA 3QV2A 2W2XA 3AEQB 3AHGA 3I3SR 3R0VA 1DO0A 2HU5A 1Z4JA 4EY8A 4AKIA 5FTMA 2B8EA 1NIPA 1PLKA 1TJYA 1SBCA 3EHDA 4NICA 3VR2A 3ZNQA 1K1EA 3T7DA 1OA0A 2BKEA 1QP4A 3O4HA 2HR1A 3EZYA 4LCBA 5LYYA 3H1BA 3U49A 3CH5A 5DNUA 2Y77A 4D3FA 2QW0X 2HA5A 3ANLA 4BTEA 1DU4A 2QYTA 2HBYA 2RHJA 4M1QA 3VI3B 1UP6A 1AQIA 3LBIA 4B87A 4DTCA 1GZ7A 5J2UA 1FC0A 5AESA 1ZJ4A 1QF7A 3CG0A 3EA0A 4CIWA 1XDUA 4MNTA 3F8WA 5E9JA 3K2IA 5F9MA 4CTNA 3ZD7A 3IQZA 2VNKA 1KZ4A 3DL2A 2J6HA 3L0PA 3DJFA 3M6IA 5DNEA 4C0WA 1YA8A 5BSVA 2PLRA 3IXQA 1E98A 1J8FA 4QPPA 4KMSA 2GKGA 1M2FA 3HBJA 3COYA 4UULA 2A0FA 2IE0A 3NAMA 4LPKA 2PUDA 2JFQA 1HK7A 1QFXA 1W30A 2VRCA 4WKNA 2J0UA 2NADA 4MS1A 1ZJ6A 2X42A 1R37A 1P7CA 5IJWA 2P62A 3KJXA 4HFMA 5ALGA 4EATA 1EX7A 3KLMX 4DC9A 2GCOA 3WWCA 2HF7A 2ROQA 4PSDA 1BHO1 5A3VA 1PV2A 3GAZA 4TMVA 1GZUA 4ZZIA 2EGHA 4GYKA 2ZAIA 4W7IA 4ER5A 2ECKA 1YQEA 1MZPA 2YJ3A 2ZZKA 5BMVB 3DEAA 3I04A 4L9WA 1AGYA 1ZFNA 3ODPA 1T1JA 3LE8A 2OC4A 4EZBA 4GM1A 2OAP1 3HM9A 3H4VA 1K8YB 1NDUA 2B82A 4EGJA 4PTZA 1AXRA 3VH1A 3HXMA 2PXAA 2O05A 4Y67A 4DG5A 2XVAA 5TGDA 3RCBA 3ADPA 4FFSA 4Y0NA 2YQ5A 2P3QA 4RVFA 1WMAA 3FMIA 3ZG6A 3A1VA 3NV7A 3UFXA 3ZOKA 1PR3A 4JU9A 4TWAA 3R7AA 1DAOA 2EARA 5B4TA 1DX9A 2X0JA 1KHTA 3DD1A 5EWLB 2HW8A 1ZLXA 2C5GA 1P8JA 1GN8A 1HYEA 1W34A 3SLKA 3V46A 4EYSA 2FUCA 2EERA 4TL7A 4K81B 4X8OA 1MUUA 1WLYA 4GOKA 5F1YA 1XNQB 3H1TA 5EOVA 1JN0A 4ARIA 5J58A 3K35A 4Q3BA 1J42A 1UWLA 1XA4A 2JKVA 2W2LA 3GLSA 3QXJA 1JDSA 4G89A 2XNDA 1POXA 5ERXA 1ECLA 2YHAA 3RWBA 1U7WA 4WZAA 4MVJM 2E1RA 4JJIA 2MJLA 2D00A 1ADBA 5EUQB 4IWNA 4B4VA 4BKOA 4DJTA 3FROA 3JQFA 3DWEX 1XMQB 1AKMA 1I4TD 1PQUA 3DOJA 4G8CA 1Q0UA 4BGVA 3OIGA 1ZGZA 2QY9A 1KJJA 1NR7A 3UT6A 2XCIA 2A30A 3DZFA 2NQ8A 1E1YA 1MC5A 2RC6A 2QKYA 3UB2A 4ZP1A 2HK7A 2DETA 3EEOA 5FHRA 1OBVA 2P5UA 1S9HA 2P90A 1DRVA 4RWZA 3V00A 4BFTA 1Y63A 2RG7A 3LOUA 1W75A 1NBHA 3R5FA 4O4HF 3V1YA 1SEVA 5IVHA 1NQAO 4DXDA 2PV7A 3ND6A 1AGRA 2I7XA 3JR7A 3AR4A 3CMMA 4V2IA 2FSUA 1SOMA 1U6JA 2XMDA 3DBHA 3EXHB 3TNLA 2AZDA 4YACA 5I5EA 3KQWA 5C8YB 3OOEA 3U3KA 1DX4A 4EVSA 3ZY6A 2P6UA 3BRSA 3SOPA 1IXZA 1LPNA 3COPA 1OPRA 1YDFA 2AH5A 1AKEA 3MERA 3ZHOA 5CA1F 3HJFA 2VUHB 4CRWB 1Z35A 4EHBA 3ZUGA 2Q3BA 4XH9B 4LY9A 5EE0A 1SWVA 4AZ0B 5I9BA 4D45A 1M8GA 2PFSA 3BMXA 3NKLA 4EG0A 4Q9KA 2ZI9A 1EUDB 4AS1A 1FDWA 3FNQA 4TOIA 3DMTC 1Y37A 1TM7E 3D3KA 3QHAA 16PKA 3FWYA 1TKAA 3X1ZA 3EQ9A 3C6MA 1MQSA 1SIWA 5KU7A 5DBHX 5EXSA 3KQNA 2DHDA 1MKYA 4L57A 3VNSA 3CVOA 3FAZA 3TSZA 3D4LA 3K1AB 5EJ4A 4H3VA 3TMYA 4HGRA 3ZJ5A 3H2HA 3QU5A 3QKIA 3CWZA 2VHCA 2YOFA 3TUIC 3SC2A 2VIIA 3U44A 1GU0A 2V4UA 4E6EA 3RTCA 4U1RA 1WDLA 2J59A 3LDHA 2B3DA 4LF5B 5JSZB 1T6ZA 2VDOB 3TD9A 4C0JA 1QB8A 1ZR2A 3ZWCA 2F1IA 3OZSA 2C3OA 1D6NA 3GLIA 1WPGA 4IWYA 4MUXA 2IA5A 1E4EA 1YDWA 2HQOA 2PPLA 3F6PA 3MUEA 2E4AA 3AJ9A 4YAEA 3PV0A 4BWYA 3PUKA 1ESMA 2YV4A 4MUIA 1G2OA 2GBCA 1CUUA 1MZVA 2X4DA 3CVYA 4URFA 5DGCA 3M33A 5B12A 1NOIA 2YUTA 3TLJA 1FYDA 1QDEA 1HE4A 3KSZO 2AFHB 1R5NA 4MTLA 2FYTA 4ENSA 2F9LA 3A36A 3F6CA 4O2BB 1H2RS 1G20B 1UQUA 1ZGHA 4E3WA 5CFNA 1UFOA 4DSTA 1UMDB 2X22A 2J1LA 4Z9YA 3R9XA 3OZWA 2VEDA 4I1SA 3I45A 3LBYA 2B5OA 2E4VA 4Q0MA 3U16A 3MN1A 3IX7A 2WWFA 3O3NB 1EQUA 4PGAA 1T3SA 5THKA 3EGEA 3L0YA 3DL0A 3Q7SA 4GDMA 4R3WA 4YIKA 5LU9A 3RB8A 1IONA 4NE7A 2IXTA 4OB7A 2ZDHA 1PX2A 3ZE7A 4NOKA 1VI5A 2JFXA 1H1LB 1NXXA 2QVXX 5EKDA 5JFGA 3IPLA 3LT4A 2GAOA 5HMLA 2IYEA 1Y3BE 1AJEA 2QT1A 3FGPA 1XYGA 3FMPB 2O6HA 1WKCA 4JKYA 4L74A 4DSOA 3FTDA 1A5TA 2P9QA 2QF7A 2ZAMA 3NC0C 4MICA 2OFXA 2UYYA 4KR0A 4OMCA 5LQDA 1QH0A 3B9RA 2O7QA 3JALB 4FMBB 4RHFA 5IT4A 4ZVSA 4TZ6A 1XVIA 2B1JA 2PA0A 3M6MD 3W7BA 1SHZA 1RQRA 1QBGA 3ZZUA 1E5QA 4GMKA 4YJGA 3OLXA 1G9XA 4C0XA 1H8HA 3WGQA 4HV4A 2BDEA 1E2GA 4PYMA 3G2OA 4R68A 3U7GA 3HEMA 5LLTA 4LYJA 5ARBA 1PP4A 3HB7A 2QTAA 2LE0A 2XMPA 1U8TA 5D6OA 3H2BA 5DTIA 3ZWYA 4TS9A 4A2WA 1E1DA 2GJ9A 5JAHA 1OIVA 3RHFA 4X41A 5B64A 1PG0A 4JUCA 2V58A 3D8TA 4FNAA 2FU5C 3ONEA 1FRVA 3HJCA 4YFYA 3U4GA 4PXYA 2XCSB 1OBOA 2R2GA 2CLSA 1DFHA 3NM6B 5DPMA 5AM5A 5IDYA 3ZYZA 4L0CA 4HOYA 2EGGA 4X61A 4XM0A 3D7KA 1W5FA 3CLUD 2ZFUA 2QNIA 3IUJA 4A1FA 4DDKA 3ZK7A 4ENTA 3TRFA 3P9IA 3WQQA 1Q3KA 2PTHA 4BMCA 4PZPA 5IXYA 3SIXA 1M1YE 1T9BA 2ILVA 3DMGA 2HMYB 2IHYA 5AIAA 5D3QA 1HURA 5IMSA 3AU8A 5D8DA 2ZIGA 5L8VA 1VE7A 5COQA 5AVWA 1JQBA 4UXIA 2JARA 1GGMA 1UJNA 3CJQA 3I6MA 1ZU4A 2ADFA 2Y1WA 2P9ZA 2PSJA 4OBBA 3WICA 4NENA 4JY7A 5DBIA 5EMMA 1FSZA 3AHCA 4L95C 6ADHA 3FUXA 2FF5A 2QP9X 2PFKA 3D8NA 1FE8A 2KM1A 5AKXA 5LA6A 1I9CA 1NN3A 4U2KA 2GZMA 4OYHA 4KPFC 1RP1A 4L51A 2Q7DA 3ROGA 2J5KA 4KRXA 4BQRA 3IAS1 5IZCC 1WV1A 4WI1A 1U2EA 2GCPA 3A3KA 3V7WA 4HF7A 1A77A 1CDDA 5CHYA 2XUDA 1E92A 1W85A 5ETJA 3WGVA 1G3RA 2WOJA 2NACA 2ID9A 3FOAA 5TB5A 4G5HA 5JAQA 1T26A 3KE8A 3ITKA 2VTBB 3NUGA 3RAEC 3DAGA 1GA4A 2JC3A 2WQ7A 3D6FA 1HC7A 1EXMA 4L4YA 3PQ2A 2FRVA 4AZTA 2QAGB 3U7IA 1Q11A 1UBJS 1NI3A 2CMGA 2R6R1 4IIVA 4BP9A 1A8SA 5FWXA 4AO7A 1Z5WA 1JHZA 3KYCB 3LTEA 5KCMA 1TB4A 1F3OA 2JCYA 2WTAA 4N5IX 1IWPB 4DDWA 6ABPA 1SVSA 4NBKA 2FPGA 3TSWA 3IRUA 1QJ4A 2NU9B 2VUUA 3T94A 1PR2A 3IKTA 2R6GA 1PI3A 2Y68A 3OFKA 1OLSB 4HLQB 4MW4A 1M0WA 1RE1A 4KTVE 4KR9A 1JH9A 1M8JA 2O2DA 4TV8F 1O96A 3RAJA 4MB0A 1BEZA 1W5TA 1Z0UA 2PUVA 5A3QA 4DR2B 3MCVA 5G0WA 3K16A 2CGEA 1ZNWA 4KVAA 1TM5E 4BKUA 4TUYF 5BN4A 8OHMA 1LBIA 4XUCA 3AH8A 3DB2A 4JA0A 3W6PA 2Q62A 3UG6A 4O3FA 5ARDA 4R5MA 1GTSA 1VJ5A 4GC9A 1O9GA 3HA3A 1VMEA 3MC1A 4IJKA 4K5QA 3IDFA 4TKVB 5E1OA 2QQFA 2EFHB 1E6MA 2EG9A 1N3IA 4W5RA 3LPCA 4NCHA 1GUAA 2XTJA 4CT4B 3ZE9A 5FAKA 2G9NA 1L5RA 2J9XB 1ZEMA 3ZI0A 4C4TA 1OJLA 2BHRA 1H6CA 3RYCB 3PX2A 2Q1TA 1Y7LA 5K3OA 3GT7A 1Q44A 2JLUA 3QE9Y 3GLTA 2J3MA 3N2EA 4GGPA 1T0UA 2VYNA 3DE1X 1YB4A 4E2ZA 4IDFA 1M2NA 2R97A 1PV4A 1NU8A 4FC6A 5DRYA 2DFTA 1SR8A 2LCFA 1NJ1A 1CY4A 3OP1A 3RV3A 3THWA 1NMSA 1ABBA 3CF2A 1P9WA 3NBKA 5FOSA 2AK3A 4YQFA 2F3TA 3RS5A 3HCRA 4ZGGA 1P6UA 5A4DA 1MF7A 2H2HA 3G6KA 4LJLA 3BVPA 1JLMA 4M87A 4EJMA 3X1KA 1RBZA 3OHMA 5AT1A 3R2JA 3M6XA 1Y7IA 3QY0A 4HXFB 4Q4LA 4Q03A 4ZXPA 3U62A 4LA4A 2YXPX 1QRSA 5TJHA 1P33A 4Z4HA 1DRWA 2P11A 1V8DA 2MOKA 3AUFA 2GRAA 4PG6A 1EK5A 4PR3A 3L4BC 2P79A 2GPAA 1U98A 2XGSA 4A26A 1FP4A 3PLAE 1LLFA 3PQ3A 1KVTA 2A35A 2XBUA 3VVMA 1JR3E 2OZKA 1H2AS 3QXCA 4TTTS 5CUQA 5F73A 4DJDC 5KYWA 3ZZMA 1VYUA 4GP7A 4II2A 1OWMA 5K0NA 3GYBA 5HE9A 2C3UA 1TAUA 1J07A 4B74A 1IHDA 3CHYA 3EZNA 2OUIA 5A4JA 3CPJB 3K2BA 4ARCA 1SG9A 2DC1A 3DLCA 1CX9B 2UU9B 1FU4A 3VU9B 3HDQA 3ZTWA 3NKVA 2JVJA 3DL4A 1IBCA 1X1TA 2Z1MA 3KC2A 4WLEA 5FBRB 3NRCA 4ZVOA 2FWJA 4PG7A 2COUA 4IILA 5DCUA 1JKJA 3PTZA 3G7UA 1A7AA 2PGDA 1VFNA 3SI7A 1ATZA 2RHGB 2H00A 3D4OA 3D3EA 1NV9A 3NBFA 4MP6A 3AR2A 5REQB 3VJKA 3RO7A 4IX9A 1DC7A 2PKQP 3U7QB 1NXVA 1A9OA 3TRDA 3UKDA 3WRXC 3GLFA 1V5EA 4BKQA 2JK0A 2AOTB 1II9A 1UDXA 2DOKA 5KQMA 5BV8A 4ZANA 1WAMA 4BU1A 1EAMA 4KHZA 4AKEA 3BUSA 3L05A 5H80A 421PA 2H2GA 3C4QA 3PC3A 3FYTA 4HDKA 4ABYA 5C1DA 2ODNA 3ZDYB 4UEKA 4BVAA 3QJGA 2YW2A 2NV2B 2J0QA 2O1SA 3AC0A 3UK1A 1SM4A 1ZO8A 3CR7A 1DLIA 1UFKA 2PN1A 1R15A 2X2OA 2O7VA 1BGXT 3UUEA 2HRBA 1GGEA 3H83A 1H93A 3B3JA 3WYBA 2IZZA 3DDNA 5KVAA 2IH5A 4UM5A 3JQDA 5C52B 1GKIA 4MV4A 2I4NA 2VAPA 1U8UA 2WHEA 4RLFA 3KEOA 4DNPA 4EDFA 1T3ZA 5BOSB 5KTNA 1H9CA 1UMBA 1ZY2A 3P5BA 3CKLA 3E22A 4KWIA 1GL9B 3EMBA 4TN5A 4D3DA 4ENWA 1UKYA 2WZBA 1MX9A 4QTTB 2E37A 4BBJA 2FVYA 3PF9A 3V42A 5BUSA 1FPMA 4Q7JB 2QXTA 1E2KA 3IE0A 3MGCA 3RC7A 1ULZA 2I4TA 2EZ4A 3NDIA 3EOZA 2V45A 3QBVA 3LIPA 2X8AA 4RCYA 5I7SA 3R7WB 3G0BA 2IHBA 2BI4A 2BW0A 3LT2A 3QSGA 1JAHA 4HEA6 2I9KA 1J8DA 3JAKB 3DKVA 4RD1A 3MYRA 4FFDA 5JLAA 1KJYA 4JC8A 4TT3A 4I4IA 4RX1A 3Q8LA 3TO5A 1XELA 4XR4A 2Y9PB 3TUJC 3VOBA 4F3TA 2B6HA 1BHJA 4C06A 2XBLA 3N76A 4OUKX 1XHFA 1EJ0A 1XQYA 1U2GA 3GG9A 5AKYA 3DF7A 4U7DA 1X19A 3E7WA 4CIXA 4KW7A 4LRTB 1NVXQ 1JPNA 1P31A 1WPQA 4FTWA 1Q14A 4KN5A 1NNSA 2C5SA 1R7RA 2IP4A 4LECA 2XGOA 2E4YA 4OAQA 7AT1A 2E4ZA 3RF7A 5JS1A 1VIAA 3CLHA 2RGXA 4XSGA 1JHXA 4J0GA 3NHKA 1TYZA 4EPXA 4MV1A 1X8LA 3BK2A 1L9XA 1QMGA 2QRVB 2VRCD 4D4KA 2N1MA 2GI4A 2VEOA 5J40A 3HXLA 4K6OA 4ZYTA 4H7HA 3OP4A 5ALSA 3ICWA 1YJAA 5DU2A 2E9SA 1M83A 3IUPA 4N6OA 3PNMA 3KPWA 1XMPA 3NTXA 4DV0B 2BFMA 1PZGA 3WK5A 3BMNB 2R1VA 2F7SA 3IDZA 4ADSG 3IT3A 4PANA 1YQDA 4KN8A 2H52A 2REQB 2BV3A 2G7MC 1VIDA 2IEYA 4J1TA 1HFEL 5FWAA 1DQZA 5LQMA 4UTXA 1OBHA 2IYAA 1Q57A 3SC6A 2FWPA 4HRVA 1NVMB 1MJ5A 3NORA 4P38A 1W4LA 3KRTA 4YJ3A 4ZI7F 1UXIA 3ZU5A 1S2DA 1A88A 2R47A 3DMHA 3O03A 3ZWAA 3HCEA 3G88A 3OT4A 4TTQA 2P7IA 4DLTA 4BVFA 2FR8C 4NI5A 4ETNA 3N2GB 4KU4A 3H9UA 3FE2A 1TUGA 2WJIA 2IZ7A 3GFPA 4KAFA 5AH0A 3W90A 5HF9A 3ZWQA 2XB9A 1QIJA 3L4EA 3WLEA 1J5EB 4E07A 3CSUA 3RNLA 1DC5A 3T1YB 2ZI3A 2Q3FA 2AI3A 5K8LA 4V38A 2V3CC 4AAYA 4IFEA 3RRMA 3LVQE 3TD6A 4NCAA 1NLUA 3F7MA 3BTVA 3F0TA 4EI9A 1Z75A 1E99A 3EF1A 4EUNA 2TMYA 4J2TA 4FJ1A 4Q6WA 5I6DA 1EE9A 4JLWA 4CLEA 4XRRA 4LGYA 1UXOA 1KQ3A 5JCOC 4TWBA 2RE8A 2JGDB 2PMBA 2VP4A 2ZJZA 3EGXB 3OKPA 1FXSA 3B1JA 1OI2A 4MVXA 4BVLA 1IBSA 4E1AA 1Z62A 2R7AA 1L5NA 4IL5A 2IHVA 3AR5A 1WF6A 3O93A 1EXWA 3UGTA 2WSYB 5KTRA 1PS9A 1VPWA 2XCLA 2YJZA 3QVWA 4WCFB 1OXMA 5IUJC 1QTNA 1A9QA 4MI9A 1GGHA 5ED4A 4ZMRA 4EFMA 3E82A 1SCAA 4K9SA 1NMEA 2RHHA 3QTBA 4RJIA 3U17A 2WVAA 1YI0A 5D87A 5LN1A 1B0UA 4JC4A 4R01A 3S4YA 1D2GA 1WU7A 5CA0A 5BW8A 2R48A 2C58A 4G0UA 1WJGA 2Y1GA 2BF4A 3OCXA 1FFBA 4AJOA 1VSVA 4FQ7A 4XDGA 2BE9A 4F91B 3EDCA 4JVOA 4CEIB 2Z6UA 5MFPA 4JASB 3KPJA 4MV7A 3DHVA 4ESOA 2P6NA 3KLNA 3QFHA 5J4VA 3FR7A 3VR4A 5M04A 2I03A 3DDZX 4XA8A 3INYA 1T5DX 2W6IA 3N2LA 4FI3C 4D46A 4R8SA 5K8TA 4M6WB 3ZGOA 4MQ5A 5A1TA 4KO2S 3T34A 3WADA 2QL7A 4BYMA 3L0IB 5I51A 4J90A 4BNNA 1I24A 3NYQA 4DLLA 1JBEA 1YQQA 4XOIA 4FYVA 1Y33E 3TLYA 3GRYA 1WNTA 3IVXA 3KQTA 3WMFA 4QBGB 4AZSA 2ZP1A 3M5CA 1NUQA 3IUNA 5KTMA 3I2JA 2AB0A 2VDWA 3LWZA 3OWOA 3VOSA 4MROA 4H17A 3VM6A 2NU8A 3LV8A 1XLTA 1XMOB 4FBMA 1WBDA 1QIGA 1H85A 3PL5A 2OCAA 3P5SA 1KAMA 3RUFA 2JEYA 3S70A 4KK4A 2E3JA 3MQFA 3HCBA 1GYRA 4BQSA 1F0YA 1G1MA 2VP5A 2C2BA 4NU5A 1O4WA 2HHCA 5GIOE 1KQFA 2FZ5A 1SWWA 4MWDA 3M2TA 3R23A 1A50B 2G07A 2OM2A 4IYRA 2C77A 4R51A 4Y2GA 3VR6A 1XZLA 5FULA 5AJYA 4Z9BA 2X2PA 2ZUEA 3W8DA 3MIIA 5BSUA 1D5WA 1HDGO 2ZANA 5HX7A 1RZ3A 2QENA 2C88A 3SKVA 4UOEA 4EY3A 1DUVG 1A4UA 3NTOA 4L9AA 4DNXA 2MYUA 2GBLA 4N1AA 3TIXB 1DO8A 1JEQB 1U8EA 4TKLA 4WW0A 4D3XA 3A3YA 5LKAA 4LQ4A 3AVXA 5C80A 4MR8B 3L5OA 4CL8A 2Q4OA 4DR1B 1EFAA 4YXFA 1RKQA 5E4YA 2IV2X 2ZYTX 2FZEA 3I32A 4YP1A 3PC8A 3V8PA 3K6SB 2Y05A 1Z07A 4GSYA 2JGNA 4QD3A 1TQ2A 1IPEA 1CZOA 2AGVA 3KCQA 1X42A 2G7ZA 1B6TA 1IHOA 4CQLB 2CFSA 1HT0A 3N2NA 1U0JA 4FZRA 1SG0A 3IV7A 3AV3A 4NX2A 5AW6A 1E69A 2EKBA 1Z0SA 4BC1A 4AULA 1W44A 3DKIA 5T41A 4BB0A 5ICEA 3B5IA 5IF3A 2X5NA 2O3TA 1P2GA 3DAHA 3N8HA 1BW9A 4RMHA 2JZOA 3CONA 4EFKA 1D1QA 1H5UA 4AG5A 2WFAA 4WCVA 2VYQA 3ZGZA 2J5QA 2JFNA 1DXOA 2P9EA 4GE3A 1J0XO 4IIBA 1L9KA 5ICCA 2JJ2A 2O2HA 3LK7A 3CINA 1X80B 3HM2A 4ND8B 2R7LA 1PZNA 2X8BA 2C2HA 5J2UB 4RDHA 1QGOA 4D8UA 4MARA 3OQJA 4ETMA 3VPXA 1Q1NA 4NSNA 5FO1A 4I81A 5TQ2A 5DHQA 2EX0A 4NAVA 2WU0A 2NVWA 3DVAB 4IDHA 5IJAA 3EFOB 2VDPB 2GM9A 1MCZA 4KLCA 4D97A 4N47A 4A91A 3E81A 2JD0A 2DR3A 3ZHUA 4RTOA 3K96A 1UPBA 2GVNA 2JB9A 3IP9A 4PZLA 3UUGA 3WGKA 3CW9A 3MRXA 3ZCTA 4DVGA 4EF6A 1H8HD 1FNMA 2H2DA 3GNTA 4FGKA 4IP0A 4KIUA 1JLLA 5BV2P 4F92B 1QZXA 1ZU5A 1E7SA 4G8DA 4AVYA 3K0CA 1CR6A 3RSCA 3S2IA 2GESA 3I1JA 5CLLA 4C5CA 3FHOA 2F1OA 4LHWA 1R8QA 1MVOA 1DV1A 3LOQA 5CX1A 1CZNA 3OWHA 1P5JA 2AVNA 5CX4A 4URVR 5JJCA 1V11B 3JD2A 1J06A 1VL8A 2G1KA 3EWNA 3OPNA 5AK6A 5E1DA 4L73A 5JAIA 4KR3A 4PC3A 3VZQA 3X0DA 1STOA 2VOJA 2WZQA 2UVQA 3IP5A 3UYKA 1A4RA 2XCRB 4H1HA 3L9XA 3NBYC 4LXIA 1ZMBA 1DB3A 1AQ6A 3HV0A 3GVPA 4OH1A 3MW8A 1R9NA 4ETIA 3Q8KA 4LYDA 1DQSA 1Y6QA 1PWEA 1OGYA 4L6CA 1Z45A 1LK7A 3GAAA 4BMNA 2QD5A 4B3TB 3CE9A 1KA9H 4G26A 4MVJI 3WYAA 4BV9A 3CFYA 3T3HA 1UBTS 3S99A 3AK4A 1CYDA 3KDPA 3F3MA 1JJ7A 4LS3A 1T4MA 2QLBA 4MCIA 2NUAB 3VQTA 1NOJA 5BUQA 1YI1A 1ESCA 2AQKA 4LZZA 3HP4A 4YHBA 4MAMA 3FCYA 1SUFA 4RY2A 5IF9A 2O2SA 2ZWOA 4CMAA 2BGUA 2HNAA 4W9MC 4FOOA 1VG0B 2NZYA 4WZAE 2JLXA 1PSDA 2C4UA 1RNLA 4UDYX 1VPEA 5DGTA 1A98A 2HHJA 3AVWA 4GZMA 4XSHA 1H0SA 2CXNA 1I1QB 1L7AA 3LX4A 3G9QA 1AHNA 4RHUA 1VHJA 3RSQA 3VNQA 4DR4B 2CJXA 1EGAA 1FTQA 1YC5A 2H3EA 3QJYA 3THSA 3C87A 4CQMD 4EJ2A 3H42B 2IBSA 3OZEA 2YS6A 2EKLA 3T3IA 3WGLA 4HYYA 4AJ9A 4RTSA 2H1WA 1TX4B 5HWSA 3DZCA 1PZHA 3GLGE 3BXXA 3ELDA 4EUHA 3C97A 4E12A 1EMDA 2X3FA 2PKCA 3FLBA 3FSEA 3HFGA 1U1GA 2IQ5A 3MQ2A 4RGBA 5AKLA 2EF0A 1FFYA 1JR6A 5EN4A 3QU7A 2Q2WA 4TKUA 1L7RA 4HH1A 4B3IA 2A6PA 1ISFA 3OAAA 1OZ0A 2HLDD 2G1JA 3DBHB 4CTJA 1B2RA 2AG6A 2FPUA 2X2FA 1K7EB 1Z06A 2NWQA 2Z1NA 3KXPA 3M0EA 5FUXA 3U26A 1E7MA 3VMMA 5LQAA 5MDHA 2YN2A 2O8FA 3MJDA 2DECA 1J2EA 2CLHB 5A3JA 5JJIA 4KQGA 2B5VA 2X3UA 3NWPA 1U8ZA 4KOAA 4XQ0A 4CBVA 4PG8A 3W2TA 2QMQA 4Q01A 3R6DA 4MP8A 4XB6B 1QG4A 1MC8A 1P19A 4XPIA 7GPBA 2B25A 2X3YA 2HMTA 4H1WA 1QNFA 2GS9A 4PIPA 1EEHA 3O6VA 3ZPXA 1P29A 1W5AA 3NLLA 4H59A 3AOEC 2GNAA 1SHLA 3S8MA 2X76A 1LNQA 3KEFA 1HA3A 3TDMA 1J2RA 2CMKA 4GVLA 2V6FA 3ETEA 2JIQA 3KVYA 4Y2PA 3CGWA 3GGCA 4MKHA 1J7KA 2QDKA 3PQEA 1VLMA 4WA7A 4OGLA 3G5MA 3OIWA 1T4BA 2JAPA 1FFAA 4JP1A 3E3LA 4TMYA 4DTIA 2N75A 2YCBA 4NATA 3Q7PA 4QATA 3A6EA 3STVA 2JJ8A 1CK4A 3M4ZA 3SC2B 3TEJA 3AZPA 5I3ZA 1W87A 1GU7A 3WNCA 1N78A 4EPVA 3FFBA 5JRJA 1WXHA 5I7FA 1C41A 1XHLA 4WOCA 3ZDQA 2KBEA 4UUNA 5T4BA 3EYAA 4UOZA 3HN6A 4HWSA 1NTOA 4Q3CA 1MB9A 1QG6A 4ESHA 1BVYF 4DC1A 3KDAA 3RYFB 1YBAA 4NZNA 1SQGA 1I30A 2B78A 1X9HA 1E4EB 4PWYA 4HAUA 4C3ZA 5B5SA 1M67A 2R84A 2MSEB 2W48A 3WL6A 4Q3KA 4BQQA 2DSNA 3IQEA 4FKBA 4Q21A 5ALYA 5A7FA 4M99A 4J0IA 2CXHA 4IFTA 3PJGA 1MT3A 2E2WA 2V6JA 4MWOA 1XALA 4H60A 4M0PA 1JEJA 1IXRC 4A0FA 3CUKA 1HZJA 3PYMA 3UTDA 1K4KA 4EMSA 4OJTA 4YDSA 3U3ZA 3VHXB 3X1XA 2IXEA 2L2QA 3R41A 2CMHA 2G63A 2KHZA 1G0OA 2RC5A 1QTRA 3IP1A 3EUAA 4U8HA 4XLZA 3ESAA 1YE8A 5D85A 2A33A 4GU5A 2ZRPA 4QPJC 4PSUA 4G0VA 3GCWA 3EMVA 2VXCA 4WINA 4R3UC 5HVNA 1G2IA 3RS3A 1F2DA 5DWQA 3A3PA 1CY7A 5IM5A 1U0BB 3R9XB 3F47A 3I0MA 2C9OA 4L3OA 1XWWA 2OYCA 5H0IA 1T6XA 3GOQA 3IUBA 5LD2B 2AUMA 4L5JA 3BXFA 5ALVA 1MJGA 3TTYA 1H1TA 2FWNA 2Y6VA 3FVQA 2GLXA 1Q2UA 1ULUA 2CJPA 1L5VA 4Q7LA 4DYVA 3LKDA 5EIEA 1QYXA 2FWMX 4GMDA 3KNZA 4QNNA 2BTQB 4RV9A 3PU6A 1TADA 5IC4A 3U4QA 2IYLD 5T64A 3BGWA 4Y2HA 2C7PA 3OE7D 1RYYA 1XZEA 3M2PA 3WXBA 1OWLA 3ESRA 3A70A 5IX8A 2YKGA 4OIMA 5DTJA 4BVHA 2Q5QA 1DMSA 3IIJA 4EG1A 1DZ3A 2W71A 3C45A 1SPXA 3CN9A 5F3WB 2O19A 3I76A 1YOBA 4JMPA 2NMVA 4I2VA 1UKEA 1TGVA 4N7MA 3EFHA 4IXTA 3C3CA 4B71A 5HK9A 3V8EA 5DYWA 3HI4A 1Y9EA 4UVIA 4BVKA 4RA9B 4C1NA 5KEIA 3ZIUA 3PQFA 1JHRA 4UBJA 3ICEA 2B8WA 4WFQA 5A0VA 2MR5A 3EXIB 3V7YA 4HVLA 1YR7A 2G9VA 2DFNA 3CF0A 4YJGB 2O57A 4W5QA 3Q2KA 1D03A 4M86A 1EQ2A 1N2CA 1RCFA 5AXDA 1AUQA 2FRDA 5C7IO 3AHJA 5TC4A 4CMJA 1YDEA 3IHLA 2I2BA 1LI4A 4Z7NB 2QTTA 4QM6A 1DOZA 3ULKA 2F3SA 3O8DA 5KKAA 4CU5A 4L28A 2I67A 1IY9A 2HMAA 5AHRA 1PS8A 5D5QA 4LSZA 1BXKA 2X9NA 1JWAB 1P7WA 1BFKA 3A9TA 4I19A 3UUWA 1CLUA 1RC8A 2JAOA 2PWAA 2M98A 4P3NA 1JF8A 5CEJA 1KSHA 2PD3A 2Y1DA 1Z6XA 2VZEA 4G25A 3STTA 4BEBA 2IDKA 3IYLW 3LIIA 4YAJA 3ZCPA 1Z4KA 4QIHA 1MQAA 4Q15A 4GICA 1ZH4A 5ALWA 2O3JA 1PDWA 2BFOA 4U3JA 5ALPA 2VNJA 1ZICA 3AKYA 5FRDA 1FP7A 4FYXA 4TT3D 3E18A 3NU1A 1VLLA 1U9YA 1P9LA 1EAYA 1WZNA 2KSQA 2CEKA 3ED5A 3V32A 1VDZA 1ISHA 3A7DA 1CYEA 4XFDA 4A82A 4PFQA 5KO2A 1YFKA 4QOSA 1CFZA 1ZINA 2P3SA 5G1NA 1NXOA 4H6VA 4RFSB 4GYYA 2P9GA 4E2FA 4NENB 2A0XA 4LHSA 3JS5A 3H13A 5CK4A 5DP1A 1K6JA 3QEJA 5LA6B 2QMUA 1KI4A 2UV8A 1A5AB 3KZ1E 1ZAYA 1YJ5A 2DPXA 2WFZA 5FLKA 3KL4A 4BLQA 5EJ6A 1BHSA 1YHNA 2XA2A 4GMGA 1BXGA 4LXHA 1JFTA 4N7BA 1L1RA 3D8HA 5JW6A 4CQMB 1KMQA 2H7CA 2Q07A 3L7DA 1EUYA 1ENPA 4YQZA 1HE2A 4WK6A 1W85B 1XAHA 2AWNA 3LKBA 1AUPA 1JG3A 3K73O 3OCCA 2EXXA 4KN6A 1AKWA 1NM5C 4OBEA 3ZE6A 4TZKA 3B6JA 3C39A 1BVHA 4AJNA 3CURA 1H2YA 4LTDA 5LXTA 1Q20A 3OX4A 1VMKA 4MKXA 4BMYA 5HXAA 5FBWB 4P34A 3TKYA 3VU1A 1P0IA 4F8EA 3C7DB 1QHIA 3FOFC 3GJ0A 4K6GA 1L5YA 2EBWA 3LYUA 1B6GA 4U2CA 2FPGB 1TMKA 2WVJA 5TPWA 4R71A 2XLBA 3RU9A 1TO2E 2NSLA 2YINC 1U0GA 4GLOA 1VKJA 4JEIA 4BGIA 3WQBA 1UXGA 3D0OA 2WWTA 3EY4A 1KF0A 3BTUA 3AWIA 3BWXA 3CWCA 4TKMA 1T8WA 1EDOA 1E7WA 4IXWA 5BN4B 1Q15A 5AJZA 3AZQA 3WWZA 2Q3CA 4MWCA 2BFPA 2PIAA 4QFBA 2LD4A 4QVKA 2JHPA 3ILHA 1OT5A 1V3QE 3UAGA 2HOQA 1DRJA 3CBQA 1YK1A 2RGRA 1KK2A 1KI7A 1JUDA 1NQ5A 5COAA 3H75A 1Z6ZA 4EVQA 3Q7IA 3MFQA 4F56A 1ZJWA 1MAVA 2OHOA 2PSEA 4FLFA 3AHEA 2VS1A 3LW7A 3OQVA 4HMOA 5P8WA 1ESDA 3I4FA 1BMDA 1THTA 1UBMS 2ZBFA 5J4HA 4IIGA 4W4TA 2NZ2A 4RPKA 4X45A 5DM1A 1GG5A 2RB5A 3B2QA 4YRJA 1J2JA 3IAS6 3THWB 2V0GA 3D5TA 4LZAA 2IF2A 1G291 3KSUA 4PZUA 1AE1A 4I9GA 4UKDA 3G0HA 1UIMA 3UAVA 3D2LA 3BGSA 3H8SA 4XIFA 1OXTA 3AB8A 4RSGA 2IUUA 3IJ5A 1EVLA 3CNNA 4K9RA 1FTSA 4MK4A 3X1JA 1GEGA 2HPVA 1IQPA 1I4EB 3E8MA 5KYUA 3E84A 5BN5A 5FQOA 1I2AA 1V3UA 1QYVA 3P9PA 1VG1A 3WVNA 1Z33A 1IM8A 2W0MA 1J70A 4RE6A 4WKPA 1JA9A 4I46A 4TTSA 5DGIA 4LY3A 1FP4B 1XTBA 3H4MA 3OZVA 3SVLA 4TYNA 2IYVA 2BMDA 1IJEA 4UBOA 4D9NA 2UKDA 2GN2A 2W6ID 1A7JA 3C8DA 4TXNA 2H48A 1TVKA 2IY8A 3IAFA 2JFZA 3LPNA 3VO9A 5GVSA 1SVMA 1KYZA 3LUKA 4DIEA 2BCGY 1HMPA 1XRLA 2OVFA 4EHLA 4RKFA 1U0OC 4PHFA 2I91A 3C1TA 2XQVA 4EKDA 2DWCA 4YHHB 3ECAA 1VJDA 4ZYWA 4TMKA 3KSBC 3QUCA 2FI1A 4QFMA 1CDZA 1NL3A 2Q45A 1F8XA 1H4VB 3OT5A 4O4JA 3ZCVA 3TF5A 4F4DA 4JKOA 4DLZA 3SF8A 1ZM4A 4L8LA 3J7AC 4FEEA 1JKJB 2OE2A 5ENDA 1DBPA 3CKMA 3GD5A 2ON6A 2EJCA 2X13A 1VKHA 1HQKA 2VZ0A 2OAEA 3OESA 4IIYA 4LMPA 3B1VA 2WUEA 4HMPA 5AMXA 3D31A 3KQVA 1O4VA 4LI0A 5JXHA 3DAFA 1OAOA 5E6RA 3T7JA 3GLFB 4UNIA 4RD6A 1Q3TA 2PWBA 1E3IA 2AFIA 3PQ8A 1EVIA 1GRCA 1P7VA 4L50A 2BFDA 1L5LA 1S8AA 4FE3A 1DUIA 3TPCA 3ZQUA 1LBEA 1N0UA 1MA3A 2J85A 3HBMA 1HLDA 4HDKB 3UJHA 3R5TA 4A0RA 4DNQA 3KKKA 3P2MA 4J49A 1ADGA 4LFCB 4Y6GB 2GILA 1Z36A 3HC7A 3NDRA 4EAAA 2ZQZA 3L7AA 1CVRA 1JS1X 1CRQA 3DOHA 5HBGA 1QRTA 4UE3S 2O5CA 1GFZA 2FEWB 2PANA 1NVWQ 2B2NA 4QQRA 4WXYB 3FYUA 3I09A 4PU0A 3BA6A 1RHMA 3M1IA 5F7JA 4DM7A 1KRHA 3LUJA 1R50A 4URYR 3TLZA 3EXHC 4CEHB 4DF3A 2CKMA 3E22B 1V37A 3D0KA 2YN0A 2H6EA 2AQIA 1N32B 3G2PA 3L6UA 3UY4A 4ARZA 2BHTA 3OZDA 2OQVA 5KVQA 1QVVA 4AMGA 1XK6A 1TYAE 3GFGA 3EMKA 2ZSHA 3S2UA 1I4LD 4K7JA 3INTA 1XQ9A 1DOHA 4B85A 4DL9A 4UMFA 4UTVA 5IW8A 2H4FA 1G5PA 3OTWA 3G1UA 4G4SO 3UK0A 4MITA 2DQZA 2P9FA 4CLXA 4E1VA 2WMYA 1W2HA 4KQ9A 3RWMB 4ALJA 4P1ZA 2PMWB 2HSWA 4H1UA 1Y1LA 1JAIA 4LQDA 2WG0A 4C14A 2PUFA 5L3SA 4GLJA 1L7MA 3R3ZA 4RL4A 2XKBA 3LTNC 2J3HA 1T6YA 3LHSA 3RPEA 1T0IA 1V25A 2DYKA 4DM3A 2OV1A 2VQEB 3P0JA 1RJWA 2SICE 4RS4A 1SOVA 4G2NA 1H8EA 3GJ3A 2ZWVA 2XNCA 4WASA 5CNIA 2P8JA 2Y0DA 1ORDA 4PVCA 4KITB 3C7CB 3ZX5A 4YRAA 1K66A 4K40A 4L2IB 1LCIA 3E4CA 2LVBA 3SBDA 3T5BA 1Y1RA 1IN5A 3GH3A 3KOZA 1UDBA 5ER9A 1TT5A 3CXRA 1QRAA 1W88B 3EUWA 2KMLA 4FD2A 4UPEA 3BWCA 3ROMA 2GEJA 5KWIA 1UC5B 5F76A 4KO3S 2FGJA 2PSHA 2R1VB 4OIFA 1W96A 3OOHA 3TX6A 2JI4A 3S5JA 1EXDA 3EW7A 2HJGA 2Q8QA 2FLKA 3BEOA 3OU7A 4ND6A 1U65A 2FSIA 4LYGA 4YJ3F 3EIUA 1TVCA 1XD8A 2I2XB 3CH4B 2WUFA 5CIQA 2BJVA 2PGXA 1BYUA 2IOFK 3QEAZ 3PQCA 3OU2A 2RGDA 4G37A 3HCOA 1U11A 1GKYA 4Z8YA 2R60A 1JMKC 4YJ3B 3V55A 2BGTA 4QKQA 4BQNA 1VHTA 5GV8A 4ZVQA 1ZRNA 3T4PA 1WKBA 3QYPA 3PKZA 1P9RA 4ETWA 5HS4A 3OTOB 5KJ1A 5GZ6A 2JBHA 1IUOA 1PBTA 1VZ3A 1GZHB 2R62A 4CF6A 1YVEI 4CG0A 2WKWA 5IYZB 3KKPA 3ESCA 4JVNA 4YAKA 1E3LA 3R7FA 3UAYA 4FMDB 4NPAA 3H9EO 2EW8A 1U1CA 2B4TO 1I7LA 3OQIA 1E94E 2QSUA 3PDUA 1V3TA 5AW8A 1RABA 5KJEA 1U1EA 3FDJA 1EVJA 1HTWA 1IHXA 3T5MA 4AZVA 3OU6A 3BFVA 2BFFB 4L85A 1VI2A 5ADWA 2YW9A 3LQYA 4I66A 1CR0A 1ECBA 3G1TA 1M75A 4WLVA 4PAMA 5H59A 3IUYA 4DJAA 4PZ9A 4ZU1X 1MXFA 2QPTA 1YJBA 4EJ0A 3M4JA 3CRQA 3OA2A 4LRUA 1WCWA 1EHYA 3TB6A 3VC7A 3DMRA 1UAYA 2BMEA 3KOMA 3BWVA 2G9UA 4U63A 3VR4H 3FVRA 1F6BA 1WSBA 1VL5A 3O1HB 4LY6A 3PA6A 2I2DA 5JNTA 4WH0A 2OQ2A 4NXMB 4QQFA 2HQRA 3NHYA 2FX2A 3ESZA 5JNUA 1VE9A 1JG2A 2C82A 1KVRA 3HXOA 1BX3A 1LK5A 1XR3A 1KS2A 1N5OX 2VT2A 1HGXA 3RUHA 2JCBA 4K1XA 5CA0F 3L43A 1IXSB 4A2QA 2RHTA 2C7RA 4B3HA 1I2CA 5JZMA 4YJFA 3A10A 2XRYA 3SE7A 2JBAB 3DF9A 5ALMA 5LUBA 5JYBA 1SQFA 4KGDA 3W3AA 4F04A 1PUJA 2Q5CA 1V8OA 1PAUA 4TLAA 4Y6LA 5LBUA 3DW3X 2HWWA 4Z3OA 3KWJA 1XVTA 3CSSA 4U2EA 5MGNA 4OCZA 2W93A 2FSGA 2HWUA 2QP4A 2WJPA 4FZJA 5K5EA 1XMVA 2F8LA 3VR6H 2O0MA 3GRPA 4PEVA 1BAPA 1BKSB 1L4HA 4D25A 4MW1A 4HP8A 3SEZA 3WGHA 1RC1A 3RYTC 1GCOA 3PPIA 4JXKA 3I3OA 4YMVA 1OWNA 3BS4A 4YAWA 4X91A 4FD3A 1TLTA 4KQIA 1GCGA 2XZTA 3FNFA 3Q5GA 2OBBA 3LA6A 2JBWA 4NZPA 1OSNA 5T3UA 1GUZA 1FNDA 2CJWA 4FYYA 4Y18A 1OFIA 5DN9A 5K3CA 5GZ3A 2V55B 5KOHA 5D01A 1FDUA 1OU4A 1OLOA 1TK3A 4DA6A 1QX4A 3LCCA 3V8QA 3ERCA 2P5TB 4XM1A 4RYDA 3L41A 3GIDA 1JEYB 4CI9A 1QB7A 3G8AA 4A8JC 5HRUA 3AXTA 5T4EA 1I3LA 1DBWA 4ZXFA 1TFRA 3HCWA 3I9OA 1OF1A 2OWDA 3QBJA 3TQOA 2UZ1A 5C3MA 3L92A 4FLEA 1ECCA 3F49S 1AQUA 1MQ9A 5D84A 5ALTA 4MZDA 3UMSA 5BN3A 3SJCA 4O2RA 1G7SA 1LI5A 2DH6A 1Z5PA 5CNMA 5JNVA 3FUWA 3Q9LA 1T10A 1FFGA 1Z2DA 2DH5A 1Q7EA 4Y2JA 1I1OA 1P2SA 1JXAA 2H51A 4RPIA 6PFKA 1O97C 2WF6A 4LJ6A 4R69A 4X3OA 4JGGA 3RSSA 4UAUA 4DPKA 3PUYA 3D8BA 3K05A 5AKIA 1HWYA 3KJEA 3NHRA 1UPTA 1JPJA 4L5YA 2YYZA 2BSQA 3HO1A 2XTMA 5KYNA 2GXSA 3GLVA 2OY0A 1RWVA 2QAGC 4D6YA 3OZRA 4BOYA 1NPYA 4MW7A 4NS4A 4KC0A 1J7JA 1ZN7A 5M7EA 4BNDB 2CLLB 3DWFA 5CFOA 2D7JA 1QV7A 3M5WA 3TFQA 1FZTA 2HSDA 4JA2A 2X0EA 1FDSA 2BMFA 4X8LA 9MHTA 4C4SA 3LO5A 3Q12A 4NFYA 1OXVA 2ORED 5EXXA 1B6RA 4YVFA 4L9RA 1Q0HA 3OOWA 4D02A 3JQ7A 3O1LA 3AHDA 1WUIS 3IP3A 2JFPA 4ITUA 1LX7A 3O4RA 5JEEA 2JGRA 3H99A 1XXLA 5CPFA 3L8EA 5HUHA 4FFRA 2BEJA 1BW9B 2BJHA 2FW7A 3L8FA 3NOOA 5ALHA 4U4AA 5A2QA 1MRZA 4AUMA 1YTUA 4NC9A 1VHDA 1YJCA 4F4FA 3X2SA 2B0JA 5A4FS 4NY1A 1I2MA 2Q8PA 4C4XA 1VG9B 3L40A 4QA9A 2Q5HA 3PGMA 3RRYA 5JJ5A 2M9MA 3IHKA 1RMQA 1Z5VA 3TRIA 4PWZA 3USCS 1CD5A 3CKKA 1R4AA 3D0QA 5HPYB 4X6XA 1GL3A 3HB0A 2I3DA 3NOQA 5TQ2B 5JFTA 2BHLA 3TB4A 4ZEVA 1U2SA 1ND6A 1UBEA 2IDMA 2NSYA 3K8ZA 1YR3A 2IS2A 2PUJA 3CLVA 2P6RA 5EJFA 3SU8A 2PQMA 2QUAA 5KAMA 4HWTA 3RFUA 5DXFA 1C0EA 5C46F 1J2YA 4R0VA 5F33A 4CTKA 2GN1A 5AUNB 3SM3A 1JLLB 1BEUB 4JENA 1WMDA 1A9TA 1FPQA 2LR0A 2O0JA 1P2VA 3E15A 4YN3A 5KMGB 3SX4A 2F3PA 1GPLA 1JLSA 1ZHFA 1JXOA 3GDWA 3GP3A 2I8AA 4M1YA 1U4OA 2XZPA 4NAUA 4OYYA 3TVTA 5GJBA 2QMHA 2O9JA 1XYVA 2O2YA 5ENVA 2WHXA 4J0KA 4K28A 4MJXA 2AF4C 5CX1B 3BWYA 4JXJA 2WW8A 1PV1A 1XCGB 4H0NA 1Z8NA 5AHXA 2PX2A 4EHIA 4MS4B 4H15A 5BRNA 4LE2A 1T5BA 2C3MA 4QEKA 1ZD3A 5EMKA 3N0TA 1NNLA 2WMOB 4RXUA 4BV3A 1Z0DA 1N25A 4CETA 4CIVA 2KLBA 1P60A 4AJ2A 1KYXA 1N2BA 3M34A 5FL3A 4N8DA 3DHNA 5LP6B 4QNMA 1CB7A 2IVFA 1COWD 1I33A 2W2PA 4EWLA 2I1VB 4JAVC 4E4TA 4KE7A 4ZOEA 4C78A 1Z16A 4YRNA 3C3EA 1IRXA 2D3TA 4QDJA 2CKDA 4Y2QA 1DPGA 3F1KA 4CGYA 1QKKA 2O8EB 3REQA 1CHDA 5KKCA 3P9KA 2P1ZA 3BX1A 2W2VA 3I6BA 2ATCA 1CF4A 3BWBA 1EQAA 1H94A 3G7SA 4O33A 3ZWVA 4PYJA 5DI9A 2HEGA 4YRIA 3ZLVA 1I2ZA 4DV2B 3QF4B 4WVFA 4YRKA 3HKBA 3ACDA 3T9CA 1Q0QA 3L46A 4D5EA 2OENG 3HVHA 4H0FA 5CG1A 5DMHA 3DS8A 3KE9A 4IHKA 4K9NA 3X3HA 2PSFA 4BO0A 3GFTA 4FS3A 1XAIA 3PB3A 2ZWPA 3R6WA 1H3NA 2Q6VA 1V48A 4FMCF 4AMUA 4UBNA 4OM8A 121PA 1EFRA 3OIFA 4JI1B 4F5EA 1EZ4A 4YCLA 5DI3A 2D1FA 1W94A 3E9RA 3FXAA 3SEAA 4KMOA 2CUKA 4IF6A 4MQEB 4RF5A 3GEBA 4UTZA 4ZAXA 4HSEA 3B6EA 3FNHA 3KXDA 4PR0A 1JECA 2VT7A 5HCNA 5BV7A 4FOPA 5JD3A 5C18A 4PO3X 3FZNA 1P91A 4QG7A 4IR7A 5T4FA 3KR0A 1XZJA 4ACBA 4DMGA 4NU0A 3QSYA 3FTPA 3IBSA 2FSFA 1F0NA 1F3LA 3QW2A 2O8FB 3IEPA 3S1AB 4I1PA 1M2KA 4IOJA 5F2OA 2WHYA 1PGOA 4C0AC 2G3YA 1HV8A 3NIGB 4QTXA 5CP8A 5CVJA 4OHBA 4DPMA 3OF2A 2ST1A 2RCNA 3OE1A 3S7ZA 3DDOA 3HO8A 1PJBA 3JQPA 4ND7A 2V6GA 4M9ZA 1BKDR 3V1MA 1PFUA 3AM4A 3GARA 3T5PA 1V9SA 3CLUC 5CIYA 4B7UA 3I5XA 4P4UA 1K4MA 3RSZA 4Q4AA 2BCJQ 2WTNA 5JVDA 1H2BA 3PVSA 2PH5A 1KZ6A 4N5HX 1TEXA 1XLWA 2CFTA 3PFNA 4JLNA 2NUTB 3O94A 5JJLA 4B6EA 3AUTA 4GQIA 5AJXA 4ZDIA 2JCXA 2PMKA 4TVBA 1XMJA 3WG9A 6LDHA 4J7AA 1ZM9A 1LRKA 3BERA 4ZO6A 3QWIA 5HJ5A 1H6AA 3OHSX 1DJMA 2MIIA 1AOXA 4M7OA 4ZALA 5GM2A 5HGJA 3T7SA 1RWWA 3O2QB 3UJCA 5EYPB 1C3LA 1CQIA 3ZHCA 1DQRA 1Y1PA 1NA5A 1T8TA 2CLEB 4BN0A 3EG9A 3FPGA 1FW6A 2DLNA 2WAOA 4CIAA 2FUKA 3S6JA 2O2XA 2PK3A 3ZDEA 1WDMA 2EX1A 2OB1A 2P0AA 1AMOA 3SIWA 2CV0A 2VP6A 2F64A 4RKQA 1DFGA 3Q6IA 4HNUA 1N36B 1Y8QA 5ELXA 1N6PA 3QEOA 4B4UA 1G7RA 1UKVY 2H63A 2NOAA 3DE6X 4IJVA 1XWFA 4IS3A 5IAEA 4P8RA 4J7XA 4EJSB 1C7RA 4NU6A 1GFSA 4OHKA 3ZX4A 2OBXA 4PO9A 1L5ZA 4KPUA 1GNSA 3H5TA 4DMMA 1E3EA 3OQPA 4B6OA 5ICSA 4E51A 1B6SA 1YNSA 2OCPA 2Z8YM 4A6XA 2HCBA 3F8SA 2FA9A 2ZSEA 4D4IA 3QI2A 1E8DA 1VLZA 3QXXA 2Z3WA 2I9PA 2VDRB 4XVUA 4KDEA 4ZI3A 4N0DA 1YHYA 4XEHA 3AILA 3VBEA 4TYPA 4C4YA 4OHWA 2WQZA 4Z86A 3AGQA 1RYMA 3RIEA 3GLRA 1GQ2A 4D9HA 4DARA 2ID7A 4X71A 5GY7A 2FDCA 1EFPA 3V34A 1MO5A 3AG5A 2W6OA 3WBBA 3HY3A 3PLNA 3BG5A 3WIDA 4P93A 3C8MA 1J9ZA 4MUHA 3A1FA 5C5EA 3CX4A 4WACA 1OWOA 4D43A 2QJTA 1S8NA 3DZJA 3U4QB 2ZIEA 4ZDWA 2Y92A 3PC2A 5EXTA 1YA4A 4Q19A 3UENA 1W0JA 2W9XA 2ZUUA 2ODEA 3EDMA 3I2IA 4JL5A 3JQ9C 4PX2A 3VHQA 1XCLA 4J3JA 4TL9A 5DH9A 4AX4A 5LVAA 1UC8A 1YRQA 2CVZA 2OK7A 3DFMA 4F71A