4WKTA

N-alkylboronic acid inhibitors reveal determinants of ligand specificity in the quorum-quenching and siderophore biosynthetic enzyme pvdq
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
165
structure length
165
Chain Sequence
PTGLAADIRWTAYGVPHIRAKDERGLGYGIGYAYARDNACLLAEEIVTARGERARYFGSEGKSSAELDNLPSDIFYAWLNQPEALQAFWQAQTPAVRQLLEGYAAGFNRFLREADGKTTSCLGQPWLRAIATDDLLRLTRRLLVEGGVGQFADALVAAAPPGAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-homoserine lactone acylase PvdQ
publication title n-Alkylboronic Acid Inhibitors Reveal Determinants of Ligand Specificity in the Quorum-Quenching and Siderophore Biosynthetic Enzyme PvdQ.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 165
sequence length 165
ec nomenclature ec 3.5.1.97: Acyl-homoserine-lactone acylase.
pdb deposition date 2014-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 4wktA00
1AJQA 4YFBA 4HSTA 4HSRA 4WKVA 1GK1A 1JW0A 2AE5A 4E55A 1OR0A 1JVZA 3JTQA 1JX9A 2WYEA 3L94A 3SRAA 1PNLA 3SRBA 1FXVA 3S8RA 1GM8A 1AJNA 2WYDA 1KECA 1K7DA 1AI5A 1K5QA 1PNMA 4WKSA 1PNKA 3K3WA 4WKTA 1H2GA 4YFAA 1FXHA 1GM7A 3SRCA 2ADVA 1GK9A 4E56A 1AI4A 1CP9A 1FM2A 1GK0A 1GKFA 4PEMA 1E3AA 4YF9A 1K5SA 2WYCA 1AJPA 1AI7A 4M1JA 1GHDA 2AE4A 4E57A 1AI6A 3ML0A 4PELA 3L91A 2WYBA 2AE3A 4K2FA 4WKUA 1KEHA 3JTRA 1GM9A 4BTHA 4K2GA
chains in the Genus database with same CATH superfamily
1AJQA 4YFBA 4HSTA 4HSRA 4WKVA 1GK1A 1JW0A 2AE5A 4E55A 1OR0A 1JVZA 3JTQA 1JX9A 2WYEA 3L94A 3SRAA 1PNLA 3SRBA 1FXVA 3S8RA 1GM8A 1AJNA 2WYDA 1KECA 1K7DA 1AI5A 1K5QA 1PNMA 4WKSA 1PNKA 3K3WA 4WKTA 1H2GA 4YFAA 1FXHA 1GM7A 3SRCA 2ADVA 1GK9A 3FGTA 4BWCA 4E56A 1AI4A 1CP9A 1FM2A 1GK0A 1GKFA 4PEMA 1E3AA 4YF9A 1K5SA 2WYCA 1AJPA 1AI7A 4M1JA 1GHDA 2AE4A 4E57A 1AI6A 3ML0A 4PELA 3L91A 2WYBA 2AE3A 4K2FA 4WKUA 1KEHA 3JTRA 1GM9A 4BTHA 4K2GA 3FGRA
chains in the Genus database with same CATH topology
1AJQA 4YFBA 4HSTA 4HSRA 4WKVA 1GK1A 1JW0A 2AE5A 4E55A 1OR0A 1JVZA 3JTQA 1JX9A 2WYEA 3L94A 3SRAA 1PNLA 3SRBA 1FXVA 3S8RA 1GM8A 1AJNA 2WYDA 1KECA 1K7DA 1AI5A 1K5QA 1PNMA 4WKSA 1PNKA 3K3WA 4WKTA 1H2GA 4YFAA 1FXHA 1GM7A 3SRCA 2ADVA 1GK9A 4E56A 1AI4A 1CP9A 1FM2A 1GK0A 1GKFA 4PEMA 1E3AA 4YF9A 1K5SA 2WYCA 1AJPA 1AI7A 4M1JA 1GHDA 2AE4A 4E57A 1AI6A 3ML0A 4PELA 3L91A 2WYBA 2AE3A 4K2FA 4WKUA 1KEHA 3JTRA 1GM9A 4BTHA 4K2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AJQ A;  4YFB A;  4HST A;  4HSR A;  4WKV A;  1GK1 A;  1JW0 A;  2AE5 A;  4E55 A;  1OR0 A;  1JVZ A;  3JTQ A;  1JX9 A;  2WYE A;  3L94 A;  3SRA A;  1PNL A;  3SRB A;  1FXV A;  3S8R A;  1GM8 A;  1AJN A;  2WYD A;  1KEC A;  1K7D A;  1AI5 A;  1K5Q A;  1PNM A;  4WKS A;  1PNK A;  3K3W A;  4WKT A;  1H2G A;  4YFA A;  1FXH A;  1GM7 A;  3SRC A;  2ADV A;  1GK9 A;  4E56 A;  1AI4 A;  1CP9 A;  1FM2 A;  1GK0 A;  1GKF A;  4PEM A;  1E3A A;  4YF9 A;  1K5S A;  2WYC A;  1AJP A;  1AI7 A;  4M1J A;  1GHD A;  2AE4 A;  4E57 A;  1AI6 A;  3ML0 A;  4PEL A;  3L91 A;  2WYB A;  2AE3 A;  4K2F A;  4WKU A;  1KEH A;  3JTR A;  1GM9 A;  4BTH A;  4K2G A; 
#chains in the Genus database with same CATH topology
 1AJQ A;  4YFB A;  4HST A;  4HSR A;  4WKV A;  1GK1 A;  1JW0 A;  2AE5 A;  4E55 A;  1OR0 A;  1JVZ A;  3JTQ A;  1JX9 A;  2WYE A;  3L94 A;  3SRA A;  1PNL A;  3SRB A;  1FXV A;  3S8R A;  1GM8 A;  1AJN A;  2WYD A;  1KEC A;  1K7D A;  1AI5 A;  1K5Q A;  1PNM A;  4WKS A;  1PNK A;  3K3W A;  4WKT A;  1H2G A;  4YFA A;  1FXH A;  1GM7 A;  3SRC A;  2ADV A;  1GK9 A;  3FGT A;  4BWC A;  4E56 A;  1AI4 A;  1CP9 A;  1FM2 A;  1GK0 A;  1GKF A;  4PEM A;  1E3A A;  4YF9 A;  1K5S A;  2WYC A;  1AJP A;  1AI7 A;  4M1J A;  1GHD A;  2AE4 A;  4E57 A;  1AI6 A;  3ML0 A;  4PEL A;  3L91 A;  2WYB A;  2AE3 A;  4K2F A;  4WKU A;  1KEH A;  3JTR A;  1GM9 A;  4BTH A;  4K2G A;  3FGR A; 
#chains in the Genus database with same CATH homology
 1AJQ A;  4YFB A;  4HST A;  4HSR A;  4WKV A;  1GK1 A;  1JW0 A;  2AE5 A;  4E55 A;  1OR0 A;  1JVZ A;  3JTQ A;  1JX9 A;  2WYE A;  3L94 A;  3SRA A;  1PNL A;  3SRB A;  1FXV A;  3S8R A;  1GM8 A;  1AJN A;  2WYD A;  1KEC A;  1K7D A;  1AI5 A;  1K5Q A;  1PNM A;  4WKS A;  1PNK A;  3K3W A;  4WKT A;  1H2G A;  4YFA A;  1FXH A;  1GM7 A;  3SRC A;  2ADV A;  1GK9 A;  4E56 A;  1AI4 A;  1CP9 A;  1FM2 A;  1GK0 A;  1GKF A;  4PEM A;  1E3A A;  4YF9 A;  1K5S A;  2WYC A;  1AJP A;  1AI7 A;  4M1J A;  1GHD A;  2AE4 A;  4E57 A;  1AI6 A;  3ML0 A;  4PEL A;  3L91 A;  2WYB A;  2AE3 A;  4K2F A;  4WKU A;  1KEH A;  3JTR A;  1GM9 A;  4BTH A;  4K2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...