4WKXA

Reversible s-nitrosylation in an engineered mutant of pseudomonas aeruginosa azurin with red copper site
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGENWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALHKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversible S-Nitrosylation in an Engineered Mutant of Pseudomonas aeruginosa Azurin with Red Copper Site
rcsb
molecule keywords Azurin
molecule tags Oxidoreductase
source organism Pseudomonas aeruginosa
total genus 28
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4wkxA00
1JXDA 1GY1A 2EIMB 4K9JA 1GY2A 1KDJA 4N4YB 1E5ZA 3EF4A 4QKTA 3AZUA 2GI0A 4A68A 1WS8A 1OE3A 3NJJA 2PCYA 1J9TA 3ABKB 4E9YA 2ZOOA 3WIAA 1JXFA 2UXVA 1DZ0A 1IBZA 3QQXA 1OV8A 4P5SA 2BP0A 4FAAB 5B7EA 2PP8A 1QHQA 1JOIA 1PAZA 1XMEB 4FA7B 1SNRA 4YSQA 3FYIB 2UX7A 3ABLB 4YVNA 5D4HA 3X1NA 2FNWA 2FT6A 3ABMB 2DYSB 4KOBA 2QPDB 3AW5A 4Q8BA 4AKOA 1X9RA 3TBCA 3BQVA 3PCYA 4YSRA 3PXLA 4DP7X 1AR1B 2HRHA 1JXGA 1CYWA 1SDDA 1ADWA 5I6KA 1GW0A 4YSAA 3GDCA 4KNTA 2J56A 1OCCB 3OMNB 2VMJA 1ZPUA 1ZIBA 1ET8A 3SQRA 3AG2B 4TXVB 2UXFA 2PLTA 3MX0B 2AANA 3WNJA 3KW8A 3WNIA 3AY2A 4BDVB 1FWXA 3OMAB 4KNSA 1OOWA 4NB7A 3T6WA 3FQ1A 3FU7A 2B3IA 3FS9A 1R1CA 3FPYA 4G7QB 1ZIAA 4F2FA 3EH3B 3SBRA 4DP0X 4W9ZA 1AZRA 4M3HA 5I6MA 1BEXA 3IBOA 4HIPA 4YSPA 3WI9A 1AS8A 5I6OA 2VW6A 3T6VA 4HHWA 3NSYA 2PP9A 4G70B 4CSZA 1E65A 2XV2A 1E5YA 3UAAA 1TKWA 4DPCX 2FJSA 1TEGA 1ZDQA 5PCYA 3TASA 1QNIA 1AACA 2H5UA 4YSSA 1PZBA 2PPAA 3FSAA 3CZUB 2CAKA 3AG3B 1N70A 2HLEB 5I6LA 5B3SB 3CVDA 3FSWA 4JHVA 2IDQA 4M4RB 3PPSA 2W88A 1KGYE 1RZPA 3DIVA 2BP0B 2YAOA 1PZAA 5F7BA 1I53A 1GYCA 2HX7A 3NSFA 2PCFA 3FSZA 2GC7C 3N55A 3H56A 2B08A 1RZQA 4BXVA 2AZAA 1BXVA 4HCIA 5I5JA 3FQYA 2Y1AA 3L45A 1ZV2A 1AQ8A 3FSVA 1M57B 2XXGA 2DWTA 4KO7A 2MTAA 2BWDA 3MBWB 1A4BA 3EH5B 1SDDB 2IWKA 1L9TA 4A66A 1OE1A 4GP5B 3QJRB 2CUAA 4YSTA 1KCWA 1ASQA 1AG0A 1PF3A 2UXTA 3D12B 2AZUA 2TSAA 2HRGA 4YSDA 3PAZA 1JZIA 1OCOB 4DP2X 2EILB 1PNDA 3FU7B 3H4HA 2CBPA 1W6WA 1MG3C 2P80D 2FQFA 2LLNA 1MZYA 1AZUA 4BWUA 2WO2B 1CUOA 2CCWA 1XB3A 3NYKA 1BYOA 1SJMA 1SHWA 2BP8A 1VLXA 2XYBA 3ZBMA 3FPXA 3OMIB 3UADA 2HX9A 4HCGA 1WA2X 4E9QA 1T5KA 1ET5A 2XX1A 4ENZA 3T9WA 2JXMA 4HHGA 4A2DA 5I26A 1ASPA 1CYXA 2PPCA 2XWZA 1SF3A 2XXFA 2AFNA 3IEAA 3NSCA 5FC9A 5AZUA 3JT2A 1GS7A 1PLBA 2RACA 2P80A 2X88A 2YAMA 1BQKA 1MZZA 4BWWA 3FT0A 4A2FA 4KNUA 3PAVA 4KO9A 1X9UA 4KOCA 2YXVA 2W8CA 5B7FA 5B1BB 1URIA 4DPAX 2IH9A 1J9QA 9PCYA 3S3BB 2HX8A 2IDSA 2UXGA 1HFUA 2GBAA 5AKRA 1EZLA 4DP1X 2WSDA 1GR7A 3CVCA 2ZXWB 4G72B 3X1BA 3ZIYA 2PPEA 3NP4A 3KW7A 2XV0A 2YARA 3NJFA 3CG8A 4YVUA 2YAFA 3V9CA 2IH8A 1A3ZA 3T6XA 3WG7B 4YSEA 2FT7A 1NIEA 3OM3B 3SBPA 2VM4A 2BZ7A 4G71B 4BK5C 4CSPA 4NAJA 5EHFA 1E67A 1XB6A 2IAAC 3UAEA 3ABGA 1IC0A 4JHUA 3QJVB 3X2QB 1ILUA 2XV3A 4PAZA 4A2EA 1ID2A 2J57A 1NZRA 2BP8B 1A4AA 3X1EA 3TA4D 1B3IA 2FT8A 1KCBA 2VSMB 2E86A 3FYEB 1AZNA 3UGEA 2BO0A 4GY4A 1FA4A 1L9SA 1PLCA 4A2GA 3NJGA 3QJQB 1J9SA 4F2EA 3CVBA 4UANA 4ZK8A 1UATA 2VN3A 4GP8B 1OF0A 2J55A 1IKOP 2VM3A 1JZJA 1NIBA 4AZUA 2BZCA 1ASOA 1IBYA 1OE2A 1XB8A 1SHXA 4UAHA 1JZHA 1TU2A 2XVBA 5D4IA 1NPNA 7PAZA 2YAHA 4E9SA 3OD3A 1SFDA 1GS8A 1BXUA 3HEIB 2A3TA 5B1JC 1MDAA 5F7AA 3SBQA 1OCZB 2IDTA 1AAJA 4HALA 3PLYA 1BXAA 1V55B 2BWIA 1W6LA 3TBBA 3AG4B 1FFTB 1WS7A 8PAZA 3GXUB 1A65A 1NDTA 5B1AB 3TU6A 3DKHA 3U25A 2YAQA 1NPJA 2EINB 5IY5B 2IWEA 1PNCA 2YAEA 2I7SA 2DY2A 3ZDWA 3NJKA 1PY0A 2GIMA 3S3DB 3UABA 3NP3A 2PPFA 1J5CA 5ANHA 2XUWA 2ZONA 1OCRB 1NTDA 1PLAA 2JFCA 1YLBB 4WKXA 5D4JA 1JZGA 2FTAA 1AG6A 2ZWNA 2FQDA 1NWOA 3NJIA 4AKQA 3CDZA 4YL4A 4YSCA 2GSMB 3NJNA 1KV7A 4YSOA 4E9TA 1M56B 2GC4C 1QLEB 1ZDSA 3ASOB 3EHBB 1BYPA 1F56A 4G7RB 1BAWA 1E30A 2YQBA 4A2HA 1AS6A 3RYMA 4RH4A 1JERA 1HAUA 2N0MA 2GB2A 2H47C 5LDUA 1NIFA 3QJUB 1PZCA 5TK4A 5B7MA 1KBWA 3AG1B 2QT6A 1SF5A 5B1JA 2FQGA 4E9XA 2BW4A 4HAKA 1A4CA 1NIAA 1NWPA 1PCSA 2XX0A 3ASNB 1L9RA 3OQRA 1W8EA 1V10A 5I5MA 1AIZA 4GYBA 3IN0A 5PAZA 2NRDA 4AKPA 1SFHA 2PP7A 4UF7C 1J5DA 3WKPA 2VSKB 3T71A 4HCFA 2XU9A 4E9VA 2R7EA 2DYRB 1CC3A 3S8FB 4N8UA 2XLLA 1N68A 4P5RA 2PPDA 2OCCB 3BVDB 4L0PB 7PCYA 3G5WA 2HXAA 2IDFA 4KO5A 1WA1X 1ETJA 4BXSV 3H4FA 2QDVA 2IDUA 2GHZA 3QJTB 5AFAA 2YAPA 2BW5A 1V54B 3QJSB 3T6ZA 4G7SB 2VW7A 3C75A 4A67A 4YSUA 3S8GB 2OV0A 3NT0A 1RKRA 3S3CB 2I85A 3X1FA 1L9OA 4EF3A 1WAEA 4Q89A 6PAZA 4W1TA 2Y69B 2Q9OA 2VW4A 1M9WA 3ZX1A 2X87A 2WO3B 4X4KA 1AOZA 3CDZB 1EHKB 5A7EA 5I6NA 4E9RA 1AZCA 3FQ2A 1GSKA 4DPBX 3NSDA 1ILSA 2QDWA 4KO6A 2CJ3A 2MRYA 3QPKA 2QPEB 4PCYA 2DWSA 3HB3B 5I5IA 1JVLA 1NIDA 2H3XC 5I6PA 4BWTA 4AX3A 1JVOA 1L9QA 1NICA 3NJLA 2OJ1A 2TSBA 2CALA 3GYRA 1JZEA 3JTBA 3UACA 1KDIA 4GP4B 1NINA 1BQRA 2BHFA 4NERA 5I28A 2Q5BA 1AANA 3N2JA 3X1GA 2EIJB 3ERXA 3NJMA 5TK2A 1DYZA 4GXFA 3FU9A 1KYAA 1WA0X 3IE9A 4BDVA 4DP8X 4MFHA 1CURA 3DTUB 1ET7A 2R7EB 3PAUA 4DP5X 4HZ1A 1AS7A 4DP6X 1BQ5A 1L9PA 2AVFA 3NJHA 2JKWA 4WTQA 1TEFA 4DP9X 1KBVA 4AI7A 5E9NA 2IWFA 2UX6A 2FQEA 3V9EA 1A8ZA 1MG2C 1RCYA 2HZHA 3IN2A 1JZFA 4DP4X 3FU8A 2J5WA 2I7OA 4F7KA 2EIKB 1GS6X 1PMYA 3EH4B 1HAWA 4E9WA 1J9RA 4JKNA 2FWLB 1AZBA 2YXWA 2DV6A 3WKQA 1IUZA 4QLWA 5B1KA 6PCYA
chains in the Genus database with same CATH superfamily
1JXDA 3QBTB 4NCDA 2IBBA 4K55A 4NWUH 5H94A 1TZAA 3HW7A 1EXHA 1C16A 3NJJA 5C0ND 1CLZH 1FVDA 3IMBA 1FCGA 2APWA 3BN9C 4FABL 1JXFA 1ZLSH 1U8KA 1ZS8A 1ZVSB 4XHJD 3IFLL 1V05A 4L9DA 3CV5A 3LB6C 3Q7JA 4YGVA 1MH5A 3R7QA 4ETQB 2EDJA 3LX9A 4M1GH 5I74C 4ODVL 4XN9A 5D4HA 3QUZB 4IJ3B 5EU6B 1ZLEA 5JXAH 3TCXA 2DIEA 3K2IA 2NXZB 4AKOA 5ADOL 1UKQA 4KXZI 5SWZB 4QTHA 3GZPA 2JJUA 2EDMA 1KCVH 2P47B 4IQHA 2E8ZA 3BN9D 1AMYA 2HG5A 4P2OA 1T1ZB 4DSYA 5ESQA 4ALAH 4Q6IC 3NUKA 5EZLA 3LB6D 2YOCA 3EOBA 2XI9A 2GJ6B 1BZQK 1I8IA 2EDXA 3MV8B 3BKML 1GL4B 4JQXA 1A6TB 4YDJB 2ATKA 4WY7H 4NQEE 1LWHA 5KANG 3UROR 4K7PL 1R1CA 3EH3B 1A1MA 3GXFA 1A66A 4YN3A 4HUXA 3WBDA 2KI6A 2X09A 5DHYA 2EIEA 1C7TA 3HFMH 1JPSL 2VW6A 4X6CE 2Y9RT 4Q7DA 4AEHH 5AAPA 4OZGE 2XV2A 5J1AA 2AQNA 3QC6X 2QKIC 2AXHA 3TOPA 3VWKC 4K71B 1TEGA 3X13A 3E8UL 1XCTB 4XAKE 5D7LE 3P0GB 1WG3A 2W9LA 3PFQA 1INDL 1VGEL 2KLTA 2QQLH 1YPZA 3QRGL 2HKHL 4G43B 1C16B 4NZFA 2CUMA 2F19H 3PPSA 4ZO7A 1U8KB 4ZXBA 1OALA 2JKXA 4KKRA 4YGVB 1BMZA 2OMUA 1K5NA 2J6EH 4TSCH 3ETBJ 4TLKA 1A3RL 3VWKD 1RFDL 3RTQC 3LZOA 1PZ5A 4DKFH 3VXSE 4UM8A 3GSNL 4YE4L 4LT7A 1M57B 4X80H 3TT1H 3LVEA 2MKLC 2OM5A 3CTTA 2G2NA 4J3TA 4MBOA 5D71L 5SWQA 1H3UA 1Z9PA 2XN9A 4DVBA 3EH5B 5DLLA 4TN9A 2WZ5A 2HG5B 2DQJH 5ESQB 2CDFA 1Y7VA 2J1XA 5EZLB 5CUSH 2CUAA 1CDCA 3EOBB 4YSTA 3UTTE 4GO9A 3C12A 1A6ZA 1AG0A 5DS2A 1RUAL 3SPJA 1I8IB 1VACB 3JTTA 1O6SA 3RTQD 1CXLA 4MA8H 2ATKB 1DQML 2CBPA 1G1OA 2WYIA 4B6ZA 3NK4A 4QXUL 5DD1L 1A1MB 4JKWA 1DQLL 2Q3ZA 4WENB 2E7BA 1OF2B 4IS6A 1XB3A 2OKMA 5DHYB 5I15H 2KHAA 5CJXA 4FTDA 1L0YA 1WP6A 1OZTG 1CBVH 2YS4A 3MXWL 1MFVA 2VDOB 1OAYH 5KYNA 3HIZA 3RAJH 1FGNH 1EANA 3DO4A 4WO4C 5IB1A 3HHRB 2OL3H 1B0RA 4W6XB 1SBSL 3FT3A 3GHPA 3IEAA 5H4ZA 1YPZB 5FC9A 3JT2A 4M5ZL 5H37G 4XVJH 3TN0A 3EG9B 2RACA 3WXWL 2R0WL 2YK1H 5I1HL 3DC0A 1T04A 4K3EL 5EBGA 3U6XA 1ZTXE 4ZXBB 4N8VA 1RP8A 3BI9X 4JDEA 4B27A 4BWWA 1TTAA 3H53A 3FOMA 3BKYH 3U36A 1MRDL 1K5NB 4WLCA 1IGYA 1NBYA 1ZRUA 2JNZA 4LSTH 4KRNA 3BAWA 3PWNA 4JM2C 2Y36L 3D1MC 4MNQE 4PLOB 4WO4D 3T3MB 5HXMA 1PZ5B 4RIRA 3WFZA 5ISZB 1YNTA 2ICCA 1DQVA 4NQUA 1IFRA 2W92A 3HZYA 4I48A 1E4KA 4JRXE 5DCCA 2NYKA 2EACA 4LFHG 3LPPA 4UWQB 3B8YA 4KX8A 1D7CA 2XN9B 3ZSTA 1KELH 2HFTA 4PLJC 3X12A 3GT6A 3EYVA 4H40A 4KXBA 2DKSA 2WLHA 1EH9A 2CDFB 5F1OB 4K94L 2IOOA 2LOEA 1MJ7H 3EJUA 3V4LA 5I1IL 3D09A 5I8EA 3NJFA 2J2ZA 4OCSH 2YIHA 2ALAA 3DTXA 3JTTB 1PBYA 4JM2D 1O6SB 4YL9A 3EDJA 1MFAL 5SWSB 1T2JA 5AG8A 4KFZC 5D96C 3KPRE 3VDBA 5EH1A 4PJAF 5D6CA 4C58B 1TIUA 5ANME 3MLRH 1NGQL 5T3ZL 2JI3A 4Z7OB 4NKOA 1KCUL 4PLJD 1F18A 2IAAC 1CFQA 4JHUA 3JV5A 4Z7IA 2YEQA 5D5ME 4AM0Q 4P2RD 1A4KA 1RVFL 2F61A 1WIUA 2ZYSA 1KGJA 2R4SL 1CFBA 5FA3A 2DD8H 2DEWX 1ZTXH 3AQZA 3UTQA 4F57H 5IB1B 2Y7NA 4BH7A 4J7RA 1U4EA 1RUKH 1UOWA 1B0RB 3Q5OA 2P5ED 3F2LA 3ZYIA 2B59B 3LQMA 4OD3L 3NJGA 5E4IA 3VGBA 4OM0H 4OSUH 1J9SA 4F2EA 2WLKA 1MVUA 5DMGC 4F92B 3T77A 2WW8A 1K72A 1UATA 4AUYA 5LXVA 4HIXH 1T04B 4K5MA 4N8VB 3SDAA 1BF5A 1I7TA 2AEQL 2VXQL 3PIQA 1N8ZA 3U36B 5BQ7A 4PVMA 3BAJA 4AM0A 3EDEA 1GC1H 3PWNB 1JPTL 3LZNA 1Z5HA 5ENWA 1JD7A 1ZE3C 1XB8A 4RIRB 1ETB1 1EDYA 3UYRH 3BT2L 4UUJA 3HZYB 4I48B 4D0DA 5FGCE 4DEUA 2G2PA 4DKAA 5C3IA 5DMGD 2VLJD 3VG0L 2BVPB 2FATH 1XF2A 5J1TC 3EYVB 3WIFA 3IK2A 3HOGA 1TZGH 2DQEH 5FYKU 1EEUA 1PSKL 4AE0A 2D7TH 5GS3A 3TBBA 3K6OA 8PAZA 2J2ZB 1XH3A 2P8PA 1OSPL 3C09C 3E9TA 2WV3A 3OAWA 3ZPDA 4Q9BA 1A6UH 3VXMD 5D6CB 3WENA 4RDQF 4JFZH 2A6JA 1YNLL 2ZSWA 5BRPA 1MEXL 4WEBH 1Z9MA 2EDYA 1RK0A 4HOZA 2CPCA 4CDHA 3AMKA 2PPFA 1CFQB 2EECA 3RKPA 5C92A 1YLBB 1A4KB 1L7IH 1G9MC 1U58A 5I18H 1NWOA 2W0PA 3EO1B 2NNAA 4AKQA 5HTSA 1AXSA 5HGHA 5E95B 4TKWA 1QLEB 4X8JA 3UTQB 4EEEA 2F15A 1OANA 5HI3C 3T8VA 4O9HL 5C1MB 1YSOA 5ALCH 3AGVA 1P2CA 5ACMA 3D87B 4AYMC 1I8LC 1TNNA 4MQTB 1G0YR 4QNPF 3FB6A 3N1PC 5E9DA 4BJLA 3T77B 3THML 1H8OA 1U3ZA 2XA8L 1KBWA 3JV4B 4HLZG 2OSLB 1MFEH 1YQ2A 2OSYA 3SDAB 1I7TB 3PIQB 1N8ZB 4HK3N 2YHGA 3TEXA 4AM0B 4QRUA 3IN0A 2YGOA 2CJTA 4N24A 1P6AB 5AG9A 4NZUL 5HI3D 4U7SA 3CQQA 4UV7L 5IT2L 4FI6A 2C9UA 5FWQA 4JHWH 3GWJA 3AY4A 4U1IA 3T71A 4UUJB 2JTYA 4D0DB 1TXKA 1CDIA 1TQSA 2H1PL 2VDML 4N8UA 1U2CA 1GJUA 4JKPL 4O02L 1XF2B 3WLBA 3QORA 4KPHL 1X6LA 1CE1H 1UOLA 3VXUD 4BXSV 2IPUG 1M6OA 1PD0A 1SZNA 5DZLA 3EOTL 5JYLA 2BFGA 3SPGA 5IHUL 2P8PB 5AVTB 3QJTB 5BZDA 5LXGL 4P4RA 5BVJA 1FYTE 3ESVF 3ETTA 3VX0A 3UEZA 2VDRH 3IFNL 4KROC 1E9PA 4GW4A 4PRIA 5F2FA 1INEH 4JFPA 3VFGL 3ULVL 1MW3A 2A6JB 4ZFZA 2ZSWB 3S8GB 4JGMA 4ES9A 5HDQH 4JKMA 4KHTH 2MCPL 3QAZB 5F0LB 4PH8A 2VN7A 3P0VL 2Q9OA 1EHAA 3H9SE 4U33A 5LGKA 3OZKA 3CHXA 3MAWA 1BEYH 4OLVH 5DQ9B 5E4EB 5B3JF 1U58B 2MNUA 4POZC 2NY7H 2NNAB 3TV8A 2VLLB 1AXSB 5HGHB 4U1GC 1TQTA 4JDTH 1USZA 1GSKA 4NRXA 3MBEA 2ZXCA 4IBTA 4X8JB 3G9AB 3TT3L 4KROD 3V4UL 3QDMA 3UJJH 1EGJH 2VJ8A 4PJ5A 3NSJA 2KQNA 1ES0A 2WLMA 4WTZG 4ZSOA 1TYEB 1CU4H 3HB3B 5E9DB 3FB6B 3JWOC 2JJTA 4HWEH 1E7VA 3IDMA 3PJSB 1ZOXA 2RMNA 3ZL4L 3II1A 3MPCA 3OB0H 4POZD 5E2UH 5HHPA 5CJOH 1W91A 1AANA 3N44B 1INQA 2L04A 1HXKA 4Z7NE 2A73B 4MKMA 1QTSA 4N2CA 2PR4H 1QBMH 2YBRA 3DI2B 4I88A 1DQQA 2MOVA 1F00I 1MLCB 4KJPC 3HHMA 4JVWA 3I84A 1WWBX 4HPOL 1VFMA 3BLKA 1I82A 2W9EL 2ZJSL 1D7FA 2JB5H 4F58L 3C60D 3TH3T 2Q2LA 4APQC 4NGHH 4PGEB 3UO8B 2WXNA 4P9HH 3OC8A 2FQEA 2MJWA 4MHHI 3V9EA 1IZJA 2K6ZA 4QHMA 1JZFA 4PJBA 4KZEH 1B4LA 5BZDB 4P4RB 5BVJB 5EO1B 1MVFA 5HVGB 4A2MA 4GW4B 4KJPD 4DGYL 4ZFZB 1RUPH 1CK0H 3WAKA 3KPSD 2LLLA 3VA2C 4HT1L 2F9BT 2Z8RA 3OX8B 1E5ZA 3EF4A 4G8GE 2LU7A 2JJSC 4APQD 3CLWA 3ZMNA 3FTSA 2AJVL 1AO7D 2W91A 5HYJE 5LBSA 2BIOA 4L9LC 1OV8A 2MMXA 4DVRL 1JWMA 4NRXB 4L18A 1QHQA 2OI9C 5T8IA 5CEZL 2IAMA 3QDMB 2B1HL 4HG4K 4LLDA 4PJ5B 4YVNA 5CBAA 4DKEH 4OTXL 2KLRA 5ID1A 1ES0B 3BUBA 1CIDA 2WTOA 4ZSOB 3QUHA 5DRNA 2R2HA 4JFOA 1QO3A 4PSRA 1WQVT 4OD2A 1HXMA 3IGUA 1MWOA 4E41D 4KV5F 4U4IA 1THAA 3D33A 2YGPA 4BFBD 4Z0BL 5A16A 5A43C 4XCCL 4F7CA 4YSAA 1INQB 2J56A 5EU6E 2X3CA 5TPWL 1IC4H 1XGUB 4UB0L 3BFWA 4JFDA 3DGCR 4XC1H 1OW0A 1T1WA 2YBRB 2HFFA 3AG2B 4IDLA 4J12A 1DQQB 1LDSA 4XWGH 5SWZE 1AYOA 3KW8A 1AYRA 3OMAB 4KNSA 5MEOB 3AU0A 2RA1A 2E75C 4NB7A 3GI9L 2AW2A 2Z91A 5T33L 2ZE0A 2O30A 1CDHA 3RWDB 4ZUSA 4WUUD 3FNKA 5D55A 3V10A 1FC1A 1FUNA 2EE2A 3MV8E 3GHEL 4M62H 4FXKC 3UDWC 5KOVC 1B6DA 4PJBB 1TZHA 4QYOA 2NSQA 3BW9A 1LYQA 1MAML 2X4OA 1U2HA 5EEZA 2XICA 4NQXB 3GFUA 1JF6A 1KV3A 4DGIH 3VI4F 5GS1A 4H20L 2GW5A 5IUSA 5GZOC 4U6HA 1X5GA 4JDVA 5CCGE 3D3VA 2EUVA 3HLKA 4RRPA 2IH1A 3QDJA 3FHQA 4N0YH 2IDQA 5C0CD 2YEVB 2G5UA 3WN5C 2JK5A 3GMMA 3E3QE 4HQQH 3ZZLA 1JWMB 3TIDA 5FYKL 3P3UA 1KXVA 5HDBB 4PR5A 4HS8L 2GBVA 4LLDB 4YHYB 3P11H 4DZ8A 1HWWA 4BXVA 3EUUA 4QEGA 4E36A 4PP2A 4PS4L 1RZFL 2DTML 2R2HB 1BD2B 1VDGA 1QO3B 2E9WA 1X5LA 4HBQA 2XXGA 4JFOB 1HXMB 4NIYE 4OD2B 5C7ZA 1X5HA 3CGTA 1X7QA 5B39A 5F71A 4N68A 1A4BA 2FX8H 4Z7WA 5HP5A 3MRKA 4ORGA 5A16B 3B8SA 5DD6A 4F7CB 1HKFA 1WGOA 1KIUA 3P4OA 2MH4A 1IKNC 1OE1A 1SEQL 1TO5A 4GP5B 4LL9A 4PU2A 5AVZB 3WS3A 4D9QE 5L8KB 4JFDB 5CN1A 1JYVA 1T1WB 1J5HA 4G59C 4TL4A 2V7NA 4OJYA 2PTUA 4JN1H 4OLWL 4WJKB 4OAWA 5CZVH 4DP2X 2FD6H 4NI3A 4GXUM 1HOCA 2P80D 4RMVA 4K9EC 1Z9SA 2H6OA 4MDRA 2Z91B 4GBXA 1AZUA 4UNUA 1JGVH 4GRLC 3P3YA 4RSVA 4ZUSB 2VR5A 4EDWL 5EMYA 3EJZC 3WNMA 2DOCA 5KSAA 5JIDA 1MW0A 1Q1JL 2G3NA 5FUOH 2NT0A 3STZB 5BS0A 3MMEA 4PRPD 3VXNA 1TZHB 3BJ91 3ESPA 3BGFB 5KWYC 3NACL 3R1GH 3KM2A 4QYOB 4K94C 5E1IA 3BW9B 3AREC 3IDUA 1UJ3B 4GSDH 3GMNA 4QPEA 3WFEH 2BC4A 4XAWL 2X4PA 4DKDC 5JW5B 2XNAA 1LDPL 5I26A 1HINH 3Q3GB 5BV7L 3GBNL 1UCBH 5GGTA 3MLSH 4PIBA 5JPNC 1SF3A 3ZR6A 1RZ7H 5CS7A 3D08A 4GRLD 4JDVB 4KAQL 4U6HB 3D3VB 1TYJA 2NLJB 3EJZD 5AZUA 5B3NA 2E3VA 1T22B 3VAEA 4PB0L 3IDGA 2IH1B 3QDJB 4XO3A 2QLYA 3SYQA 2X88A 3LXBA 3UYPA 2JK5B 3GMMB 3FCUB 1BJ1J 4N0RA 2IGLA 5GSRA 2WIMA 5E00A 3GJEB 3TIDB 1N0XL 3ARED 5L8LB 4MB1A 4PP1C 1FH5L 2K6YA 4PR5B 3MV9A 4WHYH 2EYRA 2WKOA 1NC4A 2YXVA 1YPZE 4FFWC 4FG4A 4DZ8B 1F13A 5C9KA 2ICES 4KHXL 2YO3A 4OCYL 5BO0D 2RH0A 4PP2B 5C0RL 4W70A 3I6GA 4ZQKA 3WJMA 2M2DA 4W4NA 1RMFL 1T5WA 3MCYA 1X7QB 1T6BX 2Z92A 5LBGA 5T3ZD 2O5ZH 4Z7WB 3IXAA 4ORGB 4AOFA 2WSDA 5DD6B 1BJ1H 3P4OB 1KIUB 3T3ME 4I0PA 3NMEA 4HUUA 3EIFA 5HY9B 5ISZE 2DQUH 4PP1D 4RETB 5FDYA 3Q8BA 4FFWD 4R3SA 2V7NB 3D4GA 3EO9L 2M83A 3TWYA 1IQDA 5F1KC 4OAWB 2XN9E 4M1DL 1HOCB 3CLEL 1ZLVH 1NIEA 1Z9SB 3OPZL 3SCMC 2P24A 3UTZB 4GBXB 4G71B 1P7KA 4FP8H 1UM6L 2A9AA 1FZOA 4NNPH 2A9ML 1E5BA 5SWSE 3UIZA 2VC2L 2CBOA 2XTJB 3ZJAA 5A1AA 5BS0B 4HF5H 3VXNB 4IBSA 5IJVA 2Q3XA 1FNFA 2XQYG 3E7JA 4LCYA 3KPQA 3EYUL 2BC4B 1D5XB 2X4PB 3HBPA 3V6ZA 3H42L 4Z7OE 1FF5A 2AEPH 3UGEA 1AJ7H 4A7TA 1P4IL 3FT9A 4Q0XL 4TULL 2BNRD 1RZKL 3DX7A 1HTYA 4QRPB 3RKDC 2OR7A 3IDGB 1UWEH 3RVTC 2I5YL 4FADA 3UYPB 3U0PA 3OXSA 5DUBA 4CADB 1M42A 1U36A 4OLUL 5GSRB 3KJ6L 1A47A 5E00B 4KH9A 1QKZL 2G5BA 1MIEL 4HGMA 1UZGA 3MV9B 1GYVA 1NIBA 5E8EA 1QLRA 4WKZA 1NC4B 3QCVH 5C0JB 1Z3GL 3RU8H 3D85D 2YGVA 3I6GB 4ZQKB 1XGYH 1MW1A 5IMMA 4LPYA 3RKDD 1T5WB 5TQ0L 3V0WL 3F12A 2Z92B 3RVTD 4F1SA 4KI5E 5CNHA 3BQUC 5LHDA 4B53A 4ZD3H 4JHZA 2YN3A 1MCBA 3GXPA 3LOWA 2AJUH 3ARUA 3CFNA 4I0PB 4NUGL 4HUUB 1NBCA 1FFTB 4KMTH 5FECA 4EDXA 3GXUB 1NCBH 4R3SB 4MA1B 2KZ1B 1P4BH 5I19L 1IQDB 5GJTL 3HRZC 3FTGA 3A67H 2AXWA 5D1ZC 3AS2A 3RGVA 2DY2A 1CVSC 3PWPD 1N4XH 2ISDA 1NCGA 1ZJBA 3GIZH 43CAA 3BQUD 3QR1A 1NUGA 2KDYA 3BGMA 4KKBC 1FZOB 5H4YA 3OL2A 5IJVB 3SE8H 2BRRL 2GEEA 2Q0ZX 3DPDA 5L9DH 1JZ4A 4WCYH 1H9DA 4JO3H 4LCYB 1M56B 3HS0C 4GAJL 4ZFQA 4BBWA 5CO1A 4UOZA 3ZE0B 3V6ZB 2DWYA 4AYFA 3LKQA 3J8F7 2EDOA 2K70A 4PV8A 3VWJC 5D1ZD 5HPOA 1IM9A 5FYJH 4ORZC 2NY5H 4RFOL 4Y9FA 3ULUC 1UB6A 4DQOH 2F5BH 3ULVC 4O58H 4R4FL 3VCLA 3ZQ9A 4FTVA 2MEJB 2JQMA 4LSQH 4ODXA 3SGJC 2D4FA 3AG1B 4KKBD 3U0PB 3OXSB 1SF5A 3W56A 5DUBB 2XZQL 3ECQA 2XX0A 4XO9A 5E1HB 5I5MA 4GFTB 1P5UA 3GRWH 4BCZA 2P5WD 3EFDH 5E8EB 1QLRB 3K6IA 4WKZB 2DM2A 3VWJD 3DHPA 2PP7A 2X6MA 4UF7C 5I16A 3ETBF 4P48A 4PRBB 3ULUD 2IFFH 5AALA 1AKJA 1AR1C 5D1XC 5IMMB 4XVSL 3ULVD 1BQHG 1VESA 2K9UA 4P5RA 2WZPD 1T3FA 2O4EA 4UT9L 4MLSA 3VD3A 5D2LA 1J1PL 5FW7A 1NMBH 2GUOA 2Y72A 3A4FA 4IBZA 5FECB 4LLMA 4U1SA 2YAPA 4C4KO 3LS4H 3O0RH 4ZFGH 4EPSA 3BDXA 3F58L 2Z7YA 4J23A 1OZUA 2APXA 2WM0A 1AMXA 3RGVB 1DCLA 1AR1D 5D1XD 2MPVA 4PTUA 1PLGL 4RGNC 5DHVA 2I85A 3EGDA 5AYUL 3X1FA 5JXEA 1A7NH 43CAB 3K2KA 3MRJA 3BGMB 4NQCD 3BISA 1E6OH 1EHLH 5C09A 5BO1H 4F9LA 4KTYA 1HILA 2GKIA 5I6NA 3IJ7A 3WIHA 4JZNB 4IRZL 1E5CA 4XCYA 3W9EA 4LCVA 1QLEH 4L1SA 1TYRA 5LCVA 1SQ2N 3LKQB 3BWAA 4PV8B 2C7FA 1CFNB 3QPKA 2QPEB 1ESOA 3LIZL 5DUMH 4RGND 4Q14A 1UB6B 3FCGA 2DWSA 4C83B 1NMCB 3RDJA 4UDUA 1JNHB 3VCLB 4FTVB 4ODXB 4LEBA 2GIXA 1NMAH 1ORQA 2JWYA 1JZEA 1A0QH 3JTBA 1ZT4A 2ED6A 5D7SL 4CAGA 2HUEA 4M7KL 1P5UB 1HHIB 3P4NB 2DWXA 3OSVA 3QQ3A 5E9DE 5DC4B 2YQGA 4GAAA 5I16B 1NEZG 1L7TL 3RP1A 2YWYA 4BINA 4YOKA 1AKJB 5E5RB 4TQHA 3GIVB 1T3FB 4MAYA 4PWEA 2AQ2A 4JY5H 2ID5A 4PJ7F 1R3LA 1KUMA 4UYQA 1QX1A 1AQDA 4RA3A 5D2LB 3VFPB 4QRSA 2ZKMX 5K59E 2NY4B 3QFJA 2X0UA 1HJCA 4EZLA 1RHHA 4LLMB 1G6RL 3RWFA 2BSDA 3DHUA 5FHAH 1JS4A 2IPTL 3NIDB 3UPCA 5FM8A 5CEZD 4AMXA 3SGDH 1U8IA 2ZX9A 3WKQA 1NCWH 5DHVB 2E9GA 3VTMA 3ATDA 3EGDB 3N9GL 3MRJB 4X6EA 2GI0A 1EA9C 4HUNB 3WJJC 4IM8A 4PJFE 1E42A 5AVWB 3LXCA 2UY6B 4DO6A 4JVUA 2VZSA 3KYOA 5C09B 4ONOA 1HILB 3CVHA 5CILL 1IBZA 3W9EB 1OT2A 3OJMB 2Y1YA 3R0NA 3BWAB 1BQSA 3ABLB 3ZRFC 2Q10A 3HHSA 2BNUA 4MWFA 1JN6A 3IXTA 5AVRB 2YLHA 4KOBA 1X5YA 2W95A 4UDUB 4KITB 5BRQA 1G7LA 1RZJH 3TF4A 1OTUC 1RUQH 2B20A 2I9LA 1ORQB 3T65A 3QDME 5HPMA 1FL3A 2XWXA 1RZ8A 1ZT4B 1E5UI 1QQDB 4PJ5E 3MRFA 3D30A 2RGSA 4Y2DA 3DDFA 1LO4L 4QRRE 1PZ2A 2VMJA 1FSKC 4JRYD 3M1CA 4QXGL 4ZSOE 3QQ3B 5FO9A 1O0VA 2NY6B 2DWDB 3CFIC 3Q2NA 4LIQH 1GMIA 3KYNA 1TF4A 2JELH 1AP2B 3SQOH 2J5LC 2L7UA 2QGCA 4R7DA 3GSVA 15C8H 2V5TA 2Z4TA 4MAYB 4WFED 2CCLA 1OTUD 1R3LB 1A3LL 1XR9A 1AQDB 4LRNH 3BZFB 4QRSB 4I7ZC 1W72A 3QFJB 4NRZA 3BAKA 1RHHB 3OTTA 2CWRA 1FFPA 2Q6WA 1NC2D 3CSGA 2YGNA 3B1TA 3KHQA 3RWFB 2D03L 4P06A 5L2KD 3ZKQD 4HPYH 2E0PA 4PJ6A 5JIPA 4LXFA 4RMTA 5FYKD 3LS5L 5JHLL 4ZO8A 1EZSA 1U8PA 1YUKB 3V9FA 4HWNA 3RIKA 2J8OA 1FDLL 1YYMH 4X6EB 5HI4D 4PJBE 3A6OA 4LMQE 4F7TB 4KY2A 4JQIA 5I1EH 3SE4C 2C3WA 1GIGL 3QO1B 3KYOB 4HJ1A 4YXLH 3UG5A 4L48A 3CC5A 4OCXH 2KT6A 3L1GA 2G3XA 4UMGA 3VD4A 3KPNA 1XR8A 1CGUA 4PD4K 3HHSB 2BNUB 4MWFB 1JN6B 3IXTB 3WYRA 5I5JA 1X5IA 3AMLA 4I77H 5BV7C 1G7LB 2DWTA 2I9LB 2O5YL 1NUNB 5FS5A 1B2WH 3C5SB 3FFDA 3T65B 1FL3B 2Y3AA 5HDBE 3WD5L 1W0WA 2WBJB 3ZRCC 5HPMB 4D8PB 2XJLA 3FQWA 3MRFB 5DZOA 3VGAB 3FU3A 1KJ2L 5EC2A 3UCRA 1HZHL 2PWDA 1BD2E 25C8H 1JK9A 3K0YA 1IGFL 2N7AA 2CHXA 2KPNA 2YUZA 5IR1B 1MG3C 5DWPA 3ZTNL 4OV5A 3FQNB 4FQPA 3CHRA 1AE6H 1XR9B 3MLZH 4Z78A 1RIHH 3P2TA 4JFDE 2EDQA 1H3PL 1W72B 4NRZB 2YA0A 2Q6WB 4G8IA 3A3YB 5DJAA 2BLFA 2N7BA 4N5UA 2EAEA 5DRZA 1E4WL 1XAUA 4LGSB 4CNIA 1WCQA 3UADA 2YD2A 4E9QA 3U1PA 2DH3A 5DQJA 4R2GB 5GHWL 3OKNA 1HIML 1U8PB 2UWEF 4PCKA 2X4UA 4IHBA 4Z18A 1J8HD 1OAQL 4GSRA 4DPRA 3IWUA 1CFVH 3D4ZA 4L0ZA 1QW8A 3MODL 4C56D 4N8PA 4G8FA 2YMXH 3E0GA 1P1ZA 5J3HC 1KTRL 4OIFA 4WWOA 1CICC 1CXIA 2YAMA 3L1FA 4PFEA 5KVFE 1MZZA 2CKBL 5LBSH 1TTGA 3I9IA 2WXMA 2X53A 2XQBH 4FKEA 5IVZA 1S5HA 1QFHA 2BJML 3KPNB 3O2VH 5GGSA 5C6WH 5K1NA 4KO9A 3FCBA 4TSBL 2VERA 4PI0A 1X5JA 2QSCL 4KFMA 2GK0A 4HJUA 3QXVA 1EV2E 3QDJE 4WNJA 2LTQB 4OIBA 2I25N 3S3BB 1P7QB 4MJ6A 2Q8AH 1A6VH 1KNOB 4P5TA 2OZ4L 5J3HD 3FFDB 1E4JA 1CICD 3DBXA 1RZKC 2VMDA 1NJ9A 4GIPD 3FQWB 5TQ2L 3T0DA 5DMJB 2FJHA 5EC2B 5CLYA 4XN1A 3WFBH 4PJGA 3GBDA 4G5ZL 3WFCH 5JOPE 2YARA 4PGDA 1DHKA 3GTVA 4R90H 3V0JA 5T5NG 4X8XA 5J9PA 2WNGA 3VG9C 2LVEA 3ET9F 2IH8A 4FLRA 4DTGL 1SOQA 1VGKB 4Z7WE 5D93B 1OXYA 4OV5B 2DI8A 1JSYA 1DSWA 1LO0H 2ALWA 3EYSL 4NAJA 4KWUA 3K1KC 4Z78B 3GQFA 3F65A 5GRUL 1S8DA 2AF2A 3BDYH 4G8IB 4KTDL 4ANUA 1M9SA 5DJAB 4PAZA 1XHHA 4ZNEE 1OO2A 5IVXA 2AERT 1TR7A 1CE6A 1NCAL 5DRZB 1MHPH 3UBXA 2K8MA 4CNIB 1JHTB 1XMWA 2HKAA 1RERA 2X89D 5DQJB 3KH3A 1EX0A 3NFPB 3OKNB 5F1NA 4KZDH 4X5PA 5FYLL 1ZSHA 2QTVA 3CH8A 5KVFH 2X4UB 3DVNB 4JFSA 3CBKB 4MHHG 3O6LH 5DJ6B 2XTJE 1G1CA 3BVWA 5BS0E 4UQDA 2Y4SA 3QYNA 4UANA 1P1ZB 1FBIL 5J0BA 1NBVL 4ABVA 1YN6A 1RIUL 4HEPG 2EZ0C 2AJXL 1O9WA 3VI3A 2ZX7A 4F33A 3LHPL 3BMVA 2WP3T 1S5HB 2E6QA 5IVZB 3G6DH 3GO1H 1URLA 3P2DA 4NPYA 4ZOAA 4FXGC 5GGSB 3RB7A 5EN2A 5F1SA 4CN1A 2VDQB 4H0LC 4QRPE 5HDRA 2GK0B 3B3IB 3MA9H 4Y2NA 4GQ9H 4MJ6B 2IBGA 2G75A 3FO9A 3LD8C 1MAKA 4P5TB 4B41A 1DANT 3T5WA 4C59B 1SXBA 3DBXB 4ENEC 3MV9E 3KMDA 1ZGLB 2G3MA 1P69B 1UEMA 2EZ0D 3JTSA 2MSPA 3PLYA 5E2TH 2FJHB 4FRWA 4PJGB 5D7KD 3EOAA 4PGDB 4LPXA 3WELA 5I8KH 2X10A 5J9PB 1FZMA 5GZNC 3BZ4A 3QDGD 5EOTA 1KB5A 2VL5A 1M6UA 2X9XA 5I8OH 4EBQL 1IL1B 2K7PA 2A9CA 2QGEA 2VZ1A 2GIMA 3NJKA 1TNMA 1R5VA 1X5XA 2ZOLA 3QUGA 4PY8I 5KBLA 4NOBA 3NIGE 4ENED 4LDCA 2DLTA 1S8DB 3K80A 2YKKA 4OLYL 2HJLB 2XZAL 1O9VA 1BIIA 1JZGA 5IVXB 1CE6B 2FTAA 3SBWA 4WFGE 3IMVA 4S1QL 3SKMA 1M3IA 1DANU 4YSCA 1KV7A 3L3OA 5IBUG 4LQ1A 4E9TA 1TCRA 5F1NB 1MHHA 3QNXA 2VCOA 5GZND 1DBJL 3CSTA 1M2OA 2AHIA 3PS6A 4PY7A 5GGTH 3NGBB 5K33A 1YEJH 1RUML 1DUYB 4Y4HA 4PWFA 4J3UA 1ADQA 1JGLL 2X9YA 4NNXA 3PDGA 2BFVL 1YN6B 1N6QH 2B9AA 2YEZA 3ZE0E 3C8DA 4MCZA 5DXWA 1DJZA 3ASNB 3VI3B 1L9RA 3BPLB 2P44B 4F33B 4JKKA 5JHDA 2ZX5A 4KQ0A 4TQ8A 5EWIL 5DZPA 3MRBB 3PG2A 4NPYB 5EN2B 1JVKA 4BRJA 3B2VL 4CSSA 3ZOAA 5I1AA 1RIVH 1T03L 3K1DA 3MLPA 2BDNH 4JREC 2G75B 3FO9B 4H25B 4Z95L 2DYRB 4KU1A 4G3YH 4YHOL 2JJWA 4LFHD 4N2IA 2R69L 4GW5A 4LOUC 7PCYA 1DSFH 1HT6A 5H8DA 4PJIF 2NY2C 2NX5D 1GH7A 4HLEA 3W38A 2OMYB 4PJXF 4PRNB 4AEIH 3H4FA 1SY6L 4QJ5B 1UM4H 4ILDA 5EZOH 4YK4B 2LU4A 4RMBA 3B9KA 1IGCH 5DZNA 5EPMA 1FZMB 1GKEA 3BZ4B 5EOTB 4EI5C 1KB5B 1PZUB 2VL5B 4XXWC 4G83A 4Y5XA 2L7EA 3QFDA 3NEOA 4J4PC 1R5VB 2PCPA 1ZSDA 2JIXD 2ZOLB 2NSXA 2CJSA 4POUB 1P84J 1WAEA 3EZ8A 4LOUD 4D94A 5I0ZA 5I9QC 3E8VA 2ZICA 2E4TA 2NY2D 4IK7A 2JKSA 5LO7A 5FO8A 2VW4A 3T0EC 2X87A 2JSFA 3DGGA 3LQAC 3BKCH 3HN8A 1F42A 4L05A 1YY9C 3SKMB 1QYGH 3QI9A 1WUZA 5LG1A 3L3OB 1TCRB 3MR9A 1MHHB 3QNXB 3VM7A 1QPKA 4EI5D 3NSDA 4WU7B 4WEUD 1Q38A 3MREA 3O2WL 5MI0B 1O7DC 2MRYA 4J4PD 4WDIA 3N40F 2DJSA 2YC1A 4IRSA 4PY7B 3BESR 3BO8A 3FB5A 3MRPA 3N3EA 4Y2OA 4Y4HB 3IKCA 5J11B 4MDIA 1T6VN 1E2WA 3ARPA 3NH7L 4FL4B 4NNXB 4XGZA 3T0ED 4J3WA 2YEZB 5LNDA 5J4MA 2H32A 4MCZB 1CGSH 4F8LA 1YY9D 5DK2A 4NERA 1JZ7A 1CLOH 3S6CA 4HKXA 3QQ4A 5KS9F 1QBLH 2HTKC 4PYGA 4YDNA 4L0YA 5TK2A 3OKMA 4I3RH 5I6XB 3GSUA 3NZSA 5I1AB 5ICUA 3WE6B 4BDVA 3BPNB 1QFWH 1YAZA 4Y4FA 5AB9A 4GXVL 3A0OA 4N3UA 4MVBC 4WI5A 5KG9A 3REVA 3DVIA 2AAVA 2AQ3A 3NFNA 4GW5B 5EF1A 3N42B 1KEGH 2IOMA 1KBVA 1MFCH 1DCEA 2FSEA 4LARL 4EN2A 5JPMC 2HTKD 4P57B 5TE7H 1RH8A 5IQ7L 2EXWC 2Y0SA 3B9KB 3FAXA 1Y6KR 2YMTA 1VKXB 2IH3A 3KH4A 3NCJH 4KKNA 3HNSL 1EHXA 5GGVH 2QGDA 5FFLA 4Y5XB 3BP7A 4MVBD 3PY9A 4G8AC 2WWKO 3A24A 4P23A 1Q0XH 2WYTA 3EUDA 2VDPB 1A1NA 1ZSDB 1FZKA 4WEEA 5ITBL 1Z0MA 4FEMA 1E3XA 4QKTA 4RMUA 3N06B 1R6VA 4XODA 4P9ML 1G9NL 2X2HA 3NIDE 2IFGA 2PCYA 2GITB 3DGGB 1F4WH 2XZCH 3ABKB 3AS0A 2VN6A 4U3SA 4E9YA 3QI9B 2NY3B 3MOAH 4FQJH 3QQXA 4HUCA 2EXWD 3AM8A 3MR9B 4FQ1H 3O11A 1JV5A 4OFQA 2X6BA 3HZ3A 1NDMA 1UA6H 3MREB 5CJBA 2OSWA 1O6TA 1DVFA 2EO1A 3A21A 4U3CA 2YC1B 4IRSB 5E7FA 1KPUB 4XPAL 3BO8B 3FB5B 2YZ8A 3LDBB 5ETUA 4Y2OB 5C09E 3IKCB 4GLRI 4XGZB 3ECUA 2ZPKH 4YSRA 3KVPA 3U6RA 5BMFH 4I1NB 4MQXC 4BK8A 2IG2L 2XKUA 1DBAL 2H32B 1MRCL 4JHAH 5DK2B 2WMPA 2IPUK 2XDHA 1ADWA 1CFTA 3QQ4B 2IMNA 2XBDA 4HSAC 3RWIB 1GYAA 1HCYA 3G6JA 1AHWC 3OKMB 4ELKB 3EXLA 3MFFA 1ET8A 2AJYL 3GSUB 2Y2TA 3UBHA 2WHVA 4AIOA 2R29A 2HH0H 1DSYA 1KB3A 2ZP9A 4BDVB 3TEZA 4Y4FB 4YEFA 3WTWA 2EO9A 4TPRL 2ZCLH 3U4BH 3EJPA 1Q9KA 3DI3B 5KG9B 3REVB 1DL7H 2CO7A 2DEYX 5KVGL 1GYUA 3NFNB 4MQXD 4DP0X 1C7SA 1U42A 4ZMLA 5I6MA 5I0DA 3O3UN 4PJEA 1PFCA 4EIUA 1AS8A 3X3FL 1A14L 2FSEB 2X12A 2V3EA 5CXPA 5EU7C 1E65A 3KPLA 4LVHC 1ZA6A 2IH3B 4UU9A 3U0TA 2AK4D 3IETB 3IDIA 3Q9PA 5E5MA 2WLYA 2FJSA 3BP7B 3D2UD 1JZDC 3TASA 4P23B 3QFJE 3ZHKA 5GS0L 1NLBH 1A1NB 4V1DB 1OAXH 3O6FA 1FZKB 5DHVH 1RK1A 3BXNA 2CA3A 2QR0A 2EH8H 3V4PB 3V52L 3DPBA 2DIAA 2YUXA 2Q8BH 4U3SB 1N0LA 4WK4B 2W88A 3N1MC 2YD3A 3K5RA 3WIHH 2VO8A 5MENA 4GUPA 2Z7WA 3O11B 1JV5B 5DLMH 4MCMA 5DD5L 1DDTA 2BVOB 1NDMB 1DVFB 4OY9A 4IHOA 2K3TA 4D7BA 3KXFB 5ETUB 3FQYA 1J0IA 3EBIA 4UOW1 5EU5A 1BREA 1AQ8A 2CGYA 2EDNA 2DMBA 2G9KA 4KVCL 5T3XL 5KBNC 1P6FA 3WFDH 4BFKA 2WMPB 1BFTA 3BWSA 1CFTB 4F20A 3HZMB 4LSPL 3ARVA 3G6JB 5A40E 5LNEA 3MFFB 4K8RL 4X4YA 1UACH 2WUBL 3T4AC 4YQXL 5C6TL 1CLYH 1BWMA 4JX0A 3GJFK 1Q9KB 3GSWA 2A9NH 4B9IA 4JUTA 2CO7B 2KKQA 2PO6C 4DN4L 1MZYA 1FFNA 5BRZA 4PJEB 2OS7A 1IVTA 1KYOK 3TVMC 1KY7A 4MKTA 3RDTA 2FEJA 3KPLB 2R2EA 1ZA6B 4NFDA 4UU9B 5AW9B 5INCA 2B5IC 3U0TB 4HU8A 1WA2X 3IDIB 3S96A 4YNYA 4PCTA 5E5MB 2Q2EB 3FN0H 5GGRA 1AI1H 1LILA 4EI6A 4GW1A 4FZ8H 1O5DT 3KPMA 4FQXA 5G4OA 4RVBA 5CP7A 3O6FB 5H35A 2PO6D 4UTCA 3RY6C 1RK1B 3D6GA 3RIAF 3EO0A 3BXNB 5K1JA 4YX2L 4AJ0A 2GVYA 4XPHL 1PLBA 3DPBB 4CGTA 4Z3GA 4L5FL 2H0JA 3FFCA 3TVMD 4B9YA 1N0LB 3O3DB 3CVHH 3DX9B 3HG1A 1HZLA 2IDCA 4M43L 4UAOB 5I8CA 4GUPB 4M02A 3TZVA 1IC7L 2W07B 4O2CA 3TIEA 5DVLA 1X9UA 4D9LH 4F80A 5B7FA 1JYNA 4NM8H 4IHOB 4K23L 4I2XA 5EU5B 3T2OA 1KPRB 2FX9L 2CGZA 3KCWA 3KLAA 3OLDA 3B9DA 4MMZA 3FB8B 1OGTA 4QHUB 3HR5A 5LVEA 2R1WA 2UZYA 2ICEC 1EZLA 2J88H 3UJIH 2VDKL 2ZCZA 3E1ZA 4FNUA 4JO2L 2F1BA 3X1BA 2PPEA 1FAIL 3ILEA 2IEPA 4ODWA 2YA2A 4X4YB 5I1DA 1UC6A 3MGOA 5AWNH 2HVKA 3HC3H 5FYLD 2XWBB 4NUPA 4O5LH 4RMRA 4FFYA 3LH8A 2C3GA 1J1OH 4N3TA 1IZKA 4ESKA 1FFNB 4DEWA 2C34A 3HA0A 2BY2A 3KL0A 1W72H 1V5JA 2R0ZL 3ABGA 1I1FB 4HFWA 4UT6A 4M7ZC 2QFPA 4TUUA 1F86A 4Z7VA 3A23A 4Y5YC 3VFUA 1A4AA 4P4KA 5INCB 5EOCL 1MNUL 3OJ2C 4I18C 3O6KL 3S96B 1H5BC 2IQ9H 3I74A 3M45A 4DEPC 5GGRB 4EI6B 2VSMB 3AFLA 4GW1B 2AQPA 3SKJH 2XTLA 3KPMB 4FQXB 3L4UA 5H35B 3BKJH 5DEGA 2JCCF 1PLCA 2A83B 3EO0B 4IBLT 3S88L 2VZ3A 4Z7AA 5DTFB 5DWUH 4BQ9A 3W9DA 4XP4H 4JQIH 3FFCB 4I9WE 4PJHB 1FG2A 3HG1B 5ICZB 1P4UA 5IFJA 5I8CB 5TD4A 3KWTA 1ZY9A 4Y1AA 4XZ4A 5DT1L 4O2CB 3TIEB 2DEXX 2J12B 1V7NL 4FERA 2XY2A 5JW4N 4BSJA 2W5PA 1OE2A 5EBWA 2AV1A 2IXQA 3JUYA 4GAGH 1MCDA 1TU2A 1TZOA 1P53A 4TNWF 1OARL 4I2XB 5KVEL 2N7SA 4KDTC 3KLAB 3QXAA 4MMZB 1OGTB 1QFWI 1A5FH 1WAAA 4YHMH 1KIQB 5AOKA 3HR5B 3HUJA 5E4AA 4ZMXA 2R1WB 2UZYB 4WI7A 4LLUB 2QKIA 1BXAA 2HFEA 3D0VB 3HBQA 1QEXA 4WHYG 3IJEA 3CN2A 4ODWB 5I1DB 5B1AB 3IMSA 1L3WA 2CDGA 3MGOB 2HVKB 3IPEA 2HFGH 3GMQA 1PJWA 2DDQL 2WJ7A 4OCNC 4W6YB 1QRKA 1N12A 2Z6FA 1I85C 3PL6A 4R7LA 3S3DB 3LH2L 4PJGE 2DIJA 5E0FA 1S4IA 3HMXL 3IU4H 3NP3A 1JZ2A 2ZONA 4HFWB 1PLAA 5T1DL 3U2JA 4M1GL 3ZQWA 4Z7VB 4LBEA 2X3BA 4ZMWA 3VFUB 3RTQA 4P4KB 5T1KA 3KR3L 3M17A 4G11A 4HPHA 3RWEB 2GC4C 5LGJB 4MCYA 1ID5I 5F7WC 4YHLH 4URTB 1KCVL 4A2HA 4NX0A 4Q52A 5GPRA 3DROB 4HWBA 5DEGB 2DQCL 5IVXE 1HAUA 4UTBA 5HHXL 4XP1L 3W9DB 4R84A 3ZDYF 4GSXA 5TK4A 4FCAA 5F3FA 1WTLA 1FGVH 1WEJL 1FPTH 1G7HA 3KYKL 4HAKA 4ZX6A 5IFJB 3TJEH 1I8AA 2ZKHH 4H88H 5E6IC 5CD5C 4WY7L 4Y1AB 2HRPL 1TITA 2CLRA 3GLZA 3PWUA 2FYVA 4M3KB 3R8BB 5F3BB 5ES4B 5B38A 2BNQB 4OZIF 5EBWB 2DLEA 2Z64C 2AV1B 2IXQB 2VDQH 1TU2B 4X7CC 2ERJC 2VSKB 2VLKA 3O8XC 2DM4A 1VFBA 4CMHB 2ESVB 4OUUB 3RIAK 1D7DA 1N68A 2EEAA 3HUJB 3PP4L 5D70H 5HI5C 3CPLB 4L0PB 3G5WA 4KO5A 5DI8A 1WF5A 2QKIB 1U8JA 1WBZA 3SDDC 5CD5D 2HFEB 5E6ID 4WO4A 2H2PC 1MFDH 4A6YA 4XP6H 1TZ8A 3IJEB 2OYPA 1NSNH 5AFAA 3HAEA 2CDGB 1SLXA 3V5DA 3NPSC 1AQKH 2WVUA 2DYPD 3CDFA 3MRCA 1V8HA 1X5AA 1WJ3A 3GMQB 3O8XD 1H3TA 3TYGH 3L3GA 4A67A 1JP5A 1OAZH 1ZCRA 3PL6B 3SDXF 1J8KA 1AFVL 1I7ZA 2R56L 5HI5D 1B9ZA 1CF8L 4EF3A 3KWUA 3SDDD 5I71B 2ZCHH 1E50A 2CUHA 4H8WH 4EOWH 2J6EL 3Q1SH 4LBEB 3C5JA 3AS1A 3KVQA 1S3KH 2H2PD 4GIAA 5CLTA 4ZPVA 3RTQB 5T1KB 3AGWA 3DMMA 5KTEL 3M17B 4IRJC 4DKFL 5F21B 4WF7A 1OQOA 3OWRA 3SO3B 1EIBA 1F4XH 4MCYB 2XCMC 4O2EA 2UUDH 3ZW3A 3W1ZA 1MCNA 3V6OC 1YUHB 3T8XB 2ADYA 3OJVC 4N90D 2DQJL 3RY5A 3UCQA 1ETA1 2EO7A 3OR6A 3J7HA 4JPWH 4AX3A 3RILA 2E7LC 3UC2A 4HKJB 3UACA 2V8MA 3VSVA 2BHFA 3I6SA 5AAWA 4HW6A 4IRJD 4MA8L 1G9NC 2Q5BA 3X1GA 2CLRB 3KDMB 3PWUB 2P5EA 4A2LA 5HYQA 3JWNH 4GXFA 5B38B 3S97C 3A6BL 2JQZA 3CFQA 3F64A 4HS6A 1WA0X 4DP8X 5IUCA 4MFHA 2VLKB 4XNUL 3OQ3B 3NZUA 4DJMA 2X7LA 1VFBB 5AOIA 3GBLA 3T08A 1O7VA 1JNLH 5DI8B 2ZUQC 4L4TD 1U8JB 1WBZB 4N8VG 3CFBA 4B9KC 4QO1A 2J4WL 1GGYA 3EFOA 4ISVA 1MG2C 3IN2A 3P9WB 4ONFL 1MXDA 3QCUH 5AB0A 3HAEB 1N2RA 1BVKA 1L0XA 3V5DB 1A7QL 2WWMC 1KB5H 3MRCB 4Y89A 4XVJL 4TNWK 2DI9A 1MIMH 3L3GB 2VKXA 5E1AA 4QLWA 3ALXA 4EUPA 1I7ZB 3VXPB 2VR9A 1GY2A 2HCZX 3M46A 4DWHA 4N4YB 1KGCD 1XGRA 1L6ZA 3HS8A 5FGRA 4H0HB 4OM1L 4BFRA 3L9RA 4IBQA 2WUCH 3DMMB 1S3RA 1OAKL 3AWGA 4XP9L 5J6HA 1BIHA 3FUEA 4PGZA 5HJGA 2DBLH 3QUMA 1QSEA 3CX5J 1F1DA 4O2EB 2WWMD 1DQDH 4MTMA 4NWTL 1UD2A 2R23B 4HJ0C 1MJ8H 2FT6A 5DD3H 1FNAA 2D2CC 3TBCA 3WTXA 3OR6B 1ADQH 4HEMA 2VDNL 1IIKA 5C7XL 5DJCA 4HMCA 3MXVL 1CYWA 2NY0B 4XNBA 3JV6A 1IRAY 1BZ9A 4U1JA 1X5MA 3HNVH 3L5WA 2P5EB 5HYQB 1IJNA 1J10A 1N8OE 4BFIB 4GO8A 4QHPA 1JV2A 3B7RL 5DO2C 2N1TE 4HXBL 1QNZH 2V5RA 4HJ0D 1GHFH 4HS6B 5EORH 2X7LB 3MTXA 4FD0A 1VIWA 2VIRA 5E99L 5FCUH 5IESL 2QBWA 1CT8A 4JFWA 5D2NC 1CFSA 4QO1B 4F57L 1ZTXL 3EFOB 4ISVB 5F9WC 2RFXB 3QQ9C 3BAEL 1RUKL 3FB7A 2Q7AA 3ZTEA 2QVMA 4OBRA 1N2RB 1BVKB 4GI9A 1VPOH 4QAMB 3IKKA 1JF1A 5DO2D 4OM0L 1I8LA 2O1AA 1BOYA 3OSKA 1UASA 2YD7A 1HU8A 4NO5B 4RZCB 5E1AB 4K8RC 2WAHA 3L4VA 4G9FD 4EUPB 3VXUA 2VDPH 2PPAA 3FSAA 1SXZA 4ELDA 1T0NB 1BG9A 4AIXA 1S7TB 2EE3A 4ZTOL 3LXAA 3L9RB 4MD5A 1J8SA 7FABH 1NCDL 2G9HA 2ZXGA 4JHVA 3D39A 3C5ZB 3QQ9D 1BFVH 4TUKH 3WMSA 1FFRA 3MJ7A 3SE9H 1MI5A 3L2NA 5J6HB 3UYRL 4P46B 1QSEB 4QIRA 1YN7A 4V1DE 5HYEA 2E9JA 1OM9A 4ZDHB 1F4YL 1S7WA 1WVZA 2GC7C 1EO8H 2FATL 5A3IC 4K8RD 1DBBH 2G60H 2DPKA 1UB5A 1A6AA 3MJ9A 2D7TL 1YEEH 3OG6B 1CGVA 2YOAA 2B39A 2FHCA 1QAWA 4IU3A 2H32H 4MZRA 3QHFL 2MFNA 1A6UL 4M61B 3QJRB 4ZZFA 3L5WB 1YZZA 4JFZL 2EIZA 4NIKB 4G6JH 3KXFE 4AMKL 1HESA 3FN9A 1BBJA 1JV2B 1PEWA 1PF3A 2UXTA 1QEWA 1J8RA 5A3ID 4KXAA 5IHLB 1ODUA 4XCNB 3F7LA 3OB8A 1MXGA 1S9WA 3A6CH 1VENA 1M05B 2VIRB 5IHWA 5I18L 2LQRA 4M6OH 3M88A 1SM3L 1CT8B 1CFSB 1HQ4A 3T6QC 3FT1A 4LAQL 2VXTH 1SJMA 3HNTH 3PU7A 2DBJA 4PJAA 1KBGL 3TO4C 4U7KA 3FB7B 2LT9A 3QEQA 1VHPA 5MP6H 5EC1A 4RBPH 1JF1B 3FPXA 1BVLA 2P4AB 1R3KA 5E6YA 4IGBA 5EEWA 4JE0A 2JXMA 4PJEE 5T5NF 2JB6A 3LV3A 4TSAL 2VH5L 2F7IA 3VXUB 4ZMOA 3APFA 2AGJH 3NSCA 1RU9H 1DBMH 4MD5B 2DQIH 3V4PH 2UZXA 3CLFH 1PIGA 2Z4QA 1PG7X 3D39B 4LSSL 4TV3A 3DX3A 4IJTA 3TO4D 4EXPX 4Q58C 1MI5B 2ZWSA 3UEQA 4R83A 3CVIH 3UX9B 1IILE 2FYYB 3DV4A 3HE6C 3KPSA 4QR7A 2WZ6A 3WUWA 2HYMA 4AXWA 4OZGF 5I2IA 2APTA 5D72L 4Z5RA 1RXLA 2KH2B 1UB5B 1ZGLP 2VLRE 4L8SC 1A6AB 3G5VA 5IEHA 4AYBA 4PG9A 1R0AH 1JGIA 1QFUH 3MBXL 5SX5H 1ZLWH 5IK3A 3VRLE 3TA3B 2FH6A 1BM3H 1ZEAH 1TJHL 3SN6N 4KROB 1QI3A 2VDRL 3HG4A 2VR7A 1CLVA 1INEL 4ZODA 2EIZB 1T1XA 3MGTA 3H7LA 1LGVA 3UO1H 2FGZA 3HE6D 1BBJB 4KHTL 2R29H 1QEWB 4FNQA 2R51A 4DESA 2OAAA 3CCHA 1V3JA 2JJSA 3ISWA 1LEIA 3H7BA 4S2SA 3JUZA 3T6XA 1S9WB 4NQQA 3SBPA 4BZYA 2AAAA 2V7HA 1L6PA 2H3NA 3N1QC 1IJ9A 4L9LA 5SX4H 4LRIA 3SYCA 4HJJH 1HQ4B 4LPUA 4X2UA 5FO7B 3GB7A 3PDDA 5DURD 2CIKB 3F62A 3X2QB 2VITA 1EGJL 2XV3A 3W37A 4PJAB 4RMSA 3QEQB 4XPGH 5EC1B 1G7PA 1XWVA 3X1EA 1FJ1A 2PWFA 2L8AA 3ARBB 3GHBH 1BVLB 4IGBB 2CBMA 2JB6B 3LV3B 3PXJA 4ES8A 3LN9A 2DZEA 1S7SB 3MJ8A 1B4TA 2ADIA 1TENA 5CJOL 3Q6FA 2W9DL 5C8JA 4FNTA 1G4MA 2UZXB 1PZ3A 1NDGA 5CCHE 2Z4QB 1A6WL 4TNEA 4EIGB 2B1OA 4Q4EA 4N28A 1E2ZA 4QXVA 4AEFA 3FT4A 4PUBH 3B1UA 4JMXA 3OPUA 1IKOP 1ZV5A 3KPSB 3KEHA 5F7NC 3WUWB 2V2XA 1W80A 2BZCA 2X0WA 2W81C 4AXWB 3GSNA 35C8L 2BXYA 3QO0A 4WI0A 4Z5RB 4NGHL 1NANI 3GD1C 3FFCE 4BCXA 3PWVA 3H3PL 3W0WB 3G5VB 4PJHE 3U7AA 2CD0A 4B60A 5GRVL 5C0CA 3HG1E 4PG9B 4FXKA 2EDLA 3BCFA 3UDWA 1FE8H 3QUXC 3BYYA 2GSIA 4LSRL 3MRRA 3VNZA 3T2LA 2EDBA 1YHPA 2CRZA 5CCKH 2X4SA 2XVGA 4W9DC 2EC8A 4XMPL 3MGTB 3SOTA 1RUPL 2P3YA 4I2XE 1MLBA 2XKSA 3PQYD 5GZOA 5ALBH 1YEGL 4AJVA 1LEIB 3H7BB 4F5CA 4XBGB 4IOFC 3QZPA 4UV4H 4DO4A 2XV6B 3QZBA 3VQMA 3ZDWA 2V7HB 4LSUH 3WN5A 2H3NB 3TNNA 5I75C 2WCPA 3KCPA 3QUXD 3CHOA 3DO3A 4L9LB 3TPUA 5JIQA 1FV1A 1XH1A 5GGQH 3WEOA 3GB7B 1J5CA 4YFDB 2EH7H 2D3NA 1G94A 2VITB 1NTDA 5D4JA 2QQKL 2A2QT 4C4BA 1AG6A 3RWJB 1ECYA 2XETA 1G7PB 4DKEL 3LKNA 3CDZA 4F15C 4HJEA 1XBRA 1T89C 1WC7A 4ZBJA 4IOFD 2BIQA 3GK8L 1HWGB 5DMYA 2CJUL 3Q5TA 3OKLA 3MNVA 4PW9A 1AQMA 1KLFB 3MJ8B 4ODTL 2ADIB 1IO4C 3OHXC 4Z7VE 4KTEL 3Q6FB 4ZRGA 2WXQA 3KBFA 1G6VK 1IKNA 4JPVH 3ZQXA 4ONGL 3U83A 5C8JB 2MCAA 4PRPA 1NDGB 1PZCA 2IIJA 1BGXL 2WWNA 2LAAA 4ZMYA 1KTJA 1ERNA 3GS0A 1AGEB 1PCSA 5FOJA 4QUOA 1K3ZA 4CL7A 1MPAH 1DP0A 1Q0YH 4YJZL 1Q9WA 4GYBA 5D5MF 2V2XB 1QOKA 4NZTH 4Y8AA 2EE9A 4GRLA 1XQ4A 3QO0B 4WI0B 1J5DA 4J6RL 2OR8A 3PWVB 2L4OA 4HCFA 1MCLA 5EF3A 4O00A 5KYWA 4FXKB 4AV4A 4FS0A 3F6IA 2GSIB 4Y1AE 1BSIA 3MRRB 3BVDB 3EJCA 4XP5H 2FECI 2BNQE 1C8QA 4NFBA 2HWZH 4YAQB 2DQDL 4KNQA 4ZS6C 4NJAL 1MLBB 2D3LA 2VB5A 3G6AA 4E68A 3OHMB 3FQRA 1OP5K 3WKMH 5JPNA 4P2CG 2ESVE 1WAAE 2BCMA 3HUJE 2H26A 3L5XH 3QUYC 4FA8A 3S35H 3RBSA 5EV7A 4Y5VA 4N0YL 4FFYH 3KCPB 4NQED 3TPUB 3LKSA 5IMOA 2RCSH 1FV1B 4K7FA 5SV4A 4EIBA 2Y6TE 5FGBC 3RL1A 4TOYL 1Z66A 2DL2A 4MAZA 3CFKA 4OFKA 4UT6H 2C5DC 3P0YH 7CGTA 1AOZA 4ZS6D 3LKNB 1QR4A 3CDZB 1EHKB 3FQTA 3AQXA 4AJYV 1QTPA 5EEYA 2N59A 1WC7B 3QUYD 1WFTA 4M93C 5HHNA 2MCMA 2X4QA 3OKLB 3MNVB 1FRGL 4YUEL 3MLVL 4XHQA 4XAKD 5D7LD 2UVFA 4PRPB 5HDOA 1XH2A 4G7VH 2VXQA 3JVGC 3CXDL 5F3HA 1R34A 3FO1B 3CFTA 4JN1L 5CZVL 3IDXH 4N6RA 1OKEA 1Q9WB 1E9OA 1TTFA 4L3EB 3SCMA 2B1AH 3QH3A 4QRTA 4GRLB 2BNRA 1WZKA 5AVXB 2ZNWA 3U0WH 2ZYRA 4M56A 2ICWI 1CURA 3QE5A 4MMXC 5ICXA 3DYMA 1H8LA 3VXSD 3Q48A 1JZ8A 5JIMA 1PPIA 2JKWA 2CZNA 1NKGA 3L3KA 4GSDL 3AJ7A 2VQ1A 3AABA 4FLOA 4FA6A 4FHKA 3V0AC 3G6AB 2O61A 2VLKE 2H0PA 1CTNA 1RZ7L 4NLHA 1MF2H 3UTTD 4HUKB 4PS8A 1AZBA 3QUKA 4XXCA 3ZVVA 4QHNA 4NJ9H 4Y5VB 3JVFC 3IJSA 3KNBA 4XNAA 5KBPA 3LKSB 2CDEA 1ZMYA 3MGAA 2GFBA 3RE0A 5IMOB 4K7FB 3L4TA 2F7OA 1TFHA 4HIEA 3U9PL 3RL1B 1AR2A 3CFKB 5J7CC 2A4ZA 5IGXH 1OE3A 1N5YH 2ZSVA 4PG2C 5DJYA 4IMLB 4M48H 4NQTA 4ODUA 5EBMA 5G2NA 3NCYP 3VI4A 1BG1A 4P5SA 3CN3A 1KLUA 1N10A 2WQ8A 1JOIA 3PWPA 1LE9A 3ILQC 1IBBA 1OHZA 2I24N 2X4QB 5HHNB 3BSZL 5CN3A 5I73B 1XF5A 3BQUA 2O5ZL 5ITFA 4MA3A 4NYLB 4HWBH 1XT5A 3VUAA 2QPDB 3AW5A 3MN8A 5L6YL 4UTBH 5C3TA 3BQVA 1EUTA 5CGYC 5KAQF 3X3GH 2DQUL 4JMNA 1D6VH 1DDHA 1YVLA 2HRHA 3HC2A 1S78C 2P48B 3KL3A 1SUJA 5F3HB 4JFVA 4PJDB 1QR1A 4J5VA 2QKSA 4N6RB 3Q13A 5AOMA 3T3PB 3SCMB 5DS8B 3ILQD 2KYIA 1MJJA 2BNRB 1CGYA 2R0LH 1A22B 4RFEB 5DQDL 4BEIA 4FP8L 3SD2A 4DERA 3OAYH 2E4FA 4MNQD 2CHWA 5ICXB 4ZW6A 3T6WA 2HUHA 3FUNA 4KK9C 3CH1A 3FS9A 1XZ0A 4O02A 1C12A 5CGYD 2VDOL 3ZXAC 2ADFL 1X44A 4Q9QH 2XWCA 3HS0A 4JRXD 5GGSY 1S78D 2P5WA 1N19A 1IGIH 2BCKA 5I6OA 2VQ1B 3P30L 3FO2A 3VWJA 3ROOA 4RFNC 2AEPL 3AADB 2IGFL 1OP9A 1M3JA 4A6YH 4E9LA 2O61B 1AJ7L 4AG4L 1SYSB 3HAEH 2ADGB 1NGWB 5C07D 5HVHC 4BE5A 3QUKB 4ZFOB 1IARB 1KN4L 4KK9D 3IJSB 3KNBB 4IBVA 2BIHA 3C2AH 2CDEB 3MNWA 2CAKA 4WGVB 1DFBH 2A7BA 4TUOA 4YHNA 1N70A 2Z34A 5IQOA 2ZSVB 4OF8A 5DJYB 5EBMB 2B3RA 3VI4B 2V17H 3NABL 3DIVA 1KLUB 3MLTA 3PWPB 5D1XA 1QFPA 3B7TA 1LE9B 3JT0A 4TQEH 1UQSB 5C86A 1OWWA 3H56A 4E2OA 1XF5B 5AKVA 3BQUB 4MA3B 4OJAA 1KXHA 3N41F 4NP4H 4JRWA 2AJUL 1KN2H 2Y1AA 5F7DA 1LL1A 3IM1A 3QWRD 1I8UA 4KMTL 4KO7A 4Z77A 1EXGA 3JWDL 1SLWA 1LMKA 1QSEE 5KSUA 1DDHB 2J3SA 2QQNH 2XRAL 1QR1B 3QCTL 4U6TA 3SOBL 2W0LA 1MJJB 2P8MA 3ZIMA 1YJDH 4DW2H 2TSAA 1EJOL 1XVSA 3GIZL 4HEME 1X4ZA 1N7MH 3CH1B 4H8UA 1XZ0B 4O02B 1C12B 5F7MC 2D73A 3VQ2C 4LSVH 2F1EA 2BVEA 4XCEA 2IGTA 5I1KH 3C6LC 1MQKH 5E2VH 2XYCA 1PU0A 5TTRA 3IDJA 3FO2B 3VWJB 2N0KA 1I9IL 3ROOB 2YWZA 1XSOA 1WZ1L 1VLXA 4IDJL 3MRDA 5E2WH 2PWGA 1GGIH 1A7PH 3S4SG 2F5BL 3GDBA 1V3KA 1R9FA 5A2IH 3T9WA 3PXHA 4YDKH 4U31A 4JKLA 1CYXA 4EUPH 3MNWB 1QRNA 2LW3A 4OR1A 1S6NA 3C6LD 3GRWL 3EFDL 3UG3A 4BFOA 4OF3A 3OBAA 1WBXA 2P52A 4TVUA 2F53A 3ZGIA 4MJIA 3IDYB 4TRPL 3VNYA 4OVVA 5C0FA 2A77H 1Q94A 5JQ6L 3QUMH 1WDAA 4U1MA 4HIJA 4LU5H 4WW1B 4GUQA 1BAFL 1WWWX 1IGMH 4LVNC 5BOZG 2IANA 3HMWL 4YMPA 2N1KA 3D39E 5F7DB 1NMBL 1MI5E 3MJ6A 2C1OA 4Z77B 2X28A 5BZXA 4CJ1A 5C0BD 5KSUB 3OB0K 3V0EA 2A0LC 1RULL 3DOIA 2ZXWB 1TVHA 4BGLA 4PWKA 3EKCA 2P8MB 3VB8A 4P04A 4YLQT 1N64H 1V7ML 2FWSA 3O9WC 5AW6B 1FAKT 1G9MH 2XWEA 3S34L 1M7IA 3ARGC 5M7QA 4XCEB 4CSPA 1X5FA 4WWKA 3WKYA 5IW3A 4B97A 2N3JA 2GPZA 2VE6B 3EDFA 5I1CH 1IC0A 2A0LD 3L1OH 3IDJB 3QJVB 5GRVK 4XNYH 3FCTA 5TF0A 1AGBA 1P1VA 4A2EA 1BF8A 1ID2A 5HYSG 3DK2A 4F24A 1CZ8H 1ANUA 3Q8CA 4BSVA 1MFMA 1J1XH 2CGRL 4OB5L 4CILA 4BFEA 3EJRA 4K7PX 1ECZA 4M7JL 5F93C 1I1AB 1HYRC 4OLZL 3S5LB 1G5GA 3BPCA 5JW4M 1FYTD 3O9WD 2E86A 4KJYB 2I60H 4R8WL 3OLGA 3I50H 5BUPA 2DLFH 2OULB 1L9SA 1QRNB 3ARGD 1XH0A 1GSMA 1FORL 4UTAL 5CKAA 4QHKI 3QEQE 5I1LA 4WV1B 5CWSB 3CZJA 4OI7A 4HETA 4UM9A 2FGWL 2IMMA 1D5IL 5GISH 5JDSA 3T0AA 4ODHL 1EAOA 4S1DC 3TBSA 3RL2A 1WBXB 2VERN 3H9SD 2F53B 4MJIB 2VN3A 5C0FB 3P77A 1Q94B 3T8MA 2WKGA 4S10A 1M1XA 2FEDC 3EDDA 4HIJB 4LHUG 4U1MB 4XMVA 1GTNA 1DJYA 5I0YA 4NBXB 2JLPA 3ILDA 3TBTA 4MJ5A 2JI1A 2IANB 5LJYH 4GQZA 3VXTA 2ODHA 1XGPB 1EFXA 2NR6C 1ZT1A 2C1OB 5AVQB 1OM3H 3FTXA 5GJSH 4S1DD 1LXMA 2IDTA 1I9RH 4BK5A 1LLAA 3MRQA 2R1XA 5D8JH 3UZQA 2BWIA 3AQDA 1TVHB 2IBZX 2E27H 3W0WE 5TE4H 4GKZA 5HGGS 3ZDZB 1XXFC 3IWVA 3KYMA 1SMAA 2F58L 1Z5YD 2DLIA 2YAEA 3MYJA 4YO0A 1T21A 4ADGA 1BBDH 5JIHA 1M7IB 2NR6D 5KN5A 3S36X 4UINL 3KL5A 3OZ9L 4WWKB 5I30H 4MYWB 3V5HA 3W3BA 1PG7L 5JQIB 3DDGA 3FCTB 4R96A 4NFCA 3WTSA 4XOAA 3VXRB 1LK3H 2PXYC 1A7BA 1AH1A 2KZWA 2ZD0A 4YHKH 3T3MF 3JWOH 3BPCB 4K2UH 4OJFL 1KFAL 1RUQL 4XMUA 4ZOBA 3D25A 3FC8A 3NJXA 3U48A 2F54D 3CMGA 1GMEA 3WFHA 4X7TA 5CGMA 1KENL 1C8PA 2N01B 1JRHI 4WI3A 4UM9B 5BUAA 2MPAL 12E8L 2OP4L 3GRBA 5B7MA 4WFFE 3IFLH 4G8GD 3TBSB 3TP4A 3RL2B 2CO6A 4MSWB 2OA9A 2PXYD 3P77B 4PI2A 1W8EA 1JAEA 1M1XB 1J8HA 3Q2CA 5HYJD 15C8L 5I23A 3TBTB 4J3OG 4C56A 3UAJA 5ADOH 4LRNL 2NXZC 4MJ5B 2AXJA 3P69A 2HPTA 4KXDA 4WNQA 3VXTB 5M94B 1DJSA 4MA7L 4BKLB 3MC0A 4UQAA 1EFXB 4YS4A 1CC3A 1ZT1B 4Z7OF 1QZ1A 5DVKA 1MREL 5TF1L 1TLMA 4GSUA 4HPYL 4J28A 1O5PA 1WA1X 4HG4J 2IQAA 2WN2A 4G6ML 3MLUL 3MRQB 3UZQB 5TE6L 3Q0HA 5CGBA 4E5XG 3BKMH 1JMZA 4R6UA 1KB9K 5EU6D 1SJXA 1YYML 4PJ7A 2NXZD 2GAZA 4RNRA 3KYMB 4K7PH 3WEMA 1IFHL 3MYJB 4YO0B 3BDBA 2Q87A 4U2ZA 4YXLL 3INUL 2PABA 2OPCA 1ACYL 3L7EA 1JPSH 3V5HB 2EDFA 3MV7E 5IIEA 4R96B 2WCGA 3SGKC 1N18A 4YDIL 4F5CE 5JUEH 4JL2A 2ZOKA 5JYMA 3MV8D 4C57C 5FB8B 2ZCKL 3E3QC 3LN5B 3HJ0A 4I77L 4BQ8A 4ODBD 1MFBL 2A74C 3D25B 4AW7A 4B3VA 4BSWA 1INDH 3WDHA 4I9XA 3WFHB 4ZW8A 3PF2A 4BRVA 5I6PA 3O6MH 1FL5A 5I66A 1S9KC 3NJLA 2TSBA 2AXGA 2CO6B 4AW4A 3EH1A 2R2BA 3VDAA 3KWWA 4QJ4B 5LGHL 1J8HB 1RFDH 3BVUA 3NJMA 1DYZA 2ZX6A 1JPGA 3P3RA 4PRPE 4YE4H 3F6JA 4S1RH 4WNQB 1JYXA 2NY1B 5D71H 3LAFA 4HZ1A 3IJYB 2AMGA 3BLPX 1S5IL 1UKSA 4MXQC 4DP6X 1GCFA 2YPLE 2VUYA 4L3EE 2IQAB 5AYTA 5IFAL 3O3EA 2IWFA 2UX6A 3QK0A 3CFCL 3K74B 3NZHH 1RUAH 4U1HA 4ZMZA 1T6WA 3KJ4B 2NYYC 4PJ7B 1DQMH 4D9QD 4RNRB 6FABH 1T66C 2YMXL 4QXUH 5DD1H 1ZLVK 5DDHA 3DX0A 1TJGL 4GNKB 4GUCA 2CM5A 5T1LB 4F7MA 6PCYA 3HS9A 4GI6A 1CLCA 1KDJA 3L7EB 4MXQD 1IBFA 2COQA 1Q8MA 4NHUA 2VC2B 2OSXA 3MXWH 1BFOA 2DQHH 3GMOA 5IIEB 1VEMA 4MGXA 4M4RA 4IBYA 3QDGA 3NBNA 2UXVA 5BQDA 1YEKH 4PLKC 2NYYD 1A6VL 1XZWA 1T66D 2DQFA 4OUOA 2ZF9A 1DQJA 4BSWB 1IEBA 1YC7A 4L4VA 2FO4A 2G5RA 3NK3A 4WEMB 1KJVA 2C9VA 1J0YA 4M5ZH 4ZW5A 4XPTH 3WXWH 2R0WH 3WNOA 5I1HH 4TNVF 4K3EH 3BVVA 2YD4A 1FL5B 5I66B 4N85A 3WFCL 4DP7X 4ZXBC 2AXGB 3NDYE 1FZJA 3NN8B 5GZNA 5JORA 1MRDH 1NCHA 2R2BB 3KWWB 4PVNA 4OCRL 4PLKD 2XOTA 5K93A 1F2XK 3DX8A 1JPGB 2BIMA 3D48R 4M8VA 1CWVA 5H37A 5FR3A 1AZZC 2Z35A 1Z5LA 3HKFA 3WNIA 3LCYA 3DRQB 3SHSA 2YRBA 3ZE2F 2WKLA 4IEFA 3G04B 4UT9A 3O4LB 4PJDE 1ZIAA 2AJSL 5DYFA 1O9ZA 3SGEI 2B4CL 2C4FT 3RPIB 3T3PE 8CGTA 4JN2B 4ZXBD 2EE0A 4K94H 4H1LB 5L4MA 4YSPA 2BNRE 4JM4L 5I1IH 4KV5E 5J89A 2AV7A 5KVFL 3KEDA 1EUUA 4U1HB 4NUQA 3SJVB 1MFAH 5ISZD 5CJ8A 4EN3A 2DN7A 1G0XA 5A6IA 2BS9A 3NZ8B 3FQXA 1NFAA 1NGQH 1L3NA 2AK1L 3DURA 3OKOA 4N2MA 4F7MB 4FKKA 3ETSA 2XN9D 4NKIL 1G7IA 4HZLA 3BUDA 3CZUB 5CJXC 5TGBB 4NHUB 5AL0A 1II4E 1ZT7A 3L7FA 3GMOB 1WE5A 4LLWA 5KYUB 3FONB 3GO1L 5EF0A 3HPJA 1RVFH 3APMA 2UWEA 3SKUD 4MXVF 4M4RB 2PN5A 3QDGB 1DVQA 4IRZA 3RVUC 4N8CH 1KGYE 2R4SH 5SWSD 4GQ9L 1PZAA 1R3IL 5K59F 3ROLA 1UZ8A 2DQFB 2AJZA 2PCFA 5EZJB 1LO3L 2H8PA 1DQJB 2JIXA 3LIZA 1IEBB 4L4VB 1RZQA 1ZANL 4JJHA 3FJTA 1F58L 1KJVB 2WAQA 3S2AA 3IS0X 3I3EA 5E8DL 1W0YT 2GABA 3L45A 2JTDA 1D3CA 3VI4E 1H3VA 4ANWA 2VXQH 2AEQH 2MTAA 3L54A 4DGUA 1FZJB 3NIFF 3LZLA 3LTVA 5JORB 3RVUD 2J7LA 3MFGB 4EI5A 3EBHA 2ZP8A 2AEWA 4KI5C 1VZIA 1UUSA 1HS6A 2VDLL 4Z7UF 4UOW0 4J4PA 4PJFF 4EJ1C 5I8OL 3MJGX 3DX8B 1RLWA 1O75A 1IBGL 3BT2H 3G9VA 2Z35B 1Z5LB 1E4KC 2AS5M 3ZSSA 3NFSL 4IEFB 4NXSA 3T0EA 5HHVL 3VG0H 5AB2A 2J8UE 4ERSL 1LEKB 2FLBT 1EZVY 3GBEA 3KGUA 1F02I 4Q4IA 1PSKH 2N4IA 4ZX5A 3D69A 1CDJA 4KI5D 1XIWA 1G6RA 4CKQA 2AV7B 2ZTBA 3V6FB 1TQVA 1OSPH 4U1KA 1JUFA 4KVNL 4OFVA 4XOCA 1X4XA 1YEJL 3P3TA 4LOFA 3RZWA 4EN3B 2CXKA 3FQXB 3HCVA 2P1YA 2VUKA 1MEXH 2QV2A 3DURB 1J12A 3OKOB 4R7VA 3IJ8A 3LZFH 4J6IA 1N6QL 1G7IB 2O26U 4HZLB 1NAMA 3O41A 3LNIA 5IOPA 3GGWA 5F7HA 1ZT7B 3FCSA 3L7FB 3ZTJH 2D0GA 5I1JL 4MQ7A 3HPJB 1GS7A 2F7RA 3KVDD 2UWEB 3WUZA 3QQDB 5EB9A 1IT9L 4IIQB 1IFGA 3MI6A 3HLAA 5BZZA 5IFHL 2DS4A 4FNRA 4HH9B 3ROLB 4FLHA 1MFNA 2AJZB 2PCFB 4O9HH 2H8PB 4MB4A 4FGMA 3H0TA 3L5JA 3U7WH 1HHHA 3GUTA 5C0AB 1WYJA 2JJVA 5AOJA 4DPAX 1J9QA 3H55A 4NT6A 1MCWW 3QWQB 2XA8H 3CNKA 4GS7B 3TH2T 1NA8A 4GKSB 2OMBA 3VD7A 3V6BR 2UXGA 2YUVA 2EXTA 5EZOL 4LGRB 5EZIL 5AKRA 1IGCL 1CBJA 2WJ5A 4EI5B 4PJBF 5FF6A 1SRDA 2NSMA 4D9RE 4MD4B 4NZUH 4UV7H 2DKUA 5IT2H 2DB8A 1RSYA 1DN2A 1FLTX 2H1PH 2VDMH 5SV3A 3T0EB 4H5SB 3B7YA 3MLXL 1K4DA 3FN3A 4U0RB 4JKPH 4O02H 4KPHH 2BZ7A 5ESAA 4Y7OC 1WZLA 2CIIA 4XMLL 1HHJA 3D69B 3GNML 1RL1A 1XTMA 1XIWB 1G6RB 4CJ0A 3DOHA 3U30B 4U1KB 2FIKA 1KTLB