4WKXA

Reversible s-nitrosylation in an engineered mutant of pseudomonas aeruginosa azurin with red copper site
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGENWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALHKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Reversible S-Nitrosylation in an Engineered Mutant of Pseudomonas aeruginosa Azurin with Red Copper Site
rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 28
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4wkxA00
4HAKA 2YAFA 5LDUA 3AG2B 3WNJA 2BWIA 5I6OA 4GP8B 1KYAA 1AG6A 2GBAA 3FPXA 2PPCA 3S3CB 4ENZA 6PAZA 1PZCA 1FA4A 1T5KA 2HLEB 4DP7X 5ANHA 3JTBA 1PMYA 2PPDA 1HFUA 1OE3A 2R7EB 3ABMB 1M9WA 2AZAA 3FSZA 4HCFA 4YSPA 2UXTA 4KOBA 1L9QA 1SF3A 3KW7A 1CURA 2BO0A 2CUAA 3PAUA 2I7SA 3FU8A 3FYEB 5B7MA 2XXGA 1BEXA 3OQRA 1OCCB 5I5MA 1IC0A 4G7SB 3QQXA 1JZHA 3WI9A 3UAEA 4AKQA 2YAEA 2OJ1A 1A8ZA 5AZUA 5E9NA 3X1BA 2R7EA 1JXFA 4M3HA 1ADWA 5B1JC 1BXUA 5D4IA 1AS6A 2PP8A 1AOZA 4P5SA 1BXAA 1KCWA 2XV3A 4GP4B 3QJSB 4A2DA 2A3TA 1BQ5A 2BZ7A 2EINB 2CBPA 1SDDB 4W9ZA 7PAZA 1ID2A 1BAWA 1AACA 3ASNB 2FQGA 3OMAB 4DP4X 2Y1AA 4KNTA 5F7AA 1GY2A 2BW4A 2HX9A 2IDFA 4YSTA 2PCFA 3GYRA 1V54B 1QLEB 1TKWA 2CJ3A 2XX0A 1KDIA 2FT7A 3FT0A 3OD3A 1AZCA 2N0MA 3ABKB 2PPAA 2TSBA 3X1EA 3NJNA 3FQ2A 1VLXA 4L0PB 1ET8A 4K9JA 3QJUB 1SDDA 3RYMA 1GS6X 4WKXA 4MFHA 1F56A 1GSKA 2IWEA 3CVDA 4WTQA 2PP7A 5B1JA 1L9SA 2HX7A 1AZNA 1WS8A 2H47C 2DWSA 1RZQA 3T6WA 2FT6A 1OE2A 5I5IA 3CDZB 1OCZB 2FTAA 1ZIAA 1ASOA 3WKQA 4YVNA 3D12B 1ET5A 2HX8A 1RKRA 4UAHA 3ZX1A 1PZAA 2P80A 2VM3A 1AG0A 3X1GA 3DTUB 3MBWB 4NAJA 2YAOA 3EF4A 4JHVA 4BXVA 2B08A 1XB6A 2PCYA 4E9YA 3SBPA 1BXVA 1JXDA 2AANA 5AKRA 1GS8A 4GY4A 1NPJA 4FA7B 3EH5B 1NIEA 3CDZA 3WIAA 4DPBX 3UAAA 5B7EA 3SBRA 1FWXA 1ETJA 1MZYA 2HRGA 3NYKA 2J5WA 4YSCA 1MG3C 1R1CA 2H3XC 1J5CA 2HZHA 2DYSB 3S3DB 3NJMA 2XV0A 1JVOA 2YQBA 3WKPA 3V9CA 4YSEA 2VM4A 4GP5B 4E9QA 1EHKB 3CVBA 1WAEA 4N4YB 4DP0X 1GYCA 4F7KA 5TK2A 5I5JA 3IE9A 2HXAA 5B3SB 9PCYA 1NIDA 1SHWA 1CYXA 1YLBB 4A66A 3AW5A 5I6NA 1SFHA 1NINA 1BYOA 3X1FA 1WA2X 1NIFA 1MZZA 4A2FA 3ABLB 1KBVA 1V10A 3EHBB 2ZXWB 3PLYA 4YSOA 5F7BA 1PNCA 3PXLA 4UANA 4CSPA 1A4CA 1NPNA 1J9SA 3C75A 3SQRA 4YVUA 7PCYA 2Y69B 3ERXA 1NZRA 2DV6A 3QJVB 4YSSA 3KW8A 1PCSA 2I85A 4JKNA 2UXVA 3IEAA 2VSMB 3ZIYA 2J57A 5EHFA 4AI7A 1KDJA 3NJFA 1OV8A 3AG1B 4A68A 3HB3B 4NERA 2QT6A 2E86A 1DZ0A 3NJKA 1N68A 2FNWA 4DP2X 2X87A 4RH4A 4DP1X 1AAJA 3EH3B 3FU7B 1AIZA 4BWUA 3UABA 3TBCA 1ILUA 4BWWA 4YSDA 5I26A 3T6VA 1JZFA 3CVCA 3N2JA 3CG8A 3NJJA 2IH8A 1JZJA 1NTDA 2XUWA 2OV0A 1A4AA 4GXFA 1IUZA 1W6LA 1FFTB 2XX1A 2YAPA 3NJLA 3UADA 2WO3B 4GYBA 1KCBA 2YAHA 1AZBA 2BHFA 3X2QB 2RACA 3FU7A 3T71A 4AKOA 2EIMB 1J5DA 4DP6X 1SFDA 2J55A 2PPEA 3QJTB 1AQ8A 3S8FB 1L9TA 3FU9A 4AKPA 2PP9A 2BP0B 4A2EA 3BQVA 4Q8BA 2GSMB 4N8UA 3ASOB 2LLNA 2AZUA 2UXFA 4HHGA 5B1BB 2CCWA 1ET7A 1L9OA 1WS7A 1N70A 4G72B 1JZEA 4TXVB 2IDQA 3AZUA 3FPYA 1V55B 1ZV2A 1NIBA 3N55A 1NWOA 2EIKB 3G5WA 1W8EA 2JKWA 2QDWA 3X1NA 2YXWA 1JZGA 4BDVB 1OCOB 1CC3A 3NP3A 2BP0A 3WNIA 4PAZA 2YXVA 1JZIA 4G7QB 4KO5A 4M4RB 3NSYA 1GW0A 1J9TA 2X88A 4G71B 2XU9A 2NRDA 2FQFA 4FAAB 4DP9X 1A3ZA 1QNIA 2OCCB 3IBOA 8PAZA 4AX3A 4QLWA 2BP8B 3L45A 1B3IA 1E5YA 4KO6A 1CYWA 4CSZA 4KOCA 2GC7C 2IWKA 2P80D 1SHXA 1MDAA 1X9RA 3ZBMA 3FQYA 3MX0B 1WA1X 3PCYA 2ZONA 1TU2A 1SF5A 1BYPA 2W8CA 2XVBA 5FC9A 1A65A 5D4HA 4HZ1A 3U25A 1A4BA 1PY0A 1AS7A 1ZDQA 3H56A 1NDTA 3NP4A 3SBQA 4W1TA 3IN2A 1JERA 5PAZA 3GDCA 1E30A 1NIAA 4ZK8A 2BP8A 2VW6A 1MG2C 4YSUA 1XMEB 1BQKA 4P5RA 1RCYA 4E9WA 2FQEA 4HIPA 1GR7A 1PZBA 1OOWA 2I7OA 5B7FA 1QHQA 3IN0A 3T9WA 1ASPA 2GC4C 4A2GA 2CAKA 3ZDWA 5B1KA 2Q9OA 1ZPUA 2GB2A 2XLLA 1OF0A 4DP8X 1JXGA 2IAAC 4PCYA 3TBBA 1GS7A 1M56B 5I6LA 2IH9A 4DPCX 2IDTA 1KGYE 4KNSA 1BQRA 3AG4B 1CUOA 2UX6A 2GI0A 2EILB 2MTAA 3FSVA 1NWPA 1W6WA 1HAUA 2IDSA 4HALA 3V9EA 3DKHA 2YARA 2EIJB 3NSFA 1L9RA 3CZUB 2FT8A 2VSKB 1EZLA 1OE1A 2IWFA 3TASA 5D4JA 2WSDA 3GXUB 4HCGA 2MRYA 4JHUA 1XB8A 2QPDB 5PCYA 1KV7A 2VN3A 1HAWA 4E9SA 3DIVA 4E9VA 1URIA 1JOIA 2FJSA 2GIMA 1NICA 1ASQA 2QDVA 1GY1A 4YSRA 4BK5C 3PAVA 4A67A 1JVLA 2BW5A 1PF3A 1KBWA 4G7RB 3OMIB 2WO2B 1ZIBA 4E9TA 2FWLB 5I28A 2AFNA 3FSWA 3S3BB 2DY2A 4X4KA 3H4HA 2CALA 1IKOP 4A2HA 2YAQA 1RZPA 2Q5BA 3ABGA 3QJRB 4G70B 1J9RA 4YSAA 1AZRA 2B3IA 2DWTA 4HCIA 2JFCA 3TU6A 4EF3A 1AZUA 5I6MA 4KNUA 2VW4A 5I6PA 3NSDA 3JT2A 4DP5X 4UF7C 5TK4A 4DPAX 1SNRA 5IY5B 3NJIA 3UGEA 3TA4D 1AR1B 1IBZA 1E5ZA 1ILSA 2DYRB 2GHZA 5B1AB 5AFAA 2HRHA 4Q89A 3FQ1A 1J9QA 1OCRB 2XYBA 3NSCA 4BXSV 6PCYA 3EH4B 3T6ZA 2H5UA 3NJHA 4QKTA 1ZDSA 2ZOOA 4E9XA 2QPEB 2J56A 4F2FA 3FYIB 3WG7B 1AANA 2PLTA 1PAZA 1UATA 1AS8A 3OM3B 1M57B 1DYZA 2IDUA 5A7EA 3QJQB 2BWDA 2TSAA 4KO7A 1PLCA 4BDVA 1PLAA 4YL4A 4YSQA 1PNDA 3OMNB 1IBYA 3PAZA 1PLBA 1TEFA 2XV2A 2BZCA 4F2EA 3NT0A 3AG3B 3QPKA 5I6KA 3FS9A 1SJMA 3NJGA 2VMJA 2YAMA 1L9PA 1E65A 4HHWA 2W88A 3H4FA 1TEGA 1I53A 3BVDB 4KO9A 2FQDA 2VW7A 3HEIB 4BWTA 1XB3A 2ZWNA 2AVFA 1E67A 2XXFA 2XWZA 3T6XA 4AZUA 2JXMA 3UACA 3FSAA 4NB7A 3S8GB 3PPSA 2PPFA 2UX7A 1X9UA 4E9RA 1WA0X 2UXGA 3AY2A
chains in the Genus database with same CATH superfamily
1QSFB 1UG9A 5FA3B 4O51A 3UBHA 1KXVC 1ZGLM 3MSPA 5T1KB 2Z35B 5EN3A 3V8CA 2A2QT 3U4EA 4NNYB 4LKCB 2QGCA 1ZSHA 3S3CB 3VDCA 1H6UA 4NN5C 2FL5A 4FHJA 4K3EL 4NKDB 3CK0H 2NY7H 5DJZB 1HFUA 2I60H 2R0KH 3BH4A 4OUUA 2NY2C 3EGXB 4TSAL 2BINA 5LN8A 4NQQA 1KZYA 1L9QA 1N0XL 3ILPB 4CN1A 5D1ZA 2F53A 2BCKB 4XC3L 2V37A 4Y1AB 1S7QA 3STBA 3TEXA 4KK5D 2GQHA 2JB6B 5TGBB 4LOUD 3FZUC 4IRJA 4YHLL 1G87A 4G7SB 1JWUA 1Z9SA 3QEGL 5IFHL 5DQJB 2WN3A 1D6EB 4P0DA 3L5WA 3DIDA 3SQBB 5L88L 1H19A 3HKZA 3X1BA 3OV6A 1KENH 1NAMA 2MMXA 2P5EB 3CFKA 4GXVL 3T0VA 4IS6A 3WMPA 5IHUL 2BIPA 5AAWA 2IIJA 4XNMB 2IJ0C 5IUCA 3QJSB 3QG6B 4TLUA 4Y5XB 4C57C 2YEVB 5CCKH 4FQLH 4HIIB 5I23A 2G2PA 4JRYD 2Y5TA 4U1GB 4NFCA 4FF9A 4NSKA 2KDYA 5F0PB 3MA9H 2HKFL 4YE4L 3CMOH 2IFGA 3QUXA 4WUKL 1IZJA 3ZKND 3RDTD 3WO4C 1RI8A 3A24A 5I1DA 4Z8FL 3MLZL 3QQ4B 4EO5A 3QUZB 3MQIA 5G5DA 3ZSTA 4PYHA 1CVSC 3L54A 4JDVB 3F04A 3EYFB 5JQ6H 4IMKA 1PQZA 1LWRA 4TL4A 2VABB 2ADFH 4XP6L 5MI0B 3UBXB 3UJJH 5C0CE 4NRXA 4EBQH 3L4UA 3NJNA 2GT9B 1UUNA 3TTSA 4B9PA 4PJXE 3VYOA 1Y0LB 4HEME 5C07D 4HZAA 5C0FB 4XMPH 1U8NA 3ZL4H 2OMWA 3LEVL 3T4YA 1PIGA 3L3IA 2BSRB 4Z7QE 2COVD 3QC6X 5EU6A 5BW7A 4DQOH 1QFWI 2C9SA 5CO1A 3BVTA 5LUMA 3LRKA 3LCYA 4ETYA 5LXGL 1DP0A 1KIPB 4QY8A 2Y2WA 4NJ9L 1KLUA 4L3EE 2QV4A 3X3FH 2IAMB 4OF6A 4H8WL 1HI6A 3KL0A 2B2XL 3HC3L 4M5YH 5DS8B 3ZKQD 4XNQB 4U1MB 5DT1H 2WBJA 3SBPA 3M7OA 5E2UL 4LBEA 4ZUVA 5ESAA 4CKVX 4NRYA 1F4XH 1DQJA 4XN2A 2WQAA 5D1QB 2FWSA 2A4CA 5F70A 3DROA 1PKQE 3QIUA 3DX2A 4AEHL 3OJ2C 4CDGC 4IMLB 1TQCB 2NY4D 5JHLH 1S7XA 2A1WL 4EAEA 5DTFB 4E0RA 4JCLA 4L1SA 2WUBH 4BFKA 4XXDB 3E6FB 4HK0A 4PJGB 2VDOL 2FX9L 2FO1A 2FJFB 1YPZB 5IVOA 1NCWL 4QRQB 2VM4A 3GSNB 1S3KH 4RAUA 4TNWF 3T0EA 3MLTB 3FQXA 2WWMC 1R3KA 1E4KA 4FP8H 2WVUA 2Z65C 5C0AE 2VR5A 1YMME 3PG2A 5T33L 2GVYA 5T8IA 3ZRSA 2QPUA 1CPUA 4RFNB 3QEUB 2B20A 1HE8A 3LKNA 3QJFB 4FCHA 4XN9A 4FTVB 4NKMB 4FQ1L 4PBVC 5SWSE 3MREB 1UB5A 2P24B 4YSOA 4N86A 4K4KA 3R06B 3UERA 5D6DA 5IMLB 1ZTXH 2GIYA 2PWGA 3EJYC 3KS0J 3L3OC 3SZ6A 3HG2A 3MYJB 1IJ9A 3QJVB 3H3PL 3RU8H 4M62L 1TYEB 3W2DL 1IAOB 2D31B 2OMXB 2W0FB 1HZHH 3WKYA 5DQ9B 3M8OH 4JEGB 4Y9GA 2LLGA 5CMAA 5HGGS 3VTMA 2FGWH 2C3VB 4O5LL 1BPVA 3CHPA 5EHFA 1TR7A 3CFQA 4LLQA 3D2UA 3FCGA 3SJVD 3V95A 3VXUE 4OCMC 3EOAB 4XNZB 5IWLC 1JPTL 4HBQA 1MJ8L 1CE6B 4ZS6D 3BP7B 3TM6A 4PJDA 3EO1B 4PJEE 4B9IA 3OBAA 1E5CA 4BZ2L 4Y2DD 1DBBL 5KSBB 1G7LA 1BBJA 1YCSA 1K85A 1XGUB 3FRUB 3Q2WA 3MODL 2BK8A 2HVKA 1WZKA 3TVMD 4U1SA 3VGAC 4K7PL 3IETB 2WYHA 2JIXB 1JZJA 5GS0H 1IARB 1AQMA 1GMEA 2QKIA 3OKEA 5G55A 1XSKA 2O6FA 1Q9OA 2AV1B 4M93B 3R0NA 4NKOB 1NLDH 2BRQA 4X5QA 5HY9A 4QF1B 2WO3B 2VLRB 2JI1A 4H0IA 5D5MB 4QAMB 3L4WA 5JOPD 3WIIL 3FU7A 4F57H 1UH2A 2IBZX 2RALA 4HS8L 3C8KA 5DVMA 1NC2A 1L9TA 1E7VA 3ARBC 5L2KA 4EI6A 3H42L 5E8NA 4WWNA 2EDRA 4LSQH 4JO5A 1JZ5A 4HULB 3PHOA 1DQML 4YPJA 4N8UA 2BVOA 3LRLA 2LLNA 2QTVA 1OAZH 3LKOB 5D71L 5CGYC 3I02B 2ZYSA 2WCSA 4HUWB 4MMXA 4G72B 2GIXA 2QVIA 3QUYC 1MRDH 2BIHA 4GQ9H 3C08H 1V55B 3E2HC 4OV5A 4LNRA 1NIBA 3N55A 2YPVL 1UYWL 1BJ1H 4XE0A 1ZLSH 3V4UL 4W4NA 1OCOB 1H3PH 1I8KB 2NXZB 3TJPA 4M00A 4WEEA 4N9GA 2GJ6E 1QUNA 4BBWA 3OAYH 1UGKA 2CDFB 4MS6A 1FP5A 4OLUH 3GXTA 3R1GL 4CC4A 1QOKA 2YGVA 4BSVB 1QFPA 2KQNA 3O6FC 2YD9A 3GI9L 4GLRH 1HH9B 4HOMA 4OAWB 4X9YA 1U3ZA 1TYJA 4EQ2A 2FYVA 4NN6C 5DJYA 1CFBA 2X09A 4PJBF 3KHOA 4AX3A 5F3FA 3FAWA 2V2TA 1GJWA 2EXWD 3CVHH 3HBPA 1UB6A 5I71B 1IAIM 1WHPA 2AEOA 4KI5F 2R1XB 4HC1L 3NZSA 4UTAH 3WTTA 1FO0B 1MRFH 4IBUA 3IGAA 1S9YB 2IANE 4H20L 3FQUB 4F1SA 1TZHB 3NBNA 4OQTH 1Z7JA 3TBVA 3OKKA 5DA4A 3EFFA 1D5MA 2F54A 3MLSH 4UT9A 3O2DL 4E36A 2X2UA 5KVEL 3IJSB 2AEPL 3ROOA 1C1EL 1T20B 5AVQB 2FSDA 1JERA 4OB5L 3L7FA 5PAZA 4ZK8A 3FCTA 1F0LA 3FO0L 1ZS8B 3O41A 4HCRL 2DWEB 2BPBA 3EG9B 1ZHKB 2FQEA 4JQIA 4AQAA 1W2KT 4ZD3H 4PSPA 5JMRA 4I48B 3AROA 1NMBH 1E9PB 2PTTA 3F65A 4MBOA 5GHWL 3RWHB 1ASPA 2GJZB 1JPEA 2OYKA 3QCUH 1M3JA 2EC9T 1AVAA 1ZWIA 3A4FA 1DEEA 3F01A 1YEIH 1G7IA 5DQDH 4QTHA 3SDYH 4JVWA 4GG6E 2JKTM 2J8UB 2YK1L 3SDAB 1LVEA 3SE9H 3PWLA 3BCFA 4AENB 1X44A 4HH9A 3DX9A 2IADB 2C3GA 2MTAA 1DQDH 5IFAH 1G1YA 4J8RA 4N2GA 2NZ9D 3CVHA 1TJHL 5IB1A 1DHKA 1UM5H 2DLFL 2FZ3A 5KBLA 4Y19B 4UTAA 4N2NA 5B22A 2MIZA 2AF2A 2ICWI 3MBEC 3BI9X 2N7SA 4JUSA 3BWZA 3U46A 1Q9KA 2ATPB 2VXQH 1S5HB 3WY3A 5BQ7A 1QPKA 3IJYB 3B9KC 1GC1L 4PN6A 3HLAA 3ARFC 1OE1A 1WP6A 2CQVA 2IWFA 2UUDH 2R15A 4XAKE 2BCMA 4V1DB 3RP1A 1DVFD 4X7SH 4PRBB 4UQ3A 4BE5A 3DUUB 4D0BB 4Q4IA 1KC5H 3MUY1 2RGSA 3VFNA 3N5AA 5CD3B 4A67A 1QASA 4OKVB 5C7ZA 3U7WL 3BWUF 1J10A 3TN0B 3ZDXF 3R8BB 5GS0C 4FEIA 1A1MA 4RMSA 2Y22A 2FWLB 1NFAA 1LWHA 2UZYB 2J6WA 2BZDA 4NFDA 3L5HA 3S3BB 5IMMA 2NY3B 1A6WL 2EDFA 1A6PA 1QPXA 3GRBA 1YEEH 1U91A 1DLHA 4H5SA 3QJRB 4PJIF 4JLRA 3J8F7 2ILLA 2IGLA 3MGAA 5LO7A 3QUMA 2JFCA 5AUMA 4KNUA 3FHQA 2PW2B 5A6IA 1X3DA 5IT2H 3AU0A 3NSDA 5DVPA 2J20A 1K4DB 2OYLA 4HHAA 3NJIA 2ITEA 2N1TE 43C9A 3HI6H 3NIFE 3ZHKA 5DUBA 3ZK0A 3EKCA 1NCBH 3KPNA 1SZNA 4PRDA 5EMYA 4R7XA 5CJXA 4D0DA 3LVTA 1A8JH 4W6XB 2EADA 1P1ZB 2V6HA 4L1BA 4S1QL 1PSKH 1TMQA 5CINH 2VNCA 1BGXL 1KTCA 4HT1L 1OCRB 3WEMA 4ATTA 2WBKA 4DEPC 3HOGA 1WBZA 4PS7A 5TF0A 4I1RA 1MJJA 1R5IB 4W9JC 5IVXE 3VGGA 4R83A 3SKOB 3ZZQA 2K45A 1TO5A 2ITFA 2AV7B 1HOEA 3NMEA 3BP6B 3O6KH 5LDSA 2WXMA 3CZEA 2IOMA 1WTGT 3ISWA 3MRRA 3I75B 4P4RA 1EFXB 1CTOA 1PNDA 5HI3D 1WT5C 1FNFA 1O0VA 4U2YA 1B9KA 3MXVH 1PLBA 3UTQB 2QQKH 2XJLA 4PVMA 1ZLWK 2XV2A 3U4BH 3ZDYB 4NUJB 4PY7B 2CK0H 2Z8VC 3E6HA 1KN2L 3VCLB 3H4FA 1I53A 5BO1L 2VW7A 1P9MA 4HV8B 4JPKL 4OGAC 4Y7MA 1M05A 4X6BA 4TVPH 1OXYA 2ADIA 1RJYB 2UWEA 4LSSL 3DETD 3U1SH 3H9ZA 1EPFA 4MXVF 3W81A 3GJFB 3C5ZA 5JHDA 3MJ7B 2R4SL 4PUBH 5DVNA 1EEYA 4ZFZA 2WMPB 1P7QD 3MU3A 2EE9A 4X80H 2L0DA 3KPMA 3PIQB 3ZN6A 3BVXA 2PO6B 4UTBL 1NCAL 5JORB 5D7LD 3WNJA 3FL7A 1I7UA 4OIAA 2LHAA 4PSRA 3D07A 2QLYA 3SD5A 4K23H 1BQLL 2XZAL 3EGDB 1GGIH 1PDKA 3ROLB 1USZA 3LH9A 1MPAH 4JN1L 4YSPA 3WAKA 1FL5B 2UXTA 4WNJA 4KY2A 5T3XL 3PRZA 4ZFOB 3ZE1B 4LASL 4X6DA 5D8JH 5K9JH 1KEGL 3NCMA 1MAKA 4G9FE 3F6JA 2JE8A 3SDCA 2ZCLL 2MOVA 2DQFA 3H3BC 1Z3GL 2VJ8A 3F7VB 3PV6A 2NX5B 2K9FB 2WD0A 4GUPB 2A6DA 4RISL 3RWEA 4BFNA 1QR4A 5E6ZA 2HJFA 4TV3A 4RZCA 5FHBH 5HYSB 2ICWA 3DX6B 5C0EB 2JKRM 1F13A 1V3MA 1MUJA 2JWYA 4X7FC 1D5BB 1V27A 2JELH 5D4IA 2AQPA 1S7TA 2PCFB 5IBTL 4KKLC 3ZO9A 4P5SA 2R39A 3RUGA 1QR1A 4AL8L 4GP4B 3B2PA 4R7VA 1J1PL 1CGUA 3GSUA 4JY4B 2P44B 4WRLA 4RBPH 2EINB 4DKEL 5C0JB 1F41A 1OTTD 2X5PA 3EDDA 5I76A 2F8VA 3MNWA 3PHQA 3LSOA 2HMID 3U9UB 2IFFL 3AXLA 2Y1AA 2CD0A 1IBDA 5JXEC 3IU3A 4X6EB 2HT2C 2IDFA 5DVOA 2D3NA 3ZUCA 1JS4A 3U1PA 3FO2A 4TSAH 1ACYH 3UTSD 2O5ZL 5CM1A 1N0XH 4HUNB 3FN0L 3M17B 4A7TA 3FT4B 3T2OA 3OD3A 3FTGA 2F8XC 3IPEA 4ZMZA 3S96B 4L0PB 4MWFB 4YHLH 3N42F 5GIRA 3KLDA 3QEGH 3L4TA 3CVDA 5IFHH 2VITB 2VLJA 4J3TA 3KXFE 2LU3A 2WQRA 1BWWA 2YZ8A 3NPSC 5L88H 3FQRB 1FIGL 5LNGA 2XIDA 1HWWA 4IHBA 5I5IA 4LHUG 4DUWA 4GKSB 5DDHB 4GXVH 2FH6A 5FCSH 1MCSA 2DQIL 3RX5A 2VM3A 2W9DL 3QIBC 3LN5B 4HAGA 5EPMA 3KPRA 1N5AB 3TO4C 5JW3L 3KPQB 4F7TB 2GEQA 3P4NB 4JFZL 5IESL 3K0YA 3MROB 4L4TA 4GJTB 3NCFB 4MD4A 5DVLA 3M1CA 2HKFH 1E4HA 4YE4H 3CV5A 2H9GB 4WUKH 2WY3B 1NAKL 4Z8FH 2EUXA 4XX1G 4ADIA 3MLZH 4MSWA 3LRMA 1G6VK 1T5WA 1J5IA 1OCWL 4WWOA 2DLTA 4NDMB 5DEZA 5L2JB 2XPGA 3U30B 2EZ0D 1RXLA 2X4TB 3B6SA 4ODHH 4E42B 3N9GL 4XP6H 5E4EC 3JZYA 3WLWC 5EZJB 2HG5B 1UWEL 3GLEA 2ZUTA 3VFGL 4X98B 3M1BB 3MBWA 5FKAB 4EN3B 1CFMA 1CGSH 4QHKJ 1RPUA 2VLKA 2WNKA 1DL7L 3HE7A 1FL3B 4KHTL 4LVEA 3L1FA 1SBBA 5B21A 4N4YB 4K5LA 1A2YB 3OLEA 3K4AA 4P5TB 3WJMB 4GXUN 1HYSC 1YNLL 3BQUD 5D7IB 3AABA 1N10A 3LEVH 3ZTJG 2SEBA 2Z8SA 5J1AA 5B4MD 2EJ1A 4KC3B 1MHHB 4Y4KA 4LCWD 5I6NA 4FD0A 1NINA 4HEPG 1B0IA 4NQSA 3W5MA 1U8JB 3EFOB 5LXGH 5F0MB 3B8SA 4QHLA 1LP9A 1E9OA 1V10A 3EHBB 1QA9A 3EYQC 4NJ9H 3KJ4C 4UDUA 4UV7L 5LGJA 3TF4A 5H4YA 2WTRA 4C83A 5IQMA 4TULL 3B34A 4MCZA 4YVUA 2B2XH 3HC3H 2Y69B 3ERXA 5E4OA 5TDPB 3S48A 3H1ZA 2YWZA 5E2UH 4QRRA 5BS0E 4JQVC 1G9ML 5DJ6B 4DO4A 3GRGA 3MRLA 4R90L 2G75B 5EIVA 4XNBA 1J7VR 2A1WH 4C58B 4PJ7B 1I1AC 3AU1A 1MW3A 5BZXA 3MXWH 4YL9A 4Z76B 2E86A 2ZP9A 3HHSA 2VDOH 3ZQWA 2EVHA 3CXDL 4JJ5B 5CXPA 3LNFA 3TEUA 1NCWH 3OF6D 2IH1A 3CLEL 3EH3B 3B2UD 3AXHA 2WINA 3L4ZA 1DQIA 2E7LA 3TCXA 2J2ZB 4BWWA 1WSST 2XNAA 2HFTA 3D39E 5JUEL 5T33H 1RPKA 1TCRB 1CLYH 2QZ5A 3T3PB 1KB5A 3TV3L 3WFEL 1IGTA 3W38A 5FOJA 4ZG1A 2XUWA 5J57B 1IC5L 3V6BR 4WI7A 5JYMA 1PX8A 2FR4B 3FB6A 4K94H 2M1KA 4FQ1H 4CC0A 4GAGL 1LO5B 3REWA 1JHKL 1U8LB 3DECA 4K8RD 5IGXL 4A37A 3OHMB 3CGTA 1BQHG 3X2QB 5GQBA 1NM4A 1LMKA 2BOBA 4AQ1C 5IV2B 2H6PA 1J5DA 2YSSA 1EXGA 3QDMD 3TYFA 3S8FB 3H3PH 2O30A 2ZYIA 4M62H 1VGKA 4I0PD 5AW3B 4Q8BA 4Q6IC 15C8L 3AB0C 2COQA 3IMSA 3NZUA 3ASOB 4X4ME 4RMWA 2AZUA 4ILDA 5C0BA 3QDGE 3SBWC 3EYOB 1SXCA 1WS7A 3IMTA 1JZEA 4XBGA 3ZMRA 1G1OA 1JPTH 3TWYA 5E0QA 3CFNA 3FQTB 3HMXA 3E9TA 1W8EA 1TJGL 1E8ZA 4BZ2H 1J0KA 2KT6A 1DBBH 3BSGA 4R4ND 3LD8B 3SCMC 1ZAGA 2FEJA 1EIBA 1XXDC 3H2WA 3QZBA 3MODH 3MV9B 4N22A 2QV2A 1UCBL 2EDJA 1ORSA 2X88A 3HG1E 3QZLA 4N1EA 3KPSD 5F44A 3C6LC 4XXCC 4YHML 2LU4A 4NGHL 4M43L 4R0LB 4MVBC 2E76C 5C0IB 5TE4L 4BUHA 1AY1L 1U8QB 4MJIA 3AREA 43CAA 2B16A 4WFGD 2GYSA 4OGXL 3T2NL 4HZLA 2GC7C 3WIIH 2CLZA 1ZTXE 4HS8H 2C4FU 2DM7A 5CCJA 2A9NL 2MTPA 4KQ4L 5GGRB 3VVVA 1DVYA 1AR1D 1EHXA 1FLTX 1OAQL 3TYGL 5E5RB 1KPRA 3H42H 1XTLA 1I75A 1JI1A 4IBZA 1T1WA 4N0YL 4QXTB 4HOWA 4NCC1 1DQMH 4Q9QL 4O51B 5KSVA 1SLXA 5D71H 3P9MB 1Z66A 1CICA 2O61B 1R33A 3SPVA 4EZJA 1FFNB 4IBTA 2FL5B 4LGPB 4QXVA 2E7LC 2BIOA 5C6TL 4HBCL 4P46A 4UAOB 4K7PX 2VN5A 5F97E 2YPVH 3RL2B 1UYWH 4WI6A 3MNMA 3GMQA 1BD2E 3B56A 2ENYA 2Q9OA 3MRMA 5K9QG 3GB7A 2F53B 1A25A 5BOPA 3ZIMA 4UQIM 5C0CA 2CPCA 4PCYA 3R1GH 2K3TA 5E9AA 1CL7I 2C3HA 1X7TA 4ZAKD 4KROD 2AJ3B 4K9EL 1AD0A 2J5LC 3GI9H 4Y4FC 1CUOA 5AQ0A 2UX6A 2X6UA 3MV7E 2HG0A 3GINA 3L5WB 3O4OC 1IO4C 4WU5B 4PJDF 1EJ6A 1A6TB 3WUWB 4FS0A 3TPKA 4HC1H 1QTPA 5ICYB 4IS6B 2CO7B 2YA0A 1JZ4A 4H20H 4OD1L 4F1ZA 1DBML 5IQ7L 2YPLB 1N8OE 1XR8B 1T0NA 1JN6A 1T2XA 1T7ZA 3BEVB 3O2DH 2APXA 2FX8L 2Y5TB 2AEPH 2OR8A 1C1EH 4JHWL 4UOZA 1S9KC 5I15L 2XDHA 4OB5H 4ZXBC 3FO0H 3QUXB 4NPYA 4HCRH 3DLQR 2K8MA 1YEDA 2P4AB 4ECNA 1MREL 2H8PA 3N41B 3FF7A 5LBSA 5E6IC 3QAQA 1EJOL 1DQTA 3ARGC 3K1DA 1F6FB 1PKQA 3U6RA 4AJWA 2DQ6A 2R2EA 3S35L 2NSMA 3FHAA 4JMNA 4NRXB 4K94C 1DJWA 4FFWC 5FCUL 1JK8A 2QVKA 3E7JA 2YK1H 4NO3A 5ICXA 3TNNA 4ZOEA 5ANME 5A1AA 1R3HB 1YYLH 1RU9L 5J6GB 3LIZL 4RGNC 4ELDA 3FFDA 3RVWD 2LABA 5I16A 3WTVA 3EJSA 1DJXA 3FU6A 4JFYB 1UEYA 5C0AA 1YMMA 2E8ZA 3T4YB 5D93C 4FXGC 1TJHH 3L3IB 2Y5EA 5EU6B 2DLFH 3QBTB 4OM1L 1QRNB 1PW3A 2P5WA 1TIUA 5AVTB 5TK4A 3P0YH 4LVHB 4QHKI 5E4AA 1QEXA 3D69A 4GPVA 4JKLA 4QY8B 5SWSA 3U2JA 4CVZA 4GFTB 3C60C 5IBLD 3ULVE 1JPST 5B39G 1MN4A 2DJMA 2VJXA 3DRTA 2GHZA 4NQUA 3ALXA 5JHBA 1GZPA 2M2DA 2X0WA 3KPPB 1J48A 4B0MB 1EEZB 3I6SA 2CIKB 3INUL 1RHHA 2WBJB 5F0LB 4LBEB 3H2QA 3QQ9C 1T0MB 3LRSB 3NJHA 1OGTA 4QJ3B 2WQWA 4JZJB 2DL2A 3FUFA 4P4KD 3DROB 4IM8A 1S7XB 1M57B 3MCYA 3PQYE 5C09B 1GW6A 5D2LA 4E0RB 3QZWA 3TBSB 3SDDB 4PJEA 3Q13A 4O2FA 1NKGA 3X17A 5KBPA 5HHME 1TEFA 1A6WH 4PMFA 4RAUB 4F2EA 1EH9A 1TETL 1UACL 2H32B 3L9RA 3BH8A 4U6XB 1IVTA 1TSRA 4ZPTB 3ZKMD 2WQVA 2WANA 1CFQB 3GD1C 2NW2A 3LAFA 4F7CA 1JI2A 1R3IH 5F71A 3PREA 1XF3B 2AVFA 3KGSA 5F9WB 2DJUA 2XWZA 3RVXD 2EDEA 4F92B 1UB5B 1QKZL 5CLZA 1G7JB 1PD1A 1YQVL 4ZMLA 3D34A 2MQCA 4KVPA 1RZKH 1WA0X 4PV8A 4JM2C 4JVUA 4S1QH 4A39A 4KZEH 1BGXH 1Q90A 3WFBL 3FTYA 2NY1D 4N2HA 4YHOL 4IEFB 1A6UL 4L8CA 4OCWL 4BV1A 4K07A 2D7NA 5CMAB 5LN4A 4CN6A 1OE3A 2JKJA 3ELQA 4JBSA 5CD5C 5E24E 4FA8A 2KPNA 8FABA 2XXCB 3H2PA 2ESVB 4F9LC 2OZ4L 4BFFA 3BW9A 2CIIA 5C9JA 1G7LB 5H4ZA 4BH8A 1BBJB 1YN6A 4LCCA 1KN2H 5GZNA 3OG6B 4F27A 3T77A 2GJ6A 5AVWB 2HTKD 1M7UA 1D5XB 4JPKH 3O11B 1LTXA 1LEIA 1VDGA 5JZ7D 5CN1A 5SWZE 3UJTL 1G9HA 4LSSH 4R26L 3N0PB 1RK0A 1KYOJ 5D1XE 1Q9OB 1W15A 2CHDA 4FJ6A 1FGVL 5ETUB 2VZ3A 2R4SH 1KCWA 2Q7AA 3REVA 1JRHI 1OW0C 2VLLA 3UG3A 4Y9CA 4HFWB 3C8KB 4P3WA 4UTBH 1KTLB 1NCAH 2CRYA 5D7KD 1VFBB 1R5WA 3SPIA 3ULSA 1S4IA 5CGMA 4AVHA 5J11B 2QADB 1UJTA 3RIFK 1JMZA 4OH2A 4I9XA 4DP4X 1KCKA 3MOAL 1BQLH 1CFTB 2XZAH 4X6CE 2AXFB 4G6JH 4MMXB 4F7PB 4HIEB 5DJ2B 3VG9B 1UH4A 2WNGA 3DOSA 4JN1H 3GIVA 2XX0A 3VFTB 4YBHA 1OEZW 4PB0L 4KRPB 4OV5B 4LASH 5EU3A 2TSBA 4HU2A 4F24A 1AQKH 1CGVA 3KG5A 4N6QA 3FCSB 2IC2A 2VZUA 4H25A 3AS2A 4I18A 5E2JA 2ZCLH 1CD8A 1YDPA 1Z3GH 2A9DA 3WDJA 3CDCA 5F7EL 1L6XA 4U3SA 4N5UA 3F62A 1WS8A 4ZZFA 4PIBA 3UO1L 4U05A 1ZPLA 2OXGB 2TRHA 2BXYA 2G2RB 5IBTH 1QQDA 3KLHC 3VXPA 2OAAA 1PZAA 1SJHA 5EBMB 4QRSA 4AL8H 4AC2A 1UB6B 2ITDB 2QPSA 4PGDA 4XH2A 3EAKA 1J1PH 2AITA 2I25N 1K8IA 5E6RB 3VFPA 5E9DA 2X0VA 1PTZA 4AV0A 4NC2B 1E50A 2HWZL 3HZKA 3V0IA 3VWKB 2NUPA 3IDGB 3TBVB 3ZE2E 3EFFB 2X7LA 2IFFH 3ZYIA 3SE4A 4FA7B 2PTUA 3MJ8A 4YXLH 2UWEF 4RFEA 5JLZA 1INEL 3GTNA 3N43B 2OXHA 1ETJA 1XGZA 2AK4D 4JCWA 3O41B 2O5ZH 1T2QH 1O9ZA 2GSIB 3MUUA 5BZDB 3CH1A 3FN0H 1KCVL 5K59E 4AOFA 3C5JA 2AS5M 4YGVA 4FRWA 1B4TA 1ZLWH 3GZKA 3QXVA 3EGSB 1D2PA 4NZ8A 3QFJE 4ZMQA 4P2QA 4JFVA 4Y9EA 3PWPD 1AHKA 2Y72A 2HH0H 3G3LA 5J9PB 5E5UB 2XRAL 4UUJB 1G7IB 4MMZA 2WXKA 3WHXA 1X7QA 1IGIL 4X4YA 4QTHB 4UNTA 5TDOA 1FIGH 1H0DA 3BXNA 4WO4D 2R0WL 1SDYA 2WXFA 1T04A 1KB9J 4HG4K 4R97B 5IMKA 4ZQTA 1DDHA 1RZKC 4HH9B 4P2YA 4QRTA 1WCBA 2DQIH 4WI8A 4M1GL 3JTSB 1U92A 4X6DF 5JW3H 3APFA 5HSFA 1U3HA 4N5EC 4ABVA 2D03L 3RGVB 5I8OL 4FHBD 2YD0A 4M5TA 2ARJQ 4JFZH 5IESH 3IFNH 4W9EC 4LFHG 4OF0A 4C4UA 4CC1A 1RZFL 3RZCA 1N12A 4N2OA 1S46A 1T3FA 5BQ7B 1HOCB 1UZ6E 5DUJA 4PU2A 1QACA 5LGYA 2ZUQC 2E7DA 1OCWH 4LVNC 1BJ1J 1NBVL 4UQ3B 2HVJA 4N2AA 1RH8A 2NYYC 1CXLA 2OJEB 4EEEA 2VSCA 4ZSOE 5C3IA 3HB3B 2QT6A 5E51A 1UQSB 1UWEH 5HGHB 4PJ5D 3VFGH 2ZZUT 5SV3A 4LQ1A 4XCEA 5KYYB 4OZIE 1QHOA 4KHTH 1KTDB 4YBLB 4HJTA 1GHFL 5TD4A 2QFRA 3D9AL 3SDXE 1JIBA 4BWUA 4GUOA 2H2SC 4NUMA 3GBLA 2Q6WA 5IMMB 3ULUE 2JI2A 1YNLH 2YMXL 2WQ8A 2WIIA 2XACC 5FKPB 3FTUA 1J0YA 4JE0A 3VD4A 4K73A 4ZX4A 4H5SB 4HDIA 4IOSA 5KANG 3K8MA 4JLRB 4LPTA 5CEZE 1M6UA 3LB6D 1DE4B 1AMXA 5DJ0A 2OSWA 3FH8A 1LE5B 4BFRA 4AYID 5ACMA 4GS7B 4UV7H 1GYVA 3DUSA 3S36H 4BHUA 1PZ3A 2ID5A 5J4MA 4TULH 4LKXA 4FQXD 4RWHA 4U1IB 2ZWKA 1REIA 3MRJA 3DDGA 43C9B 1YNTB 5KSAC 2JNZA 3HUJE 5BV7L 4D0DB 3GS0A 2G5RA 3L08A 4P23C 5A2KH 3MZTA 1FG9C 3OB8A 4JNXA 3JTTA 3SY0B 5CAYB 3AFLA 5CZVH 3ALWA 1LO2H 2LFGA 3N44F 3SYPA 3L1GA 3Q3GA 1MJJB 3PNRB 1KXHA 1S7SA 3NEEA 1U4FA 3F6IA 2NCMA 3QI9D 4M5SA 4MA1C 4OU3A 3P2DA 4OZFA 4K8RL 1NDGA 4ZNCD 4GRWB 1XEDA 3CXDH 3TIDA 5JMOC 4X0NA 1CI5A 3CLEH 3C6SB 4H0GA 4HKXA 5DR5L 3QORA 1J1XL 1DQVA 2DS4A 4LU5L 2BNRD 2BNQE 4L37A 4N2BA 4OTXL 3LNHA 1X5IA 2Z7WA 4AVJA 4N8VG 4AL8C 1H8NA 2VZVA 2YD1A 1UWYA 1IC5H 1QZNA 2ZCZA 4WFHD 1AGFB 3E6HB 4KK5C 5CJQL 5DD6B 4LOUC 3HRZA 1L7TL 4AVKA 8PAZA 4GAGH 1CGTA 1JHKH 3DJ9A 1TVHA 5AKTA 5IGXH 4C56A 4R4FL 3FONB 3C5ZB 1MNNA 2Z3FA 5JHDB 2XVBA 1EEYB 1XGRB 4ZFZB 1UD8A 3MUGA 2WVVA 3DMMB 2E7BA 3QXAB 1HHKA 1PY0A 3MCKA 1OB1A 4WQOA 4M5ZL 3KWXA 4Z7WA 4W1TA 4BH7B 2RCSL 4TQPA 2HKHL 5IJBC 2A6IA 1NGPL 1EDYA 3NAAL 5E1HB 3GBML 4XO4A 1LP9F 3SYAA 1KJ3L 1XR9A 1OOWA 2GJPA 3RDTC 3ZKNC 2LU7A 1H3UA 1TJGH 1NMCB 1PDKB 1WICA 3PHAA 2B0SL 3QH3B 4JFDB 3CX5J 4M56A 5EUKA 3O2VL 2VIRA 1TYRA 1WVZA 3ENEA 2DTMH 2G3MA 5D72L 1BVZA 3ZDWA 1HILB 1KYUA 4UT6H 2CM6A 4DP8X 2BVPA 1UZ8A 1UCBH 3TT3H 3SDCB 5IREA 3MGTA 2AC0A 3B7RL 5GS1C 2WZPD 2R59A 1PGRB 1MSPA 2X2IA 3PV6B 3Q6FB 1FSKB 4L3AA 4NGHH 2VXTL 4R7DB 5GPRA 4M43H 5IJCC 3NJXA 3KXFA 3JVFC 5TE4H 1AY1H 2BIQA 2XY2A 1MDTA 2CO4A 4RZCB 5AW8B 3T2NH 4OGXH 3BVNB 4B9YA 2AXHA 1M4KA 5CFAA 2F9BT 1P7HL 2A9NH 4KQ4H 3GMNA 4RGNE 4Y2OB 1QVOB 2A6JA 2B1OA 1OAQH 3RUGB 2OX5B 5FDWA 1G84A 1QR1B 5MHSE 2WVTA 1J8KA 5FM8A 4O02A 4AYDC 6CGTA 1QSFD 2NYKA 4Z78A 1CS6A 2ZOLA 4Q9QH 1EZLA 1OF2A 5DRWA 3PHQB 2HAZA 5KVDL 4JFFE 3IS0X 2BVQB 4KKZA 3WDIA 5C6TH 4BZYA 4MQ7A 4HBCH 1A7NL 3ARYA 5DZJA 5D7EA 1R3LA 1JGDB 5FDYA 1D9KD 3P4OA 4CADB 2ZG2A 3OMIB 5I1HL 4RVBA 1GGTA 1ZIBA 1DN0B 4TLSA 2HUEA 1E43A 2NY4C 4FOMA 4JG1L 4UT6A 1ZLVK 1J0ZA 3HE6A 4L3CB 5AOLA 5FX3A 2NNFA 5CBEA 1UVQB 3I6LD 3GSWA 4K9EH 4NJAL 4OZGE 5F9JB 1IMHC 3D51A 1UA6L 5F88A 4YHYB 1EZSA 1J9RA 1E2WA 3KCPB 3QQ3A 3AY4C 4KH9A 4OLZL 1BF8A 4OCSH 1SN5A 3QJHA 3OPUA 2RA1A 4WUUB 1G9MC 2YXMA 2VW4A 3BJ91 3GC3A 1QBAA 3DXAD 4GMSL 3OHXA 2A0LD 2M83A 4XO5A 4JRLA 4OD1H 1DBMH 3UGEA 3KPRB 4JFQB 1QNZL 2VQ1B 3EBGA 4QNPE 1JYVA 3DTXA 2JV6A 2FX8H 3N04A 4JHWH 2HTLD 4JDTH 4CDHA 2Y23A 5I15H 4MD4B 1UA7A 2FB4H 4BK5A 5AOJA 3IXAB 1T21B 2ZX8A 2H5UA 2FEEL 3VXRD 1FNGB 2ZOOA 4MSWB 5LG1A 4IKIA 4AIEA 4F7MA 4J4PD 1MREH 2KZKA 4YHIA 2GJRA 3RGBA 3DK2A 4WI2A 5DJCA 4GRLB 2C7UB 1EJOH 1T80A 4WI0B 5I0VA 1GJIA 2WGXA 4L23A 1F90L 3MRHA 1WUNT 3VFMA 4HJ1A 3UBGA 1PCXA 2EYTA 4I4WB 4J3WA 3VNZA 4AIOA 3CC5B 4O9HL 5FCUH 1ROWA 1XH1A 2X4OA 1XGPA 4KTEL 4ZS6C 3R8QA 1RQ5A 3RTLA 5KYXB 4OD2A 5ALBL 1OWWA 4Y2DC 5DRXA 3PWJB 5EBLA 3LIZH 5HYJE 4RDBA 2IALB 1HKLL 3S6CA 2VDMH 4H1LA 4Z7IA 1TEGA 1FVCB 2DB8A 5DMGD 4WU7A 3U36B 3JV6A 4L1DA 5F6HJ 2A9AA 3HEIB 3P30L 1RVFL 4M6OL 4YXHL 3TVMC 4BWTA 1EUTA 4Y4KB 4OM1H 4X0KA 1IBHA 4LOFA 3O6LL 3HLKA 3VGEA 2FO4B 1MCFA 3IXTB 3PWVA 4CSTA 2ZQKA 3WDHA 5ENWA 1JD9A 5LGJB 3QXUA 4FL4B 5KS9B 1XF5A 5KYWA 4FULA 3Q1SL 5KVEE 2CKBH 3AY2A 3LS4L 4ZMNA 3INUH 1CLVA 1MQ8A 2OM5A 3S35X 4LRNL 5EU5B 3DX4A 4KITB 2YMOA 3TJHD 4ETQA 4OZHB 2QSCL 2B9BA 4OZ4A 5ANHA 5EC2A 4LEXL 2XWTB 1N0LB 3BPNC 4R2GD 1P2CA 1BDYA 1EERB 2ICEC 3ABMB 1F11A 4NI3A 3AU1B 4X9HA 3TEYA 1UASA 1VESA 2B5IC 3FQ4A 4YMPA 2QR0B 3KW7A 5MERA 3NN8B 5L4JA 5KVMC 5T3ZD 2I7SA 3SOTA 4KFMA 3BUYA 1TETH 3NUKA 3DVGA 1UACH 2VL4A 4NQVA 1AGCA 2CRMA 2O5NA 1A7OL 3UAEA 5EUOE 3VDBA 4UDTA 3WU1A 1N2RA 4JM2F 2AAAA 3K6DA 4J2XA 3BKJL 2QHRL 3GT6A 1MHEA 2Z1PA 2OMUA 2P7TA 3FB6B 4OFDA 2X05A 4PR5A 1Q9LA 1FRGL 3P4LA 2YN3A 4A6YL 4CUCA 3GNML 1QKZH 3E8UH 1WWWX 2CHXA 2XN9D 1YQVH 3WEXA 2BOBB 2BMKA 1G5AA 5HVWA 2EXWC 3RB5A 1E3XA 4RCAA 4WSGA 4G8FB 1VEOA 3VO0A 2CUIA 1KY6A 2JLLA 2LOEA 1VGKB 4NZJA 4OJDH 2CJTA 4GOSA 3QE5A 2ZTBA 1OGAD 1A6UH 2YZ1A 3HPLA 4OCWH 4KNTA 5ERWB 2WSPA 3S4SG 1GY2A 5G4OA 2HX9A 1JTPA 2JJWA 4LPVA 3V5DB 4JFEE 2F7OA 2JK5B 4K9EC 4NNPL 5ES4B 4JM4H 5HHNA 2A74C 1QP1A 2XCMC 4TRPL 1BG1A 1NGZB 3PL6A 4LLVB 4S11A 2OZ4H 4W9FC 3X12A 4PGEB 4IHOA 2H1XA 5A16A 2DQEL 3QXTA 1PIFA 3VXMA 1BD2A 3RLSA 1F56A 1X5JA 2QELA 3TOPA 2PP7A 4PGZA 2JIXD 3I50L 3CN4A 5F3BB 2O93L 1IGFH 2VM9A 3UJTH 2XTJD 4R26H 3CDZB 1QTSA 3V55A 1OK8A 1SJEA 3EJJX 1KCRL 5D2LF 1GMIA 4A2FA 1FGVH 4AV4A 5FFLA 2XQBL 3AREB 1USQA 2W07A 3PABB 2WB7A 1TVBA 3IAPA 4DK3A 2CLZB 1NGWB 2NZ9C 2WLLB 4U1KA 4G1EA 4QOKE 5D7JA 4D9LL 3QEQA 2OQJA 2NXYD 4BKLA 4G7YL 5EU4B 4UU9A 1EAOA 4OJFL 5KSVB 1JTOA 2XFGB 1SYSA 4LSVL 1CFNB 1U6AL 2CGYA 2IO5A 3B5GA 1PZ5B 1MZYA 4L4VD 1DVFC 2PW1A 2JH2A 2Y7NA 4P46B 4UOJA 3BPLB 5ABDE 1SOSA 1I9RL 4WK4B 2KBGA 5DS2A 1B3JA 3GMQB 1KCUL 4GP5B 1Z9PA 1PYWB 4MX7A 1G4RA 2EICA 1M2VA 4O58H 5C0DA 2J8OA 4QXGL 3QZNA 1KJVB 4KK8D 4UMSA 1KXTA 5B3NA 5IEKB 1JNLL 2FLMA 3MNZB 1LK2B 1AD0B 4PJXB 1NIDA 1I8UA 5DYOB 1IGJA 2DIJA 3F7RA 3BP4A 4A66A 3MO1B 1QLFA 2BFVL 2J1XA 4NO0A 4LHUD 4APQA 1BFOB 3G5ZA 5BCAA 4G8GE 4RGMB 5I1LA 1HHHA 1CQYA 4WFFD 4UZSA 5EFIA 4TNVF 2DYPA 4Z7QB 4TLKA 2ADJA 5ACZA 5ISZA 1LE9A 5EULV 2HWZH 2BIMA 1S9WB 4XN7A 1JN6B 1LO3L 2FIRT 5DMJB 3W11D 4L3EB 4NENA 2RH0A 2WP3T 2UXVA 4BZ1A 4DKDC 3FQNA 2ZSVA 4K0OA 3FK3A 5EC1B 1KCVH 4A68A 5T3XE 2B8OT 3OKOA 2ARJB 4V2CB 5KJRL 4K7FB 4LARL 3G6AA 5EF2A 1CDIA 3U6RB 4M7LH 4XCFL 2NQ3A 2C9AA 4U31A 1XCTA 4M4PA 2XRAH 2YJLA 4F8TA 2PCXA 3NIDE 1IGIH 1SQ2N 4HS6A 3SDAD 3TNNB 1JZ8A 2R0WH 3PGCA 1JZ7A 5HI3C 3S3SA 1JHLL 4MLSA 4PG2A 3TH3T 1NTDA 3B7SA 1EV2E 3HG5A 3UEQA 2YFNA 4AY0A 4IBSA 4M1GH 5L6YL 1FNSL 5C0AB 3FFCE 2WO4A 3NJLA 3UADA 2RR3A 1I85C 4FLRA 1TFHA 4L0YA 1AZBA 2D03H 3CN3A 3HBQA 5I8OH 3AT8A 3S2AA 4X7DC 5IJDC 1GAFL 4EMZA 2IPKA 4MRBA 4AEEA 3D69B 5SWSB 3DETC 4G6FD 4F2ME 5AZEL 5FM5M 3DHMA 4U1LB 1I8IA 3FHEA 1SXNA 3ECUA 3TH4T 2AQ3A 1HDMB 4NXKA 3BQVA 4OFQA 4N0UE 1F3DJ 3W39A 5CCGE 2GSMB 3EXJA 3AS1A 1YVLA 4P04A 4MAYA 1NC4A 4XVSL 3A21A 3FCUB 5MEQB 3HZYB 1A6ZA 5F6HI 1KY7A 4DCQA 1OGTB 1I8LC 4R7NA 2AAVA 4AXWB 3FPYA 4J3BA 4W70A 4LAJH 1JV2A 3QIWA 3TN0D 4DVBA 4P5KB 2YXWA 1VCAA 3VXSA 2MNJB 2VMCA 1T83A 1GHFH 3IB4A 3NQKA 3A23A 3D9AH 3JWDL 3VXUB 1NEUA 1UT9A 4P9HL 2DWDB 4PJEB 1MXGA 2YMXH 4O2FB 3KEHA 4KO5A 2G3ZA 2J6EA 2WBWB 4U6HA 1JP5A 1UXSA 1IE5A 1F2XK 3IT8D 3MRIB 5CZRA 3HKFA 1KTRL 1S7WA 3W5NA 4G80B 5KG9A 1AE6L 2BP8B 2BDNL 4KKNA 3W56A 1JCVA 4Y1AE 3ESOA 4C59B 1AXSA 2BJML 1LQBC 2X1QA 2Z31D 4FQHA 4MLIA 4NZDA 5SWZA 4LDOB 5TJWK 3V0WL 4F7CB 5E08L 2J71A 4KX8A 5D1XA 5I5RA 4ODTL 5C07E 1RFDL 3NCXA 4KZ0A 3T6QC 1UH3A 2HJLA 2ATKA 3SYQA 3JV4B 5BV7H 4HJSA 4PV9A 2FWOB 3RKPA 2Z8RA 4PV8B 4MD0A 2BHZA 2EDDA 5CR8A 3VXNB 1INDH 1FORL 1ES0B 3RWIA 1RUKH 4S10A 3G5YA 4PIRF 1OTSD 2GITA 4X5LA 1OTTC 3W9EB 3K3QA 4Z18A 5FWQA 4ANXA 1DJSA 4L8BA 4BFEA 4TSBL 2HMIC 3U0PA 3FO9A 4HIPA 4K8RH 4F91B 4X6CA 3APCA 4M61B 2HCZX 2OW6A 3RY5A 5DR5H 3MOBL 3V10A 5EZIL 3NIFF 1J1XH 2ZICA 3BZDA 4LU5H 1D3CA 5IQNA 4OTXH 4YC2C 5IFJA 1Q0YL 3QS3A 4KI5D 4DPCX 4BH8B 3UYRH 4ANWA 5CJQH 1DBKL 4LCCB 5DJDA 3EBAA 4ES8A 2GJ6B 3L5XL 4TSCL 3NRPA 1T1YA 4JFXB 4A38A 1S7UA 4AGMA 3QA3A 1IBFA 5IW6A 3C09B 1J8SA 3T4AC 1RERA 1RK0B 2YGNA 3QDJB 3MOQA 3ZDZF 1ADQL 5GGVL 3REVB 2NNAB 4RMVA 2ZKHH 3UMTA 4OLYH 1AMYA 3DKHA 2PWHA 2EAEA 5F6IC 1VJSA 3NCEB 3TL5A 2YFOA 3ZMNA 1H5BC 3DV6A 3BUPA 4NAQA 2YHGA 4POUB 5FOBA 4NO2B 4WKZA 5DHEA 4M5ZH 3CC1A 2IANB 2IVFC 3TTYA 3ULSB 3DIFB 3M46A 1H3XA 2HKHH 3QRLA 4JHUA 1NGPH 3NAAH 3GBMH 4X99A 4KHXL 4PPTA 1KJ3H 5EZOH 4NQCB 3SGKA 4PJ9D 5B8CB 2QHLA 3Q5TA 5D4QA 2B0SH 4NQEA 3WMQA 4U6VH 3O2VH 3DOSB 1HSAA 2FSEA 2YPKB 3GIVB 3IDIA 4D0CA 5D72H 3NFPA 3T3MF 4MB5A 4E9TA 1RZIA 1KBKA 4GRMB 2OS7A 2EZ0C 2AFNA 2XQYA 4J6RL 1XVSA 1Y6NR 1QSEA 4MDJA 4H25B 4KJPD 4A2HA 2NX5D 2Q5BA 4L1TA 5FK9B 4LIQE 4MNGA 2GK0B 4G70B 4GB9A 5TH2B 4U3SB 3SJVE 4ODUA 3H9YA 2MPVA 4GG6B 4AH2A 3BD4A 1AO7E 2ZX7A 3BQUC 3G08A 2VDRB 5I6PA 3GUTB 1I7TB 5JW4N 4HWBA 3JT2A 5ICZA 3VM5A 5B4MC 4KXDA 4D94A 4QRSB 12E8H 1E3FA 4R4BB 3FUIA 4PGDB 5F9OL 2DJ4A 2XQ0A 1AOHA 2YN5A 2AGJH 4FNRA 3FU0A 1YMHA 1BHGA 2UVFA 3PGDA 5B39B 4ZO9A 1P5UB 1V7NL 4PRIA 3SEPA 5CIPA 4EDWL 4S0SD 1TPXB 1F1GA 4JQXC 5AVZB 1O5PA 5JOPE 1A7NH 2E56A 1AANA 3CFDA 4HJGA 5AB0A 1AGBA 2XC8A 5I1HH 4ELKA 1SY6A 5AW0B 1A9VA 1JL8A 1PG7W 2I69A 4JG1H 1KGJA 3DJRA 5A40E 4NJAH 4OZIA 5GXBB 4FNTA 4Z7WF 4LLAA 4HKZB 2BZCA 1UA6H 3C5XA 4NO5B 3U6XA 1XH3A 4N0RA 2E0PA 4WW2A 4MMZB 3STZA 3B2UC 1L0QA 1FG2A 1BCIA 5TDOB 3BXNB 1X5YA 2Y7LA 2NY6B 5BV7C 5I1AB 5KBKA 1YUHA 3QHZL 1N19A 1KGCD 4HJJL 1DDHB 4OCXL 1BZDA 1CE1L 1WCBB 4GMSH 4KWUA 3AM8C 2UZXB 5T1MB 4M8UA 1NBCA 2F6AA 1U92B 4O2CA 4AZUA 3K80A 5I24A 5IMOB 1E9QB 1QNZH 5MEND 2WZAA 3MV01 3UDWA 4K8RC 4CVXA 4E68A 2YAFA 2P8LA 1CLZL 2CCVA 3DHUA 3NIFB 4BCYA 4MAUL 4KTDL 3HUJA 2FDBP 5DVKA 5D5ME 4GBXD 4ZJ9A 3WEAA 1NL0L 4I0PC 3JTBA 2HVJB 5K69A 3B7UX 4XP4L 1F90H 3W0WA 3X13A 1TJIL 1ND0A 3US1A 1M9WA 3ZKSD 1W0VA 5IG7B 3V7AG 4X2UA 4GSUA 4EN3D 4F7EB 5IVXB 3GMOB 4ICWA 4Q2ZB 4O9HH 3T08A 1CURA 5CSZA 3POHA 2BSEA 4YDMA 2UY7B 4MZIA 4KTEH 4UNVA 2HT3D 3FYEB 3DTDA 2XBDA 4PJ8A 5B7MA 1Q94B 4NN5B 3NSJA 4R4NC 3VWJA 4P5TD 3MAWA 2D3LA 2Q6WB 1ETZA 2JKSA 3BVVA 5AWNL 1HKLH 4UIMB 4AE1A 4FNLL 1GPOH 1RVFH 4M6OH 4YXHH 3GZPA 4V2BA 3WN5A 1DJYA 1SOQA 3KWWB 5J12B 3O6LH 5B1JC 4IGBB 4FFVD 1O9WA 5H37H 1AHWA 3EHBD 3L9YA 3QJZA 4JPIA 4A1RA 4NC1E 2XV3A 3UC0L 5EDSA 3ZE0E 1WAAF 4HOZA 4H40A 4RSYA 3Q1SH 4LKXB 1BQ5A 4O2EA 5E5LA 2BZ7A 5T3ZL 3NVQA 5DC0A 1RK1B 3MRJB 1PEZA 3D25B 3MRPA 3ULAB 4DGUA 4OFVA 4LRNH 3FUDA 2W1NA 1FNAA 1AR1C 3L81A 4IIQA 4OCYL 4WIQA 2AK1L 3T2PA 3LPOA 4APXA 2QSCH 2WHVA 4LEXH 3U4KA 1ECZA 5IK3A 2ZIDA 2GJJA 2HFEB 4Q52A 5GS2D 4WHTA 1FC1A 3HI5L 3HAEH 3QWOB 3VGDA 4XNUL 1JWSB 1ZLVH 3FT3B 3QZWG 4JPVL 3FT0A 2VUYA 2Y06L 1IKFL 1BA9A 1N3NA 2CO3A 1VLXA 3CCHB 2ZX6A 1EEUA 4D9RE 3MLYL 5AAMA 2P47B 3WO4B 3ZXAC 2V3FA 3RY4A 1A7OH 5A2FA 2DIEA 3DVIA 2FGZA 3IYLW 4Q9RL 2NDFA 4G9FB 4IRSD 3D4GA 1RZQA 3BKJH 2QHRH 3G5XB 5AW5B 3T6WA 3TBTA 5JDSB 4ZAKC 3C5SA 4KROC 3O3EA 2WTPA 3HRZB 1I1YA 4TNWK 1FRGH 4A6YH 4MYWB 3GNMH 4B5ZA 4Z7NF 3ILDA 2CKNA 2D7QA 1KIRB 2YUWA 5EOCL 4PB9L 2EYRA 4ISVA 2RFXA 3WIHL 2XOTA 2YQ2A 1GTNA 1DO6A 1MCWW 2MCPL 4E41D 4A7VA 3MUGB 2WVVB 3L3HA 1HHKB 3MCKB 3KYAA 5EU7C 2GHWB 2VH5L 3RTQA 4DPBX 4N8PA 4YHNA 4NNPH 2J8HA 1WD9A 1RZJL 2W95A 2JCCB 4FXLA 2J5WA 1MG3C 2YRLA 4CBZA 4TRPH 4WWKD 5J89A 3BPCB 1P4BL 1F4WL 4Y16A 2HYMA 2DQEH 2VIRB 1BVOA 4P2OA 4YSEA 1JWMA 4LOEA 4Y7OC 2BVPB 2ZWLT 3I50H 1LM8V 1OGSA 3GI8H 3VYPA 3ZRFC 1N5YL 5I6XC 2AXWA 4FTDA 1X4XA 3L48A 3KYNA 3O45B 2IQ9L 4OZGA 4W9LC 4ZX3A 5B3JF 1CYXA 4UQ2A 1J0HA 5EZLA 4H88L 3KXFB 1A9BA 1MELA 2XQBH 3SO3C 1UGNA 3MRNA 5AL0A 1T7YA 1WC7A 3QRGL 1KF9B 3RFRA 3RVWC 3II3A 4EDXB 2ZCHL 3PLYA 5FGBA 1PNCA 4ZO6A 4P59L 2A38A 4D9LH 5CJ5A 1SMAA 2LTQC 4HGKC 3BVWA 5IW6B 1DUZA 4G7YH 1EBPA 2CLVB 1ONQA 1KBGL 4Q58C 3MRCA 3PJSA 4OJFH 3RNQA 4Z78B 3K72B 5J56B 3IGLA 1TSHA 5ID1B 5IBLC 2YEZB 5CKAA 1WEJH 1WIPA 5DRWB 3IEAA 1XDTT 2WSKA 3BEWA 1OIOA 2LT9A 3DA0A 4LSVH 5AAMC 1EAJA 1COBA 4L05A 2P42B 1W72A 2E6JA 5DD3L 1KDJA 4PRNA 3D30A 3BISA 4ELMA 2HUHA 4AZ8B 4MQ7B 2UV3A 1RSYA 3L3OB 1ZJAA 1I9RH 3P4OB 1JFQL 4P4KC 4Z7OE 5D1ZD 3WSQH 1KCUH 2F53D 4FN0A 1AIZA 5DO8A 4XPFL 4QXGH 3GTVA 4NLAA 1WG3A 5CBEB 1JNLH 4IRJD 2ORBL 3VMPA 5AB9A 1XZ0B 4TUOA 1UOLA 5F88B 1E5BA 2XG4B 2IF7A 5BVPL 1LDPH 1ZEAL 4OFKA 4LCUA 1HXMB 1R47A 2BFVH 2OLDA 3OKDA 1MFAH 3L95B 2VDPH 5HYJA 3GMMB 4KJQD 2ODHA 4N2MA 3CHRA 3ZKMC 5E8PB 1NOAA 3NH7L 2YAHA 4KKBD 4XO9A 2RACA 1EO5A 3LZOA 3FSOA 2ED7A 5AYTA 5IKCA 1J8HA 2VXUL 3RWJA 4HGWA 5I73C 1UKTA 3G9AB 5HJGA 1TZGL 3VGAB 4AE0A 3RVXC 1LO3H 3AQDA 5FW6A 1BZQK 4LFHD 4WSJA 4FCAA 4G43B 5DFWH 1MFVA 4S0TD 5DK0A 3LZFH 2GTWA 5DRNA 3QUXD 4H4NA 4YGAB 2X89A 5KWYC 5HHOA 3BKYL 5BS0B 4JANA 4Y4HA 3VUAA 4IU3B 2HT4D 3OWEA 4F9PC 3Q2VA 4P99A 3AAZA 2KZBA 5DJCB 4LARH 2NY1C 1QFUL 5I82A 5IQOA 3MGOB 5I1GL 4RWYL 1A7QL 1IL1A 5A3ID 2C3XA 3ARBB 3VFMB 4XCFH 3GJFK 5E6SB 1MHCA 1ZVSB 5KOMC 4PAZA 2DIAA 2F7QA 5KN5B 1U8IB 2X4OB 3NSYA 4CSSA 1FZKA 3CFUA 3QUYB 2BSSB 4M29A 4PBXA 5EBLB 1ZLEA 2GCYB 1MCDA 5KVGH 3E2HB 1QABA 1A02N 1FNSH 3ARUA 3D39B 2OCCB 3ZE1E 4WU7B 1KNOB 3ZMEA 3JV6B 3S3PA 3LNEA 5IR1A 3G04A 1EHLL 2HTKC 5EU6D 1YEKL 4PJCE 4X0KB 3WHE1 5AYUL 4RAVA 3F00A 1B0GB 3ARDA 5FA4B 1GAFH 5JZ7C 4UILL 1MDAA 3CDFA 3ZBMA 3PWVB 3H3KA 4Z7UE 2Z4QA 5AZEH 4YDKL 4UINL 3P2TA 4HPYL 5D4HA 4X5WA 3O6FB 4DKFL 1T89C 2QL1A 3FT2A 4HMDA 4NN6B 4NZTL 2WBJD 1MVUA 2Q2EB 1F58L 3LNIA 4Z1PA 4XVSH 5E5MA 5EH1A 1IBGL 2V2XA 1NIAA 4CNIB 4OJEH 1FNHA 2UY6B 3I9PA 1XMEB 4DW2L 4P9ML 1AQDA 1RCYA 1FFPA 4G8IB 3R18A 4TQEL 3PAYA 4AYFB 3I3EA 3QIUD 1WHOA 2J1YA 4Z3HA 1MOEA 2OI9C 3SYCA 3MX0A 3QDGB 3GLDA 2QVTA 2OCFD 3KLAB 3EJPA 4FQJL 4Z0XB 4ONGL 3CMGA 4P9HH 2Q7YB 4OLVH 3O3UN 4XHJD 2IAAC 1N26A 3ELAT 1HQRA 3T0ED 4CMHC 2D0GA 4XPGL 1FJ1A 1HHJB 1JK9A 3CX2A 1CI3M 4UDTB 4WK2B 3U9WA 1AE6H 2BDNH 3HG1B 2BJMH 1MHEB 1NGXA 3CBKB 4JG5A 2P7TB 2DBLL 2V9RA 4PR5B 4LLMB 5HDQH 4M02A 1RFDH 3CSFA 4HPHA 5CFHA 3M88A 1K4CA 3UYPA 4YXKH 4MA7L 4N0FA 4NBYB 1PG7H 4FQIH 3V4VL 1RSFA 1BAFL 3E3QC 4LRIA 1XT5A 4H0LC 3WS6C 5AZ2L 2VSKB 4KU1A 3D18B 3L4CA 4J3OH 5EO0A 4QCIA 1FORH 4Q97A 2F0CA 1QUPA 2OMTB 1T1ZA 4LCWE 4E9SA 4R7LA 1HE7A 1QEWA 1CT8A 4KY1H 4EUPB 2OL3A 3HPLB 3KPOA 5AVRB 4TOYH 4TSBH 1VPOH 2A99A 1JOIA 1BFTA 4N25A 3D2UD 2PXYA 5HYQB 4PP2A 3MBEB 5HHNB 3FMGL 2W65B 4KXCA 3MOBH 5EZIH 1N59A 5FYJD 3B9KB 2EEXA 1I4FB 3BUIA 1MJUL 1B0RA 4OLEA 4WVRA 5DMKA 2OSXA 3X12B 5TF1L 4YHKL 1E27A 4PJHE 3H4HA 3IVKA 1XSOA 1DBKH 1BD2B 3MKKA 1MWAH 1YQ2A 3AT9A 5F3HA 3L5XH 1RV6X 1D7CA 4DZ8B 1R75A 2VE6A 3CJJA 3P9LA 4WO4C 3MV7B 1ADQH 5JOFB 3W9DA 5GGVH 3NFNB 3KHQA 1EX0A 3CTTA 5D7IE 2G60L 2HA1A 1CB4A 4G1EB 4YIQB 2WZ5A 1MFMA 1NC2D 4H26A 3V6OC 5L2KD 2OQJB 1DJZA 1N8ZA 3OLDA 2G5BB 2QADD 2PABA 4NX0A 5A2AA 2ZG3A 1MEXL 4EN2A 3GDBA 4KHXH 1CXKA 2WXRA 4WV1C 4OF8A 3UMNA 2R1YA 2Q76A 3MCLL 1IAIL 4C8XA 1GZHC 3QDME 1NCJA 4M48L 5BPPA 3EH2A 4KRPD 2RD0A 2H41A 4BDVA 5F7KC 3LOWA 3D5OF 1Q1JL 4XVJL 4X9IA 3VFWA 4J6RH 2NOYA 25C8L 1U3JA 1H6EA 4OY9A 3O8XA 3PAZA 4OF7A 1AI1H 2A5UA 1OK0A 5HHXL 4MX7B 3FS9A 1M2VB 4M6ML 2AMGA 4IYKA 2P46B 4CRPA 3NJGA 1LEKB 4M8RA 4X6CF 4F5CA 5T1DH 3TA3A 2X4RB 5ANMB 1KJ2L 1XB3A 3BP4B 4YDVA 1F00I 1X5XA 4APQB 1E67A 3CFEA 3G5ZB 5I1LB 2ZX5A 3EFDH 3BLKA 3FFCA 3U0TA 1F4HA 3LB6C 2YQGA 5F9OH 3N40F 3LXCA 2R0LL 3WNOA 2BSDA 5ACZB 2WP3O 5IBUG 1LE9B 3VWKD 5IF0B 4JR9H 3FUMA 4P48A 1J05A 4ODWB 2EH7L 4HMEA 1BSIA 4FQXC 2GUOA 4WEBL 1VA9A 2F54D 2Z93A 5F7LB 3JWDC 1V7NH 1TITA 4NENB 2W60A 3IPBA 4P9HC 4WFGE 3FKUS 1OGPA 2XKNB 3VU2A 2XZQL 3FQNB 3O9WA 3ZT5A 2CK2A 3EO0A 3FSZA 1SM3L 3VVWA 1JD7A 1HQ4A 1A9EA 5I17A 3Q44A 2NPLX 4UQCA 3QI9C 1QSFA 3O0RL 3ET9F 1TXKA 2A4ZA 3PQYB 4PFEA 5T1KA 3S5YA 5I5MA 4NNYA 4LKCA 2VRKA 3OAWA 3WI9A 1JF1B 2I9TA 5F7FA 2F68X 2Z9TA 2WLMA 2ZKWA 5DJZA 3RAJL 5HHMB 4I3SL 5C7XH 2MOGA 3QHZH 4HJJH 2Q86B 3RFZC 4OCXH 4YFDB 2VRQA 1CE1H 4M7ZB 3EGXA 1G6RL 7CGTA 2EDKA 3ILPA 2NY0D 5FLVA 1JSYA 2IH3A 4FFZA 2BCKA 2WXHA 4Y1AA 2VXSL 4WFED 5LVEA 1AC0A 2JB6A 5TGBA 2A3TA 4AT6A 5DFAA 2WKGA 1CLZH 5DQJA 1ID2A 4KTDH 4MAUH 1CU4L 1I8IB 5KVDE 4PJAE 3DDFA 5I1IL 3SQBA 1WFOA 5JPMC 4NUGL 1H6TA 1XTMA 5DLLA 1NL0H 2P5EA 4MJJA 4U6TA 4YSTA 5JPNC 1TJIH 4D8PB 3GYRA 4DCQB 4P3DB 1QATA 1T6VN 3P3SA 2NR6A 3OWRA 2K7PA 3S4SB 3IKCB 3QG6A 4Y5XA 2PUQT 2BNUA 2AQQA 2PPAA 4HIIA 1SVZA 1C5CL 3LJ3A 5C0GA 3BZ4B 3WNPA 4I85A 3O6ML 4WKXA 4AM0Q 2A6KA 4D2NA 5AWNH 4E5XG 4FNLH 3QUZA 3S2CA 5I19L 5A6LA 1VFOA 3E38A 3MVSA 4U6HB 3EBHA 1UXSB 3TWCH 3BZEB 4Y88A 2ZF9A 1KLFA 3KGRA 4JDVA 3SGDH 1S7WB 1WYJA 3TXAA 1VEMA 3UBXA 5I1EL 1AXSB 1JJUA 2OTPA 3UC0H 5SWZB 2GT9A 2YR3A 4OZIF 3ME0B 4FABL 5D1XB 5T3ZH 1Y0LA 3FTVA 1CCZA 5C0FA 3VD7A 2V8MA 4NAJA 3KEDA 2GSGB 1QWHA 2P43B 4OCYH 2PCYA 3ULUF 1CTMA 2AK1H 3LKSB 2AANA 3LKRB 4R96B 3JYCA 2KZWA 1IM9B 1Y07A 3MLRH 5JW4M 2BSRA 3DBXA 2KMWA 1JGUL 3F84A 4HD5A 3G5YB 2OJZL 1FWXA 1XMWA 4X5XA 3QIBB 3F7YB 2XI9A 3HI5H 3TO4B 3QNZA 2YPLE 4L8BB 4XNUH 2DM3A 4BJLA 3F8UB 1KIPA 2H3XC 2H0PA 3FO9B 4JPVH 2GTQA 2Y06H 1IKFH 2Q7NA 2IQAB 2IAMA 3U48A 1BVNT 5DS8A 3MV8E 3MLYH 3V9CA 5GRWA 4U1MA 2APWA 1D9KC 4NRZA 5JW5A 4CU6A 5IFJB 4Q9RH 5FUZL 5E70A 3NZHL 3GRWL 3V4PL 5D1QA 4L3FA 3D0AA 2DQJL 4N0CD 4IMLA 1RIUL 5E4EB 4AUJA 1T1YB 2C9PA 1RUPL 1BYOA 1S7UB 2CXKA 4GG8A 5DTFA 1XCWA 1ZA3B 1TNNA 3WY2A 2YGPA 3E6FA 1WFUA 2Y07L 2FJFA 3CHSA 1YPZA 4PB9H 5DHDA 1AO7A 3KR3H 4QRQA 1F5WA 3C5ZD 4WEMB 3WIHH 3NTCL 5JHDD 3GSNA 5EF3A 2YKLL 4LLWB 3CWGA 3F12B 2MCPH 2A0LC 1OOAA 1MKFA 5TQ0L 4PW3A 4NS0A 2I85A 2VH5H 1ESOA 4OQ1A 2WJ7A 4UT7L 3QEUA 3QJFA 4GAYB 3DYOA 4A7GA 2HTLC 4LGSB 3BVUA 3ZE2B 5DLML 1RZJH 4FTVA 3NK3A 3HMWH 5LHDA 3NJFA 2P24A 3KJ4B 3BSHA 3KE0A 3MLPA 3HPJB 4RRPA 4J4PC 4QHUB 1F4WH 3SPGA 4JFHE 3VMOA 1KN4L 3ZRCC 1RZIB 1ZK5A 3QJXA 4B7IA 1TZIA 3MBXL 1IAOA 1QBMH 2D31A 2OMXA 2W0FA 4HFUL 3N6YA 4MDJB 3SDCD 3SZKC 1JZFA 3BUQA 3QFJB 5ICUA 1N5YH 2XY1A 3DVNB 1ACCA 2IQ9H 1OQOA 2C3VA 3RHWF 1I1AB 4GXFA 1O6SB 4ODUB 3OX8B 3F5WA 5CZKA 3QRGH 1CE6A 3BP7A 4JRWA 3DSFL 4GYBA 3UTTE 3W1ZA 5ITBL 3EYUL 2DQGL 5DMGC 5JOEA 4QO1B 3D85B 4P59H 3MPCA 4LEEA 1CD0A 3JWOL 5E7FA 1XGUA 2OMNA 3FRUA 1AQ8A 1KBGH 2KLTA 3OC5A 4AKPA 3STLB 3IETA 3LEXB 5T5NF 5K33A 3HFFA 2UXFA 2ZOKA 2AV1A 7TAAA 4NKOA 2IGTA 4M1DL 5DD3H 5IJKA 4QF1A 2Q8BH 2VLRA 4P06A 5D5MA 1I3VA 4LPYA 1AIFB 4AQ1B 4HG4J 1NAML 1GYUA 1DUYB 1ZV2A 2D7TL 1G43A 3TJHC 3CFDB 4HJGB 1JFQH 5E56A 4FKEA 4ZSOB 3V0VA 4MYPA 1TEYA 3BFQG 2XV6B 3C8HA 5D7KE 4XPFH 4Q6IB 3NP3A 5A43C 4JO1L 2ORBH 4OZIB 3LKOA 3EYSL 4W4OA 1KYOK 3I02A 1XH3B 3VRLF 3PJLA 1ZEAH 4PH8A 4HUWA 4WW2B 3SDXB 3STZB 4MHHI 1FG2B 4YX2H 3RL1B 5EEYA 2X6CA 3MKGA 4G8AC 2AQ2A 3ESMA 3OAZK 1YUHB 5KVFE 4CSZA 2I60L 3NH7H 3SCMB 1X6NA 1ZLUK 3WTUA 4EI5B 5FGCE 4O2CB 3GHEL 1JHTB 2VXUH 3KPRD 1L9MA 1K72A 5FC9A 1BYPA 1TZGH 1MCIA 2CDFA 2E5EA 3SE3C 1I1RA 4L4TD 3C6LB 3WXWH 4BSVA 1NCDL 1TJXA 2P8LB 3NP4A 4OAWA 5KBMA 4QDGA 4JKPL 5DWUL 5JR1H 3BKYH 2FO8A 1X4ZA 3HUJB 3QWQB 2DI9A 4M3JA 4UB0L 1MG2C 1ZRUA 4ZUSB 1QLEL 3E3QE 1CMOA 5FW8A 1QFUH 2CBMA 2R1XA 4RWYH 4XB8A 1QO3B 3GSRB 3HBZA 3X13B 1TQVA 2RAMA 1FO0A 3OJDB 1S9YA 2DRUA 2GC4C 1TZHA 1W0VB 3FQUA 5HDBF 2A9ML 2J72A 4XNZC 3GMRA 2XLLA 3OL2A 2EDTA 5CCKL 5CSZB 2VLKD 1TTCA 4FQLL 2VSDA 3HE7D 5EWIL 5C0RL 5J06A 3AMLA 3ARZA 3IJSA 4PJ8B 1T20A 4FNPA 2H0EA 3QARA 3AS3A 3CMOL 2AK4E 1ZS8A 2FIKA 2BNQB 1CF8L 1R24B 2DWEA 4ELMF 4MQTB 3EG9A 1ZHKA 2D9QB 2PWEA 3FB5B 4HLJA 5FO9B 1EHLH 5DFTA 3QWRA 4X6FB 4Y4KD 1WRFA 1YEKH 1E9PA 3P11H 4FG6D 5DC9B 3RWHA 3WN5B 1XV8A 1XSIA 1XD0A 2GJZA 2R2BA 2ENQA 2XTJC 3O0LA 1S7RB 3PWPE 2OYPA 3WL9A 5JQ6L 3HZ3A 1AHWB 2I9LA 1BOYA 1RZJC 4UINH 4YDKH 3S9DB 4HPYH 3ZT7A 3ZQXA 4DKFH 4Y4FB 3LZQA 3KDMA 5KJ7E 2J8UA 1L9RA 2ZWSA 4I2XB 4NZTH 4AENA 1IU1A 3MRPB 4QRRD 1T7WA 1F58H 4JO2L 3NDZE 3QK0A 3D4CA 4LOVA 1IBGH 2IADA 3G6DL 4B9CA 3NGBB 5L8KB 4IKJA 4DW2H 2NXYC 8CGTA 3T1WA 4TQEH 5F89B 4JFPB 1OHQA 1IE4A 2YLHA 2WNWA 2Y2YA 4Y19A 1P4LB 4FQJH 1F6LL 4Z95H 4ONGH 2LLLA 3ML8A 1W9XA 3RBGA 2ATPA 3IJYA 1P84K 3CIQA 5AG9A 4ZXBB 4XPGH 3FRPB 3OZLA 4V1DA 5DT1L 4D0BA 3DUUA 2Z34A 3FTZA 1O9VA 5I8EB 1UJ3C 3RZWA 1F4XL 1SYVA 2WXOA 4Z6AT 5ACLA 2N3JA 2WGNB 5C08E 1MCRA 5GRZA 3ARGB 5JA8B 4KK8C 4WENB 4OKVA 2EXTA 2DBLH 3O3EB 2X28A 3RWDB 2R0ZL 5DJ8B 4QRPE 4IRZA 2WUBL 1VFAA 2EKSB 4UF7C 1IB5A 2UZYA 4FI6A 5FYJL 4MA7H 2F19L 2C4FT 4GW4B 2PR9A 1FVDA 3DRQB 1BAFH 4MZ2A 1X5HA 3V4VH 5I71C 1GYAA 5AZ2H 1NM9A 2JTYA 2DKSA 4XCYA 4RGNB 4X8GA 3K81A 3BAYA 4Q89A 4TNFA 3GS7A 6PCYA 5D93B 4FXGB 4Y8DC 5AW1B 1H8LA 3T6ZA 4EI0A 5C0BD 3W11C 4GSDL 4YHNB 3L4XA 3GJFH 4H44C 1K4DA 4TTGA 1XHHA 5GRVK 3HFML 4JFFB 3FMGH 2VDLL 3C60B 3VFUB 2AHIA 4LF3A 2WC7A 5HPMB 1MJUH 4YSQA 4L8SC 5TF1H 4YHKH 2JXMB 5HHQB 4P2OB 4B9KC 2ODIA 2CLRB 1NOLA 4WW1B 3AG3B 1B88A 4ES9A 1KBPA 4WJ5A 1A3LL 4PHXA 5FM4A 1R5IA 5BQDA 3CDGB 3LRHA 3I3DA 3SKOA 2Q10A 4GI9A 2I5YL 2BP5M 2VDNL 2GY5A 4OZGB 4XP9L 4ZBJA 3T65B 1QSZA 3SDAC 4UQ2B 2QQQA 3JXAA 2OPCA 3BP6A 1A9BB 2ZWNA 4MJID 4F8NA 3ARED 3QRFM 2XXFA 3T6XA 2QGDA 1EFXA 2BNRE 2YBRB 5FFGA 2G60H 1VENA 3DX7B 4M9PA 3UTQA 2WXGA 2OR9L 4XO3A 4NUJA 4I0CC 4PY7A 1BZ7B 4QEGA 4WFHE 4PVBA 1DUZB 3VCLA 1E42A 3AG2B 3Q6GL 4EIGB 3QRBA 1OO2A 4GP8B 1MEXH 4HV8A 2VUOA 1JNHA 3ATDA 5EOTA 4DP7X 1CICD 3LMJL 3BEWB 1PY4A 1GH7A 1P5VB 2R7EB 4GO9A 2I07B 4NFBA 1MLCB 3MJ7A 4MKMA 4Y1SA 2RBLA 4P46D 1Q1JH 4XVJH 5CP3H 1UM4L 1U8CA 25C8H 3UAJA 3ZZLA 3PIQA 2B4CL 3TN0C 2PO6A 4ODXB 4PHZA 3L1EA 5JORA 2BY3A 5GJTL 5HHXH 1UD2A 5C0CD 1E40A 2Z4TA 1AP2B 4M6MH 1IGYB 4UT9L 4LPWA 2B9AA 3L17A 4GINA 3BIBX 3M86A 4TUOB 3EGDA 5AZUA 3NIGF 3MRDA 1KJ2H 4LCUB 4MB1A 4KBPA 3ROLA 3BC9A 5HYJB 1FL5A 5K9KB 3T0DA 4ZFOA 1AS6A 3HS0C 2YGQA 4ZFQA 3FB8A 2GI7A 4P05A 1DJHA 2Z7UA 4PJCA 1QG3A 2Z31C 5DHXB 3UZEA 1CLOH 4HGWB 2EH7H 1HK6A 3F7VA 4JDZB 4WEBH 4GUPA 5LNDA 4PLKD 3IJ7A 4JRXE 3ARRA 4I7ZC 4BIKA 5DK0B 2FBOJ 2O6PA 3DX6A 4RAHA 5C0EA 2K8QA 5GRVL 1WAPA 2XZQH 5I74B 3W3BA 5DZ9A 1JBJA 1D5BA 3D2TA 3PGFL 4ZT1A 2PCFA 2J21A 4JANB 1SM3H 4JAMB 3VI3E 4AITA 1RZ7L 1S2EA 3AAZB 3CVHL 1OTSC 1NUNB 4DFHA 1OAYL 2YD5A 3S0PA 4L9LC 1AZCA 1BREA 4JY4A 1X9QA 5DHYA 1HJCA 4UTAL 3O0RH 3FQ2A 3RY6A 4J3OF 5C0JA 1ZA6B 4OJAA 2P1YA 4MS8D 5AENA 1UD5A 2FJGA 2EYSB 1XBDA 2PR4L 2KYIA 5DHVH 2HX7A 4UM9A 3RAJH 3VSUA 4NXSA 1WUZA 4X6EA 2DWSA 4KI5C 3C87A 1IGMH 1M9SA 3VB8A 2AJVL 3GF8A 1LYQA 1ZIAA 5BMFL 1G6RH 5C0AD 5EUOB 1YMMD 4WLCA 4N2LA 3FT4A 3G04B 1RKRA 2X3CA 4AQOA 1WIUA 1NMBL 3EADA 1AD9A 2VXSH 3S96A 2P5WD 2FNBA 3GMPB 5F21B 4AM0B 4XXWC 3QCUL 3I6LE 3Q2LA 2R69A 4ZUTB 2G0KA 5SWSD 2Z4QB 4F8PA 1L3WA 2FJHA 2VITA 3I85A 3EF4A 5CJ8A 3NIDF 4TUJB 5H8DA 1CU4H 3QUKA 3IFOB 5I1IH 1JXDA 4NUGH 1XH2A 4AGOA 2EIZB 1XWVA 1NIEA 4GKSA 1MVUB 5DDHA 1N4XL 5B7EA 1HZLA 5E5MB 3DXAE 2CMRL 3DX8B 4FNQA 4KRNA 4UMGA 3FTSA 3QUML 5IFAL 1OSEA 4YHPA 3LN5A 3W57A 4PGBB 1V3KA 3D4ZA 2XSKA 3T0WA 4GFXA 3R7RA