4WL9A

Time resolved serial femtosecond crystallography captures high resolution intermediates of pyp
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Time-resolved serial crystallography captures high-resolution intermediates of photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4wl9A00
2PYPA 2WKRA 3CAXA 2PD8A 5I5LA 2ZOIA 3LUQA 4KUKA 3IBRA 3RH8B 2VV7A 3C8CA 5DKKA 3T50A 3LI8A 2WKQA 4HJ6A 5EFWA 3H82B 3NJAA 1V9YA 1XFQA 4I3AA 3VE3A 1GSVA 2VV8A 3E4OA 1S1YA 4DJ3A 4EETB 1ODVA 4HH3A 4EXOA 2B02A 4BBVA 4EESA 3ULFA 1JNUA 3UMEA 1OTBA 3EWKA 3UE6A 2V0WA 1T1AA 2A24B 4EQ1A 1OJ5A 3VOLA 1XJ6A 4WF0A 4EEPA 1WA9A 3CLOA 3FG8A 1GSXA 5IU1A 5J3WA 4HJ4A 3LIAA 3UB9A 2ZBBA 4E04A 3BWLA 1D06A 1KOUA 5J4EA 1OT6A 3EEHA 4LPZA 2OWHA 3NOPC 4LLOB 4EEUA 1TS0A 3F1NB 2YKFA 4WLAA 5KIZA 2KDKA 1TS6A 2QKPA 2QJ7A 3D72A 5HDDA 3MJQA 1LSWA 5F68A 4MN6A 4NXBA 5HD5A 1S66L 3HJKA 4GS9A 3A0RA 1OT9A 4L9FA 3LYXA 4XT2B 3PYPA 4B9OA 3FC7A 2VLGA 3ZQ5A 2H28A 3OLOA 4JGPA 1OJGA 2PYRA 2J80A 2L0WA 1P0ZA 1P97A 1MZUA 5G4YA 3MXQA 4HOIA 4JGOA 2I9VA 4M4XA 2W0NA 5HDCA 3LIBA 5HZHA 4JGQA 1XJ4A 4NXGA 1X0OA 2INWA 3MFXA 2KX6A 3H7WB 3UB7A 1NWZA 2ZOHA 4L9GA 3H7WA 2PD7A 2R78A 2Z6CA 5AVEA 2QJ5A 4F3LA 4NXFA 4L9EA 4R3AA 2YKHA 4MN5A 2OWJA 2BASA 5HWTA 3LIDA 3LIFA 5HWWA 4H6JA 5G4ZA 5TBMA 3C2WA 3GECA 4GW9A 2JHEA 4GHIA 1N9OA 5F69A 4KUOA 4R70A 1V9ZA 3NHQA 2L1MA 1D7EA 2PR5A 5A8BA 4RQ9A 1S67L 4R6LA 2PDRA 4WN5A 3K3CA 1XJ2A 1S1ZA 2GJ3A 2VEAA 3LIEA 4BBTA 5DJUA 1TS7A 1DRMA 2D02A 1N9NA 3MQOA 3F1OA 4LRYC 1F9IA 1UWPX 1DP8A 4GS9B 1DP9A 1G28A 1N9LA 1T19A 3A0VA 1T1BA 5AVFA 2PR6A 2Z6DA 4EW7A 3F1PA 3NOUC 3IS2A 4HP9A 1EW0A 4YWZA 3E4PA 1OTIA 3PHYA 4HP4A 3UB6A 4JGRA 2QWSA 2M1CA 2V9AA 2HV1A 5F6AA 2K7SA 3SW1A 4HHDA 3P7NA 4KQDA 3CWFA 3G6OA 3BY8A 1VB6A 4LRZE 2V1AA 2VV6A 4HQAA 2P7JA 5IS1A 4HI4A 1UWNX 4HNBA 2OOLA 3UMDA 3B33A 2QHKA 3HJIA 1XJ3A 4R38A 4EERA 1T18A 4LRXC 4F3LB 1TS8A 2V1BA 4HJ3A 1GSWA 3GDIA 4BBUA 2L4RA 2PHYA 4WL9A 3UB8A 4I3JA 4DJ2A 1BYWA 4K08A 4H6JB 3H82A 5TBMB 4GHIB 3K3DA 1Y28A 1S4SA 4I3IA 1LSXA 1LT0A 2JN7A 3VE4A 3MQQA 3E4QA 5DJTA 5J7EA 3RTYA 5HSQA 4HH2A 1LL8A 1DP6A 4HY8A 1LSVA 3H9WA 3ICYA 4I39A 2W27A 1F98A 1S4RA 2D01A 2A24A 2CMNA 3F1OB 4I5SA 5DKLA 4GCZA 3MR0A 2V0UA 1OTAA 3KX0X 4WUJA 1OTEA 3BY9A 3F1PB 3A0SA 1XFNA 3IS2B 3LICA 3NOTC 1OTDA 5HWVA 1UGUA 5HD3A 1T1CA 5F5YA 3F1NA 3LI9A 5HDSA 4PKYA 4I38A 4HIAA 2EA9A 4PKYG 4NXEA 2WKPA 4XT2A
chains in the Genus database with same CATH superfamily
5DF7A 2WKRA 2Y2OA 2PD8A 2HGVA 2EX2A 4RA7A 4OQGA 3C30A 4BENA 3M6HA 3JPUA 4MBFA 3ZG0A 3C8CA 5DTTA 2Y2KA 4EBPA 1TF1A 4Y7PA 3HVFA 3Q82A 4OOMA 3GR2A 2O99A 3VP3A 4XUZA 2QZ6A 3H82B 1V9YA 3T4TA 3VE3A 2BLSA 4GD8A 2Y2LA 4Z1WA 4DJ3A 5FSRA 4EXOA 1PYYA 1NYMA 1GA9A 3QP5A 1PIOA 3MS6A 1NY0A 4U0XA 5A91A 3ULFA 4WZ5A 2PU4A 3UMEA 4E3LA 3Q7VB 2ZQAA 1E3UD 3OZHA 3G30A 5EE8A 1D1JA 3QP8A 3R7WB 2WUQA 3VOLA 4WF0A 4BQMA 4Y15A 2XFSA 1Y4OA 1H8YA 3QP2A 4HJ4A 4U0TA 3MKEA 4GDBA 5HAIA 2ZBBA 3TE8A 2B18A 2H0TA 4G3VA 2M7VA 2IWCA 5CEDA 4OQ0A 1QMFA 3UO9A 2OWHA 4EEUA 4GNUA 3G4PA 2YKFA 3BFDA 3HLWA 4WLAA 1CI9A 4Z9QA 2QKPA 1XXMA 2QMIA 5KSHA 2QJ7A 3D72A 5L09A 2XH9A 1GHIA 5F68A 1CK3A 3K2NA 2UWXA 4QY5A 1FR6A 2W3GA 1OT9A 4L9FA 3HREA 2BG1A 3G2ZA 3CUEA 2Y79A 4ESPA 4X1LA 1ZKJA 4R23A 1SDEA 1I5QA 1DJBA 2PYRA 2L0WA 1ONHA 1MWRA 3ZG7B 5G4YA 3MXQA 3NDEA 4JGOA 2Q0OA 2W0NA 3A3EA 2HJ9C 3MQ0A 1PNEA 4IVIA 3HLGA 5M19A 3UE1A 3PBOA 4EBNA 2V8CA 2XFTA 3IXGA 3KYQA 3H7WA 2PD7A 1W8QA 3TG9A 2X71A 3ZYTA 1PFLA 4DE3A 4MLLA 4MN5A 3L7HA 2Y2NA 2BASA 5HWTA 4S2NA 1K6SA 5EV0A 1NLYA 2W3DA 4QWOA 2EFXA 3LIFA 1Q2QA 1YMSA 4WM9A 4H6JA 3HLCA 5G4ZA 2XF3A 3PTEA 3MZFA 5HL6A 1N9BA 1BLPA 3TSGA 4R70A 1V9ZA 3NHQA 5IHVA 3HLEA 1ZHHB 2HZ5A 3MKFA 2PR5A 2JBFA 5DF8A 1IYQA 4ETXA 4AFIA 3P09A 2Y55A 4WEKA 1YLZA 1DY6A 1LHYA 1PI4A 4JF4A 1DRMA 1BLSA 2Y91A 3C5AA 2Y59A 5CHUA 3IH8A 3MQOA 1M40A 4MDZA 4LRYC 5DTKA 1G28A 3FZCA 1T19A 1XGJA 4OVDA 4R1GA 1H0MA 1NYYA 4N1HA 4EW7A 4IUHA 3NOUC 4X53A 3IS2A 2O9CA 5FAQA 2IWDA 4HP4A 1M6KA 5HW3A 3RFBA 3T4LA 3BQ8A 1S6RA 4ZJ2A 1VEUA 2Q9MA 1DJCA 3G31A 3BY8A 4LRZE 2V1AA 1CF0A 4HQAA 4Y0TA 1SKFA 2OOLA 3UMDA 1XJ3A 2OLVA 1T18A 4EERA 3S7PA 4S2JA 4KZ9A 4KZ3A 4HJ3A 1ES3A 2B95A 2ZMFA 1GSWA 2L4RA 4PM6A 1S0WA 2EXBA 4P6BA 4GOGA 3BQAA 4PHTA 1BYWA 4H6JB 4QU3A 2GDNA 4NK3A 4DKIA 2XK1A 2J3TD 5HL1A 3K3DA 3KSFA 5DTSA 1S4SA 2WAFA 3T4SA 3S1YA 3DTIA 1FOFA 2JN7A 4X6TA 3PBQA 4N9LA 3HLBA 5KSCA 1YLTA 1YSQA 4FUWA 1CQAA 4DDSA 2Y2QA 4E3JA 1IKGA 4HH2A 1DP6A 4EQIA 2ZM8A 3VP4A 3H9WA 4GLQA 4IHQA 4I39A 1W63Q 2WAEA 2CMNA 5U47A 2JE5A 5DKLA 5FI2A 5GHXA 1KGGA 4QHCA 3CMZA 1IEMA 3MR0A 1OTAA 1CEFA 3T4OA 2ZL1A 1TEMA 3JVVA 3ZDJA 4O01A 3IS2B 4DXCA 1BUEA 3LICA 4DMZA 1K4FA 5FASA 1E4DA 2XDMA 1T1CA 2ZJ9A 3V3SA 3LI9A 1CJFA 4MBHA 5DF9A 2HJEA 1IELA 1C3BA 1VEUB 3LR0A 5AQBA 2XA7S 3VOZA 2ZQ9A 1KGEA 4NXEA 1LL9A 3A3FA 3OCNA 4CPKA 3CITA 2P04A 4XT2A 5DFXA 4MEZA 3CZDA 1K25A 5LBRA 2HDQA 2EFUA 2RL3A 5EPHA 4KUKA 3PXPA 4FCFA 2OV5A 2EX8A 3IX8A 2LB9A 3G32A 3ZHHA 5EVLA 2WKQA 4HJ6A 4P0MA 3NJAA 1TDLA 3E4OA 4S2IA 4LGWA 3AGFA 4YINA 4BL3A 1BULA 1ERMA 3MBZA 4B4ZA 4XUXA 5CGXA 3C7VA 1ONGA 1OTBA 3SH7A 4KQQA 3DBAA 1JWPA 4CJNA 4EQ1A 1PWCA 1MPLA 3LY4A 3FG8A 4WMCA 1GSXA 5J3WA 3DTMA 2QPNA 2VA0A 3UB9A 4E04A 2GX5A 1PWDA 1D06A 3GMWA 1IYPA 3EEHA 4LPZA 4OPRA 3NOPC 3RXWA 5EUAA 1JTDA 1TS0A 1U60A 4PM8A 5L2FA 1NRJA 4KZ5A 5KIZA 1OMEA 5KZHA 4ID4A 5HFOA 4S2KA 2EWVA 3RJUA 4GD6A 1LSWA 3BYDA 4OLGA 4Y0UA 2LB5A 3HJKA 2WADA 3WS4A 4XT2B 5EVEA 4N9KA 3PYPA 3VP1A 1GCEA 4B9OA 3FC7A 2P08A 4EWFA 2WGVA 5HAQA 2EWWA 2JKRI 3A3IA 1YMXA 3B42A 3ZQ5A 3OLOA 3N6IA 2AVXA 1J9MA 4FH2A 1L2SA 4RX3A 4UA6A 3UE0A 3U2AA 4C6YA 4Y13A 5AJGA 3V67A 2KOIA 3MFDA 4M4XA 5HDCA 1EWZA 1O07A 1K57A 1YAXA 4LV1A 3BFCA 3DTEA 1W7FA 5F1GA 3UN7A 2HPBA 2DRWA 3TJZC 1XP4A 3WS1A 5F83A 4B88A 4R4SA 3UB7A 4JBFA 4O8GA 1IYSA 4G3WA 4R3BA 2ZOHA 4L9GA 2VGLS 2Z6CA 4KZ4A 2JKRM 5AVEA 2QJ5A 3C4OA 4Q0HA 4F3LA 4OOLA 2J7VA 4KZ6A 3MF0A 5BOHA 4R3AA 3W2ZA 1PW1A 3S7OA 2NUPC 3UDXA 2OWJA 4BJPA 3E2LA 4FH4A 3LIDA 3CI6A 2FFYA 4DXBA 3FPVA 4CLCA 5KMWA 1Q2PA 3LR5A 2VZWA 3SH9A 4GHIA 4GKUA 1N9OA 5F69A 4OPYA 4RX2A 4KUOA 4NEED 3GVBA 2JKGA 4PM7A 1D7EA 2J9OA 1K0KA 4WMCD 1EI5A 1Z09A 3K3CA 1XJ2A 2GJ3A 5L07A 1KE3A 4GJ4A 1YLYA 3LIEA 3PBSA 3WS2A 5DJUA 4PM5A 5FA7A 4NG2A 4OP8A 4OQHA 3ZG8B 4OPQA 3FV7A 4QD4A 1W79A 2V20A 3BECA 4ZJ1A 2D02A 3OC2A 3T1RA 1FCMA 1F9IA 3ZVWA 1TD5A 1DP9A 1N9LA 3A0VA 1T1BA 3ZCZA 2FZ0A 2PR6A 3P01A 1PW8A 4WZ5C 3SS3A 5CHJA 4DE2A 4E3NA 3E4PA 1KE4A 3FKWA 4S2PA 3UB6A 4JGRA 4RVAA 3CHWP 3PBTA 2HV1A 5F6AA 1MKMA 5CECA 4BD1A 3QNBA 4KZ7A 4HHDA 3PAEA 3P7NA 3CWFA 3SS4A 1BTLA 4JF5A 2VV6A 2P7JA 1MBLA 2PBDP 4KZ8A 1MY8A 1NZOA 3B33A 2ZM2A 3IWIA 3LEZA 4PM9A 4R38A 1WYCA 2XA7M 3ZNTA 4LRXC 4GZBA 4F3LB 3P98A 4MN7A 3GDIA 3A3DA 3T4QA 2IWBA 3T1QB 4EUVA 4K0WA 4E3IA 3UPPA 3DTKA 3UB8A 1FILA 5EVIA 3DWZA 2X02A 3TRCA 3L9KA 2NUTC 5GLBA 4DJ2A 4K08A 4CLCB 4X68A 4FD8A 4GHIB 2EX6A 4UHUA 1Y28A 3CUEC 3NY4A 4Q0JA 4CLCD 1K54A 3VE4A 3EOIA 5L8MA 4OQIA 1J3WA 3RTYA 4LV2A 5HSQA 2VK3A 5AQ7A 2G2WA 1LSVA 1RCJA 3D9YA 3G35A 3ICYA 3FWLA 2ZC6B 3R4KA 4I5SA 4OONA 2H5SA 3HUNA 3IX4A 3HCYA 2C5WB 4ZRRA 1XX2A 4C3QA 4FOFA 1OTEA 4UA9A 3S4XA 1ACFA 5EOEA 5FQKA 2PAVP 1SDNA 4O0PA 1NZUA 1PZPA 3HLFA 3NOTC 1OTDA 1UGUA 4PMAA 5FEFA 5HD3A 4NKPA 5F5YA 3F1NA 5HDSA 4S2NC 4R3JA 4PKYA 5HX9A 1NJ4A 4WELA 1F5MA 2HF6A 2Y2JA 5CRFA 4WBGA 1K54C 3BM6A 4HBTA 2KLIA 3TW8A 2JKTI 4S2LA 2HP5A 1CI8A 2WGIA 2GZAA 3OPPA 5FQQA 3LUQA 4HEFA 5IT5A 2XROA 3JYIA 1HTZA 3DWKA 4ME4A 3SZTA 2Z2MB 3G2YA 1PWGA 3QHYA 1O7EA 5EVIB 4E3MA 3LI8A 5FQ9A 4CLCE 3LR3A 4OH0A 1WE4A 4F94A 3E0YA 1BLCA 1I2WA 1GSVA 5EVID 2VV8A 3IX3A 2E8JA 4DF6A 2JKTM 5HAPA 5CERA 3S7NA 4EESA 4R0QA 1K55A 2ZQ7A 4YFMA 1LI0A 2W3FA 4KG2A 3GRJA 3IXDA 3VP2A 3EWKA 3BFGA 1T1AA 2VGLM 4BLMA 3KYZA 5HPFA 3IQAA 1ES4A 3HLDA 1QMEA 4FSFA 3BJNA 3CLOA 5FATA 2UV0E 3QNCA 4ARZB 5J8XA 1MKIA 3LFVA 4OOYA 2A49A 3VMAA 1HLUP 1F2KA 1KOUA 5J4EA 1OT6A 1KVMA 1TVFA 1Z6FA 2HDSA 3N8LA 1RGZA 4X1MA 2WYXA 3EQVA 5TFQA 2E8IA 3S7QA 3F1NB 2ACGA 2XR0A 2KDKA 5F1FA 2A3UA 3OPLA 3AGDA 5CXWA 2JC7A 2Z2LB 1EROA 3QP6A 2OAQ1 4NXBA 1S66L 3UE3A 3A0RA 3GTCA 1PI5A 3MXSA 3LYXA 3FPWA 1LL5A 3D3OA 4M3KA 5K5BA 4D60A 3G34A 1YLJA 1G6AA 4C75A 1FR1A 3HBRA 1L0FA 1MWTA 2VLGA 4JGPA 2J80A 3IF6A 3Q7ZA 1P97A 1SKOB 4MBKA 4HOIA 2I9VA 1FSYA 3LIBA 5HZHA 4Y5FA 4E6WA 5C5KA 1XJ4A 3VSLA 5FI6A 2W3HA 4KG6A 1H8MA 1X0OA 2XLNA 3MFXA 3GQZA 3IHBA 2KX6A 3N8SA 3MMHA 3UDIA 2PT7A 3BLMA 1YM1A 2WZXA 3FKVA 5EOOA 4KZAA 4JXGA 4Y2FA 3NECA 4NXFA 3U4LP 3UB5P 3OPHA 1MWSA 1YKDA 2ZC4B 2YKHA 1VQQA 1NXYA 1OPXA 3CJMA 5E2FA 5E2GA 3ITAA 3C4PA 3M2KA 5CHMA 4EUZA 1RGYA 3CPTA 3T12B 3C2WA 5HARA 2M7UA 3GECA 5CX7A 2JHEA 4WYYA 5DFYA 1ES5A 2HDRA 4OKPA 5F82A 2L1MA 3HUOA 1BSGA 2OAP1 1H8ZA 2PDRA 2VEAA 1HZOA 3E2KA 4UAAA 1N4OA 2Y8HA 1YQSA 4BBTA 2IA2A 1TS7A 1FIKA 1L3LA 3ZG5A 1ES2A 2EX9A 3WS0A 4E3OA 1N9NA 5CGSA 3IT9A 3VOYA 2Y4AA 3IH9A 4ZTKA 4DRTA 5EM0A 3S22A 4K91A 3VFHA 4E6XA 4JKTA 4E3KA 5FDSA 2Z6DA 3EQUA 3NDGA 5DVAA 4RYEA 5FAPA 4HP9A 1EW0A 3Q81A 4YWZA 4FTXA 1OTIA 3PHYA 4II7A 1YLWA 3IF6B 5TR7A 1SHVA 3LR4A 4O7DA 2V9AA 2ZC3B 3T4KA 1WYBA 3O88A 4MCWA 1STZA 2V2FF 3W4OA 4IJGA 5A92A 3ZFZA 3SW1A 3LEQA 2FH5A 3WRZA 4LV3A 4KQDA 3G6OA 3KO6A 5TGFA 1VB6A 1VETA 2XEPA 1ERQA 4HI4A 1JVJA 1UWNX 3D4FA 4Q0IA 4HNBA 1IOUA 4JPMA 3WWXA 1ESIA 4P6ZS 3IBJA 2DCFA 3HJIA 1K6RA 1Y54A 4GN2A 4MNRA 1TS8A 2A2LA 3IWOA 1FQGA 3VV4A 1VM1A 1AWIA 4HESA 4WL9A 3N4IA 4JF6A 3WRTA 3UPOA 2HP6A 4I3JA 4L0LA 3ZNYA 4X25A 1JWVA 4BL2A 3T1XA 2V1ZA 3CPTB 3KYEA 5FQMA 1E25A 4I3IA 2DNSA 1LT0A 3O3VA 2JCHA 2G2UA 1IYOA 3E4QA 4G3KA 4WZ4A 3RXXA 2B5RA 2VGKA 3OPRA 4BD0A 4DDYA 2PU2A 4HY8A 1A0KA 3BLSA 3UY6A 4JXSA 4XXRA 1IKIA 1K57C 2D01A 1S4RA 3IF5A 2A24A 4ETZA 4GB7A 4MMNA 1K56D 4GCZA 3PAGA 1L0EA 1W5DA 4EV4A 3PBRA 1IFQA 3HL9A 1K4EA 3BFFA 3M2JA 3BY9A 5GHZA 3A0SA 3A3JA 2OSUA 3V3RA 5GLCA 1LLBA 1FSWA 4S2OA 4UA7A 3IHAA 1MXOA 3Q1FA 2BTFP 5GLDA 3KSIA 2P9VA 3V5MA 4KZBA 4CLCC 2WKHA 1VETB 4OPZA 4PKYG 4N92A 4IBXA 2JKFA 1MC0A 1XA1A 4S2MA 3NIAA 2VGJA 2PYPA 2CC1A 3T1SA 3CAXA 2ZD8A 1MWUA 5I5LA 2ZOIA 1NLZA 2OLUA 3GSGA 4IEDA 3IBRA 2RCXA 3RH8B 2VV7A 2WK0A 4KENB 5CTMA 5DKKA 4N1XA 3M6BA 3T50A 1FCNA 2Q9NA 1ALQA 5GLAA 3ITBA 1YLPA 3W4PA 4Y0OA 5EFWA 1XFQA 1ESUA 2PBYA 4QPRA 4I3AA 4DE0A 1G68A 1S1YA 1SCWA 1BLHA 2O9BA 2V8FA 4EETB 2C6WB 4OP5A 1JWZA 2ZQDA 4KQRA 1ODVA 5E43A 3B3XA 4HH3A 3NULA 2B02A 4P85A 4BBVA 4DE1A 2HDUA 1YPRA 1JNUA 4Y17A 2QYBA 2XD1A 3N8RA 2Y2HA 3QP1A 2ZQ8A 5I94A 3UE6A 2V0WA 5A93A 3E98A 2A24B 3MZEA 4EBLA 1OJ5A 3WS5A 1KGFA 1XJ6A 4EEPA 1WA9A 2O0YA 4U3TA 1KDSA 5IU1A 1I2SA 3LIAA 3MXRA 3OCLA 3BWLA 3O86A 4ARZA 3KSHA 4UQIS 5FDHA 1P9WA 4LLOB 4EU0A 2VJWA 3AGEA 1ZG6A 5EVIC 3LY3A 1TS6A 2P9VB 3BFEA 5HDDA 3MJQA 1XPBA 2J3TC 2H10A 3V39A 1YT4A 2ZM0A 4MN6A 5HD5A 2WGWA 2VKSA 4GS9A 4LFUA 1G5UA 4ZDXA 2XRNA 3GV9A 2P74A 2ZC7A 2EXAA 2Y2MA 2R9XA 4BMWA 3CG5A 3UNWA 3VFFA 4K0XA 5FI7A 2I72A 3EGXC 3IXHA 1TDGA 2H28A 1OJGA 1GA0A 3IXBA 1P0ZA 1MZUA 3SOIA 3V50A 4IVKA 1W63M 1SKOA 4NETA 4JGQA 4NXGA 1L0GA 2G7UA 1L0DA 3VSKA 4JXVA 3DAVA 1XKZA 2INWA 2R9WA 5FQJA 1H3QA 1XGIA 3H7WB 5M18A 1YSPA 1NWZA 2R78A 4ZAMA 5CEBA 1KE0A 4L9EA 3UDFA 1HVBA 3HUMA 4KG5A 4B4XA 3ZGAB 4P6ZM 4PAUA 2Y2PA 5HWWA 4DN0A 4GDNA 3ISGA 5TBMA 5D3OA 3MSHA 4Y3IA 1HD8A 4GW9A 5E2EA 1VHMA 3KSGA 5CTNA 3NI9A 1AXBA 2FFFB 3N7WA 3NBLA 1JTGA 1NRFA 5A8BA 4RQ9A 1S67L 4R6LA 3TOIA 2J8YA 4WN5A 1PRQA 1S1ZA 2W3EA 3OOVA 3EEAA 4OLDA 3SH8A 2WZZA 2Y2GA 3IWQA 4LENA 3FYZA 3PBNA 4PPRA 3F1OA 4QB8A 2WGWB 1UWPX 1DP8A 4GS9B 3DW0A 5GHYA 4IBRA 5AVFA 3F1PA 3MZDA 2ZMAA 2DMWA 1K55C 3Q07A 2Y2IA 2ZMVA 2ZC5B 1ZG4A 4QY6A 4LV0A 1PZOA 4B93A 5GL9A 3UPNA 1RP5A 2QWSA 3VP0A 2M1CA 4H8RA 3I7JA 1LI9A 5JYOA 2K7SA 1FCOA 4X56A 1GHPA 5AQAA 2O9AA 3BEBA 2W1TA 2VX8A 2XGNA 5L10A 4QJGA 5IS1A 3ZVTA 4Q8IA 3LGOA 3OBFA 4HBUA 4WEJA 3JVUA 2QHKA 3EGDC 3NCKA 1SZVA 2H0YA 5G18A 1K38A 2K31A 2V1BA 4BBUA 2PHYA 2HP9A 1G6OA 2J3WA 1XA7A 2WKEA 3H82A 5TBMB 4P87A 5FQIA 4YOFA 5CGWA 3BW6A 5TJJA 1LSXA 5M1AA 1E3UA 3MQQA 1ZC2A 5DJTA 1W8YA 4JLFA 1KVLA 5J7EA 3SS5A 1GHMA 3IF6C 4ZJ3A 2J9PA 3W8KA 3Q7VA 3QP4A 1LL8A 2GNXA 5E2HA 4X69A 3LCEA 5FEGA 1CEGA 2ZLYA 2W27A 2WKIA 3NC8A 1BT5A 4KQOA 1F98A 1K56A 1DJAA 3F1OB 2ZL1B 3R7WA 2XD5A 3T4JA 4ZBEA 5EECA 5JYPA 4JXWA 4D2OA 2V0UA 3KX0X 4A5RA 2XQZA 4WUJA 5FAOA 3C38A 4YNRA 1BZAA 4UEYA 3B47A 4LCMA 3F1PB 1H5XA 1XFNA 3BRMA 4IUKA 4X55A 2W1RA 3O5YA 5A90A 4LCLA 4BWIA 5HWVA 3W4QA 5AQ9A 4R4RA 3PR6A 5HPIA 2X01A 3O87A 2ZQCA 3C7UA 1P9RA 4I38A 4UQIM 2MJ6A 5FL3A 1ZTUA 4CQHA 4HIAA 2W1TB 2K2NA 3ZG9B 2EA9A 3LO7A 2PRFA 5MC7A 2XSSA 2WKPA 1KDWA 5EM1A
chains in the Genus database with same CATH topology
2PYPA 2WKRA 3CAXA 2PD8A 2GZAA 5LBRA 2HGVA 5I5LA 2ZOIA 1NLZA 3LUQA 5IT5A 2XROA 3C30A 4KUKA 3IBRA 3RH8B 2VV7A 3C8CA 4ME4A 5DKKA 1TF1A 3PXPA 3T50A 4OOMA 3LI8A 2LB9A 2WKQA 4CLCE 2O99A 3LR3A 4HJ6A 5EFWA 3E0YA 3H82B 3NJAA 1V9YA 1XFQA 3T4TA 4QPRA 4I3AA 3VE3A 1GSVA 2VV8A 3E4OA 1S1YA 4Z1WA 2O9BA 4DJ3A 4EETB 2JKTM 1ODVA 4HH3A 4EXOA 2B02A 4BBVA 3S7NA 4EESA 3ULFA 1JNUA 2QYBA 3UMEA 2W3FA 1OTBA 3DBAA 3EWKA 3UE6A 2V0WA 1T1AA 2VGLM 3E98A 2A24B 3R7WB 3KYZA 4EQ1A 1OJ5A 5HPFA 3VOLA 1XJ6A 4FSFA 4WF0A 3BJNA 4EEPA 1WA9A 3CLOA 2O0YA 3FG8A 1GSXA 5IU1A 5J3WA 4ARZB 4HJ4A 2VA0A 3LIAA 3UB9A 3OCLA 2ZBBA 3TE8A 4E04A 2B18A 2GX5A 3BWLA 4G3VA 2M7VA 3LFVA 4ARZA 1D06A 1KOUA 5J4EA 3KSHA 4UQIS 1OT6A 3EEHA 4LPZA 1P9WA 2OWHA 3NOPC 4LLOB 4EEUA 1TS0A 3EQVA 4EU0A 3S7QA 3F1NB 2VJWA 2YKFA 1NRJA 4WLAA 5KIZA 2KDKA 1TS6A 2QKPA 5KSHA 2QJ7A 3D72A 5HDDA 3MJQA 2EWVA 2J3TC 1LSWA 5F68A 3K2NA 4MN6A 2LB5A 2OAQ1 4NXBA 5HD5A 1S66L 2VKSA 2W3GA 3HJKA 4GS9A 3A0RA 1OT9A 4L9FA 3UE3A 3LYXA 3FPWA 4XT2B 2XRNA 3D3OA 3CUEA 3PYPA 4B9OA 5K5BA 2Y79A 3FC7A 4BMWA 2P08A 2EWWA 2JKRI 3EGXC 2VLGA 3B42A 3ZQ5A 2H28A 3OLOA 4JGPA 1OJGA 2PYRA 2J80A 2L0WA 1P0ZA 1P97A 1MZUA 5G4YA 3U2AA 3MXQA 5AJGA 4HOIA 3V67A 4JGOA 2KOIA 2I9VA 4M4XA 2W0NA 5HDCA 1W63M 3LIBA 5HZHA 4JGQA 4Y5FA 1YAXA 5C5KA 1XJ4A 4NXGA 2HJ9C 2W3HA 3MQ0A 2G7UA 1H8MA 1X0OA 2INWA 3MFXA 3PBOA 1H3QA 2KX6A 3TJZC 3H7WB 1YSPA 3UB7A 3KYQA 3MMHA 4O8GA 2PT7A 1NWZA 4G3WA 2ZOHA 4L9GA 2VGLS 3H7WA 2PD7A 2R78A 2Z6CA 4Y2FA 2JKRM 5AVEA 2QJ5A 4Q0HA 4F3LA 4OOLA 4NXFA 4L9EA 3ZYTA 3MF0A 4R3AA 3W2ZA 1YKDA 2YKHA 3S7OA 4MN5A 2NUPC 2OWJA 1OPXA 4P6ZM 4BJPA 4PAUA 2BASA 5HWTA 3LIDA 3CI6A 1NLYA 2W3DA 3LIFA 5HWWA 4DN0A 3FPVA 4CLCA 4H6JA 5G4ZA 5TBMA 3LR5A 3C2WA 2VZWA 2M7UA 4Y3IA 3GECA 4GW9A 2JHEA 5CX7A 4GHIA 5HL6A 1N9OA 5DFYA 5F69A 1VHMA 3KSGA 4KUOA 4R70A 1V9ZA 4NEED 3NHQA 1ZHHB 2L1MA 1D7EA 2PR5A 2OAP1 4RQ9A 5A8BA 1S67L 4R6LA 4ETXA 2PDRA 4WN5A 4AFIA 3K3CA 1XJ2A 1S1ZA 2GJ3A 2VEAA 4WEKA 4GJ4A 2Y8HA 2W3EA 3LIEA 3OOVA 3PBSA 4BBTA 2IA2A 5DJUA 3EEAA 1TS7A 1DRMA 3PBNA 2D02A 1N9NA 3MQOA 3OC2A 3F1OA 4MDZA 4LRYC 1F9IA 1UWPX 1DP8A 1TD5A 4GS9B 1DP9A 1G28A 1N9LA 1T19A 3A0VA 1T1BA 2FZ0A 5AVFA 2PR6A 2Z6DA 4EW7A 3P01A 3F1PA 3EQUA 4IUHA 3NOUC 3IS2A 2O9CA 2DMWA 4HP9A 2ZMVA 1EW0A 4YWZA 3E4PA 1OTIA 3PHYA 4II7A 4HP4A 4B93A 3UB6A 4JGRA 2QWSA 3LR4A 2M1CA 2V9AA 3T4KA 4MCWA 1STZA 3PBTA 3RFBA 3T4LA 3BQ8A 2HV1A 5F6AA 1MKMA 2K7SA 4IJGA 3SW1A 2FH5A 2O9AA 4HHDA 3P7NA 4KQDA 2W1TA 3CWFA 2VX8A 3G6OA 3KO6A 3BY8A 1VB6A 4LRZE 2V1AA 2VV6A 4HQAA 2P7JA 5IS1A 4HI4A 1UWNX 3OBFA 4Q0IA 4HNBA 1IOUA 2OOLA 3UMDA 3B33A 4P6ZS 4WEJA 3IBJA 3JVUA 2QHKA 3HJIA 3EGDC 1XJ3A 4R38A 4EERA 1T18A 2XA7M 4LRXC 3S7PA 4F3LB 1TS8A 2A2LA 2K31A 2V1BA 4HJ3A 2ZMFA 4MN7A 1GSWA 3GDIA 3VV4A 3T4QA 4BBUA 2L4RA 2PHYA 4WL9A 4EUVA 1G6OA 3UB8A 3TRCA 2J3WA 2NUTC 4I3JA 4L0LA 3BQAA 4PHTA 4DJ2A 1BYWA 4K08A 4CLCB 4H6JB 3H82A 5TBMB 4YOFA 4GHIB 3BW6A 2J3TD 5TJJA 3K3DA 3KSFA 1Y28A 1S4SA 3CUEC 4I3IA 1LSXA 3T4SA 1LT0A 4Q0JA 2JN7A 4CLCD 3VE4A 3MQQA 3PBQA 3E4QA 3EOIA 5DJTA 4G3KA 5L8MA 5J7EA 1YSQA 3RTYA 5HSQA 4HH2A 1LL8A 1DP6A 4HY8A 1LSVA 2GNXA 3H9WA 4GLQA 4IHQA 3ICYA 3R4KA 4I39A 2W27A 4KQOA 1F98A 1S4RA 2D01A 1W63Q 2A24A 2CMNA 4ETZA 3F1OB 4I5SA 5DKLA 3R7WA 4MMNA 4GCZA 3T4JA 3MR0A 2V0UA 1OTAA 3KX0X 3HCYA 4WUJA 3T4OA 3C38A 4ZRRA 3PBRA 4YNRA 1IFQA 3JVVA 4FOFA 4UEYA 1OTEA 3BY9A 3B47A 3F1PB 4O01A 3A0SA 1XFNA 3IS2B 4IUKA 3LICA 4DMZA 2W1RA 4O0PA 3NOTC 3O5YA 1OTDA 4BWIA 5HWVA 1UGUA 5HD3A 1T1CA 4NKPA 5F5YA 3F1NA 3LI9A 3PR6A 5HPIA 5HDSA 3KSIA 4PKYA 5DF9A 2HJEA 4WELA 1F5MA 1P9RA 4I38A 2HF6A 4UQIM 2MJ6A 4CLCC 5FL3A 1ZTUA 4CQHA 4HIAA 2W1TB 2K2NA 3LR0A 2EA9A 2XA7S 4PKYG 4NXEA 2KLIA 3OCNA 5MC7A 2XSSA 2P04A 3CITA 1MC0A 2WKPA 3TW8A 4XT2A 2JKTI 5DFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYP A;  2WKR A;  3CAX A;  2PD8 A;  5I5L A;  2ZOI A;  3LUQ A;  4KUK A;  3IBR A;  3RH8 B;  2VV7 A;  3C8C A;  5DKK A;  3T50 A;  3LI8 A;  2WKQ A;  4HJ6 A;  5EFW A;  3H82 B;  3NJA A;  1V9Y A;  1XFQ A;  4I3A A;  3VE3 A;  1GSV A;  2VV8 A;  3E4O A;  1S1Y A;  4DJ3 A;  4EET B;  1ODV A;  4HH3 A;  4EXO A;  2B02 A;  4BBV A;  4EES A;  3ULF A;  1JNU A;  3UME A;  1OTB A;  3EWK A;  3UE6 A;  2V0W A;  1T1A A;  2A24 B;  4EQ1 A;  1OJ5 A;  3VOL A;  1XJ6 A;  4WF0 A;  4EEP A;  1WA9 A;  3CLO A;  3FG8 A;  1GSX A;  5IU1 A;  5J3W A;  4HJ4 A;  3LIA A;  3UB9 A;  2ZBB A;  4E04 A;  3BWL A;  1D06 A;  1KOU A;  5J4E A;  1OT6 A;  3EEH A;  4LPZ A;  2OWH A;  3NOP C;  4LLO B;  4EEU A;  1TS0 A;  3F1N B;  2YKF A;  4WLA A;  5KIZ A;  2KDK A;  1TS6 A;  2QKP A;  2QJ7 A;  3D72 A;  5HDD A;  3MJQ A;  1LSW A;  5F68 A;  4MN6 A;  4NXB A;  5HD5 A;  1S66 L;  3HJK A;  4GS9 A;  3A0R A;  1OT9 A;  4L9F A;  3LYX A;  4XT2 B;  3PYP A;  4B9O A;  3FC7 A;  2VLG A;  3ZQ5 A;  2H28 A;  3OLO A;  4JGP A;  1OJG A;  2PYR A;  2J80 A;  2L0W A;  1P0Z A;  1P97 A;  1MZU A;  5G4Y A;  3MXQ A;  4HOI A;  4JGO A;  2I9V A;  4M4X A;  2W0N A;  5HDC A;  3LIB A;  5HZH A;  4JGQ A;  1XJ4 A;  4NXG A;  1X0O A;  2INW A;  3MFX A;  2KX6 A;  3H7W B;  3UB7 A;  1NWZ A;  2ZOH A;  4L9G A;  3H7W A;  2PD7 A;  2R78 A;  2Z6C A;  5AVE A;  2QJ5 A;  4F3L A;  4NXF A;  4L9E A;  4R3A A;  2YKH A;  4MN5 A;  2OWJ A;  2BAS A;  5HWT A;  3LID A;  3LIF A;  5HWW A;  4H6J A;  5G4Z A;  5TBM A;  3C2W A;  3GEC A;  4GW9 A;  2JHE A;  4GHI A;  1N9O A;  5F69 A;  4KUO A;  4R70 A;  1V9Z A;  3NHQ A;  2L1M A;  1D7E A;  2PR5 A;  5A8B A;  4RQ9 A;  1S67 L;  4R6L A;  2PDR A;  4WN5 A;  3K3C A;  1XJ2 A;  1S1Z A;  2GJ3 A;  2VEA A;  3LIE A;  4BBT A;  5DJU A;  1TS7 A;  1DRM A;  2D02 A;  1N9N A;  3MQO A;  3F1O A;  4LRY C;  1F9I A;  1UWP X;  1DP8 A;  4GS9 B;  1DP9 A;  1G28 A;  1N9L A;  1T19 A;  3A0V A;  1T1B A;  5AVF A;  2PR6 A;  2Z6D A;  4EW7 A;  3F1P A;  3NOU C;  3IS2 A;  4HP9 A;  1EW0 A;  4YWZ A;  3E4P A;  1OTI A;  3PHY A;  4HP4 A;  3UB6 A;  4JGR A;  2QWS A;  2M1C A;  2V9A A;  2HV1 A;  5F6A A;  2K7S A;  3SW1 A;  4HHD A;  3P7N A;  4KQD A;  3CWF A;  3G6O A;  3BY8 A;  1VB6 A;  4LRZ E;  2V1A A;  2VV6 A;  4HQA A;  2P7J A;  5IS1 A;  4HI4 A;  1UWN X;  4HNB A;  2OOL A;  3UMD A;  3B33 A;  2QHK A;  3HJI A;  1XJ3 A;  4R38 A;  4EER A;  1T18 A;  4LRX C;  4F3L B;  1TS8 A;  2V1B A;  4HJ3 A;  1GSW A;  3GDI A;  4BBU A;  2L4R A;  2PHY A;  4WL9 A;  3UB8 A;  4I3J A;  4DJ2 A;  1BYW A;  4K08 A;  4H6J B;  3H82 A;  5TBM B;  4GHI B;  3K3D A;  1Y28 A;  1S4S A;  4I3I A;  1LSX A;  1LT0 A;  2JN7 A;  3VE4 A;  3MQQ A;  3E4Q A;  5DJT A;  5J7E A;  3RTY A;  5HSQ A;  4HH2 A;  1LL8 A;  1DP6 A;  4HY8 A;  1LSV A;  3H9W A;  3ICY A;  4I39 A;  2W27 A;  1F98 A;  1S4R A;  2D01 A;  2A24 A;  2CMN A;  3F1O B;  4I5S A;  5DKL A;  4GCZ A;  3MR0 A;  2V0U A;  1OTA A;  3KX0 X;  4WUJ A;  1OTE A;  3BY9 A;  3F1P B;  3A0S A;  1XFN A;  3IS2 B;  3LIC A;  3NOT C;  1OTD A;  5HWV A;  1UGU A;  5HD3 A;  1T1C A;  5F5Y A;  3F1N A;  3LI9 A;  5HDS A;  4PKY A;  4I38 A;  4HIA A;  2EA9 A;  4PKY G;  4NXE A;  2WKP A;  4XT2 A; 
#chains in the Genus database with same CATH topology
 5DF7 A;  2WKR A;  2Y2O A;  2PD8 A;  2HGV A;  2EX2 A;  4RA7 A;  4OQG A;  3C30 A;  4BEN A;  3M6H A;  3JPU A;  4MBF A;  3ZG0 A;  3C8C A;  5DTT A;  2Y2K A;  4EBP A;  1TF1 A;  4Y7P A;  3HVF A;  3Q82 A;  4OOM A;  3GR2 A;  2O99 A;  3VP3 A;  4XUZ A;  2QZ6 A;  3H82 B;  1V9Y A;  3T4T A;  3VE3 A;  2BLS A;  4GD8 A;  2Y2L A;  4Z1W A;  4DJ3 A;  5FSR A;  4EXO A;  1PYY A;  1NYM A;  1GA9 A;  3QP5 A;  1PIO A;  3MS6 A;  1NY0 A;  4U0X A;  5A91 A;  3ULF A;  4WZ5 A;  2PU4 A;  3UME A;  4E3L A;  3Q7V B;  2ZQA A;  1E3U D;  3OZH A;  3G30 A;  5EE8 A;  1D1J A;  3QP8 A;  3R7W B;  2WUQ A;  3VOL A;  4WF0 A;  4BQM A;  4Y15 A;  2XFS A;  1Y4O A;  1H8Y A;  3QP2 A;  4HJ4 A;  4U0T A;  3MKE A;  4GDB A;  5HAI A;  2ZBB A;  3TE8 A;  2B18 A;  2H0T A;  4G3V A;  2M7V A;  2IWC A;  5CED A;  4OQ0 A;  1QMF A;  3UO9 A;  2OWH A;  4EEU A;  4GNU A;  3G4P A;  2YKF A;  3BFD A;  3HLW A;  4WLA A;  1CI9 A;  4Z9Q A;  2QKP A;  1XXM A;  2QMI A;  5KSH A;  2QJ7 A;  3D72 A;  5L09 A;  2XH9 A;  1GHI A;  5F68 A;  1CK3 A;  3K2N A;  2UWX A;  4QY5 A;  1FR6 A;  2W3G A;  1OT9 A;  4L9F A;  3HRE A;  2BG1 A;  3G2Z A;  3CUE A;  2Y79 A;  4ESP A;  4X1L A;  1ZKJ A;  4R23 A;  1SDE A;  1I5Q A;  1DJB A;  2PYR A;  2L0W A;  1ONH A;  1MWR A;  3ZG7 B;  5G4Y A;  3MXQ A;  3NDE A;  4JGO A;  2Q0O A;  2W0N A;  3A3E A;  2HJ9 C;  3MQ0 A;  1PNE A;  4IVI A;  3HLG A;  5M19 A;  3UE1 A;  3PBO A;  4EBN A;  2V8C A;  2XFT A;  3IXG A;  3KYQ A;  3H7W A;  2PD7 A;  1W8Q A;  3TG9 A;  2X71 A;  3ZYT A;  1PFL A;  4DE3 A;  4MLL A;  4MN5 A;  3L7H A;  2Y2N A;  2BAS A;  5HWT A;  4S2N A;  1K6S A;  5EV0 A;  1NLY A;  2W3D A;  4QWO A;  2EFX A;  3LIF A;  1Q2Q A;  1YMS A;  4WM9 A;  4H6J A;  3HLC A;  5G4Z A;  2XF3 A;  3PTE A;  3MZF A;  5HL6 A;  1N9B A;  1BLP A;  3TSG A;  4R70 A;  1V9Z A;  3NHQ A;  5IHV A;  3HLE A;  1ZHH B;  2HZ5 A;  3MKF A;  2PR5 A;  2JBF A;  5DF8 A;  1IYQ A;  4ETX A;  4AFI A;  3P09 A;  2Y55 A;  4WEK A;  1YLZ A;  1DY6 A;  1LHY A;  1PI4 A;  4JF4 A;  1DRM A;  1BLS A;  2Y91 A;  3C5A A;  2Y59 A;  5CHU A;  3IH8 A;  3MQO A;  1M40 A;  4MDZ A;  4LRY C;  5DTK A;  1G28 A;  3FZC A;  1T19 A;  1XGJ A;  4OVD A;  4R1G A;  1H0M A;  1NYY A;  4N1H A;  4EW7 A;  4IUH A;  3NOU C;  4X53 A;  3IS2 A;  2O9C A;  5FAQ A;  2IWD A;  4HP4 A;  1M6K A;  5HW3 A;  3RFB A;  3T4L A;  3BQ8 A;  1S6R A;  4ZJ2 A;  1VEU A;  2Q9M A;  1DJC A;  3G31 A;  3BY8 A;  4LRZ E;  2V1A A;  1CF0 A;  4HQA A;  4Y0T A;  1SKF A;  2OOL A;  3UMD A;  1XJ3 A;  2OLV A;  1T18 A;  4EER A;  3S7P A;  4S2J A;  4KZ9 A;  4KZ3 A;  4HJ3 A;  1ES3 A;  2B95 A;  2ZMF A;  1GSW A;  2L4R A;  4PM6 A;  1S0W A;  2EXB A;  4P6B A;  4GOG A;  3BQA A;  4PHT A;  1BYW A;  4H6J B;  4QU3 A;  2GDN A;  4NK3 A;  4DKI A;  2XK1 A;  2J3T D;  5HL1 A;  3K3D A;  3KSF A;  5DTS A;  1S4S A;  2WAF A;  3T4S A;  3S1Y A;  3DTI A;  1FOF A;  2JN7 A;  4X6T A;  3PBQ A;  4N9L A;  3HLB A;  5KSC A;  1YLT A;  1YSQ A;  4FUW A;  1CQA A;  4DDS A;  2Y2Q A;  4E3J A;  1IKG A;  4HH2 A;  1DP6 A;  4EQI A;  2ZM8 A;  3VP4 A;  3H9W A;  4GLQ A;  4IHQ A;  4I39 A;  1W63 Q;  2WAE A;  2CMN A;  5U47 A;  2JE5 A;  5DKL A;  5FI2 A;  5GHX A;  1KGG A;  4QHC A;  3CMZ A;  1IEM A;  3MR0 A;  1OTA A;  1CEF A;  3T4O A;  2ZL1 A;  1TEM A;  3JVV A;  3ZDJ A;  4O01 A;  3IS2 B;  4DXC A;  1BUE A;  3LIC A;  4DMZ A;  1K4F A;  5FAS A;  1E4D A;  2XDM A;  1T1C A;  2ZJ9 A;  3V3S A;  3LI9 A;  1CJF A;  4MBH A;  5DF9 A;  2HJE A;  1IEL A;  1C3B A;  1VEU B;  3LR0 A;  5AQB A;  2XA7 S;  3VOZ A;  2ZQ9 A;  1KGE A;  4NXE A;  1LL9 A;  3A3F A;  3OCN A;  4CPK A;  3CIT A;  2P04 A;  4XT2 A;  5DFX A;  4MEZ A;  3CZD A;  1K25 A;  5LBR A;  2HDQ A;  2EFU A;  2RL3 A;  5EPH A;  4KUK A;  3PXP A;  4FCF A;  2OV5 A;  2EX8 A;  3IX8 A;  2LB9 A;  3G32 A;  3ZHH A;  5EVL A;  2WKQ A;  4HJ6 A;  4P0M A;  3NJA A;  1TDL A;  3E4O A;  4S2I A;  4LGW A;  3AGF A;  4YIN A;  4BL3 A;  1BUL A;  1ERM A;  3MBZ A;  4B4Z A;  4XUX A;  5CGX A;  3C7V A;  1ONG A;  1OTB A;  3SH7 A;  4KQQ A;  3DBA A;  1JWP A;  4CJN A;  4EQ1 A;  1PWC A;  1MPL A;  3LY4 A;  3FG8 A;  4WMC A;  1GSX A;  5J3W A;  3DTM A;  2QPN A;  2VA0 A;  3UB9 A;  4E04 A;  2GX5 A;  1PWD A;  1D06 A;  3GMW A;  1IYP A;  3EEH A;  4LPZ A;  4OPR A;  3NOP C;  3RXW A;  5EUA A;  1JTD A;  1TS0 A;  1U60 A;  4PM8 A;  5L2F A;  1NRJ A;  4KZ5 A;  5KIZ A;  1OME A;  5KZH A;  4ID4 A;  5HFO A;  4S2K A;  2EWV A;  3RJU A;  4GD6 A;  1LSW A;  3BYD A;  4OLG A;  4Y0U A;  2LB5 A;  3HJK A;  2WAD A;  3WS4 A;  4XT2 B;  5EVE A;  4N9K A;  3PYP A;  3VP1 A;  1GCE A;  4B9O A;  3FC7 A;  2P08 A;  4EWF A;  2WGV A;  5HAQ A;  2EWW A;  2JKR I;  3A3I A;  1YMX A;  3B42 A;  3ZQ5 A;  3OLO A;  3N6I A;  2AVX A;  1J9M A;  4FH2 A;  1L2S A;  4RX3 A;  4UA6 A;  3UE0 A;  3U2A A;  4C6Y A;  4Y13 A;  5AJG A;  3V67 A;  2KOI A;  3MFD A;  4M4X A;  5HDC A;  1EWZ A;  1O07 A;  1K57 A;  1YAX A;  4LV1 A;  3BFC A;  3DTE A;  1W7F A;  5F1G A;  3UN7 A;  2HPB A;  2DRW A;  3TJZ C;  1XP4 A;  3WS1 A;  5F83 A;  4B88 A;  4R4S A;  3UB7 A;  4JBF A;  4O8G A;  1IYS A;  4G3W A;  4R3B A;  2ZOH A;  4L9G A;  2VGL S;  2Z6C A;  4KZ4 A;  2JKR M;  5AVE A;  2QJ5 A;  3C4O A;  4Q0H A;  4F3L A;  4OOL A;  2J7V A;  4KZ6 A;  3MF0 A;  5BOH A;  4R3A A;  3W2Z A;  1PW1 A;  3S7O A;  2NUP C;  3UDX A;  2OWJ A;  4BJP A;  3E2L A;  4FH4 A;  3LID A;  3CI6 A;  2FFY A;  4DXB A;  3FPV A;  4CLC A;  5KMW A;  1Q2P A;  3LR5 A;  2VZW A;  3SH9 A;  4GHI A;  4GKU A;  1N9O A;  5F69 A;  4OPY A;  4RX2 A;  4KUO A;  4NEE D;  3GVB A;  2JKG A;  4PM7 A;  1D7E A;  2J9O A;  1K0K A;  4WMC D;  1EI5 A;  1Z09 A;  3K3C A;  1XJ2 A;  2GJ3 A;  5L07 A;  1KE3 A;  4GJ4 A;  1YLY A;  3LIE A;  3PBS A;  3WS2 A;  5DJU A;  4PM5 A;  5FA7 A;  4NG2 A;  4OP8 A;  4OQH A;  3ZG8 B;  4OPQ A;  3FV7 A;  4QD4 A;  1W79 A;  2V20 A;  3BEC A;  4ZJ1 A;  2D02 A;  3OC2 A;  3T1R A;  1FCM A;  1F9I A;  3ZVW A;  1TD5 A;  1DP9 A;  1N9L A;  3A0V A;  1T1B A;  3ZCZ A;  2FZ0 A;  2PR6 A;  3P01 A;  1PW8 A;  4WZ5 C;  3SS3 A;  5CHJ A;  4DE2 A;  4E3N A;  3E4P A;  1KE4 A;  3FKW A;  4S2P A;  3UB6 A;  4JGR A;  4RVA A;  3CHW P;  3PBT A;  2HV1 A;  5F6A A;  1MKM A;  5CEC A;  4BD1 A;  3QNB A;  4KZ7 A;  4HHD A;  3PAE A;  3P7N A;  3CWF A;  3SS4 A;  1BTL A;  4JF5 A;  2VV6 A;  2P7J A;  1MBL A;  2PBD P;  4KZ8 A;  1MY8 A;  1NZO A;  3B33 A;  2ZM2 A;  3IWI A;  3LEZ A;  4PM9 A;  4R38 A;  1WYC A;  2XA7 M;  3ZNT A;  4LRX C;  4GZB A;  4F3L B;  3P98 A;  4MN7 A;  3GDI A;  3A3D A;  3T4Q A;  2IWB A;  3T1Q B;  4EUV A;  4K0W A;  4E3I A;  3UPP A;  3DTK A;  3UB8 A;  1FIL A;  5EVI A;  3DWZ A;  2X02 A;  3TRC A;  3L9K A;  2NUT C;  5GLB A;  4DJ2 A;  4K08 A;  4CLC B;  4X68 A;  4FD8 A;  4GHI B;  2EX6 A;  4UHU A;  1Y28 A;  3CUE C;  3NY4 A;  4Q0J A;  4CLC D;  1K54 A;  3VE4 A;  3EOI A;  5L8M A;  4OQI A;  1J3W A;  3RTY A;  4LV2 A;  5HSQ A;  2VK3 A;  5AQ7 A;  2G2W A;  1LSV A;  1RCJ A;  3D9Y A;  3G35 A;  3ICY A;  3FWL A;  2ZC6 B;  3R4K A;  4I5S A;  4OON A;  2H5S A;  3HUN A;  3IX4 A;  3HCY A;  2C5W B;  4ZRR A;  1XX2 A;  4C3Q A;  4FOF A;  1OTE A;  4UA9 A;  3S4X A;  1ACF A;  5EOE A;  5FQK A;  2PAV P;  1SDN A;  4O0P A;  1NZU A;  1PZP A;  3HLF A;  3NOT C;  1OTD A;  1UGU A;  4PMA A;  5FEF A;  5HD3 A;  4NKP A;  5F5Y A;  3F1N A;  5HDS A;  4S2N C;  4R3J A;  4PKY A;  5HX9 A;  1NJ4 A;  4WEL A;  1F5M A;  2HF6 A;  2Y2J A;  5CRF A;  4WBG A;  1K54 C;  3BM6 A;  4HBT A;  2KLI A;  3TW8 A;  2JKT I;  4S2L A;  2HP5 A;  1CI8 A;  2WGI A;  2GZA A;  3OPP A;  5FQQ A;  3LUQ A;  4HEF A;  5IT5 A;  2XRO A;  3JYI A;  1HTZ A;  3DWK A;  4ME4 A;  3SZT A;  2Z2M B;  3G2Y A;  1PWG A;  3QHY A;  1O7E A;  5EVI B;  4E3M A;  3LI8 A;  5FQ9 A;  4CLC E;  3LR3 A;  4OH0 A;  1WE4 A;  4F94 A;  3E0Y A;  1BLC A;  1I2W A;  1GSV A;  5EVI D;  2VV8 A;  3IX3 A;  2E8J A;  4DF6 A;  2JKT M;  5HAP A;  5CER A;  3S7N A;  4EES A;  4R0Q A;  1K55 A;  2ZQ7 A;  4YFM A;  1LI0 A;  2W3F A;  4KG2 A;  3GRJ A;  3IXD A;  3VP2 A;  3EWK A;  3BFG A;  1T1A A;  2VGL M;  4BLM A;  3KYZ A;  5HPF A;  3IQA A;  1ES4 A;  3HLD A;  1QME A;  4FSF A;  3BJN A;  3CLO A;  5FAT A;  2UV0 E;  3QNC A;  4ARZ B;  5J8X A;  1MKI A;  3LFV A;  4OOY A;  2A49 A;  3VMA A;  1HLU P;  1F2K A;  1KOU A;  5J4E A;  1OT6 A;  1KVM A;  1TVF A;  1Z6F A;  2HDS A;  3N8L A;  1RGZ A;  4X1M A;  2WYX A;  3EQV A;  5TFQ A;  2E8I A;  3S7Q A;  3F1N B;  2ACG A;  2XR0 A;  2KDK A;  5F1F A;  2A3U A;  3OPL A;  3AGD A;  5CXW A;  2JC7 A;  2Z2L B;  1ERO A;  3QP6 A;  2OAQ 1;  4NXB A;  1S66 L;  3UE3 A;  3A0R A;  3GTC A;  1PI5 A;  3MXS A;  3LYX A;  3FPW A;  1LL5 A;  3D3O A;  4M3K A;  5K5B A;  4D60 A;  3G34 A;  1YLJ A;  1G6A A;  4C75 A;  1FR1 A;  3HBR A;  1L0F A;  1MWT A;  2VLG A;  4JGP A;  2J80 A;  3IF6 A;  3Q7Z A;  1P97 A;  1SKO B;  4MBK A;  4HOI A;  2I9V A;  1FSY A;  3LIB A;  5HZH A;  4Y5F A;  4E6W A;  5C5K A;  1XJ4 A;  3VSL A;  5FI6 A;  2W3H A;  4KG6 A;  1H8M A;  1X0O A;  2XLN A;  3MFX A;  3GQZ A;  3IHB A;  2KX6 A;  3N8S A;  3MMH A;  3UDI A;  2PT7 A;  3BLM A;  1YM1 A;  2WZX A;  3FKV A;  5EOO A;  4KZA A;  4JXG A;  4Y2F A;  3NEC A;  4NXF A;  3U4L P;  3UB5 P;  3OPH A;  1MWS A;  1YKD A;  2ZC4 B;  2YKH A;  1VQQ A;  1NXY A;  1OPX A;  3CJM A;  5E2F A;  5E2G A;  3ITA A;  3C4P A;  3M2K A;  5CHM A;  4EUZ A;  1RGY A;  3CPT A;  3T12 B;  3C2W A;  5HAR A;  2M7U A;  3GEC A;  5CX7 A;  2JHE A;  4WYY A;  5DFY A;  1ES5 A;  2HDR A;  4OKP A;  5F82 A;  2L1M A;  3HUO A;  1BSG A;  2OAP 1;  1H8Z A;  2PDR A;  2VEA A;  1HZO A;  3E2K A;  4UAA A;  1N4O A;  2Y8H A;  1YQS A;  4BBT A;  2IA2 A;  1TS7 A;  1FIK A;  1L3L A;  3ZG5 A;  1ES2 A;  2EX9 A;  3WS0 A;  4E3O A;  1N9N A;  5CGS A;  3IT9 A;  3VOY A;  2Y4A A;  3IH9 A;  4ZTK A;  4DRT A;  5EM0 A;  3S22 A;  4K91 A;  3VFH A;  4E6X A;  4JKT A;  4E3K A;  5FDS A;  2Z6D A;  3EQU A;  3NDG A;  5DVA A;  4RYE A;  5FAP A;  4HP9 A;  1EW0 A;  3Q81 A;  4YWZ A;  4FTX A;  1OTI A;  3PHY A;  4II7 A;  1YLW A;  3IF6 B;  5TR7 A;  1SHV A;  3LR4 A;  4O7D A;  2V9A A;  2ZC3 B;  3T4K A;  1WYB A;  3O88 A;  4MCW A;  1STZ A;  2V2F F;  3W4O A;  4IJG A;  5A92 A;  3ZFZ A;  3SW1 A;  3LEQ A;  2FH5 A;  3WRZ A;  4LV3 A;  4KQD A;  3G6O A;  3KO6 A;  5TGF A;  1VB6 A;  1VET A;  2XEP A;  1ERQ A;  4HI4 A;  1JVJ A;  1UWN X;  3D4F A;  4Q0I A;  4HNB A;  1IOU A;  4JPM A;  3WWX A;  1ESI A;  4P6Z S;  3IBJ A;  2DCF A;  3HJI A;  1K6R A;  1Y54 A;  4GN2 A;  4MNR A;  1TS8 A;  2A2L A;  3IWO A;  1FQG A;  3VV4 A;  1VM1 A;  1AWI A;  4HES A;  4WL9 A;  3N4I A;  4JF6 A;  3WRT A;  3UPO A;  2HP6 A;  4I3J A;  4L0L A;  3ZNY A;  4X25 A;  1JWV A;  4BL2 A;  3T1X A;  2V1Z A;  3CPT B;  3KYE A;  5FQM A;  1E25 A;  4I3I A;  2DNS A;  1LT0 A;  3O3V A;  2JCH A;  2G2U A;  1IYO A;  3E4Q A;  4G3K A;  4WZ4 A;  3RXX A;  2B5R A;  2VGK A;  3OPR A;  4BD0 A;  4DDY A;  2PU2 A;  4HY8 A;  1A0K A;  3BLS A;  3UY6 A;  4JXS A;  4XXR A;  1IKI A;  1K57 C;  2D01 A;  1S4R A;  3IF5 A;  2A24 A;  4ETZ A;  4GB7 A;  4MMN A;  1K56 D;  4GCZ A;  3PAG A;  1L0E A;  1W5D A;  4EV4 A;  3PBR A;  1IFQ A;  3HL9 A;  1K4E A;  3BFF A;  3M2J A;  3BY9 A;  5GHZ A;  3A0S A;  3A3J A;  2OSU A;  3V3R A;  5GLC A;  1LLB A;  1FSW A;  4S2O A;  4UA7 A;  3IHA A;  1MXO A;  3Q1F A;  2BTF P;  5GLD A;  3KSI A;  2P9V A;  3V5M A;  4KZB A;  4CLC C;  2WKH A;  1VET B;  4OPZ A;  4PKY G;  4N92 A;  4IBX A;  2JKF A;  1MC0 A;  1XA1 A;  4S2M A;  3NIA A;  2VGJ A;  2PYP A;  2CC1 A;  3T1S A;  3CAX A;  2ZD8 A;  1MWU A;  5I5L A;  2ZOI A;  1NLZ A;  2OLU A;  3GSG A;  4IED A;  3IBR A;  2RCX A;  3RH8 B;  2VV7 A;  2WK0 A;  4KEN B;  5CTM A;  5DKK A;  4N1X A;  3M6B A;  3T50 A;  1FCN A;  2Q9N A;  1ALQ A;  5GLA A;  3ITB A;  1YLP A;  3W4P A;  4Y0O A;  5EFW A;  1XFQ A;  1ESU A;  2PBY A;  4QPR A;  4I3A A;  4DE0 A;  1G68 A;  1S1Y A;  1SCW A;  1BLH A;  2O9B A;  2V8F A;  4EET B;  2C6W B;  4OP5 A;  1JWZ A;  2ZQD A;  4KQR A;  1ODV A;  5E43 A;  3B3X A;  4HH3 A;  3NUL A;  2B02 A;  4P85 A;  4BBV A;  4DE1 A;  2HDU A;  1YPR A;  1JNU A;  4Y17 A;  2QYB A;  2XD1 A;  3N8R A;  2Y2H A;  3QP1 A;  2ZQ8 A;  5I94 A;  3UE6 A;  2V0W A;  5A93 A;  3E98 A;  2A24 B;  3MZE A;  4EBL A;  1OJ5 A;  3WS5 A;  1KGF A;  1XJ6 A;  4EEP A;  1WA9 A;  2O0Y A;  4U3T A;  1KDS A;  5IU1 A;  1I2S A;  3LIA A;  3MXR A;  3OCL A;  3BWL A;  3O86 A;  4ARZ A;  3KSH A;  4UQI S;  5FDH A;  1P9W A;  4LLO B;  4EU0 A;  2VJW A;  3AGE A;  1ZG6 A;  5EVI C;  3LY3 A;  1TS6 A;  2P9V B;  3BFE A;  5HDD A;  3MJQ A;  1XPB A;  2J3T C;  2H10 A;  3V39 A;  1YT4 A;  2ZM0 A;  4MN6 A;  5HD5 A;  2WGW A;  2VKS A;  4GS9 A;  4LFU A;  1G5U A;  4ZDX A;  2XRN A;  3GV9 A;  2P74 A;  2ZC7 A;  2EXA A;  2Y2M A;  2R9X A;  4BMW A;  3CG5 A;  3UNW A;  3VFF A;  4K0X A;  5FI7 A;  2I72 A;  3EGX C;  3IXH A;  1TDG A;  2H28 A;  1OJG A;  1GA0 A;  3IXB A;  1P0Z A;  1MZU A;  3SOI A;  3V50 A;  4IVK A;  1W63 M;  1SKO A;  4NET A;  4JGQ A;  4NXG A;  1L0G A;  2G7U A;  1L0D A;  3VSK A;  4JXV A;  3DAV A;  1XKZ A;  2INW A;  2R9W A;  5FQJ A;  1H3Q A;  1XGI A;  3H7W B;  5M18 A;  1YSP A;  1NWZ A;  2R78 A;  4ZAM A;  5CEB A;  1KE0 A;  4L9E A;  3UDF A;  1HVB A;  3HUM A;  4KG5 A;  4B4X A;  3ZGA B;  4P6Z M;  4PAU A;  2Y2P A;  5HWW A;  4DN0 A;  4GDN A;  3ISG A;  5TBM A;  5D3O A;  3MSH A;  4Y3I A;  1HD8 A;  4GW9 A;  5E2E A;  1VHM A;  3KSG A;  5CTN A;  3NI9 A;  1AXB A;  2FFF B;  3N7W A;  3NBL A;  1JTG A;  1NRF A;  5A8B A;  4RQ9 A;  1S67 L;  4R6L A;  3TOI A;  2J8Y A;  4WN5 A;  1PRQ A;  1S1Z A;  2W3E A;  3OOV A;  3EEA A;  4OLD A;  3SH8 A;  2WZZ A;  2Y2G A;  3IWQ A;  4LEN A;  3FYZ A;  3PBN A;  4PPR A;  3F1O A;  4QB8 A;  2WGW B;  1UWP X;  1DP8 A;  4GS9 B;  3DW0 A;  5GHY A;  4IBR A;  5AVF A;  3F1P A;  3MZD A;  2ZMA A;  2DMW A;  1K55 C;  3Q07 A;  2Y2I A;  2ZMV A;  2ZC5 B;  1ZG4 A;  4QY6 A;  4LV0 A;  1PZO A;  4B93 A;  5GL9 A;  3UPN A;  1RP5 A;  2QWS A;  3VP0 A;  2M1C A;  4H8R A;  3I7J A;  1LI9 A;  5JYO A;  2K7S A;  1FCO A;  4X56 A;  1GHP A;  5AQA A;  2O9A A;  3BEB A;  2W1T A;  2VX8 A;  2XGN A;  5L10 A;  4QJG A;  5IS1 A;  3ZVT A;  4Q8I A;  3LGO A;  3OBF A;  4HBU A;  4WEJ A;  3JVU A;  2QHK A;  3EGD C;  3NCK A;  1SZV A;  2H0Y A;  5G18 A;  1K38 A;  2K31 A;  2V1B A;  4BBU A;  2PHY A;  2HP9 A;  1G6O A;  2J3W A;  1XA7 A;  2WKE A;  3H82 A;  5TBM B;  4P87 A;  5FQI A;  4YOF A;  5CGW A;  3BW6 A;  5TJJ A;  1LSX A;  5M1A A;  1E3U A;  3MQQ A;  1ZC2 A;  5DJT A;  1W8Y A;  4JLF A;  1KVL A;  5J7E A;  3SS5 A;  1GHM A;  3IF6 C;  4ZJ3 A;  2J9P A;  3W8K A;  3Q7V A;  3QP4 A;  1LL8 A;  2GNX A;  5E2H A;  4X69 A;  3LCE A;  5FEG A;  1CEG A;  2ZLY A;  2W27 A;  2WKI A;  3NC8 A;  1BT5 A;  4KQO A;  1F98 A;  1K56 A;  1DJA A;  3F1O B;  2ZL1 B;  3R7W A;  2XD5 A;  3T4J A;  4ZBE A;  5EEC A;  5JYP A;  4JXW A;  4D2O A;  2V0U A;  3KX0 X;  4A5R A;  2XQZ A;  4WUJ A;  5FAO A;  3C38 A;  4YNR A;  1BZA A;  4UEY A;  3B47 A;  4LCM A;  3F1P B;  1H5X A;  1XFN A;  3BRM A;  4IUK A;  4X55 A;  2W1R A;  3O5Y A;  5A90 A;  4LCL A;  4BWI A;  5HWV A;  3W4Q A;  5AQ9 A;  4R4R A;  3PR6 A;  5HPI A;  2X01 A;  3O87 A;  2ZQC A;  3C7U A;  1P9R A;  4I38 A;  4UQI M;  2MJ6 A;  5FL3 A;  1ZTU A;  4CQH A;  4HIA A;  2W1T B;  2K2N A;  3ZG9 B;  2EA9 A;  3LO7 A;  2PRF A;  5MC7 A;  2XSS A;  2WKP A;  1KDW A;  5EM1 A; 
#chains in the Genus database with same CATH homology
 2PYP A;  2WKR A;  3CAX A;  2PD8 A;  2GZA A;  5LBR A;  2HGV A;  5I5L A;  2ZOI A;  1NLZ A;  3LUQ A;  5IT5 A;  2XRO A;  3C30 A;  4KUK A;  3IBR A;  3RH8 B;  2VV7 A;  3C8C A;  4ME4 A;  5DKK A;  1TF1 A;  3PXP A;  3T50 A;  4OOM A;  3LI8 A;  2LB9 A;  2WKQ A;  4CLC E;  2O99 A;  3LR3 A;  4HJ6 A;  5EFW A;  3E0Y A;  3H82 B;  3NJA A;  1V9Y A;  1XFQ A;  3T4T A;  4QPR A;  4I3A A;  3VE3 A;  1GSV A;  2VV8 A;  3E4O A;  1S1Y A;  4Z1W A;  2O9B A;  4DJ3 A;  4EET B;  2JKT M;  1ODV A;  4HH3 A;  4EXO A;  2B02 A;  4BBV A;  3S7N A;  4EES A;  3ULF A;  1JNU A;  2QYB A;  3UME A;  2W3F A;  1OTB A;  3DBA A;  3EWK A;  3UE6 A;  2V0W A;  1T1A A;  2VGL M;  3E98 A;  2A24 B;  3R7W B;  3KYZ A;  4EQ1 A;  1OJ5 A;  5HPF A;  3VOL A;  1XJ6 A;  4FSF A;  4WF0 A;  3BJN A;  4EEP A;  1WA9 A;  3CLO A;  2O0Y A;  3FG8 A;  1GSX A;  5IU1 A;  5J3W A;  4ARZ B;  4HJ4 A;  2VA0 A;  3LIA A;  3UB9 A;  3OCL A;  2ZBB A;  3TE8 A;  4E04 A;  2B18 A;  2GX5 A;  3BWL A;  4G3V A;  2M7V A;  3LFV A;  4ARZ A;  1D06 A;  1KOU A;  5J4E A;  3KSH A;  4UQI S;  1OT6 A;  3EEH A;  4LPZ A;  1P9W A;  2OWH A;  3NOP C;  4LLO B;  4EEU A;  1TS0 A;  3EQV A;  4EU0 A;  3S7Q A;  3F1N B;  2VJW A;  2YKF A;  1NRJ A;  4WLA A;  5KIZ A;  2KDK A;  1TS6 A;  2QKP A;  5KSH A;  2QJ7 A;  3D72 A;  5HDD A;  3MJQ A;  2EWV A;  2J3T C;  1LSW A;  5F68 A;  3K2N A;  4MN6 A;  2LB5 A;  2OAQ 1;  4NXB A;  5HD5 A;  1S66 L;  2VKS A;  2W3G A;  3HJK A;  4GS9 A;  3A0R A;  1OT9 A;  4L9F A;  3UE3 A;  3LYX A;  3FPW A;  4XT2 B;  2XRN A;  3D3O A;  3CUE A;  3PYP A;  4B9O A;  5K5B A;  2Y79 A;  3FC7 A;  4BMW A;  2P08 A;  2EWW A;  2JKR I;  3EGX C;  2VLG A;  3B42 A;  3ZQ5 A;  2H28 A;  3OLO A;  4JGP A;  1OJG A;  2PYR A;  2J80 A;  2L0W A;  1P0Z A;  1P97 A;  1MZU A;  5G4Y A;  3U2A A;  3MXQ A;  5AJG A;  4HOI A;  3V67 A;  4JGO A;  2KOI A;  2I9V A;  4M4X A;  2W0N A;  5HDC A;  1W63 M;  3LIB A;  5HZH A;  4JGQ A;  4Y5F A;  1YAX A;  5C5K A;  1XJ4 A;  4NXG A;  2HJ9 C;  2W3H A;  3MQ0 A;  2G7U A;  1H8M A;  1X0O A;  2INW A;  3MFX A;  3PBO A;  1H3Q A;  2KX6 A;  3TJZ C;  3H7W B;  1YSP A;  3UB7 A;  3KYQ A;  3MMH A;  4O8G A;  2PT7 A;  1NWZ A;  4G3W A;  2ZOH A;  4L9G A;  2VGL S;  3H7W A;  2PD7 A;  2R78 A;  2Z6C A;  4Y2F A;  2JKR M;  5AVE A;  2QJ5 A;  4Q0H A;  4F3L A;  4OOL A;  4NXF A;  4L9E A;  3ZYT A;  3MF0 A;  4R3A A;  3W2Z A;  1YKD A;  2YKH A;  3S7O A;  4MN5 A;  2NUP C;  2OWJ A;  1OPX A;  4P6Z M;  4BJP A;  4PAU A;  2BAS A;  5HWT A;  3LID A;  3CI6 A;  1NLY A;  2W3D A;  3LIF A;  5HWW A;  4DN0 A;  3FPV A;  4CLC A;  4H6J A;  5G4Z A;  5TBM A;  3LR5 A;  3C2W A;  2VZW A;  2M7U A;  4Y3I A;  3GEC A;  4GW9 A;  2JHE A;  5CX7 A;  4GHI A;  5HL6 A;  1N9O A;  5DFY A;  5F69 A;  1VHM A;  3KSG A;  4KUO A;  4R70 A;  1V9Z A;  4NEE D;  3NHQ A;  1ZHH B;  2L1M A;  1D7E A;  2PR5 A;  2OAP 1;  4RQ9 A;  5A8B A;  1S67 L;  4R6L A;  4ETX A;  2PDR A;  4WN5 A;  4AFI A;  3K3C A;  1XJ2 A;  1S1Z A;  2GJ3 A;  2VEA A;  4WEK A;  4GJ4 A;  2Y8H A;  2W3E A;  3LIE A;  3OOV A;  3PBS A;  4BBT A;  2IA2 A;  5DJU A;  3EEA A;  1TS7 A;  1DRM A;  3PBN A;  2D02 A;  1N9N A;  3MQO A;  3OC2 A;  3F1O A;  4MDZ A;  4LRY C;  1F9I A;  1UWP X;  1DP8 A;  1TD5 A;  4GS9 B;  1DP9 A;  1G28 A;  1N9L A;  1T19 A;  3A0V A;  1T1B A;  2FZ0 A;  5AVF A;  2PR6 A;  2Z6D A;  4EW7 A;  3P01 A;  3F1P A;  3EQU A;  4IUH A;  3NOU C;  3IS2 A;  2O9C A;  2DMW A;  4HP9 A;  2ZMV A;  1EW0 A;  4YWZ A;  3E4P A;  1OTI A;  3PHY A;  4II7 A;  4HP4 A;  4B93 A;  3UB6 A;  4JGR A;  2QWS A;  3LR4 A;  2M1C A;  2V9A A;  3T4K A;  4MCW A;  1STZ A;  3PBT A;  3RFB A;  3T4L A;  3BQ8 A;  2HV1 A;  5F6A A;  1MKM A;  2K7S A;  4IJG A;  3SW1 A;  2FH5 A;  2O9A A;  4HHD A;  3P7N A;  4KQD A;  2W1T A;  3CWF A;  2VX8 A;  3G6O A;  3KO6 A;  3BY8 A;  1VB6 A;  4LRZ E;  2V1A A;  2VV6 A;  4HQA A;  2P7J A;  5IS1 A;  4HI4 A;  1UWN X;  3OBF A;  4Q0I A;  4HNB A;  1IOU A;  2OOL A;  3UMD A;  3B33 A;  4P6Z S;  4WEJ A;  3IBJ A;  3JVU A;  2QHK A;  3HJI A;  3EGD C;  1XJ3 A;  4R38 A;  4EER A;  1T18 A;  2XA7 M;  4LRX C;  3S7P A;  4F3L B;  1TS8 A;  2A2L A;  2K31 A;  2V1B A;  4HJ3 A;  2ZMF A;  4MN7 A;  1GSW A;  3GDI A;  3VV4 A;  3T4Q A;  4BBU A;  2L4R A;  2PHY A;  4WL9 A;  4EUV A;  1G6O A;  3UB8 A;  3TRC A;  2J3W A;  2NUT C;  4I3J A;  4L0L A;  3BQA A;  4PHT A;  4DJ2 A;  1BYW A;  4K08 A;  4CLC B;  4H6J B;  3H82 A;  5TBM B;  4YOF A;  4GHI B;  3BW6 A;  2J3T D;  5TJJ A;  3K3D A;  3KSF A;  1Y28 A;  1S4S A;  3CUE C;  4I3I A;  1LSX A;  3T4S A;  1LT0 A;  4Q0J A;  2JN7 A;  4CLC D;  3VE4 A;  3MQQ A;  3PBQ A;  3E4Q A;  3EOI A;  5DJT A;  4G3K A;  5L8M A;  5J7E A;  1YSQ A;  3RTY A;  5HSQ A;  4HH2 A;  1LL8 A;  1DP6 A;  4HY8 A;  1LSV A;  2GNX A;  3H9W A;  4GLQ A;  4IHQ A;  3ICY A;  3R4K A;  4I39 A;  2W27 A;  4KQO A;  1F98 A;  1S4R A;  2D01 A;  1W63 Q;  2A24 A;  2CMN A;  4ETZ A;  3F1O B;  4I5S A;  5DKL A;  3R7W A;  4MMN A;  4GCZ A;  3T4J A;  3MR0 A;  2V0U A;  1OTA A;  3KX0 X;  3HCY A;  4WUJ A;  3T4O A;  3C38 A;  4ZRR A;  3PBR A;  4YNR A;  1IFQ A;  3JVV A;  4FOF A;  4UEY A;  1OTE A;  3BY9 A;  3B47 A;  3F1P B;  4O01 A;  3A0S A;  1XFN A;  3IS2 B;  4IUK A;  3LIC A;  4DMZ A;  2W1R A;  4O0P A;  3NOT C;  3O5Y A;  1OTD A;  4BWI A;  5HWV A;  1UGU A;  5HD3 A;  1T1C A;  4NKP A;  5F5Y A;  3F1N A;  3LI9 A;  3PR6 A;  5HPI A;  5HDS A;  3KSI A;  4PKY A;  5DF9 A;  2HJE A;  4WEL A;  1F5M A;  1P9R A;  4I38 A;  2HF6 A;  4UQI M;  2MJ6 A;  4CLC C;  5FL3 A;  1ZTU A;  4CQH A;  4HIA A;  2W1T B;  2K2N A;  3LR0 A;  2EA9 A;  2XA7 S;  4PKY G;  4NXE A;  2KLI A;  3OCN A;  5MC7 A;  2XSS A;  2P04 A;  3CIT A;  1MC0 A;  2WKP A;  3TW8 A;  4XT2 A;  2JKT I;  5DFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...