4WL9A

Time resolved serial femtosecond crystallography captures high resolution intermediates of pyp
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Time-resolved serial crystallography captures high-resolution intermediates of photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4wl9A00
4EESA 5G4YA 3C2WA 2QWSA 5J3WA 5A8BA 2I9VA 4R6LA 3NHQA 3UB7A 1TS7A 1WA9A 1GSVA 1Y28A 5IS1A 4EERA 1LSWA 2ZBBA 4I3IA 1F9IA 3UB8A 4NXFA 2QKPA 2PDRA 3F1NA 4R38A 2HV1A 3LIFA 2PR6A 3H82B 2A24A 2D01A 2YKHA 3F1OB 1DP8A 3A0RA 3LIAA 4NXBA 4B9OA 1X0OA 4EEPA 2OOLA 4GS9B 4I39A 1OTDA 3HJKA 3BWLA 3E4PA 4EQ1A 4HH2A 1GSXA 2PR5A 1T1BA 3ZQ5A 3LICA 1T19A 1XJ2A 1N9OA 5HZHA 4L9EA 5F68A 2WKQA 5HDDA 1P97A 1TS6A 5TBMB 2PYPA 4R70A 3PHYA 4HJ3A 5HDSA 1LL8A 3D72A 4KQDA 5F69A 3HJIA 5DJUA 3IS2A 3NOPC 4WL9A 3MFXA 4HP4A 3T50A 2JHEA 2CMNA 1OTAA 2L4RA 2W0NA 1XFQA 3BY8A 1G28A 4GS9A 3SW1A 4WN5A 4H6JB 2VV8A 1UGUA 3E4OA 5AVEA 1V9YA 3B33A 2R78A 3MJQA 4LLOB 3RTYA 1D7EA 4RQ9A 4EW7A 1XJ3A 2L0WA 3LIDA 4KUKA 4L9GA 1JNUA 4HP9A 1S66L 4BBUA 2GJ3A 3IS2B 3H82A 3KX0X 3LUQA 4HNBA 3BY9A 3G6OA 5DJTA 3LYXA 2PD8A 5HWTA 4BBTA 5KIZA 2VEAA 1EW0A 1N9LA 2M1CA 1S1ZA 1XFNA 4LRXC 1UWNX 4HIAA 2OWHA 3EWKA 1T1CA 4EXOA 2Z6DA 1TS8A 1VB6A 5F6AA 1N9NA 2PHYA 5HD5A 4HI4A 4WLAA 2VLGA 1KOUA 2YKFA 4LRYC 4WUJA 4I5SA 5HDCA 4E04A 2V9AA 3E4QA 4L9FA 4HJ4A 5G4ZA 1DP9A 2KDKA 4DJ2A 2VV7A 3GDIA 3ICYA 3OLOA 4F3LB 1DP6A 3ULFA 3VE3A 4LRZE 1T18A 2J80A 2QJ7A 2V1BA 3P7NA 2ZOHA 4R3AA 1OTEA 1OJGA 3UMDA 4MN5A 3F1PA 3C8CA 4HOIA 4PKYG 2W27A 4WF0A 3CAXA 3IBRA 2KX6A 1OT9A 4K08A 3EEHA 2H28A 3LIBA 4GCZA 4M4XA 1DRMA 3UB6A 3MQOA 4KUOA 2PD7A 4EETB 5HSQA 4XT2B 4HY8A 4DJ3A 2D02A 2P7JA 3VE4A 4GHIA 4HQAA 4EEUA 1OTIA 2EA9A 3MQQA 4LPZA 3FG8A 3A0VA 1OJ5A 3NOTC 2A24B 2Z6CA 4JGOA 5I5LA 5F5YA 3UE6A 5J4EA 1S4SA 2V0WA 3F1OA 2WKPA 4YWZA 2B02A 3MR0A 4MN6A 3LIEA 1NWZA 3F1NB 3CWFA 5J7EA 3H7WA 1T1AA 3LI8A 1XJ6A 3A0SA 1V9ZA 5HD3A 5DKKA 4JGQA 2BASA 2OWJA 2ZOIA 3UMEA 1OTBA 1F98A 1S1YA 2QHKA 2V0UA 3CLOA 4JGRA 5TBMA 4HH3A 1TS0A 2K7SA 3F1PB 1P0ZA 4PKYA 3VOLA 1S67L 2V1AA 1LT0A 4JGPA 3LI9A 4HJ6A 1UWPX 3H9WA 3MXQA 4I38A 5IU1A 3H7WB 3K3CA 2PYRA 1XJ4A 3PYPA 4I3AA 4NXEA 3UB9A 4NXGA 5EFWA 4BBVA 5AVFA 5HWVA 2L1MA 2INWA 3NJAA 1BYWA 1LSVA 1LSXA 3NOUC 5DKLA 3RH8B 4GW9A 2JN7A 4H6JA 1OT6A 2VV6A 1ODVA 4HHDA 1MZUA 4I3JA 4F3LA 1GSWA 5HWWA 1S4RA 4XT2A 3K3DA 2QJ5A 4GHIB 2WKRA 3FC7A 1D06A 3GECA
chains in the Genus database with same CATH superfamily
3UE1A 2V8CA 3O5YA 4EESA 4Y0TA 3UB7A 2WGWB 4E3JA 3ITAA 4NXFA 2PDRA 1E4DA 1GHPA 1K54C 1CEGA 4DE0A 4MDZA 4B9OA 1SZVA 2VA0A 3GTCA 1OTDA 2QMIA 4HH2A 5F1GA 1LI0A 2O9AA 5GLAA 5HDDA 2JC7A 2OV5A 5DJUA 3HUOA 3ZG0A 4HP4A 4MNRA 1AXBA 1OTAA 2R9XA 4IBRA 3VSLA 5AVEA 4P6BA 3FPVA 3B33A 1XP4A 1IKIA 2VKSA 4EW7A 3V5MA 3RXXA 4HIAA 4EXOA 1SKFA 2XD1A 3DWZA 4OOMA 3NIAA 2ZM8A 2WYXA 4L9FA 2H0YA 3SS3A 3IX8A 3LY3A 3CUEC 2W3DA 3ULFA 3DTIA 3N8SA 2E8JA 4WYYA 4MN5A 2W3EA 1FCOA 3DW0A 3GQZA 1CEFA 4X56A 3U2AA 2EFUA 1PW1A 1OTIA 5EV0A 2DCFA 3Q81A 3LR3A 1OJ5A 3UE6A 1L0GA 1BT5A 2B02A 2UWXA 2EX2A 3BJNA 1PZOA 1OTBA 2V0UA 1BTLA 3F1PB 1PIOA 4HBTA 4NG2A 4E3NA 5BOHA 1LT0A 4JGPA 1PYYA 3HLEA 3PTEA 1KDWA 4WZ4A 3T4JA 3PYPA 3TW8A 3L9KA 5HAIA 3N6IA 1NYMA 4I3JA 2A49A 2QJ5A 3K3DA 1NXYA 3HUMA 3LY4A 4XUZA 1LSWA 3BQ8A 3L7HA 2XDMA 3H82B 2XGNA 1BLCA 4R3BA 2YKHA 2ACGA 3Q7ZA 3T4LA 5FQMA 4CJNA 1PI5A 1HVBA 1N9OA 5M19A 1IYSA 1IYOA 4UEYA 1SDNA 5HAQA 4Y0UA 5HL6A 1EROA 2W0NA 1XFQA 2EXAA 4GS9A 3KSFA 5E2FA 5FASA 3S7QA 1ZG4A 1JNUA 2P9VA 2VGKA 5AQ9A 2PD8A 4OP5A 5FI6A 4ETZA 1HLUP 4KG2A 4KENB 5CHMA 2V9AA 1PNEA 1ZKJA 1WE4A 5CGSA 3MKFA 2Z2LB 5FI2A 5GL9A 1CJFA 1HTZA 3HL9A 4CLCE 4EETB 5CXWA 3EQUA 5E2EA 3FG8A 2A24B 4S2IA 1YMSA 1BLSA 5DTTA 4RYEA 1NWZA 3C7UA 3FKVA 2GNXA 3ZNYA 3TJZC 4QU3A 3PBRA 4Y13A 2BASA 2EXBA 3IXBA 1S67L 3FV7A 4E6XA 2HJEA 3BFCA 1I5QA 1LSXA 4KG6A 1OT6A 4WZ5C 2Y2MA 3M2KA 4WELA 2WKRA 2WGWA 3EOIA 1JTDA 3F1NA 2BTFP 3MQ0A 3NI9A 2VX8A 2C5WB 4EQ1A 3IXDA 2V1ZA 4NK3A 3ZQ5A 3LICA 4RX2A 1ZG6A 5CGXA 2XROA 1T19A 2Y2PA 5HAPA 3ZG9B 4PM6A 1E25A 4UQIS 3D72A 1ESIA 3PBTA 3BY8A 1MY8A 3GVBA 3OOVA 3GSGA 2XH9A 3B47A 4CPKA 3N4IA 4OP8A 2J9PA 4BBUA 3UN7A 2JCHA 1K25A 3LUQA 1GA9A 2XFTA 2OLUA 3NC8A 4Q0HA 5CHJA 3BFGA 3M6HA 5F6AA 1KOUA 4WUJA 4MBHA 2LB5A 4S2KA 3E4QA 3CZDA 3SZTA 4X25A 3T4TA 1BLPA 2XD5A 2OAP1 2PRFA 1LLBA 3UMDA 1TD5A 5EVLA 3CAXA 2WUQA 3EEHA 4KUOA 2W1TA 3BFEA 5HSQA 4GHIA 2PU4A 4BWIA 3UY6A 1PZPA 1K57A 3Q7VA 3MMHA 2P74A 1Z6FA 4QB8A 1I2WA 3LI8A 4X1MA 2K2NA 3T4QA 5CECA 2XF3A 1VEUB 3N7WA 1BYWA 5DTKA 3VFHA 3RH8B 3VP3A 4EBNA 5CRFA 3A3EA 1DJAA 3RJUA 1TS7A 2J3TD 4G3KA 2HDRA 2JBFA 1ONHA 3MXSA 1ES2A 4NEED 3UE0A 2A24A 4ZBEA 2XEPA 4S2JA 1KGFA 4FD8A 2GDNA 2WKQA 3W4QA 5TJJA 4ZRRA 4PM5A 3KYEA 5EVIC 4OQHA 4KZAA 3SW1A 2ZL1B 4WN5A 1G6OA 3OCNA 2KOIA 4OPRA 1XJ3A 4KUKA 3HVFA 1S66L 1Q2QA 3IS2B 3R7WA 5MC7A 5AJGA 3K2NA 1SHVA 2OWHA 1YQSA 4ME4A 1FILA 4ZJ3A 4OLDA 4MBKA 3VE3A 2J80A 4QHCA 4G3WA 4R3AA 2WKEA 4Z9QA 3G34A 1H3QA 4DDSA 1CQAA 1I2SA 1P9RA 4X69A 4U3TA 2XR0A 3VSKA 1MPLA 3UE3A 4E3OA 3LEQA 5DKKA 2EX6A 3BRMA 2QHKA 4HH3A 4EQIA 3BECA 1ES5A 3MXQA 3V39A 2WK0A 1NJ4A 3QP1A 4GHIB 1K56D 3C4OA 4I3IA 3OZHA 3JPUA 2Y8HA 1Y54A 5DVAA 1DP8A 1YKDA 1X0OA 3IF6C 3WS1A 4KZ5A 4MBFA 3IT9A 3FWLA 2W3FA 1BZAA 2WAFA 1P97A 4R70A 5TR7A 1FSWA 3UDXA 3A3IA 1IYQA 4GZBA 3S4XA 1UGUA 1SKOB 3E0YA 3E4OA 3PAEA 4YINA 3EEAA 3T4OA 3IF6B 4HP9A 5FSRA 1VHMA 3KX0X 4KZ9A 3GR2A 4N9KA 3AGDA 1JVJA 1VB6A 4RVAA 1F5MA 5FDHA 2DMWA 2OLVA 4OQIA 4ZTKA 5FAOA 3VFFA 1K55C 3HLDA 1YAXA 2Y2GA 4F3LB 4HBUA 3IX3A 1DP6A 5FAPA 4AFIA 4EUZA 2W1TB 3IXGA 4CQHA 3IBRA 1ONGA 3IQAA 5FA7A 3MQOA 1FIKA 4OQGA 1BULA 4IHQA 1IFQA 5I5LA 4OOYA 3BFDA 5JYOA 4DRTA 4OPQA 3KSHA 1W63Q 5F83A 1W8QA 2EX9A 4HJ6A 3VP0A 2B5RA 4NXEA 3RFBA 4Y17A 4Y7PA 5DKLA 4JF4A 2ZOHA 2EX8A 3FC7A 4X1LA 3N8LA 4R6LA 3NHQA 4K91A 1WA9A 5IS1A 1E3UD 2QKPA 3LIFA 2PR6A 2QPNA 4ID4A 3GRJA 4LENA 3D3OA 2XFSA 2WGVA 5A93A 1DJBA 1NY0A 3MZDA 1OMEA 3IHBA 2QYBA 3WRTA 3VP1A 4NETA 3HLBA 5HDSA 1LL8A 4UHUA 5D3OA 3PBNA 3ZG5A 3SH8A 3CPTB 1ZTUA 5L2FA 4II7A 5HX9A 4OPYA 4JPMA 3LR4A 3BY9A 3LYXA 2RL3A 1EW0A 3MKEA 3EWKA 3OPHA 1PWDA 2V8FA 2PHYA 3HREA 5DTSA 4O0PA 1SCWA 2VV7A 3C7VA 5DFYA 1YLWA 3D9YA 3DTKA 3C8CA 4PMAA 4GCZA 1FCNA 3WS0A 1G68A 2JKTI 2PAVP 3VE4A 3Q82A 2J9OA 3MQQA 4JF5A 3OC2A 5E2GA 2V0WA 2DRWA 1FSYA 2WKPA 2XQZA 1T1AA 1LI9A 1PWCA 4LV2A 4JGQA 2ZOIA 3DTEA 2G2UA 2FZ0A 2HDQA 5FQ9A 5KSHA 5CX7A 3H9WA 1YSPA 1ESUA 2Y2HA 4I3AA 4OKPA 4NXGA 5EFWA 4GN2A 1KVMA 2Y2NA 3ZCZA 4IVIA 2VV6A 4Q0IA 4OH0A 1ES4A 2P04A 3C2WA 2QWSA 5A8BA 4UA7A 5JYPA 1GA0A 5EVEA 1TDGA 3A3JA 5TFQA 1ZC2A 3OBFA 2Q9NA 3CITA 1RP5A 1K4EA 2BLSA 3LEZA 4MEZA 3BWLA 3E4PA 1TEMA 1K6RA 3FPWA 1XGIA 4O01A 4HEFA 2W1RA 5EVIA 3NOPC 4O7DA 3G2YA 3GMWA 2VV8A 2R78A 2Y2QA 4RQ9A 2A2LA 2VGLS 4GDNA 3CHWP 3G31A 3ZYTA 1WYCA 1UWNX 3GV9A 1N9NA 5HD5A 2J8YA 3C30A 2P08A 5G4ZA 4KZ8A 1DP9A 4GLQA 2NUPC 4KQRA 2J3TC 4X55A 3M6BA 3JVVA 5DF8A 4KZBA 4CLCA 1K4FA 1YLTA 4HESA 5F5YA 3UDIA 2K31A 4FSFA 4E3KA 2PU2A 3E98A 4MN6A 3LIEA 3F1NB 4DF6A 1STZA 4K0WA 3VP2A 4JLFA 5GHXA 1TS0A 4BL2A 1Q2PA 4QWOA 4GJ4A 4KZ3A 2JE5A 5AVFA 3A3FA 3NJAA 4B4XA 3CI6A 1VQQA 4GW9A 1VETA 1C3BA 4XT2A 3OPPA 5CEBA 4LV3A 3BW6A 5HL1A 4E3MA 2E8IA 3FZCA 4ARZB 3HJKA 2Y91A 2PR5A 1O7EA 1EWZA 3DTMA 3IWQA 3IH8A 2RCXA 4ZAMA 2ZJ9A 3EGDC 1QMEA 1IKGA 1H8MA 2XSSA 4CLCC 3V3RA 2G7UA 1G28A 1V9YA 1MC0A 3LR0A 4S2NA 1HZOA 3G30A 3ZFZA 2H5SA 4MCWA 3VV4A 2V20A 4KZ6A 3FKWA 2C6WB 5HWTA 5KIZA 2VGLM 3ZDJA 4IVKA 3T4KA 5M1AA 4DXCA 2HP6A 4DJ2A 3MZFA 4MN7A 1T18A 4P6ZS 4DDYA 3LGOA 2PBDP 1JWVA 4GD8A 5A92A 4PAUA 1LL5A 5I94A 1RCJA 1VETB 4LV1A 4LPZA 2Z6CA 1XXMA 1S4SA 3O88A 4C3QA 2Y2LA 3G2ZA 3NULA 2FFFB 1L0FA 2M7UA 2QZ6A 4JGRA 4LV0A 3IF5A 4KQOA 4R3JA 2Z2MB 3BQAA 3CUEA 3P98A 3IBJA 3CJMA 3VP4A 2JN7A 4F3LA 4LCMA 1PFLA 1D06A 2XK1A 4Y5FA 4N1HA 1GHIA 1K54A 2DNSA 4KQQA 3C4PA 3MS6A 3DBAA 2D01A 4R23A 1YMXA 3A0RA 3LIAA 3MFDA 2JKRI 4GS9B 4OLGA 4UA6A 3BEBA 4EWFA 2HP5A 3NDEA 3QP8A 3KSGA 4O8GA 5F69A 3T50A 4WL9A 1W5DA 1TDLA 1MWTA 3EQVA 4DMZA 2J3WA 3RTYA 5HARA 3BFFA 1D7EA 4DE2A 3HLWA 5EVIB 4HNBA 2HP9A 2VEAA 1S1ZA 1FCMA 3JYIA 1T1CA 4R4RA 3N8RA 4B4ZA 3IH9A 4Y15A 4RX3A 5HDCA 2J7VA 1FQGA 5EPHA 3MF0A 2V1BA 2MJ6A 3IWIA 3IWOA 2NUTC 4IEDA 3P01A 5KMWA 4M4XA 2H28A 3Q1FA 5L09A 1ALQA 2VJWA 2LB9A 5HPIA 4LGWA 4Q0JA 3V50A 3ZVTA 1MWUA 3UMEA 3O86A 3PAGA 3NECA 1DJCA 1PW8A 3MBZA 4EBPA 3G32A 2EFXA 5CGWA 4I38A 1K56A 1TF1A 1K57C 2INWA 2WAEA 2OAQ1 4C75A 4LFUA 1S4RA 5J3WA 2H0TA 1KGEA 1GSVA 3WS5A 5FEFA 2W3GA 4GD6A 1K0KA 3T1SA 2OOLA 4I39A 2X01A 4BLMA 1CF0A 3E2KA 4DKIA 3HUNA 4L9EA 3OPLA 3OCLA 2Y2JA 4FTXA 1ZHHB 4B88A 1MWRA 1MWSA 2ZQCA 4ZJ1A 1ES3A 3MXRA 4H8RA 3LFVA 2JKRM 4BD1A 5U47A 3G6OA 1NYYA 5CHUA 4IUHA 3R4KA 2O0YA 1S6RA 2HF6A 2XA7S 1BSGA 4I5SA 4OVDA 4UAAA 3GDIA 2WADA 3S7NA 5EOOA 1GHMA 3P7NA 3WS4A 4MMNA 1GCEA 3ZG8B 2Q9MA 1M6KA 1JTGA 4X68A 2AVXA 1FOFA 4QPRA 2Y79A 1Y4OA 1W8YA 5EUAA 2K7SA 3VOLA 1N9BA 5IU1A 3H7WB 3UB9A 5AQBA 3S1YA 1ODVA 5G4YA 2B95A 3W4OA 3DWKA 1NZUA 4R38A 3EGXC 1RGZA 1XGJA 4NXBA 1W63M 1H5XA 1GSXA 1HD8A 4YNRA 1XJ2A 4BQMA 4Q8IA 5F68A 1XX2A 5FAQA 5GHYA 5FL3A 4JXGA 4KG5A 2ZC3B 3LIDA 3B3XA 1L0DA 5EECA 5DJTA 4N1XA 4QY5A 5IT5A 1CK3A 1XFNA 3HBRA 2HPBA 3TG9A 2Z6DA 1TVFA 2JKTM 1KE4A 2YKFA 4HJ4A 2KDKA 3ICYA 2Y2OA 1XPBA 4LRZE 5LBRA 5FQJA 2ZC7A 5HW3A 3TE8A 1OJGA 5FATA 1KVLA 3HCYA 4EV4A 4WF0A 5CEDA 3QP6A 4P0MA 1ERMA 1DRMA 2O99A 3BM6A 3Q7VB 4DJ3A 2EA9A 5J4EA 2HDSA 3T1XA 3KO6A 3F1OA 1H8ZA 3CWFA 3AGFA 2OWJA 4CLCD 4C6YA 4GOGA 4BMWA 2Y4AA 4R1GA 2IWDA 3SS4A 3NOUC 4WEKA 2VGJA 2GZAA 3WWXA 2I9VA 4WEJA 1D1JA 3NBLA 1Y28A 4WMCA 2WKIA 4ZJ2A 2P9VB 1DY6A 2ZMFA 3ZG7B 2WKHA 4PHTA 4NKPA 2HJ9C 3BLSA 5CERA 2Y59A 3PHYA 5CTMA 3IS2A 3U4LP 2JHEA 2CMNA 4H6JB 3ZVWA 4A5RA 3UNWA 5FQQA 2GJ3A 3S7PA 1NZOA 2M1CA 1YPRA 1NRJA 4LRXC 1TS8A 2ZM0A 4E3LA 3TSGA 4K0XA 1NLYA 1MBLA 1JWPA 5KSCA 4ARZA 5TGFA 1L3LA 5FQIA 4IBXA 2Q0OA 2BG1A 4PKYG 5GLDA 4Y0OA 1N4OA 3S22A 2KX6A 3LIBA 3PXPA 3FYZA 3I7JA 4XT2B 1AWIA 2D02A 3NDGA 5EVID 5DFXA 4S2NC 3SS5A 4YOFA 1XA7A 2EWWA 3PBOA 4YWZA 3MR0A 4F94A 2ZLYA 4LCLA 4P6ZM 3T1RA 4N92A 4S2OA 4RA7A 3UDFA 1EI5A 1H8YA 4EUVA 1UWPX 4DN0A 5GLCA 2PYRA 4BBVA 1XKZA 4GNUA 3W8KA 1OPXA 3QP4A 4H6JA 1MZUA 4L0LA 5HD3A 3W2ZA 2I72A 2VK3A 4CLCB 1ERQA 4ZDXA 2ZC4B 4D2OA 4N9LA 2ZD8A 3IF6A 4U0XA 4ETXA 2W3HA 1T1BA 4JBFA 2XRNA 3OPRA 1TS6A 4KZ7A 4HJ3A 4KQDA 3MZEA 3MFXA 2WZZA 4DE3A 3QNBA 1YLJA 5E43A 1JWZA 1M40A 3IHAA 2H10A 2PBYA 3G4PA 4Y2FA 1CI9A 5DF9A 5FEGA 1A0KA 2Y2IA 4S2MA 1RGYA 1J3WA 4LRYC 3C5AA 4GDBA 3UB5P 2O9BA 4KZ4A 3F1PA 2ZM2A 3ZNTA 4K08A 3HLFA 1Z09A 1YT4A 5HPFA 2EWVA 4HQAA 4EEUA 2GX5A 4JXVA 5EM1A 5M18A 2O9CA 4JGOA 2R9WA 4QJGA 3C38A 5J7EA 3H7WA 2ZQDA 2ZQ9A 1H0MA 2G2WA 1P0ZA 4PKYA 3UO9A 4D60A 1VM1A 2V1AA 2IWCA 2V2FF 4XUXA 4Z1WA 3TRCA 3VMAA 5HWWA 1KE3A 1GSWA 5G18A 3D4FA 1MXOA 3ZHHA 4JXSA 4PM9A 1G5UA 4M3KA 1YLYA 5A90A 2ZQAA 4FUWA 1O07A 4GKUA 3F1OB 1NLZA 3A3DA 4IUKA 1K55A 3O3VA 3QNCA 5AQAA 3Q07A 5F82A 3UPOA 2PYPA 5KZHA 4PPRA 2B18A 1YM1A 1FR1A 2L4RA 3ITBA 1MKMA 2HZ5A 3O87A 5EM0A 4DE1A 3CPTA 4S2PA 1PWGA 4HI4A 5CTNA 3IXHA 4E04A 3B42A 4R0QA 1IYPA 4FOFA 5C5KA 5EE8A 1VEUA 1OTEA 2X71A 3QP5A 3UB6A 4HY8A 1BUEA 3A0VA 4WM9A 1IELA 3HLCA 2ZMVA 3UPNA 5IHVA 4OOLA 2X02A 1W79A 3K3CA 2JKGA 3IX4A 1KDSA 1BLHA 1K6SA 3VOYA 4EERA 2ZBBA 3UB8A 3LCEA 3SH9A 3T1QB 4IJGA 1E3UA 4WMCD 2M7VA 2HDUA 3SH7A 4OONA 1ACFA 4YFMA 1KE0A 4BENA 4PM8A 5HZHA 4P87A 5GLBA 4U0TA 5TBMB 3HJIA 2Y2KA 4R4SA 4BD0A 3BYDA 4OPZA 3LR5A 2IWBA 2UV0E 1SKOA 3MJQA 4LLOB 2L0WA 2WZXA 3UPPA 3AGEA 3QHYA 5A91A 1YLZA 4BBTA 3T4SA 1N9LA 3WRZA 4MLLA 4QY6A 4WLAA 2VLGA 2ZMAA 5L10A 2VZWA 2Y55A 3KYZA 2OSUA 3WS2A 4G3VA 3NCKA 3MSHA 2PT7A 1G6AA 1LL9A 4ESPA 3TOIA 2PD7A 3T12B 2P7JA 4JF6A 4WBGA 3PBQA 1F2KA 2JKFA 2ZC6B 3CMZA 5FQKA 4UA9A 4GB7A 1XJ6A 3A0SA 1V9ZA 4Y3IA 4E3IA 1F98A 3CLOA 5FDSA 2XA7M 1QMFA 1S0WA 2IA2A 3ZGAB 3NY4A 1XJ4A 3JVUA 2FFYA 3LO7A 5HWVA 2L1MA 1LSVA 4EBLA 3RXWA 2ZQ7A 2WGIA 4BL3A 1F9IA 5GHZA 2HV1A 1U60A 1J9MA 3E2LA 4BJPA 3CG5A 3KYQA 2ZQ8A 3BLMA 4EEPA 3G35A 3P09A 4XXRA 2FH5A 4JKTA 2KLIA 3V3SA 3V67A 5L8MA 1KGGA 4X6TA 5K5BA 1L2SA 5F1FA 5HFOA 1IOUA 1NRFA 1K38A 1PRQA 3DAVA 3PBSA 3VOZA 4B93A 1P9WA 2ZL1A 1PI4A 4L9GA 3H82A 4WZ5A 5E2HA 4S2LA 5DF7A 1IEMA 3W4PA 1W7FA 1FR6A 4FCFA 1CI8A 3OLOA 2A3UA 1YSQA 2QJ7A 1LHYA 4X53A 1YLPA 4P85A 4QD4A 5FI7A 4HOIA 2W27A 5AQ7A 3HLGA 2HGVA 3S7OA 1OT9A 4PM7A 5L07A 4UQIM 4DXBA 5J8XA 3QP2A 1WYBA 3NOTC 1MKIA 1XA1A 3M2JA 4JXWA 3KSIA 5EOEA 1S1YA 5TBMA 4E6WA 4FH4A 3SOIA 2XLNA 4OQ0A 2CC1A 3R7WB 3LI9A 3ISGA 3PR6A 1L0EA 4FH2A 2ZC5B 4HHDA 1SDEA 4EU0A 3GECA
chains in the Genus database with same CATH topology
4EESA 3O5YA 3UB7A 4I3IA 4Y5FA 4NXFA 2PDRA 2Y8HA 3DBAA 2D01A 1DP8A 3A0RA 3LIAA 4MDZA 1YKDA 1X0OA 4B9OA 2JKRI 2VA0A 4GS9B 4ETXA 1OTDA 4HH2A 2W3HA 1T1BA 2O9AA 2W3FA 2XRNA 5HDDA 1P97A 1TS6A 4R70A 4HJ3A 4KQDA 3KSGA 4O8GA 5DJUA 5F69A 4WL9A 3T50A 3MFXA 4HP4A 3EQVA 4DMZA 1OTAA 2J3WA 1UGUA 3E0YA 3E4OA 5AVEA 3FPVA 3B33A 3RTYA 1D7EA 3EEAA 3T4OA 2VKSA 4EW7A 4HP9A 1VHMA 3KX0X 4HNBA 4Y2FA 2VEAA 1S1ZA 4HIAA 5DF9A 4EXOA 1T1CA 1VB6A 1F5MA 4OOMA 4LRYC 5HDCA 2DMWA 4L9FA 1YAXA 4F3LB 3CUEC 2W3DA 3MF0A 1DP6A 2O9BA 3ULFA 2V1BA 2MJ6A 4AFIA 2W1TB 4MN5A 3F1PA 4CQHA 2NUTC 2W3EA 3P01A 3IBRA 4M4XA 4K08A 2H28A 3MQOA 3U2AA 5HPFA 2EWVA 4HQAA 4EEUA 1OTIA 2GX5A 4IHQA 2O9CA 3LR3A 1IFQA 1OJ5A 4JGOA 2VJWA 5I5LA 2LB9A 3UE6A 5HPIA 3C38A 4Q0JA 2B02A 5J7EA 3H7WA 3KSHA 3BJNA 3UMEA 1OTBA 2V0UA 1W63Q 3F1PB 1P0ZA 4PKYA 2V1AA 1LT0A 4JGPA 4HJ6A 4I38A 3T4JA 4Z1WA 3PYPA 3TW8A 4NXEA 3RFBA 3TRCA 1TF1A 2INWA 5DKLA 4I3JA 2OAQ1 5HWWA 1GSWA 1S4RA 3K3DA 2ZOHA 2QJ5A 3FC7A 5J3WA 4R6LA 3NHQA 1WA9A 1GSVA 5IS1A 1LSWA 3BQ8A 2QKPA 2W3GA 3LIFA 2PR6A 3H82B 2YKHA 3F1OB 1NLZA 3D3OA 3T4LA 2OOLA 4I39A 4IUKA 1N9OA 2QYBA 4L9EA 2PYPA 5HDSA 1LL8A 4UEYA 2B18A 3OCLA 3PBNA 5HL6A 2L4RA 1ZHHB 1ZTUA 1XFQA 2W0NA 4II7A 4GS9A 3KSFA 1MKMA 3S7QA 3LFVA 1JNUA 3LR4A 2JKRM 3BY9A 3G6OA 3LYXA 2PD8A 1EW0A 4IUHA 3R4KA 2O0YA 4ETZA 3EWKA 2HF6A 2XA7S 2PHYA 4HI4A 4E04A 4I5SA 3B42A 2V9AA 4O0PA 2VV7A 3GDIA 4FOFA 5DFYA 3S7NA 3P7NA 5C5KA 1OTEA 4MMNA 3C8CA 4GCZA 3UB6A 4CLCE 4EETB 2JKTI 4HY8A 3EQUA 3VE4A 3MQQA 3FG8A 3OC2A 3A0VA 4QPRA 2A24B 2V0WA 2ZMVA 2WKPA 2Y79A 1NWZA 1T1AA 2GNXA 3TJZC 3PBRA 4JGQA 2BASA 2ZOIA 4OOLA 2K7SA 3VOLA 1S67L 5KSHA 2FZ0A 2HJEA 5CX7A 3H9WA 5IU1A 1YSPA 3H7WB 3K3CA 3UB9A 4I3AA 4NXGA 5EFWA 1LSXA 1OT6A 2VV6A 1ODVA 4Q0IA 4WELA 2WKRA 2P04A 5G4YA 3C2WA 2QWSA 5A8BA 4EERA 2ZBBA 3EOIA 3UB8A 3F1NA 4R38A 3OBFA 3EGXC 3MQ0A 4IJGA 2VX8A 3CITA 4NXBA 2M7VA 1W63M 3BWLA 3E4PA 4EQ1A 1GSXA 3ZQ5A 3FPWA 3LICA 2XROA 4YNRA 1T19A 1XJ2A 5HZHA 5F68A 4O01A 5TBMB 4UQIS 3D72A 2W1RA 3HJIA 3NOPC 3PBTA 3LR5A 3BY8A 5FL3A 3OOVA 2VV8A 3B47A 3MJQA 2R78A 4LLOB 4RQ9A 2L0WA 3LIDA 4BBUA 2A2LA 2VGLS 3LUQA 5DJTA 4BBTA 4Q0HA 3ZYTA 5IT5A 3T4SA 1N9LA 1XFNA 1UWNX 2Z6DA 5F6AA 1N9NA 2JKTM 5HD5A 4WLAA 2VLGA 1KOUA 2YKFA 2P08A 3C30A 2LB5A 4WUJA 3E4QA 5G4ZA 4HJ4A 1DP9A 4GLQA 2NUPC 2KDKA 3ICYA 4LRZE 5LBRA 2J3TC 2VZWA 3T4TA 3KYZA 2OAP1 3TE8A 1OJGA 3UMDA 1TD5A 4G3VA 3JVVA 3HCYA 2PT7A 4WF0A 3CAXA 3EEHA 1DRMA 4CLCA 2O99A 4KUOA 2PD7A 2W1TA 5HSQA 4DJ3A 2P7JA 4GHIA 3PBQA 2EA9A 4BWIA 5J4EA 5F5YA 2K31A 3KO6A 4FSFA 3F1OA 3E98A 4MN6A 3LIEA 3MMHA 3F1NB 3CWFA 3LI8A 1XJ6A 3A0SA 1V9ZA 4Y3IA 1STZA 2OWJA 4CLCD 1F98A 2K2NA 3CLOA 2XA7M 1TS0A 3T4QA 4CLCB 2IA2A 4BMWA 1XJ4A 4GJ4A 3JVUA 5AVFA 5HWVA 2L1MA 3NJAA 1BYWA 1LSVA 3CI6A 3NOUC 3RH8B 4GW9A 4WEKA 4XT2A 2GZAA 2I9VA 4WEJA 1TS7A 2J3TD 1Y28A 4G3KA 1F9IA 2HV1A 3BW6A 4BJPA 4NEED 2A24A 3KYQA 2ZMFA 4PHTA 4NKPA 4EEPA 4ARZB 3HJKA 2FH5A 2PR5A 2HJ9C 2KLIA 3V67A 5L8MA 2WKQA 5K5BA 5TJJA 3PHYA 4ZRRA 3EGDC 3IS2A 1H8MA 2XSSA 2JHEA 4CLCC 1IOUA 2CMNA 2G7UA 3SW1A 1G28A 4WN5A 3PBSA 1G6OA 3OCNA 1P9WA 4H6JB 1V9YA 4B93A 1MC0A 3LR0A 2KOIA 1XJ3A 4L9GA 4KUKA 4MCWA 1S66L 3VV4A 2GJ3A 3IS2B 3R7WA 3H82A 5MC7A 3S7PA 5HWTA 5AJGA 3K2NA 5KIZA 2M1CA 2VGLM 1NRJA 4LRXC 2OWHA 1TS8A 4ME4A 3T4KA 1NLYA 4ARZA 4DJ2A 4MN7A 3OLOA 3VE3A 1T18A 1YSQA 2J80A 2QJ7A 4G3WA 4R3AA 4P6ZS 4HOIA 4PKYG 2W27A 2HGVA 2KX6A 1OT9A 3S7OA 3LIBA 3PXPA 4PAUA 1H3QA 4XT2B 4UQIM 2D02A 4LPZA 5DFXA 3NOTC 2Z6CA 4YOFA 1P9RA 2EWWA 1S4SA 3PBOA 4YWZA 3MR0A 3UE3A 3KSIA 4P6ZM 5DKKA 2M7UA 4JGRA 1S1YA 2QHKA 5TBMA 4HH3A 4KQOA 4EUVA 3R7WB 3LI9A 1UWPX 4DN0A 3MXQA 3BQAA 2PYRA 4BBVA 3CUEA 3PR6A 3IBJA 1OPXA 2JN7A 4H6JA 4HHDA 4F3LA 1MZUA 4L0LA 4EU0A 5HD3A 3W2ZA 4GHIB 1D06A 3GECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EES A;  5G4Y A;  3C2W A;  2QWS A;  5J3W A;  5A8B A;  2I9V A;  4R6L A;  3NHQ A;  3UB7 A;  1TS7 A;  1WA9 A;  1GSV A;  1Y28 A;  5IS1 A;  4EER A;  1LSW A;  2ZBB A;  4I3I A;  1F9I A;  3UB8 A;  4NXF A;  2QKP A;  2PDR A;  3F1N A;  4R38 A;  2HV1 A;  3LIF A;  2PR6 A;  3H82 B;  2A24 A;  2D01 A;  2YKH A;  3F1O B;  1DP8 A;  3A0R A;  3LIA A;  4NXB A;  4B9O A;  1X0O A;  4EEP A;  2OOL A;  4GS9 B;  4I39 A;  1OTD A;  3HJK A;  3BWL A;  3E4P A;  4EQ1 A;  4HH2 A;  1GSX A;  2PR5 A;  1T1B A;  3ZQ5 A;  3LIC A;  1T19 A;  1XJ2 A;  1N9O A;  5HZH A;  4L9E A;  5F68 A;  2WKQ A;  5HDD A;  1P97 A;  1TS6 A;  5TBM B;  2PYP A;  4R70 A;  3PHY A;  4HJ3 A;  5HDS A;  1LL8 A;  3D72 A;  4KQD A;  5F69 A;  3HJI A;  5DJU A;  3IS2 A;  3NOP C;  4WL9 A;  3MFX A;  4HP4 A;  3T50 A;  2JHE A;  2CMN A;  1OTA A;  2L4R A;  2W0N A;  1XFQ A;  3BY8 A;  1G28 A;  4GS9 A;  3SW1 A;  4WN5 A;  4H6J B;  2VV8 A;  1UGU A;  3E4O A;  5AVE A;  1V9Y A;  3B33 A;  2R78 A;  3MJQ A;  4LLO B;  3RTY A;  1D7E A;  4RQ9 A;  4EW7 A;  1XJ3 A;  2L0W A;  3LID A;  4KUK A;  4L9G A;  1JNU A;  4HP9 A;  1S66 L;  4BBU A;  2GJ3 A;  3IS2 B;  3H82 A;  3KX0 X;  3LUQ A;  4HNB A;  3BY9 A;  3G6O A;  5DJT A;  3LYX A;  2PD8 A;  5HWT A;  4BBT A;  5KIZ A;  2VEA A;  1EW0 A;  1N9L A;  2M1C A;  1S1Z A;  1XFN A;  4LRX C;  1UWN X;  4HIA A;  2OWH A;  3EWK A;  1T1C A;  4EXO A;  2Z6D A;  1TS8 A;  1VB6 A;  5F6A A;  1N9N A;  2PHY A;  5HD5 A;  4HI4 A;  4WLA A;  2VLG A;  1KOU A;  2YKF A;  4LRY C;  4WUJ A;  4I5S A;  5HDC A;  4E04 A;  2V9A A;  3E4Q A;  4L9F A;  4HJ4 A;  5G4Z A;  1DP9 A;  2KDK A;  4DJ2 A;  2VV7 A;  3GDI A;  3ICY A;  3OLO A;  4F3L B;  1DP6 A;  3ULF A;  3VE3 A;  4LRZ E;  1T18 A;  2J80 A;  2QJ7 A;  2V1B A;  3P7N A;  2ZOH A;  4R3A A;  1OTE A;  1OJG A;  3UMD A;  4MN5 A;  3F1P A;  3C8C A;  4HOI A;  4PKY G;  2W27 A;  4WF0 A;  3CAX A;  3IBR A;  2KX6 A;  1OT9 A;  4K08 A;  3EEH A;  2H28 A;  3LIB A;  4GCZ A;  4M4X A;  1DRM A;  3UB6 A;  3MQO A;  4KUO A;  2PD7 A;  4EET B;  5HSQ A;  4XT2 B;  4HY8 A;  4DJ3 A;  2D02 A;  2P7J A;  3VE4 A;  4GHI A;  4HQA A;  4EEU A;  1OTI A;  2EA9 A;  3MQQ A;  4LPZ A;  3FG8 A;  3A0V A;  1OJ5 A;  3NOT C;  2A24 B;  2Z6C A;  4JGO A;  5I5L A;  5F5Y A;  3UE6 A;  5J4E A;  1S4S A;  2V0W A;  3F1O A;  2WKP A;  4YWZ A;  2B02 A;  3MR0 A;  4MN6 A;  3LIE A;  1NWZ A;  3F1N B;  3CWF A;  5J7E A;  3H7W A;  1T1A A;  3LI8 A;  1XJ6 A;  3A0S A;  1V9Z A;  5HD3 A;  5DKK A;  4JGQ A;  2BAS A;  2OWJ A;  2ZOI A;  3UME A;  1OTB A;  1F98 A;  1S1Y A;  2QHK A;  2V0U A;  3CLO A;  4JGR A;  5TBM A;  4HH3 A;  1TS0 A;  2K7S A;  3F1P B;  1P0Z A;  4PKY A;  3VOL A;  1S67 L;  2V1A A;  1LT0 A;  4JGP A;  3LI9 A;  4HJ6 A;  1UWP X;  3H9W A;  3MXQ A;  4I38 A;  5IU1 A;  3H7W B;  3K3C A;  2PYR A;  1XJ4 A;  3PYP A;  4I3A A;  4NXE A;  3UB9 A;  4NXG A;  5EFW A;  4BBV A;  5AVF A;  5HWV A;  2L1M A;  2INW A;  3NJA A;  1BYW A;  1LSV A;  1LSX A;  3NOU C;  5DKL A;  3RH8 B;  4GW9 A;  2JN7 A;  4H6J A;  1OT6 A;  2VV6 A;  1ODV A;  4HHD A;  1MZU A;  4I3J A;  4F3L A;  1GSW A;  5HWW A;  1S4R A;  4XT2 A;  3K3D A;  2QJ5 A;  4GHI B;  2WKR A;  3FC7 A;  1D06 A;  3GEC A; 
#chains in the Genus database with same CATH topology
 3UE1 A;  2V8C A;  3O5Y A;  4EES A;  4Y0T A;  3UB7 A;  2WGW B;  4E3J A;  3ITA A;  4NXF A;  2PDR A;  1E4D A;  1GHP A;  1K54 C;  1CEG A;  4DE0 A;  4MDZ A;  4B9O A;  1SZV A;  2VA0 A;  3GTC A;  1OTD A;  2QMI A;  4HH2 A;  5F1G A;  1LI0 A;  2O9A A;  5GLA A;  5HDD A;  2JC7 A;  2OV5 A;  5DJU A;  3HUO A;  3ZG0 A;  4HP4 A;  4MNR A;  1AXB A;  1OTA A;  2R9X A;  4IBR A;  3VSL A;  5AVE A;  4P6B A;  3FPV A;  3B33 A;  1XP4 A;  1IKI A;  2VKS A;  4EW7 A;  3V5M A;  3RXX A;  4HIA A;  4EXO A;  1SKF A;  2XD1 A;  3DWZ A;  4OOM A;  3NIA A;  2ZM8 A;  2WYX A;  4L9F A;  2H0Y A;  3SS3 A;  3IX8 A;  3LY3 A;  3CUE C;  2W3D A;  3ULF A;  3DTI A;  3N8S A;  2E8J A;  4WYY A;  4MN5 A;  2W3E A;  1FCO A;  3DW0 A;  3GQZ A;  1CEF A;  4X56 A;  3U2A A;  2EFU A;  1PW1 A;  1OTI A;  5EV0 A;  2DCF A;  3Q81 A;  3LR3 A;  1OJ5 A;  3UE6 A;  1L0G A;  1BT5 A;  2B02 A;  2UWX A;  2EX2 A;  3BJN A;  1PZO A;  1OTB A;  2V0U A;  1BTL A;  3F1P B;  1PIO A;  4HBT A;  4NG2 A;  4E3N A;  5BOH A;  1LT0 A;  4JGP A;  1PYY A;  3HLE A;  3PTE A;  1KDW A;  4WZ4 A;  3T4J A;  3PYP A;  3TW8 A;  3L9K A;  5HAI A;  3N6I A;  1NYM A;  4I3J A;  2A49 A;  2QJ5 A;  3K3D A;  1NXY A;  3HUM A;  3LY4 A;  4XUZ A;  1LSW A;  3BQ8 A;  3L7H A;  2XDM A;  3H82 B;  2XGN A;  1BLC A;  4R3B A;  2YKH A;  2ACG A;  3Q7Z A;  3T4L A;  5FQM A;  4CJN A;  1PI5 A;  1HVB A;  1N9O A;  5M19 A;  1IYS A;  1IYO A;  4UEY A;  1SDN A;  5HAQ A;  4Y0U A;  5HL6 A;  1ERO A;  2W0N A;  1XFQ A;  2EXA A;  4GS9 A;  3KSF A;  5E2F A;  5FAS A;  3S7Q A;  1ZG4 A;  1JNU A;  2P9V A;  2VGK A;  5AQ9 A;  2PD8 A;  4OP5 A;  5FI6 A;  4ETZ A;  1HLU P;  4KG2 A;  4KEN B;  5CHM A;  2V9A A;  1PNE A;  1ZKJ A;  1WE4 A;  5CGS A;  3MKF A;  2Z2L B;  5FI2 A;  5GL9 A;  1CJF A;  1HTZ A;  3HL9 A;  4CLC E;  4EET B;  5CXW A;  3EQU A;  5E2E A;  3FG8 A;  2A24 B;  4S2I A;  1YMS A;  1BLS A;  5DTT A;  4RYE A;  1NWZ A;  3C7U A;  3FKV A;  2GNX A;  3ZNY A;  3TJZ C;  4QU3 A;  3PBR A;  4Y13 A;  2BAS A;  2EXB A;  3IXB A;  1S67 L;  3FV7 A;  4E6X A;  2HJE A;  3BFC A;  1I5Q A;  1LSX A;  4KG6 A;  1OT6 A;  4WZ5 C;  2Y2M A;  3M2K A;  4WEL A;  2WKR A;  2WGW A;  3EOI A;  1JTD A;  3F1N A;  2BTF P;  3MQ0 A;  3NI9 A;  2VX8 A;  2C5W B;  4EQ1 A;  3IXD A;  2V1Z A;  4NK3 A;  3ZQ5 A;  3LIC A;  4RX2 A;  1ZG6 A;  5CGX A;  2XRO A;  1T19 A;  2Y2P A;  5HAP A;  3ZG9 B;  4PM6 A;  1E25 A;  4UQI S;  3D72 A;  1ESI A;  3PBT A;  3BY8 A;  1MY8 A;  3GVB A;  3OOV A;  3GSG A;  2XH9 A;  3B47 A;  4CPK A;  3N4I A;  4OP8 A;  2J9P A;  4BBU A;  3UN7 A;  2JCH A;  1K25 A;  3LUQ A;  1GA9 A;  2XFT A;  2OLU A;  3NC8 A;  4Q0H A;  5CHJ A;  3BFG A;  3M6H A;  5F6A A;  1KOU A;  4WUJ A;  4MBH A;  2LB5 A;  4S2K A;  3E4Q A;  3CZD A;  3SZT A;  4X25 A;  3T4T A;  1BLP A;  2XD5 A;  2OAP 1;  2PRF A;  1LLB A;  3UMD A;  1TD5 A;  5EVL A;  3CAX A;  2WUQ A;  3EEH A;  4KUO A;  2W1T A;  3BFE A;  5HSQ A;  4GHI A;  2PU4 A;  4BWI A;  3UY6 A;  1PZP A;  1K57 A;  3Q7V A;  3MMH A;  2P74 A;  1Z6F A;  4QB8 A;  1I2W A;  3LI8 A;  4X1M A;  2K2N A;  3T4Q A;  5CEC A;  2XF3 A;  1VEU B;  3N7W A;  1BYW A;  5DTK A;  3VFH A;  3RH8 B;  3VP3 A;  4EBN A;  5CRF A;  3A3E A;  1DJA A;  3RJU A;  1TS7 A;  2J3T D;  4G3K A;  2HDR A;  2JBF A;  1ONH A;  3MXS A;  1ES2 A;  4NEE D;  3UE0 A;  2A24 A;  4ZBE A;  2XEP A;  4S2J A;  1KGF A;  4FD8 A;  2GDN A;  2WKQ A;  3W4Q A;  5TJJ A;  4ZRR A;  4PM5 A;  3KYE A;  5EVI C;  4OQH A;  4KZA A;  3SW1 A;  2ZL1 B;  4WN5 A;  1G6O A;  3OCN A;  2KOI A;  4OPR A;  1XJ3 A;  4KUK A;  3HVF A;  1S66 L;  1Q2Q A;  3IS2 B;  3R7W A;  5MC7 A;  5AJG A;  3K2N A;  1SHV A;  2OWH A;  1YQS A;  4ME4 A;  1FIL A;  4ZJ3 A;  4OLD A;  4MBK A;  3VE3 A;  2J80 A;  4QHC A;  4G3W A;  4R3A A;  2WKE A;  4Z9Q A;  3G34 A;  1H3Q A;  4DDS A;  1CQA A;  1I2S A;  1P9R A;  4X69 A;  4U3T A;  2XR0 A;  3VSK A;  1MPL A;  3UE3 A;  4E3O A;  3LEQ A;  5DKK A;  2EX6 A;  3BRM A;  2QHK A;  4HH3 A;  4EQI A;  3BEC A;  1ES5 A;  3MXQ A;  3V39 A;  2WK0 A;  1NJ4 A;  3QP1 A;  4GHI B;  1K56 D;  3C4O A;  4I3I A;  3OZH A;  3JPU A;  2Y8H A;  1Y54 A;  5DVA A;  1DP8 A;  1YKD A;  1X0O A;  3IF6 C;  3WS1 A;  4KZ5 A;  4MBF A;  3IT9 A;  3FWL A;  2W3F A;  1BZA A;  2WAF A;  1P97 A;  4R70 A;  5TR7 A;  1FSW A;  3UDX A;  3A3I A;  1IYQ A;  4GZB A;  3S4X A;  1UGU A;  1SKO B;  3E0Y A;  3E4O A;  3PAE A;  4YIN A;  3EEA A;  3T4O A;  3IF6 B;  4HP9 A;  5FSR A;  1VHM A;  3KX0 X;  4KZ9 A;  3GR2 A;  4N9K A;  3AGD A;  1JVJ A;  1VB6 A;  4RVA A;  1F5M A;  5FDH A;  2DMW A;  2OLV A;  4OQI A;  4ZTK A;  5FAO A;  3VFF A;  1K55 C;  3HLD A;  1YAX A;  2Y2G A;  4F3L B;  4HBU A;  3IX3 A;  1DP6 A;  5FAP A;  4AFI A;  4EUZ A;  2W1T B;  3IXG A;  4CQH A;  3IBR A;  1ONG A;  3IQA A;  5FA7 A;  3MQO A;  1FIK A;  4OQG A;  1BUL A;  4IHQ A;  1IFQ A;  5I5L A;  4OOY A;  3BFD A;  5JYO A;  4DRT A;  4OPQ A;  3KSH A;  1W63 Q;  5F83 A;  1W8Q A;  2EX9 A;  4HJ6 A;  3VP0 A;  2B5R A;  4NXE A;  3RFB A;  4Y17 A;  4Y7P A;  5DKL A;  4JF4 A;  2ZOH A;  2EX8 A;  3FC7 A;  4X1L A;  3N8L A;  4R6L A;  3NHQ A;  4K91 A;  1WA9 A;  5IS1 A;  1E3U D;  2QKP A;  3LIF A;  2PR6 A;  2QPN A;  4ID4 A;  3GRJ A;  4LEN A;  3D3O A;  2XFS A;  2WGV A;  5A93 A;  1DJB A;  1NY0 A;  3MZD A;  1OME A;  3IHB A;  2QYB A;  3WRT A;  3VP1 A;  4NET A;  3HLB A;  5HDS A;  1LL8 A;  4UHU A;  5D3O A;  3PBN A;  3ZG5 A;  3SH8 A;  3CPT B;  1ZTU A;  5L2F A;  4II7 A;  5HX9 A;  4OPY A;  4JPM A;  3LR4 A;  3BY9 A;  3LYX A;  2RL3 A;  1EW0 A;  3MKE A;  3EWK A;  3OPH A;  1PWD A;  2V8F A;  2PHY A;  3HRE A;  5DTS A;  4O0P A;  1SCW A;  2VV7 A;  3C7V A;  5DFY A;  1YLW A;  3D9Y A;  3DTK A;  3C8C A;  4PMA A;  4GCZ A;  1FCN A;  3WS0 A;  1G68 A;  2JKT I;  2PAV P;  3VE4 A;  3Q82 A;  2J9O A;  3MQQ A;  4JF5 A;  3OC2 A;  5E2G A;  2V0W A;  2DRW A;  1FSY A;  2WKP A;  2XQZ A;  1T1A A;  1LI9 A;  1PWC A;  4LV2 A;  4JGQ A;  2ZOI A;  3DTE A;  2G2U A;  2FZ0 A;  2HDQ A;  5FQ9 A;  5KSH A;  5CX7 A;  3H9W A;  1YSP A;  1ESU A;  2Y2H A;  4I3A A;  4OKP A;  4NXG A;  5EFW A;  4GN2 A;  1KVM A;  2Y2N A;  3ZCZ A;  4IVI A;  2VV6 A;  4Q0I A;  4OH0 A;  1ES4 A;  2P04 A;  3C2W A;  2QWS A;  5A8B A;  4UA7 A;  5JYP A;  1GA0 A;  5EVE A;  1TDG A;  3A3J A;  5TFQ A;  1ZC2 A;  3OBF A;  2Q9N A;  3CIT A;  1RP5 A;  1K4E A;  2BLS A;  3LEZ A;  4MEZ A;  3BWL A;  3E4P A;  1TEM A;  1K6R A;  3FPW A;  1XGI A;  4O01 A;  4HEF A;  2W1R A;  5EVI A;  3NOP C;  4O7D A;  3G2Y A;  3GMW A;  2VV8 A;  2R78 A;  2Y2Q A;  4RQ9 A;  2A2L A;  2VGL S;  4GDN A;  3CHW P;  3G31 A;  3ZYT A;  1WYC A;  1UWN X;  3GV9 A;  1N9N A;  5HD5 A;  2J8Y A;  3C30 A;  2P08 A;  5G4Z A;  4KZ8 A;  1DP9 A;  4GLQ A;  2NUP C;  4KQR A;  2J3T C;  4X55 A;  3M6B A;  3JVV A;  5DF8 A;  4KZB A;  4CLC A;  1K4F A;  1YLT A;  4HES A;  5F5Y A;  3UDI A;  2K31 A;  4FSF A;  4E3K A;  2PU2 A;  3E98 A;  4MN6 A;  3LIE A;  3F1N B;  4DF6 A;  1STZ A;  4K0W A;  3VP2 A;  4JLF A;  5GHX A;  1TS0 A;  4BL2 A;  1Q2P A;  4QWO A;  4GJ4 A;  4KZ3 A;  2JE5 A;  5AVF A;  3A3F A;  3NJA A;  4B4X A;  3CI6 A;  1VQQ A;  4GW9 A;  1VET A;  1C3B A;  4XT2 A;  3OPP A;  5CEB A;  4LV3 A;  3BW6 A;  5HL1 A;  4E3M A;  2E8I A;  3FZC A;  4ARZ B;  3HJK A;  2Y91 A;  2PR5 A;  1O7E A;  1EWZ A;  3DTM A;  3IWQ A;  3IH8 A;  2RCX A;  4ZAM A;  2ZJ9 A;  3EGD C;  1QME A;  1IKG A;  1H8M A;  2XSS A;  4CLC C;  3V3R A;  2G7U A;  1G28 A;  1V9Y A;  1MC0 A;  3LR0 A;  4S2N A;  1HZO A;  3G30 A;  3ZFZ A;  2H5S A;  4MCW A;  3VV4 A;  2V20 A;  4KZ6 A;  3FKW A;  2C6W B;  5HWT A;  5KIZ A;  2VGL M;  3ZDJ A;  4IVK A;  3T4K A;  5M1A A;  4DXC A;  2HP6 A;  4DJ2 A;  3MZF A;  4MN7 A;  1T18 A;  4P6Z S;  4DDY A;  3LGO A;  2PBD P;  1JWV A;  4GD8 A;  5A92 A;  4PAU A;  1LL5 A;  5I94 A;  1RCJ A;  1VET B;  4LV1 A;  4LPZ A;  2Z6C A;  1XXM A;  1S4S A;  3O88 A;  4C3Q A;  2Y2L A;  3G2Z A;  3NUL A;  2FFF B;  1L0F A;  2M7U A;  2QZ6 A;  4JGR A;  4LV0 A;  3IF5 A;  4KQO A;  4R3J A;  2Z2M B;  3BQA A;  3CUE A;  3P98 A;  3IBJ A;  3CJM A;  3VP4 A;  2JN7 A;  4F3L A;  4LCM A;  1PFL A;  1D06 A;  2XK1 A;  4Y5F A;  4N1H A;  1GHI A;  1K54 A;  2DNS A;  4KQQ A;  3C4P A;  3MS6 A;  3DBA A;  2D01 A;  4R23 A;  1YMX A;  3A0R A;  3LIA A;  3MFD A;  2JKR I;  4GS9 B;  4OLG A;  4UA6 A;  3BEB A;  4EWF A;  2HP5 A;  3NDE A;  3QP8 A;  3KSG A;  4O8G A;  5F69 A;  3T50 A;  4WL9 A;  1W5D A;  1TDL A;  1MWT A;  3EQV A;  4DMZ A;  2J3W A;  3RTY A;  5HAR A;  3BFF A;  1D7E A;  4DE2 A;  3HLW A;  5EVI B;  4HNB A;  2HP9 A;  2VEA A;  1S1Z A;  1FCM A;  3JYI A;  1T1C A;  4R4R A;  3N8R A;  4B4Z A;  3IH9 A;  4Y15 A;  4RX3 A;  5HDC A;  2J7V A;  1FQG A;  5EPH A;  3MF0 A;  2V1B A;  2MJ6 A;  3IWI A;  3IWO A;  2NUT C;  4IED A;  3P01 A;  5KMW A;  4M4X A;  2H28 A;  3Q1F A;  5L09 A;  1ALQ A;  2VJW A;  2LB9 A;  5HPI A;  4LGW A;  4Q0J A;  3V50 A;  3ZVT A;  1MWU A;  3UME A;  3O86 A;  3PAG A;  3NEC A;  1DJC A;  1PW8 A;  3MBZ A;  4EBP A;  3G32 A;  2EFX A;  5CGW A;  4I38 A;  1K56 A;  1TF1 A;  1K57 C;  2INW A;  2WAE A;  2OAQ 1;  4C75 A;  4LFU A;  1S4R A;  5J3W A;  2H0T A;  1KGE A;  1GSV A;  3WS5 A;  5FEF A;  2W3G A;  4GD6 A;  1K0K A;  3T1S A;  2OOL A;  4I39 A;  2X01 A;  4BLM A;  1CF0 A;  3E2K A;  4DKI A;  3HUN A;  4L9E A;  3OPL A;  3OCL A;  2Y2J A;  4FTX A;  1ZHH B;  4B88 A;  1MWR A;  1MWS A;  2ZQC A;  4ZJ1 A;  1ES3 A;  3MXR A;  4H8R A;  3LFV A;  2JKR M;  4BD1 A;  5U47 A;  3G6O A;  1NYY A;  5CHU A;  4IUH A;  3R4K A;  2O0Y A;  1S6R A;  2HF6 A;  2XA7 S;  1BSG A;  4I5S A;  4OVD A;  4UAA A;  3GDI A;  2WAD A;  3S7N A;  5EOO A;  1GHM A;  3P7N A;  3WS4 A;  4MMN A;  1GCE A;  3ZG8 B;  2Q9M A;  1M6K A;  1JTG A;  4X68 A;  2AVX A;  1FOF A;  4QPR A;  2Y79 A;  1Y4O A;  1W8Y A;  5EUA A;  2K7S A;  3VOL A;  1N9B A;  5IU1 A;  3H7W B;  3UB9 A;  5AQB A;  3S1Y A;  1ODV A;  5G4Y A;  2B95 A;  3W4O A;  3DWK A;  1NZU A;  4R38 A;  3EGX C;  1RGZ A;  1XGJ A;  4NXB A;  1W63 M;  1H5X A;  1GSX A;  1HD8 A;  4YNR A;  1XJ2 A;  4BQM A;  4Q8I A;  5F68 A;  1XX2 A;  5FAQ A;  5GHY A;  5FL3 A;  4JXG A;  4KG5 A;  2ZC3 B;  3LID A;  3B3X A;  1L0D A;  5EEC A;  5DJT A;  4N1X A;  4QY5 A;  5IT5 A;  1CK3 A;  1XFN A;  3HBR A;  2HPB A;  3TG9 A;  2Z6D A;  1TVF A;  2JKT M;  1KE4 A;  2YKF A;  4HJ4 A;  2KDK A;  3ICY A;  2Y2O A;  1XPB A;  4LRZ E;  5LBR A;  5FQJ A;  2ZC7 A;  5HW3 A;  3TE8 A;  1OJG A;  5FAT A;  1KVL A;  3HCY A;  4EV4 A;  4WF0 A;  5CED A;  3QP6 A;  4P0M A;  1ERM A;  1DRM A;  2O99 A;  3BM6 A;  3Q7V B;  4DJ3 A;  2EA9 A;  5J4E A;  2HDS A;  3T1X A;  3KO6 A;  3F1O A;  1H8Z A;  3CWF A;  3AGF A;  2OWJ A;  4CLC D;  4C6Y A;  4GOG A;  4BMW A;  2Y4A A;  4R1G A;  2IWD A;  3SS4 A;  3NOU C;  4WEK A;  2VGJ A;  2GZA A;  3WWX A;  2I9V A;  4WEJ A;  1D1J A;  3NBL A;  1Y28 A;  4WMC A;  2WKI A;  4ZJ2 A;  2P9V B;  1DY6 A;  2ZMF A;  3ZG7 B;  2WKH A;  4PHT A;  4NKP A;  2HJ9 C;  3BLS A;  5CER A;  2Y59 A;  3PHY A;  5CTM A;  3IS2 A;  3U4L P;  2JHE A;  2CMN A;  4H6J B;  3ZVW A;  4A5R A;  3UNW A;  5FQQ A;  2GJ3 A;  3S7P A;  1NZO A;  2M1C A;  1YPR A;  1NRJ A;  4LRX C;  1TS8 A;  2ZM0 A;  4E3L A;  3TSG A;  4K0X A;  1NLY A;  1MBL A;  1JWP A;  5KSC A;  4ARZ A;  5TGF A;  1L3L A;  5FQI A;  4IBX A;  2Q0O A;  2BG1 A;  4PKY G;  5GLD A;  4Y0O A;  1N4O A;  3S22 A;  2KX6 A;  3LIB A;  3PXP A;  3FYZ A;  3I7J A;  4XT2 B;  1AWI A;  2D02 A;  3NDG A;  5EVI D;  5DFX A;  4S2N C;  3SS5 A;  4YOF A;  1XA7 A;  2EWW A;  3PBO A;  4YWZ A;  3MR0 A;  4F94 A;  2ZLY A;  4LCL A;  4P6Z M;  3T1R A;  4N92 A;  4S2O A;  4RA7 A;  3UDF A;  1EI5 A;  1H8Y A;  4EUV A;  1UWP X;  4DN0 A;  5GLC A;  2PYR A;  4BBV A;  1XKZ A;  4GNU A;  3W8K A;  1OPX A;  3QP4 A;  4H6J A;  1MZU A;  4L0L A;  5HD3 A;  3W2Z A;  2I72 A;  2VK3 A;  4CLC B;  1ERQ A;  4ZDX A;  2ZC4 B;  4D2O A;  4N9L A;  2ZD8 A;  3IF6 A;  4U0X A;  4ETX A;  2W3H A;  1T1B A;  4JBF A;  2XRN A;  3OPR A;  1TS6 A;  4KZ7 A;  4HJ3 A;  4KQD A;  3MZE A;  3MFX A;  2WZZ A;  4DE3 A;  3QNB A;  1YLJ A;  5E43 A;  1JWZ A;  1M40 A;  3IHA A;  2H10 A;  2PBY A;  3G4P A;  4Y2F A;  1CI9 A;  5DF9 A;  5FEG A;  1A0K A;  2Y2I A;  4S2M A;  1RGY A;  1J3W A;  4LRY C;  3C5A A;  4GDB A;  3UB5 P;  2O9B A;  4KZ4 A;  3F1P A;  2ZM2 A;  3ZNT A;  4K08 A;  3HLF A;  1Z09 A;  1YT4 A;  5HPF A;  2EWV A;  4HQA A;  4EEU A;  2GX5 A;  4JXV A;  5EM1 A;  5M18 A;  2O9C A;  4JGO A;  2R9W A;  4QJG A;  3C38 A;  5J7E A;  3H7W A;  2ZQD A;  2ZQ9 A;  1H0M A;  2G2W A;  1P0Z A;  4PKY A;  3UO9 A;  4D60 A;  1VM1 A;  2V1A A;  2IWC A;  2V2F F;  4XUX A;  4Z1W A;  3TRC A;  3VMA A;  5HWW A;  1KE3 A;  1GSW A;  5G18 A;  3D4F A;  1MXO A;  3ZHH A;  4JXS A;  4PM9 A;  1G5U A;  4M3K A;  1YLY A;  5A90 A;  2ZQA A;  4FUW A;  1O07 A;  4GKU A;  3F1O B;  1NLZ A;  3A3D A;  4IUK A;  1K55 A;  3O3V A;  3QNC A;  5AQA A;  3Q07 A;  5F82 A;  3UPO A;  2PYP A;  5KZH A;  4PPR A;  2B18 A;  1YM1 A;  1FR1 A;  2L4R A;  3ITB A;  1MKM A;  2HZ5 A;  3O87 A;  5EM0 A;  4DE1 A;  3CPT A;  4S2P A;  1PWG A;  4HI4 A;  5CTN A;  3IXH A;  4E04 A;  3B42 A;  4R0Q A;  1IYP A;  4FOF A;  5C5K A;  5EE8 A;  1VEU A;  1OTE A;  2X71 A;  3QP5 A;  3UB6 A;  4HY8 A;  1BUE A;  3A0V A;  4WM9 A;  1IEL A;  3HLC A;  2ZMV A;  3UPN A;  5IHV A;  4OOL A;  2X02 A;  1W79 A;  3K3C A;  2JKG A;  3IX4 A;  1KDS A;  1BLH A;  1K6S A;  3VOY A;  4EER A;  2ZBB A;  3UB8 A;  3LCE A;  3SH9 A;  3T1Q B;  4IJG A;  1E3U A;  4WMC D;  2M7V A;  2HDU A;  3SH7 A;  4OON A;  1ACF A;  4YFM A;  1KE0 A;  4BEN A;  4PM8 A;  5HZH A;  4P87 A;  5GLB A;  4U0T A;  5TBM B;  3HJI A;  2Y2K A;  4R4S A;  4BD0 A;  3BYD A;  4OPZ A;  3LR5 A;  2IWB A;  2UV0 E;  1SKO A;  3MJQ A;  4LLO B;  2L0W A;  2WZX A;  3UPP A;  3AGE A;  3QHY A;  5A91 A;  1YLZ A;  4BBT A;  3T4S A;  1N9L A;  3WRZ A;  4MLL A;  4QY6 A;  4WLA A;  2VLG A;  2ZMA A;  5L10 A;  2VZW A;  2Y55 A;  3KYZ A;  2OSU A;  3WS2 A;  4G3V A;  3NCK A;  3MSH A;  2PT7 A;  1G6A A;  1LL9 A;  4ESP A;  3TOI A;  2PD7 A;  3T12 B;  2P7J A;  4JF6 A;  4WBG A;  3PBQ A;  1F2K A;  2JKF A;  2ZC6 B;  3CMZ A;  5FQK A;  4UA9 A;  4GB7 A;  1XJ6 A;  3A0S A;  1V9Z A;  4Y3I A;  4E3I A;  1F98 A;  3CLO A;  5FDS A;  2XA7 M;  1QMF A;  1S0W A;  2IA2 A;  3ZGA B;  3NY4 A;  1XJ4 A;  3JVU A;  2FFY A;  3LO7 A;  5HWV A;  2L1M A;  1LSV A;  4EBL A;  3RXW A;  2ZQ7 A;  2WGI A;  4BL3 A;  1F9I A;  5GHZ A;  2HV1 A;  1U60 A;  1J9M A;  3E2L A;  4BJP A;  3CG5 A;  3KYQ A;  2ZQ8 A;  3BLM A;  4EEP A;  3G35 A;  3P09 A;  4XXR A;  2FH5 A;  4JKT A;  2KLI A;  3V3S A;  3V67 A;  5L8M A;  1KGG A;  4X6T A;  5K5B A;  1L2S A;  5F1F A;  5HFO A;  1IOU A;  1NRF A;  1K38 A;  1PRQ A;  3DAV A;  3PBS A;  3VOZ A;  4B93 A;  1P9W A;  2ZL1 A;  1PI4 A;  4L9G A;  3H82 A;  4WZ5 A;  5E2H A;  4S2L A;  5DF7 A;  1IEM A;  3W4P A;  1W7F A;  1FR6 A;  4FCF A;  1CI8 A;  3OLO A;  2A3U A;  1YSQ A;  2QJ7 A;  1LHY A;  4X53 A;  1YLP A;  4P85 A;  4QD4 A;  5FI7 A;  4HOI A;  2W27 A;  5AQ7 A;  3HLG A;  2HGV A;  3S7O A;  1OT9 A;  4PM7 A;  5L07 A;  4UQI M;  4DXB A;  5J8X A;  3QP2 A;  1WYB A;  3NOT C;  1MKI A;  1XA1 A;  3M2J A;  4JXW A;  3KSI A;  5EOE A;  1S1Y A;  5TBM A;  4E6W A;  4FH4 A;  3SOI A;  2XLN A;  4OQ0 A;  2CC1 A;  3R7W B;  3LI9 A;  3ISG A;  3PR6 A;  1L0E A;  4FH2 A;  2ZC5 B;  4HHD A;  1SDE A;  4EU0 A;  3GEC A; 
#chains in the Genus database with same CATH homology
 4EES A;  3O5Y A;  3UB7 A;  4I3I A;  4Y5F A;  4NXF A;  2PDR A;  2Y8H A;  3DBA A;  2D01 A;  1DP8 A;  3A0R A;  3LIA A;  4MDZ A;  1YKD A;  1X0O A;  4B9O A;  2JKR I;  2VA0 A;  4GS9 B;  4ETX A;  1OTD A;  4HH2 A;  2W3H A;  1T1B A;  2O9A A;  2W3F A;  2XRN A;  5HDD A;  1P97 A;  1TS6 A;  4R70 A;  4HJ3 A;  4KQD A;  3KSG A;  4O8G A;  5DJU A;  5F69 A;  4WL9 A;  3T50 A;  3MFX A;  4HP4 A;  3EQV A;  4DMZ A;  1OTA A;  2J3W A;  1UGU A;  3E0Y A;  3E4O A;  5AVE A;  3FPV A;  3B33 A;  3RTY A;  1D7E A;  3EEA A;  3T4O A;  2VKS A;  4EW7 A;  4HP9 A;  1VHM A;  3KX0 X;  4HNB A;  4Y2F A;  2VEA A;  1S1Z A;  4HIA A;  5DF9 A;  4EXO A;  1T1C A;  1VB6 A;  1F5M A;  4OOM A;  4LRY C;  5HDC A;  2DMW A;  4L9F A;  1YAX A;  4F3L B;  3CUE C;  2W3D A;  3MF0 A;  1DP6 A;  2O9B A;  3ULF A;  2V1B A;  2MJ6 A;  4AFI A;  2W1T B;  4MN5 A;  3F1P A;  4CQH A;  2NUT C;  2W3E A;  3P01 A;  3IBR A;  4M4X A;  4K08 A;  2H28 A;  3MQO A;  3U2A A;  5HPF A;  2EWV A;  4HQA A;  4EEU A;  1OTI A;  2GX5 A;  4IHQ A;  2O9C A;  3LR3 A;  1IFQ A;  1OJ5 A;  4JGO A;  2VJW A;  5I5L A;  2LB9 A;  3UE6 A;  5HPI A;  3C38 A;  4Q0J A;  2B02 A;  5J7E A;  3H7W A;  3KSH A;  3BJN A;  3UME A;  1OTB A;  2V0U A;  1W63 Q;  3F1P B;  1P0Z A;  4PKY A;  2V1A A;  1LT0 A;  4JGP A;  4HJ6 A;  4I38 A;  3T4J A;  4Z1W A;  3PYP A;  3TW8 A;  4NXE A;  3RFB A;  3TRC A;  1TF1 A;  2INW A;  5DKL A;  4I3J A;  2OAQ 1;  5HWW A;  1GSW A;  1S4R A;  3K3D A;  2ZOH A;  2QJ5 A;  3FC7 A;  5J3W A;  4R6L A;  3NHQ A;  1WA9 A;  1GSV A;  5IS1 A;  1LSW A;  3BQ8 A;  2QKP A;  2W3G A;  3LIF A;  2PR6 A;  3H82 B;  2YKH A;  3F1O B;  1NLZ A;  3D3O A;  3T4L A;  2OOL A;  4I39 A;  4IUK A;  1N9O A;  2QYB A;  4L9E A;  2PYP A;  5HDS A;  1LL8 A;  4UEY A;  2B18 A;  3OCL A;  3PBN A;  5HL6 A;  2L4R A;  1ZHH B;  1ZTU A;  1XFQ A;  2W0N A;  4II7 A;  4GS9 A;  3KSF A;  1MKM A;  3S7Q A;  3LFV A;  1JNU A;  3LR4 A;  2JKR M;  3BY9 A;  3G6O A;  3LYX A;  2PD8 A;  1EW0 A;  4IUH A;  3R4K A;  2O0Y A;  4ETZ A;  3EWK A;  2HF6 A;  2XA7 S;  2PHY A;  4HI4 A;  4E04 A;  4I5S A;  3B42 A;  2V9A A;  4O0P A;  2VV7 A;  3GDI A;  4FOF A;  5DFY A;  3S7N A;  3P7N A;  5C5K A;  1OTE A;  4MMN A;  3C8C A;  4GCZ A;  3UB6 A;  4CLC E;  4EET B;  2JKT I;  4HY8 A;  3EQU A;  3VE4 A;  3MQQ A;  3FG8 A;  3OC2 A;  3A0V A;  4QPR A;  2A24 B;  2V0W A;  2ZMV A;  2WKP A;  2Y79 A;  1NWZ A;  1T1A A;  2GNX A;  3TJZ C;  3PBR A;  4JGQ A;  2BAS A;  2ZOI A;  4OOL A;  2K7S A;  3VOL A;  1S67 L;  5KSH A;  2FZ0 A;  2HJE A;  5CX7 A;  3H9W A;  5IU1 A;  1YSP A;  3H7W B;  3K3C A;  3UB9 A;  4I3A A;  4NXG A;  5EFW A;  1LSX A;  1OT6 A;  2VV6 A;  1ODV A;  4Q0I A;  4WEL A;  2WKR A;  2P04 A;  5G4Y A;  3C2W A;  2QWS A;  5A8B A;  4EER A;  2ZBB A;  3EOI A;  3UB8 A;  3F1N A;  4R38 A;  3OBF A;  3EGX C;  3MQ0 A;  4IJG A;  2VX8 A;  3CIT A;  4NXB A;  2M7V A;  1W63 M;  3BWL A;  3E4P A;  4EQ1 A;  1GSX A;  3ZQ5 A;  3FPW A;  3LIC A;  2XRO A;  4YNR A;  1T19 A;  1XJ2 A;  5HZH A;  5F68 A;  4O01 A;  5TBM B;  4UQI S;  3D72 A;  2W1R A;  3HJI A;  3NOP C;  3PBT A;  3LR5 A;  3BY8 A;  5FL3 A;  3OOV A;  2VV8 A;  3B47 A;  3MJQ A;  2R78 A;  4LLO B;  4RQ9 A;  2L0W A;  3LID A;  4BBU A;  2A2L A;  2VGL S;  3LUQ A;  5DJT A;  4BBT A;  4Q0H A;  3ZYT A;  5IT5 A;  3T4S A;  1N9L A;  1XFN A;  1UWN X;  2Z6D A;  5F6A A;  1N9N A;  2JKT M;  5HD5 A;  4WLA A;  2VLG A;  1KOU A;  2YKF A;  2P08 A;  3C30 A;  2LB5 A;  4WUJ A;  3E4Q A;  5G4Z A;  4HJ4 A;  1DP9 A;  4GLQ A;  2NUP C;  2KDK A;  3ICY A;  4LRZ E;  5LBR A;  2J3T C;  2VZW A;  3T4T A;  3KYZ A;  2OAP 1;  3TE8 A;  1OJG A;  3UMD A;  1TD5 A;  4G3V A;  3JVV A;  3HCY A;  2PT7 A;  4WF0 A;  3CAX A;  3EEH A;  1DRM A;  4CLC A;  2O99 A;  4KUO A;  2PD7 A;  2W1T A;  5HSQ A;  4DJ3 A;  2P7J A;  4GHI A;  3PBQ A;  2EA9 A;  4BWI A;  5J4E A;  5F5Y A;  2K31 A;  3KO6 A;  4FSF A;  3F1O A;  3E98 A;  4MN6 A;  3LIE A;  3MMH A;  3F1N B;  3CWF A;  3LI8 A;  1XJ6 A;  3A0S A;  1V9Z A;  4Y3I A;  1STZ A;  2OWJ A;  4CLC D;  1F98 A;  2K2N A;  3CLO A;  2XA7 M;  1TS0 A;  3T4Q A;  4CLC B;  2IA2 A;  4BMW A;  1XJ4 A;  4GJ4 A;  3JVU A;  5AVF A;  5HWV A;  2L1M A;  3NJA A;  1BYW A;  1LSV A;  3CI6 A;  3NOU C;  3RH8 B;  4GW9 A;  4WEK A;  4XT2 A;  2GZA A;  2I9V A;  4WEJ A;  1TS7 A;  2J3T D;  1Y28 A;  4G3K A;  1F9I A;  2HV1 A;  3BW6 A;  4BJP A;  4NEE D;  2A24 A;  3KYQ A;  2ZMF A;  4PHT A;  4NKP A;  4EEP A;  4ARZ B;  3HJK A;  2FH5 A;  2PR5 A;  2HJ9 C;  2KLI A;  3V67 A;  5L8M A;  2WKQ A;  5K5B A;  5TJJ A;  3PHY A;  4ZRR A;  3EGD C;  3IS2 A;  1H8M A;  2XSS A;  2JHE A;  4CLC C;  1IOU A;  2CMN A;  2G7U A;  3SW1 A;  1G28 A;  4WN5 A;  3PBS A;  1G6O A;  3OCN A;  1P9W A;  4H6J B;  1V9Y A;  4B93 A;  1MC0 A;  3LR0 A;  2KOI A;  1XJ3 A;  4L9G A;  4KUK A;  4MCW A;  1S66 L;  3VV4 A;  2GJ3 A;  3IS2 B;  3R7W A;  3H82 A;  5MC7 A;  3S7P A;  5HWT A;  5AJG A;  3K2N A;  5KIZ A;  2M1C A;  2VGL M;  1NRJ A;  4LRX C;  2OWH A;  1TS8 A;  4ME4 A;  3T4K A;  1NLY A;  4ARZ A;  4DJ2 A;  4MN7 A;  3OLO A;  3VE3 A;  1T18 A;  1YSQ A;  2J80 A;  2QJ7 A;  4G3W A;  4R3A A;  4P6Z S;  4HOI A;  4PKY G;  2W27 A;  2HGV A;  2KX6 A;  1OT9 A;  3S7O A;  3LIB A;  3PXP A;  4PAU A;  1H3Q A;  4XT2 B;  4UQI M;  2D02 A;  4LPZ A;  5DFX A;  3NOT C;  2Z6C A;  4YOF A;  1P9R A;  2EWW A;  1S4S A;  3PBO A;  4YWZ A;  3MR0 A;  3UE3 A;  3KSI A;  4P6Z M;  5DKK A;  2M7U A;  4JGR A;  1S1Y A;  2QHK A;  5TBM A;  4HH3 A;  4KQO A;  4EUV A;  3R7W B;  3LI9 A;  1UWP X;  4DN0 A;  3MXQ A;  3BQA A;  2PYR A;  4BBV A;  3CUE A;  3PR6 A;  3IBJ A;  1OPX A;  2JN7 A;  4H6J A;  4HHD A;  4F3L A;  1MZU A;  4L0L A;  4EU0 A;  5HD3 A;  3W2Z A;  4GHI B;  1D06 A;  3GEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...