4WL9A

Time resolved serial femtosecond crystallography captures high resolution intermediates of pyp
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
molecule tags Signaling protein
source organism Halorhodospira halophila
publication title Time-resolved serial crystallography captures high-resolution intermediates of photoactive yellow protein.
pubmed doi rcsb
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4wl9A00
4WL9A 3FG8A 3K3CA 1G28A 3IS2B 4NXEA 4PKYG 4PKYA 2Z6CA 3H7WB 4WLAA 4BBVA 4HJ3A 3T50A 2D01A 4RQ9A 1V9YA 3LUQA 2PDRA 3CAXA 1T1BA 3EWKA 3G6OA 3F1PB 1XFNA 4R6LA 4F3LA 5HWWA 1T18A 5F5YA 5HDDA 2PYRA 3MFXA 1TS8A 3C8CA 5G4ZA 1UWPX 3MQOA 3SW1A 1GSXA 1OTIA 1TS0A 4KQDA 4MN5A 1P0ZA 5HD5A 4HOIA 2EA9A 4GS9A 5HDSA 3VOLA 5F69A 4EXOA 4WF0A 2I9VA 2W0NA 2ZOIA 5KIZA 2V1BA 3EEHA 4I3JA 2ZBBA 4JGPA 5HD3A 1OT6A 3E4QA 3F1NA 4HP9A 3RTYA 3GECA 2WKRA 3A0VA 3UB6A 3ULFA 5J7EA 1LSVA 1TS7A 2PD8A 2QHKA 3F1OA 2VV8A 2KX6A 3ZQ5A 3NOUC 3LIEA 3LIBA 3NOTC 2JHEA 2PR5A 4HNBA 4I3IA 1ODVA 2YKHA 3BWLA 4R3AA 3UE6A 1DP8A 2R78A 2GJ3A 2PYPA 5DJTA 2OOLA 3D72A 2CMNA 2L0WA 3RH8B 2A24A 3F1NB 2PHYA 3UMEA 3VE4A 5F6AA 2PR6A 3NHQA 4B9OA 3CWFA 1GSVA 1LT0A 3H82A 4R38A 1MZUA 1JNUA 4XT2A 1LL8A 5F68A 5HWVA 5EFWA 4M4XA 3A0RA 4JGOA 4HJ6A 1S66L 1VB6A 2M1CA 4GW9A 4H6JB 2ZOHA 3UB7A 1LSXA 5AVEA 2INWA 1D06A 1F9IA 1S4RA 1XJ2A 1Y28A 2WKPA 3OLOA 4EERA 2QJ5A 1TS6A 4HH2A 1OTDA 1X0OA 4LRZE 4DJ3A 3LIAA 4EQ1A 5TBMB 4NXFA 3MJQA 3LYXA 4LRXC 5IS1A 4GS9B 2K7SA 5HDCA 1OJGA 3LIFA 5HWTA 4HY8A 2QKPA 1UWNX 2VV6A 4KUKA 4L9EA 4LRYC 3H82B 5I5LA 1OT9A 2H28A 5G4YA 4EEUA 3BY9A 4BBUA 4EEPA 5DKLA 2QJ7A 1D7EA 1XJ4A 3MQQA 3NJAA 3NOPC 4GCZA 1WA9A 3E4OA 4HHDA 1NWZA 5J4EA 1S67L 5TBMA 3HJKA 2OWJA 3MR0A 3A0SA 4R70A 2P7JA 2WKQA 1LSWA 2VEAA 2V0WA 2YKFA 3PHYA 1V9ZA 4NXBA 4E04A 4EESA 1N9LA 3C2WA 2JN7A 4YWZA 4NXGA 2V9AA 4HI4A 1DP9A 2L1MA 4H6JA 2J80A 3PYPA 2KDKA 2VLGA 1BYWA 1S1YA 2D02A 1T1CA 4GHIB 5HSQA 3LI9A 2B02A 3H9WA 2HV1A 1GSWA 4XT2B 4BBTA 3B33A 3BY8A 3MXQA 4I5SA 1DRMA 4HIAA 4DJ2A 1OTAA 5IU1A 5J3WA 4LPZA 1XFQA 2PD7A 2Z6DA 3LI8A 3HJIA 4K08A 3VE3A 4HJ4A 2L4RA 4HQAA 3UB8A 2BASA 1UGUA 3CLOA 3UMDA 3F1PA 4EW7A 1OTBA 4HH3A 4I38A 3E4PA 1KOUA 2W27A 3LICA 3ICYA 4LLOB 5A8BA 3IS2A 2V1AA 3P7NA 1OJ5A 4WUJA 3H7WA 2OWHA 4MN6A 3UB9A 3F1OB 1N9NA 4I39A 1T1AA 1OTEA 3FC7A 4I3AA 3LIDA 3IBRA 5AVFA 1N9OA 1EW0A 1XJ6A 2QWSA 2VV7A 3GDIA 4JGRA 4WN5A 5DJUA 3K3DA 4L9GA 2V0UA 4GHIA 1F98A 4HP4A 1S4SA 4KUOA 3KX0X 4L9FA 1XJ3A 1S1ZA 4EETB 1P97A 1DP6A 4JGQA 4F3LB 5DKKA 1T19A 5HZHA 2A24B
chains in the Genus database with same CATH superfamily
3FV7A 3ZGAB 2Z2LB 3N8SA 2JC7A 2Y2QA 4RQ9A 1K6RA 4CQHA 4MDZA 4C3QA 1ZG4A 4F3LA 4DE2A 4GDBA 2WKHA 1PI5A 5F69A 4NKPA 3NULA 4WELA 1ES2A 3T1SA 4HP9A 3FWLA 5E43A 2VGJA 5HFOA 2C6WB 2YKHA 3O5YA 3UE6A 1YMXA 4UA9A 2ZC7A 5CEBA 4KZ9A 4E3MA 3H82A 5DTSA 4DDYA 1IYSA 3ITAA 4EBLA 5AVEA 1Y28A 4CPKA 4O01A 4WBGA 2XR0A 1H8YA 3OPPA 3HVFA 3VP0A 1FCNA 2FFFB 1SCWA 3MQQA 4GCZA 1I5QA 3OBFA 3HLEA 1YPRA 3AGDA 4P85A 2PT7A 4PM6A 4HI4A 4MMNA 4QB8A 1PYYA 2HV1A 3BY8A 1DRMA 4N1XA 3VSKA 1XP4A 1YM1A 2XK1A 2L4RA 3MZFA 4ETZA 2V1AA 1E3UD 5A92A 2DNSA 1XJ6A 4EBPA 1P97A 3RXXA 1I2SA 2DMWA 3Q81A 4ARZB 1WYCA 3SS3A 3VP2A 3LUQA 2J9PA 2V2FF 1YLYA 3OZHA 3IXGA 1S0WA 4QY6A 5EM1A 2R9WA 4X56A 1BUEA 2E8IA 1ZTUA 2DRWA 2ZMAA 3ZQ5A 4ME4A 3BWLA 1HZOA 1XA1A 5TJJA 3TE8A 1PZOA 3P09A 2PR6A 3NHQA 2O9CA 2P74A 1JNUA 1G6AA 3A0RA 3UB7A 4GW9A 1XGIA 2HDQA 1NRFA 4R1GA 1BLCA 3ZG7B 2EFXA 4S2NC 3D3OA 1YLPA 3CZDA 3NECA 4RX2A 3SH9A 2ZC4B 3LR3A 3IF6A 3A3IA 4ZJ3A 4O0PA 1BTLA 5TBMA 4Y7PA 2WADA 4C6YA 1YLWA 2IWCA 2WGWA 1AWIA 1AXBA 3E2KA 4DJ2A 5F1GA 3ZG0A 4EW7A 3FYZA 1YLZA 2EX6A 2W27A 3K2NA 5EOEA 1SZVA 3A3FA 4HESA 4B88A 4DN0A 4N9LA 1K0KA 4KUOA 1M40A 5L09A 2G2UA 3MXSA 1L0FA 4WL9A 2VX8A 3FKWA 4BMWA 4HJ3A 1PWDA 4QJGA 5CTMA 4PHTA 1GCEA 1ZKJA 3G6OA 2E8JA 4O7DA 1GSXA 3A3DA 5EVID 4G3KA 2QPNA 1ZC2A 3RTYA 2VV8A 2XROA 4Y0UA 2MJ6A 4HNBA 2PR5A 2Y2JA 4UA6A 4EQ1A 4PM9A 3N8LA 5BOHA 4GDNA 1LT0A 1LL8A 3IF6C 2B18A 4L0LA 2ACGA 4DE0A 2O9BA 1X0OA 5GL9A 3MJQA 1ONHA 4JPMA 2H5SA 3GSGA 3TOIA 2W3EA 1K38A 3NJAA 3CJMA 3HCYA 1ERQA 4Q0IA 2V1ZA 1K55C 4EESA 3KYEA 4KG6A 4NXGA 4S2IA 2J8YA 3PBQA 3HL9A 4JXGA 4IUHA 1OTAA 3EGXC 4KZBA 4C75A 4JF4A 3C4OA 3S4XA 5FDSA 3E4PA 1ES5A 3LICA 1JWPA 3IS2A 1NXYA 2H0YA 3P7NA 2WAEA 5KSHA 3QP6A 5FI2A 1KVMA 1CI9A 2ZM8A 2XD1A 2WUQA 4JF5A 4B4ZA 4R3JA 1W5DA 2Z6CA 3GTCA 5FDHA 2ZC6B 1KVLA 3CPTA 1TDLA 3UPPA 4KZ7A 4U3TA 3RJUA 1IKGA 3LY3A 3LO7A 3BQAA 4EWFA 1DJBA 2OLVA 3C5AA 1HTZA 4I3JA 3OPHA 1IYPA 2PD8A 3F1OA 2HP6A 4I3IA 3WS2A 2GJ3A 2OOLA 4UA7A 2CMNA 2Y79A 4O8GA 3UPNA 5HWVA 5CGWA 4JGOA 3PAEA 1TVFA 2INWA 2PAVP 2IWDA 3NDEA 1H8ZA 3A3EA 3WS1A 4A5RA 1K55A 4Y2FA 1MWSA 3DTEA 3H82B 4LV0A 4EEUA 1PWGA 4OPYA 4EEPA 1K56D 2Y55A 1WA9A 2W1TA 4OQIA 2WKQA 2VEAA 2YKFA 4OKPA 2Z2MB 1WE4A 4XUXA 3WRTA 2L1MA 4H6JA 2KDKA 1K4FA 4GHIB 2XQZA 4LV2A 2J3TD 3OOVA 3EOIA 3T4KA 4IBRA 1KE4A 3Q07A 5F82A 3BECA 5DF8A 4WUJA 5FAOA 4KZ6A 4LFUA 4IJGA 3MMHA 1W63Q 3BRMA 1DY6A 5CERA 4GHIA 3S7OA 1XJ3A 1NLYA 1W7FA 3KYZA 2XSSA 4CLCA 2J3WA 4OH0A 1SKFA 3WWXA 1T1BA 1W8YA 3NIAA 4UQIS 4KZ3A 3WS0A 5FI6A 4RYEA 3BFGA 4MLLA 2XRNA 3LCEA 1KE0A 2M7UA 1LSVA 4UEYA 5TGFA 3LIEA 2R78A 1CI8A 2BG1A 5FAPA 5CGXA 4P6ZM 3HBRA 3KSHA 3D9YA 1MWTA 4EERA 3UB5P 5FQJA 4WMCA 5HWTA 1UWNX 2JKRI 4Y0OA 2H28A 3SS5A 3CI6A 4ID4A 4KG5A 5DKLA 4E3LA 5M19A 3QP8A 5FA7A 1NWZA 3UPOA 3MR0A 2JBFA 4NXBA 4NK3A 4MN7A 4DE1A 1DP9A 1P9RA 2J7VA 3H9WA 5DFXA 3MXQA 5HW3A 1L2SA 3LI8A 2XGNA 1DJAA 2P9VB 1L0EA 2WGVA 4Q0HA 5A8BA 2VA0A 5FSRA 5CEDA 3E98A 3F1OB 3FC7A 3W2ZA 4IEDA 3VSLA 4WEJA 4F94A 1EW0A 5L10A 4E3IA 4L9FA 4F3LB 5DKKA 3V50A 5HZHA 4XUZA 4MBFA 3FG8A 4X68A 4NXEA 3C7UA 1H3QA 4R6LA 3PAGA 1IKIA 3BFDA 1GHMA 4MN5A 4HOIA 1SDEA 2HJEA 2W0NA 2ZOIA 3QP4A 3RXWA 3VP3A 2KLIA 3ZCZA 3UB6A 5FQQA 1TS7A 2WYXA 3LIBA 1MZUA 3PBSA 4HJ6A 2M1CA 3MKEA 1W8QA 1F9IA 4X53A 1W63M 5GLBA 3BJNA 2XFSA 4BWIA 1IOUA 4KZ8A 4L9EA 3ZG8B 5HPIA 4YNRA 2OSUA 3NOPC 4CJNA 3Q7VA 3Q82A 2EWVA 2OWJA 3IXBA 3E0YA 4R3BA 4LENA 1GHPA 2P08A 2D02A 1MWRA 2RCXA 4E6WA 3MZEA 4K0XA 1NLZA 4K08A 4JF6A 4JKTA 3CLOA 3G30A 1QMFA 1RCJA 2P04A 4OVDA 4N1HA 1VM1A 1IYOA 3H7WA 4R0QA 5HAIA 4I39A 3IBJA 3HLDA 3IXHA 3LIDA 1N9OA 1VETB 3S1YA 1L0DA 2VKSA 1ERMA 1S1ZA 2M7VA 2G7UA 5EECA 5HARA 5CXWA 1K25A 3IXDA 2XH9A 2D01A 2VGLS 1LLBA 2PDRA 2UWXA 3F1PB 2HGVA 5E2HA 2PYRA 5M1AA 5GHXA 4P6ZS 3VFFA 1TS8A 3S7QA 3U4LP 4EUZA 4P87A 3LEZA 5EVEA 1MKIA 3QNCA 3CG5A 5F6AA 4NG2A 3BLMA 4XT2A 4FUWA 5EFWA 4H6JB 2WK0A 3MQ0A 5EM0A 4YINA 3N4IA 3NY4A 1JTDA 3VP4A 4WZ5A 1H8MA 4LRZE 1U60A 5LBRA 4BL2A 5IS1A 2K7SA 4KUKA 2G2WA 2Y2OA 2A2LA 2HP5A 1YSPA 4Z9QA 5I94A 1L0GA 2Y2KA 1S67L 4R70A 3M6HA 3MXRA 4E04A 2JN7A 2V9AA 1PI4A 1Z6FA 3FPWA 4EQIA 1MKMA 4RA7A 4CLCD 4GD6A 5J3WA 1K57A 3CUEC 2ZD8A 4Y15A 5EPHA 4S2OA 5DVAA 2WAFA 2V8CA 5L07A 3C4PA 5AVFA 4S2NA 4WN5A 3K3DA 5GLAA 1F98A 3MS6A 3JVUA 4JGQA 2A24B 1G28A 5EVIB 4Y13A 1FQGA 3MBZA 3TJZC 4E3OA 1YKDA 4X55A 2A49A 1RGYA 3ZVWA 4Z1WA 2PRFA 3T4TA 2X71A 3SW1A 1KDWA 1N9BA 1BT5A 5CHMA 1J3WA 3S7NA 4X1LA 5E2GA 4Y0TA 4UQIM 5HAPA 3NOTC 3QP5A 5GHZA 2XFTA 2L0WA 3UMEA 2PHYA 5IHVA 3PBNA 3UY6A 2Q9MA 4HBTA 1Y54A 4ZJ1A 4OONA 1K6SA 3RFBA 1VHMA 2J9OA 3QP2A 2EWWA 1M6KA 3HLFA 2I72A 2ZQDA 4OQ0A 1XJ4A 4GKUA 3HJKA 4KENB 4LCLA 2JE5A 3G35A 1YLTA 4GJ4A 3TRCA 4GB7A 3HUMA 1GA9A 1CF0A 2B02A 2Y4AA 5E2FA 3MSHA 4OP5A 1PRQA 3V3RA 2VGLM 3T1RA 4R23A 2Q0OA 3B42A 4LLOB 5F83A 1OMEA 4QHCA 2DCFA 3R7WA 2XD5A 5G18A 2C5WB 3L9KA 1T1AA 3QNBA 5A93A 2EX2A 4R4RA 3GDIA 2V8FA 5IT5A 5GLCA 2BTFP 1BLSA 1DP6A 1CEFA 1JWVA 3F1NA 5KSCA 3ZNYA 1XX2A 4FCFA 5HWWA 3C38A 2CC1A 2BLSA 4CLCE 1OTIA 5HD5A 1HVBA 3PR6A 4EU0A 1BSGA 4WF0A 1W79A 1OT6A 2WKRA 3ULFA 1EWZA 2Y8HA 2KX6A 5HL1A 3SS4A 5AJGA 3VE4A 1PW8A 4U0XA 4B9OA 3EQVA 4GD8A 4DRTA 4G3VA 1D06A 4QPRA 4RX3A 3ZG9B 2ZC3B 3BM6A 5DTTA 5TBMB 3G2YA 4PPRA 4DXCA 1TD5A 2EX9A 4WMCD 3UNWA 1O07A 3SH8A 5EVLA 4NETA 2P7JA 3IX3A 4X25A 3VMAA 3HLCA 4B4XA 2VLGA 4LV3A 1KE3A 4DMZA 3BFFA 3LY4A 1ESIA 3DW0A 4B93A 2Z6DA 4DXBA 3KSFA 3F1PA 3PBRA 1OTBA 5AQAA 3T12B 2JKFA 4IHQA 4S2JA 3OPRA 3ISGA 4MN6A 3VV4A 4OP8A 1OTEA 3NCKA 4I3AA 1PW1A 5AQ9A 4FSFA 5FQ9A 5GHYA 4EUVA 4JGRA 1WYBA 4HP4A 1NZOA 4PM8A 1YQSA 2WGWB 1IYQA 3VFHA 3T4OA 4LGWA 3H7WB 1E25A 5L8MA 2LB5A 3EWKA 2K31A 3ZYTA 1E4DA 2IA2A 5FATA 3C8CA 1UWPX 2V1BA 5FL3A 4AFIA 3E4QA 4FH2A 3GECA 2QHKA 1TDGA 2JHEA 1ODVA 2XF3A 1DP8A 1CQAA 2PYPA 3D72A 3RH8B 4KG2A 3F1NB 2JCHA 2ZLYA 4ZRRA 1FILA 3N7WA 1K54C 1LSXA 3OLOA 1JVJA 4E3KA 1PFLA 4KQOA 1KGGA 4CLCC 3TSGA 1Q2PA 4HY8A 2Y91A 1MPLA 4BBUA 2OLUA 2O9AA 4HHDA 4BQMA 1TF1A 5M18A 2PU4A 4JBFA 3FPVA 4GNUA 1N9LA 4EV4A 2UV0E 2ZM0A 3C30A 5HX9A 4E3JA 3KSGA 5CRFA 1YLJA 2Y59A 3NBLA 2GNXA 3ITBA 1XFQA 1MWUA 1BLPA 2BASA 2W1RA 3M2KA 3TW8A 4HH3A 4I38A 1XKZA 3IX8A 1NY0A 3GMWA 1OJ5A 3UB9A 2ZQAA 2PU2A 4P0MA 3DTIA 4WM9A 2ZQCA 5DJUA 2V20A 4U0TA 3GR2A 5EVIC 4WEKA 2W3GA 5KMWA 2AVXA 3AGFA 3LFVA 5CHUA 1XPBA 2KOIA 4BD0A 1FCOA 4LCMA 2HP9A 4X69A 2EA9A 1F2KA 5HD3A 2ZBBA 4RVAA 2OAQ1 1K54A 1MY8A 2IWBA 2W1TB 3U2AA 2NUPC 3D4FA 2A24A 2A3UA 1GSVA 1S4RA 2WKPA 1EROA 4FTXA 5DF7A 4JXSA 5A91A 3I7JA 4GLQA 2PBYA 1KGEA 1PZPA 4JXVA 5D3OA 4LRYC 2QYBA 1BULA 1CJFA 3OCLA 4MBHA 3B47A 4DKIA 5AQBA 2Y2PA 3E4OA 2VGKA 2W3HA 1J9MA 2V0WA 3C2WA 2VK3A 2QMIA 1EI5A 4MBKA 4I5SA 5E2EA 3V39A 1YT4A 3VE3A 3UB8A 3UMDA 1FOFA 1JWZA 3SZTA 5DTKA 2QZ6A 2O99A 4II7A 1C3BA 1N9NA 1IELA 4L9GA 1S4SA 1JTGA 4WZ4A 3LEQA 3K3CA 3UN7A 1XFNA 1CEGA 2O0YA 2Y2MA 3VOLA 3V67A 2GZAA 4KZ4A 1SDNA 2H0TA 3EQUA 5J7EA 3SOIA 3MFDA 2Y2GA 2HDSA 1ACFA 3EEAA 1OPXA 3MKFA 3T1QB 4WYYA 3IWOA 3HUOA 2WZZA 3N6IA 3PBTA 1LL5A 1IEMA 3N8RA 1TS6A 4IBXA 2XEPA 3KYQA 3IQAA 2ZQ8A 4DJ3A 1FIKA 3LYXA 3PTEA 3IF5A 2OAP1 4GS9B 4OQHA 1XA7A 1ZG6A 1QMEA 5G4YA 1OT9A 2WKEA 3NI9A 5FQKA 3ZNTA 4EBNA 2QJ7A 5J4EA 4ZAMA 1RP5A 4YWZA 2Y2LA 5CGSA 1T1CA 1YMSA 3T4SA 2Y2IA 3JPUA 3UE1A 4BD1A 5U47A 4KZ5A 4DE3A 4LPZA 3SH7A 1N4OA 4FH4A 4UAAA 4ZBEA 1KOUA 3B3XA 2X02A 2GX5A 4MEZA 3IWQA 2ZM2A 3UDXA 4D60A 4H8RA 2X01A 3M2JA 3GRJA 4KZAA 1VEUA 3BFEA 4NEED 4GZBA 1GA0A 1F5MA 3A3JA 3IH8A 4N9KA 2H10A 4BBVA 3M6BA 3T50A 4IUKA 2P9VA 2HDRA 2XDMA 2EXBA 2ZL1A 5JYPA 3G2ZA 5C5KA 2VZWA 4GS9A 1VEUB 4OQGA 3EEHA 2RL3A 4OLGA 4DF6A 4ARZA 4GN2A 2Y2NA 5K5BA 2Q9NA 3CITA 2HZ5A 1LL9A 3PXPA 5JYOA 1ES3A 4M4XA 4R3AA 4KQRA 3G31A 4M3KA 3LIAA 5FI7A 1K56A 2B5RA 3T4LA 2XA7M 5HDCA 2VV6A 3DWKA 3OPLA 4R4SA 3BY9A 1LI9A 3AGEA 5F1FA 3R7WB 3A0SA 1LSWA 2HJ9C 5HPFA 3FKVA 3FZCA 3Q7ZA 3W8KA 1D1JA 3T4JA 1BYWA 1S1YA 3BLSA 2PBDP 4YFMA 4PM5A 3HUNA 3QHYA 4QU3A 1UGUA 3BW6A 1E3UA 5J8XA 2ZMVA 4ESPA 3LR0A 3HLGA 4S2LA 4X1MA 2QWSA 5FASA 3V3SA 4Y17A 3LGOA 3CHWP 4IVIA 5EOOA 3KX0X 5CHJA 3R4KA 3P01A 1YAXA 4PKYA 4BL3A 3UE0A 1TEMA 2WKIA 1MC0A 3GV9A 3CAXA 4OLDA 4QY5A 1FR6A 4G3WA 3ZG5A 4FOFA 1T18A 2JKTI 5G4ZA 4KQDA 5FQIA 1P0ZA 3VOZA 1H0MA 5EE8A 3Q1FA 4X6TA 2WGIA 5KIZA 3IHBA 4KQQA 3W4QA 5KZHA 3V5MA 2JKRM 5DF9A 4GOGA 3MF0A 3ZDJA 3ZVTA 3MZDA 5DJTA 4CLCB 1PWCA 3IHAA 3KSIA 4OOYA 3WS4A 2B95A 2ZOHA 1DJCA 3IT9A 1S6RA 1PIOA 2XA7S 2EFUA 3O3VA 4HBUA 1BLHA 4LRXC 1OJGA 2JKGA 1ESUA 4OPZA 1XGJA 1VETA 3O86A 3O87A 2HDUA 4BENA 4QWOA 3OCNA 4D2OA 3UE3A 1NYYA 3DTKA 2W3FA 3PYPA 4LV1A 4OOMA 5TR7A 1GSWA 4HEFA 1STZA 5FEFA 4JLFA 3JVVA 1H5XA 4JXWA 3IBRA 2ZQ9A 2VV7A 2ZL1B 3S7PA 1RGZA 1FCMA 4EETB 4S2PA 3IS2B 4WLAA 2EX8A 1G5UA 2FZ0A 5HAQA 5GLDA 4BLMA 3W4PA 1V9YA 1NRJA 1P9WA 3GQZA 4OPRA 1GHIA 4MCWA 4ZDXA 5F5YA 5HDDA 3MFXA 2GDNA 1ONGA 3O88A 3HREA 1FSWA 2I9VA 1XXMA 4JGPA 2OV5A 5A90A 4MNRA 3UDIA 4Q0JA 3A0VA 1HLUP 3DWZA 4OOLA 3NOUC 4S2MA 3W4OA 3Q7VB 4ZTKA 1A0KA 2FFYA 2W3DA 3G34A 3CPTB 1I2WA 2J3TC 1S66L 4YOFA 3IH9A 3TG9A 2QJ5A 3NDGA 3VP1A 1OTDA 2EXAA 1G68A 3BFCA 2HPBA 3KO6A 3G32A 4NXFA 3DBAA 4Y3IA 3LIFA 1Q2QA 1NJ4A 4UHUA 4Y5FA 2ZC5B 3HLWA 5FEGA 3L7HA 3IX4A 4WZ5C 2VJWA 3G4PA 1HD8A 2JKTM 2WZXA 4E3NA 3PHYA 4N92A 1NZUA 3CMZA 3UO9A 1CK3A 1K57C 3CUEA 4PMAA 2ZQ7A 1K4EA 2FH5A 1LI0A 3LR4A 4XT2B 3UDFA 1SKOB 3B33A 1IFQA 4HIAA 2HF6A 3ZFZA 5CECA 3HJIA 4HJ4A 3OC2A 4ZJ2A 3QP1A 3PBOA 1MXOA 3HLBA 3WS5A 4K91A 1NYMA 3ICYA 4OPQA 3WRZA 3BYDA 1VQQA 2OWHA 1L3LA 3DAVA 1SKOA 2K2NA 5CTNA 4Q8IA 4PM7A 4PKYG 3NC8A 4DDSA 1ES4A 1MBLA 2LB9A 5CX7A 3MQOA 4ETXA 1TS0A 4EXOA 5HDSA 3T4QA 1FSYA 1LHYA 4XXRA 3VOYA 2XLNA 1BZAA 3CWFA 4R38A 5DFYA 2NUTC 3JYIA 1KGFA 3P98A 5F68A 1VB6A 5EVIA 1FR1A 1XJ2A 5L2FA 1Z09A 4HH2A 4K0WA 3LR5A 1YSQA 5MC7A 1ZHHB 3DTMA 2QKPA 3BQ8A 1ALQA 5I5LA 4PAUA 3EGDC 1D7EA 4QD4A 4E6XA 5FAQA 3IWIA 4P6BA 1V9ZA 2ZMFA 4IVKA 5FQMA 2J80A 3E2LA 2ZJ9A 2R9XA 5HSQA 4S2KA 5AQ7A 3LI9A 4BJPA 1G6OA 4BBTA 3T1XA 3GVBA 5IU1A 2PD7A 3S22A 3IF6B 4FD8A 4HQAA 5TFQA 1KDSA 1O7EA 3C7VA 3BEBA 5HL6A 2Y2HA 2V0UA 5EUAA 5EV0A 1SHVA 3ZHHA 1PNEA 1Y4OA 1T19A
chains in the Genus database with same CATH topology
1F5MA 3KYZA 2XSSA 4CLCA 2J3WA 4BBVA 3T50A 4IUKA 4RQ9A 1T1BA 4CQHA 4MDZA 4F3LA 5HWWA 3C38A 4CLCE 1OTIA 5HD5A 4UQIS 5C5KA 2VZWA 4GS9A 3PR6A 4EU0A 5F69A 4NKPA 4WF0A 4WELA 3EEHA 4ARZA 1OT6A 4HP9A 2XRNA 2WKRA 3ULFA 2M7UA 1LSVA 5K5BA 2Y8HA 2KX6A 4UEYA 3LIEA 3O5YA 2YKHA 3UE6A 3CITA 2R78A 5AJGA 3VE4A 3PXPA 4B9OA 3H82A 3EQVA 4P6ZM 3KSHA 4M4XA 4R3AA 5AVEA 4G3VA 1D06A 1Y28A 4QPRA 4EERA 4O01A 3LIAA 5TBMB 3T4LA 2XA7M 5HDCA 5HWTA 1TD5A 1UWNX 2JKRI 2VV6A 2H28A 3BY9A 3CI6A 5DKLA 3MQQA 4GCZA 1NWZA 3R7WB 3OBFA 3MR0A 3A0SA 2P7JA 1LSWA 2HJ9C 5HPFA 4NXBA 4MN7A 2PT7A 4HI4A 1DP9A 1P9RA 4MMNA 3T4JA 2VLGA 1BYWA 1S1YA 3H9WA 4DMZA 2HV1A 5DFXA 3BY8A 3MXQA 1DRMA 4B93A 3LI8A 2Z6DA 2L4RA 1UGUA 3KSFA 3BW6A 3F1PA 3PBRA 1OTBA 4Q0HA 4ETZA 4IHQA 5A8BA 2V1AA 2VA0A 2ZMVA 4MN6A 3VV4A 3E98A 3F1OB 3LR0A 3FC7A 1OTEA 4I3AA 3W2ZA 4EUVA 4FSFA 4WEJA 1EW0A 1XJ6A 2QWSA 4JGRA 4HP4A 3KX0X 4L9FA 3R4KA 1P97A 3P01A 4F3LB 5DKKA 5HZHA 1YAXA 2DMWA 3FG8A 4NXEA 4PKYA 3T4OA 3H7WB 4ARZB 5L8MA 2LB5A 1MC0A 3LUQA 3CAXA 3EWKA 2K31A 1H3QA 4G3WA 4R6LA 2IA2A 4FOFA 3ZYTA 1T18A 2JKTI 3C8CA 5G4ZA 1UWPX 4MN5A 4KQDA 1P0ZA 4HOIA 2HJEA 2W0NA 2ZOIA 5KIZA 2V1BA 5FL3A 2KLIA 4AFIA 3E4QA 1ZTUA 2JKRM 3GECA 3UB6A 5DF9A 1TS7A 2QHKA 3MF0A 3ZQ5A 4ME4A 3LIBA 2JHEA 1ODVA 3BWLA 1DP8A 5DJTA 4CLCB 2PYPA 5TJJA 3TE8A 3D72A 3RH8B 3F1NB 2PR6A 3KSIA 3NHQA 2O9CA 1MZUA 1JNUA 4ZRRA 3PBSA 3A0RA 4HJ6A 3UB7A 2M1CA 4GW9A 2ZOHA 1LSXA 1F9IA 3OLOA 1W63M 2XA7S 4KQOA 3BJNA 3D3OA 4CLCC 4LRXC 4BWIA 1IOUA 1OJGA 4HY8A 4L9EA 3LR3A 5HPIA 4BBUA 4YNRA 4O0PA 2O9AA 3NOPC 4HHDA 2EWVA 1TF1A 5TBMA 2OWJA 3OCNA 3FPVA 3UE3A 1N9LA 2W3FA 3E0YA 3PYPA 4OOMA 3C30A 2P08A 2D02A 3KSGA 1GSWA 4DJ2A 1NLZA 2GNXA 1XFQA 1STZA 4K08A 2BASA 3CLOA 2W1RA 4EW7A 3TW8A 4HH3A 3JVVA 4I38A 2W27A 3K2NA 2P04A 1OJ5A 3UB9A 3H7WA 4I39A 3IBJA 3LIDA 3IBRA 1N9OA 2VV7A 5DJUA 4DN0A 3S7PA 4KUOA 2VKSA 1S1ZA 4EETB 4WEKA 2M7VA 2G7UA 2W3GA 4WL9A 3IS2B 2VX8A 3LFVA 4BMWA 4WLAA 4HJ3A 2FZ0A 4PHTA 2D01A 2VGLS 1V9YA 2PDRA 1NRJA 1P9WA 3G6OA 2KOIA 3F1PB 4MCWA 2HGVA 5F5YA 5HDDA 2PYRA 3MFXA 4P6ZS 1TS8A 1GSXA 2EA9A 4G3KA 3S7QA 2I9VA 4JGPA 2ZBBA 5HD3A 3RTYA 2OAQ1 4Q0JA 3A0VA 2VV8A 2W1TB 2XROA 3U2AA 4OOLA 3NOUC 2NUPC 2MJ6A 4HNBA 2PR5A 4EQ1A 2A24A 5F6AA 1GSVA 1LT0A 2W3DA 4XT2A 1LL8A 2B18A 5EFWA 2J3TC 1S66L 4H6JB 3MQ0A 4L0LA 4YOFA 1S4RA 2WKPA 2QJ5A 1OTDA 1H8MA 2O9BA 4GLQA 1X0OA 3KO6A 4LRZE 4NXFA 3MJQA 5LBRA 5IS1A 2K7SA 3DBAA 4Y3IA 3LIFA 4KUKA 4LRYC 2QYBA 2W3EA 4Y5FA 2A2LA 3OCLA 3B47A 1YSPA 2VJWA 3NJAA 3HCYA 3E4OA 1S67L 4Q0IA 2JKTM 4R70A 2W3HA 2V0WA 3PHYA 4E04A 4EESA 3C2WA 2JN7A 4NXGA 2V9AA 3CUEA 3PBQA 3FPWA 2FH5A 3LR4A 4XT2B 3B33A 4I5SA 1MKMA 1IFQA 4IUHA 4HIAA 1OTAA 2HF6A 4CLCD 5J3WA 3CUEC 3EGXC 3VE3A 3HJIA 4HJ4A 3UB8A 3OC2A 3UMDA 3PBOA 3E4PA 3LICA 3ICYA 2O99A 3IS2A 3P7NA 4II7A 2OWHA 1N9NA 5AVFA 5KSHA 4WN5A 3K3DA 4L9GA 1F98A 1S4SA 2K2NA 4JGQA 3JVUA 2A24B 3K3CA 1G28A 4PKYG 2Z6CA 3TJZC 1YKDA 2LB9A 1XFNA 5CX7A 2O0YA 4Z1WA 3T4TA 3MQOA 4ETXA 1TS0A 3SW1A 4EXOA 3VOLA 5HDSA 3T4QA 3V67A 3BQAA 2GZAA 4I3JA 3S7NA 3EQUA 5J7EA 2PD8A 4UQIM 3F1OA 3EEAA 3NOTC 4I3IA 1OPXA 2GJ3A 2OOLA 2CMNA 2L0WA 2Y79A 3UMEA 2PHYA 3PBNA 4O8GA 3CWFA 4R38A 5DFYA 2NUTC 5F68A 5HWVA 4JGOA 3PBTA 1VB6A 2INWA 1XJ2A 3RFBA 1TS6A 1VHMA 4HH2A 3KYQA 4DJ3A 4Y2FA 3LR5A 1YSQA 2EWWA 3LYXA 2OAP1 4GS9B 1ZHHB 5MC7A 2QKPA 3BQ8A 3H82B 4PAUA 1OT9A 5G4YA 3EGDC 5I5LA 4EEUA 4EEPA 2QJ7A 1D7EA 1XJ4A 5J4EA 1WA9A 2W1TA 3HJKA 2WKQA 2VEAA 2YKFA 1V9ZA 4YWZA 2ZMFA 2L1MA 4H6JA 2J80A 4GJ4A 2KDKA 3TRCA 1T1CA 4GHIB 3T4SA 5HSQA 3LI9A 2B02A 4BJPA 1G6OA 2J3TD 3OOVA 4BBTA 3EOIA 3T4KA 5IU1A 4LPZA 2PD7A 2VGLM 4HQAA 3B42A 1KOUA 4LLOB 5HL6A 2GX5A 4WUJA 3R7WA 4IJGA 1T1AA 1W63Q 3MMHA 3GDIA 5IT5A 2V0UA 4GHIA 3S7OA 1XJ3A 4NEED 1DP6A 1T19A 1NLYA 3F1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WL9 A;  3FG8 A;  3K3C A;  1G28 A;  3IS2 B;  4NXE A;  4PKY G;  4PKY A;  2Z6C A;  3H7W B;  4WLA A;  4BBV A;  4HJ3 A;  3T50 A;  2D01 A;  4RQ9 A;  1V9Y A;  3LUQ A;  2PDR A;  3CAX A;  1T1B A;  3EWK A;  3G6O A;  3F1P B;  1XFN A;  4R6L A;  4F3L A;  5HWW A;  1T18 A;  5F5Y A;  5HDD A;  2PYR A;  3MFX A;  1TS8 A;  3C8C A;  5G4Z A;  1UWP X;  3MQO A;  3SW1 A;  1GSX A;  1OTI A;  1TS0 A;  4KQD A;  4MN5 A;  1P0Z A;  5HD5 A;  4HOI A;  2EA9 A;  4GS9 A;  5HDS A;  3VOL A;  5F69 A;  4EXO A;  4WF0 A;  2I9V A;  2W0N A;  2ZOI A;  5KIZ A;  2V1B A;  3EEH A;  4I3J A;  2ZBB A;  4JGP A;  5HD3 A;  1OT6 A;  3E4Q A;  3F1N A;  4HP9 A;  3RTY A;  3GEC A;  2WKR A;  3A0V A;  3UB6 A;  3ULF A;  5J7E A;  1LSV A;  1TS7 A;  2PD8 A;  2QHK A;  3F1O A;  2VV8 A;  2KX6 A;  3ZQ5 A;  3NOU C;  3LIE A;  3LIB A;  3NOT C;  2JHE A;  2PR5 A;  4HNB A;  4I3I A;  1ODV A;  2YKH A;  3BWL A;  4R3A A;  3UE6 A;  1DP8 A;  2R78 A;  2GJ3 A;  2PYP A;  5DJT A;  2OOL A;  3D72 A;  2CMN A;  2L0W A;  3RH8 B;  2A24 A;  3F1N B;  2PHY A;  3UME A;  3VE4 A;  5F6A A;  2PR6 A;  3NHQ A;  4B9O A;  3CWF A;  1GSV A;  1LT0 A;  3H82 A;  4R38 A;  1MZU A;  1JNU A;  4XT2 A;  1LL8 A;  5F68 A;  5HWV A;  5EFW A;  4M4X A;  3A0R A;  4JGO A;  4HJ6 A;  1S66 L;  1VB6 A;  2M1C A;  4GW9 A;  4H6J B;  2ZOH A;  3UB7 A;  1LSX A;  5AVE A;  2INW A;  1D06 A;  1F9I A;  1S4R A;  1XJ2 A;  1Y28 A;  2WKP A;  3OLO A;  4EER A;  2QJ5 A;  1TS6 A;  4HH2 A;  1OTD A;  1X0O A;  4LRZ E;  4DJ3 A;  3LIA A;  4EQ1 A;  5TBM B;  4NXF A;  3MJQ A;  3LYX A;  4LRX C;  5IS1 A;  4GS9 B;  2K7S A;  5HDC A;  1OJG A;  3LIF A;  5HWT A;  4HY8 A;  2QKP A;  1UWN X;  2VV6 A;  4KUK A;  4L9E A;  4LRY C;  3H82 B;  5I5L A;  1OT9 A;  2H28 A;  5G4Y A;  4EEU A;  3BY9 A;  4BBU A;  4EEP A;  5DKL A;  2QJ7 A;  1D7E A;  1XJ4 A;  3MQQ A;  3NJA A;  3NOP C;  4GCZ A;  1WA9 A;  3E4O A;  4HHD A;  1NWZ A;  5J4E A;  1S67 L;  5TBM A;  3HJK A;  2OWJ A;  3MR0 A;  3A0S A;  4R70 A;  2P7J A;  2WKQ A;  1LSW A;  2VEA A;  2V0W A;  2YKF A;  3PHY A;  1V9Z A;  4NXB A;  4E04 A;  4EES A;  1N9L A;  3C2W A;  2JN7 A;  4YWZ A;  4NXG A;  2V9A A;  4HI4 A;  1DP9 A;  2L1M A;  4H6J A;  2J80 A;  3PYP A;  2KDK A;  2VLG A;  1BYW A;  1S1Y A;  2D02 A;  1T1C A;  4GHI B;  5HSQ A;  3LI9 A;  2B02 A;  3H9W A;  2HV1 A;  1GSW A;  4XT2 B;  4BBT A;  3B33 A;  3BY8 A;  3MXQ A;  4I5S A;  1DRM A;  4HIA A;  4DJ2 A;  1OTA A;  5IU1 A;  5J3W A;  4LPZ A;  1XFQ A;  2PD7 A;  2Z6D A;  3LI8 A;  3HJI A;  4K08 A;  3VE3 A;  4HJ4 A;  2L4R A;  4HQA A;  3UB8 A;  2BAS A;  1UGU A;  3CLO A;  3UMD A;  3F1P A;  4EW7 A;  1OTB A;  4HH3 A;  4I38 A;  3E4P A;  1KOU A;  2W27 A;  3LIC A;  3ICY A;  4LLO B;  5A8B A;  3IS2 A;  2V1A A;  3P7N A;  1OJ5 A;  4WUJ A;  3H7W A;  2OWH A;  4MN6 A;  3UB9 A;  3F1O B;  1N9N A;  4I39 A;  1T1A A;  1OTE A;  3FC7 A;  4I3A A;  3LID A;  3IBR A;  5AVF A;  1N9O A;  1EW0 A;  1XJ6 A;  2QWS A;  2VV7 A;  3GDI A;  4JGR A;  4WN5 A;  5DJU A;  3K3D A;  4L9G A;  2V0U A;  4GHI A;  1F98 A;  4HP4 A;  1S4S A;  4KUO A;  3KX0 X;  4L9F A;  1XJ3 A;  1S1Z A;  4EET B;  1P97 A;  1DP6 A;  4JGQ A;  4F3L B;  5DKK A;  1T19 A;  5HZH A;  2A24 B; 
#chains in the Genus database with same CATH topology
 3FV7 A;  3ZGA B;  2Z2L B;  3N8S A;  2JC7 A;  2Y2Q A;  4RQ9 A;  1K6R A;  4CQH A;  4MDZ A;  4C3Q A;  1ZG4 A;  4F3L A;  4DE2 A;  4GDB A;  2WKH A;  1PI5 A;  5F69 A;  4NKP A;  3NUL A;  4WEL A;  1ES2 A;  3T1S A;  4HP9 A;  3FWL A;  5E43 A;  2VGJ A;  5HFO A;  2C6W B;  2YKH A;  3O5Y A;  3UE6 A;  1YMX A;  4UA9 A;  2ZC7 A;  5CEB A;  4KZ9 A;  4E3M A;  3H82 A;  5DTS A;  4DDY A;  1IYS A;  3ITA A;  4EBL A;  5AVE A;  1Y28 A;  4CPK A;  4O01 A;  4WBG A;  2XR0 A;  1H8Y A;  3OPP A;  3HVF A;  3VP0 A;  1FCN A;  2FFF B;  1SCW A;  3MQQ A;  4GCZ A;  1I5Q A;  3OBF A;  3HLE A;  1YPR A;  3AGD A;  4P85 A;  2PT7 A;  4PM6 A;  4HI4 A;  4MMN A;  4QB8 A;  1PYY A;  2HV1 A;  3BY8 A;  1DRM A;  4N1X A;  3VSK A;  1XP4 A;  1YM1 A;  2XK1 A;  2L4R A;  3MZF A;  4ETZ A;  2V1A A;  1E3U D;  5A92 A;  2DNS A;  1XJ6 A;  4EBP A;  1P97 A;  3RXX A;  1I2S A;  2DMW A;  3Q81 A;  4ARZ B;  1WYC A;  3SS3 A;  3VP2 A;  3LUQ A;  2J9P A;  2V2F F;  1YLY A;  3OZH A;  3IXG A;  1S0W A;  4QY6 A;  5EM1 A;  2R9W A;  4X56 A;  1BUE A;  2E8I A;  1ZTU A;  2DRW A;  2ZMA A;  3ZQ5 A;  4ME4 A;  3BWL A;  1HZO A;  1XA1 A;  5TJJ A;  3TE8 A;  1PZO A;  3P09 A;  2PR6 A;  3NHQ A;  2O9C A;  2P74 A;  1JNU A;  1G6A A;  3A0R A;  3UB7 A;  4GW9 A;  1XGI A;  2HDQ A;  1NRF A;  4R1G A;  1BLC A;  3ZG7 B;  2EFX A;  4S2N C;  3D3O A;  1YLP A;  3CZD A;  3NEC A;  4RX2 A;  3SH9 A;  2ZC4 B;  3LR3 A;  3IF6 A;  3A3I A;  4ZJ3 A;  4O0P A;  1BTL A;  5TBM A;  4Y7P A;  2WAD A;  4C6Y A;  1YLW A;  2IWC A;  2WGW A;  1AWI A;  1AXB A;  3E2K A;  4DJ2 A;  5F1G A;  3ZG0 A;  4EW7 A;  3FYZ A;  1YLZ A;  2EX6 A;  2W27 A;  3K2N A;  5EOE A;  1SZV A;  3A3F A;  4HES A;  4B88 A;  4DN0 A;  4N9L A;  1K0K A;  4KUO A;  1M40 A;  5L09 A;  2G2U A;  3MXS A;  1L0F A;  4WL9 A;  2VX8 A;  3FKW A;  4BMW A;  4HJ3 A;  1PWD A;  4QJG A;  5CTM A;  4PHT A;  1GCE A;  1ZKJ A;  3G6O A;  2E8J A;  4O7D A;  1GSX A;  3A3D A;  5EVI D;  4G3K A;  2QPN A;  1ZC2 A;  3RTY A;  2VV8 A;  2XRO A;  4Y0U A;  2MJ6 A;  4HNB A;  2PR5 A;  2Y2J A;  4UA6 A;  4EQ1 A;  4PM9 A;  3N8L A;  5BOH A;  4GDN A;  1LT0 A;  1LL8 A;  3IF6 C;  2B18 A;  4L0L A;  2ACG A;  4DE0 A;  2O9B A;  1X0O A;  5GL9 A;  3MJQ A;  1ONH A;  4JPM A;  2H5S A;  3GSG A;  3TOI A;  2W3E A;  1K38 A;  3NJA A;  3CJM A;  3HCY A;  1ERQ A;  4Q0I A;  2V1Z A;  1K55 C;  4EES A;  3KYE A;  4KG6 A;  4NXG A;  4S2I A;  2J8Y A;  3PBQ A;  3HL9 A;  4JXG A;  4IUH A;  1OTA A;  3EGX C;  4KZB A;  4C75 A;  4JF4 A;  3C4O A;  3S4X A;  5FDS A;  3E4P A;  1ES5 A;  3LIC A;  1JWP A;  3IS2 A;  1NXY A;  2H0Y A;  3P7N A;  2WAE A;  5KSH A;  3QP6 A;  5FI2 A;  1KVM A;  1CI9 A;  2ZM8 A;  2XD1 A;  2WUQ A;  4JF5 A;  4B4Z A;  4R3J A;  1W5D A;  2Z6C A;  3GTC A;  5FDH A;  2ZC6 B;  1KVL A;  3CPT A;  1TDL A;  3UPP A;  4KZ7 A;  4U3T A;  3RJU A;  1IKG A;  3LY3 A;  3LO7 A;  3BQA A;  4EWF A;  1DJB A;  2OLV A;  3C5A A;  1HTZ A;  4I3J A;  3OPH A;  1IYP A;  2PD8 A;  3F1O A;  2HP6 A;  4I3I A;  3WS2 A;  2GJ3 A;  2OOL A;  4UA7 A;  2CMN A;  2Y79 A;  4O8G A;  3UPN A;  5HWV A;  5CGW A;  4JGO A;  3PAE A;  1TVF A;  2INW A;  2PAV P;  2IWD A;  3NDE A;  1H8Z A;  3A3E A;  3WS1 A;  4A5R A;  1K55 A;  4Y2F A;  1MWS A;  3DTE A;  3H82 B;  4LV0 A;  4EEU A;  1PWG A;  4OPY A;  4EEP A;  1K56 D;  2Y55 A;  1WA9 A;  2W1T A;  4OQI A;  2WKQ A;  2VEA A;  2YKF A;  4OKP A;  2Z2M B;  1WE4 A;  4XUX A;  3WRT A;  2L1M A;  4H6J A;  2KDK A;  1K4F A;  4GHI B;  2XQZ A;  4LV2 A;  2J3T D;  3OOV A;  3EOI A;  3T4K A;  4IBR A;  1KE4 A;  3Q07 A;  5F82 A;  3BEC A;  5DF8 A;  4WUJ A;  5FAO A;  4KZ6 A;  4LFU A;  4IJG A;  3MMH A;  1W63 Q;  3BRM A;  1DY6 A;  5CER A;  4GHI A;  3S7O A;  1XJ3 A;  1NLY A;  1W7F A;  3KYZ A;  2XSS A;  4CLC A;  2J3W A;  4OH0 A;  1SKF A;  3WWX A;  1T1B A;  1W8Y A;  3NIA A;  4UQI S;  4KZ3 A;  3WS0 A;  5FI6 A;  4RYE A;  3BFG A;  4MLL A;  2XRN A;  3LCE A;  1KE0 A;  2M7U A;  1LSV A;  4UEY A;  5TGF A;  3LIE A;  2R78 A;  1CI8 A;  2BG1 A;  5FAP A;  5CGX A;  4P6Z M;  3HBR A;  3KSH A;  3D9Y A;  1MWT A;  4EER A;  3UB5 P;  5FQJ A;  4WMC A;  5HWT A;  1UWN X;  2JKR I;  4Y0O A;  2H28 A;  3SS5 A;  3CI6 A;  4ID4 A;  4KG5 A;  5DKL A;  4E3L A;  5M19 A;  3QP8 A;  5FA7 A;  1NWZ A;  3UPO A;  3MR0 A;  2JBF A;  4NXB A;  4NK3 A;  4MN7 A;  4DE1 A;  1DP9 A;  1P9R A;  2J7V A;  3H9W A;  5DFX A;  3MXQ A;  5HW3 A;  1L2S A;  3LI8 A;  2XGN A;  1DJA A;  2P9V B;  1L0E A;  2WGV A;  4Q0H A;  5A8B A;  2VA0 A;  5FSR A;  5CED A;  3E98 A;  3F1O B;  3FC7 A;  3W2Z A;  4IED A;  3VSL A;  4WEJ A;  4F94 A;  1EW0 A;  5L10 A;  4E3I A;  4L9F A;  4F3L B;  5DKK A;  3V50 A;  5HZH A;  4XUZ A;  4MBF A;  3FG8 A;  4X68 A;  4NXE A;  3C7U A;  1H3Q A;  4R6L A;  3PAG A;  1IKI A;  3BFD A;  1GHM A;  4MN5 A;  4HOI A;  1SDE A;  2HJE A;  2W0N A;  2ZOI A;  3QP4 A;  3RXW A;  3VP3 A;  2KLI A;  3ZCZ A;  3UB6 A;  5FQQ A;  1TS7 A;  2WYX A;  3LIB A;  1MZU A;  3PBS A;  4HJ6 A;  2M1C A;  3MKE A;  1W8Q A;  1F9I A;  4X53 A;  1W63 M;  5GLB A;  3BJN A;  2XFS A;  4BWI A;  1IOU A;  4KZ8 A;  4L9E A;  3ZG8 B;  5HPI A;  4YNR A;  2OSU A;  3NOP C;  4CJN A;  3Q7V A;  3Q82 A;  2EWV A;  2OWJ A;  3IXB A;  3E0Y A;  4R3B A;  4LEN A;  1GHP A;  2P08 A;  2D02 A;  1MWR A;  2RCX A;  4E6W A;  3MZE A;  4K0X A;  1NLZ A;  4K08 A;  4JF6 A;  4JKT A;  3CLO A;  3G30 A;  1QMF A;  1RCJ A;  2P04 A;  4OVD A;  4N1H A;  1VM1 A;  1IYO A;  3H7W A;  4R0Q A;  5HAI A;  4I39 A;  3IBJ A;  3HLD A;  3IXH A;  3LID A;  1N9O A;  1VET B;  3S1Y A;  1L0D A;  2VKS A;  1ERM A;  1S1Z A;  2M7V A;  2G7U A;  5EEC A;  5HAR A;  5CXW A;  1K25 A;  3IXD A;  2XH9 A;  2D01 A;  2VGL S;  1LLB A;  2PDR A;  2UWX A;  3F1P B;  2HGV A;  5E2H A;  2PYR A;  5M1A A;  5GHX A;  4P6Z S;  3VFF A;  1TS8 A;  3S7Q A;  3U4L P;  4EUZ A;  4P87 A;  3LEZ A;  5EVE A;  1MKI A;  3QNC A;  3CG5 A;  5F6A A;  4NG2 A;  3BLM A;  4XT2 A;  4FUW A;  5EFW A;  4H6J B;  2WK0 A;  3MQ0 A;  5EM0 A;  4YIN A;  3N4I A;  3NY4 A;  1JTD A;  3VP4 A;  4WZ5 A;  1H8M A;  4LRZ E;  1U60 A;  5LBR A;  4BL2 A;  5IS1 A;  2K7S A;  4KUK A;  2G2W A;  2Y2O A;  2A2L A;  2HP5 A;  1YSP A;  4Z9Q A;  5I94 A;  1L0G A;  2Y2K A;  1S67 L;  4R70 A;  3M6H A;  3MXR A;  4E04 A;  2JN7 A;  2V9A A;  1PI4 A;  1Z6F A;  3FPW A;  4EQI A;  1MKM A;  4RA7 A;  4CLC D;  4GD6 A;  5J3W A;  1K57 A;  3CUE C;  2ZD8 A;  4Y15 A;  5EPH A;  4S2O A;  5DVA A;  2WAF A;  2V8C A;  5L07 A;  3C4P A;  5AVF A;  4S2N A;  4WN5 A;  3K3D A;  5GLA A;  1F98 A;  3MS6 A;  3JVU A;  4JGQ A;  2A24 B;  1G28 A;  5EVI B;  4Y13 A;  1FQG A;  3MBZ A;  3TJZ C;  4E3O A;  1YKD A;  4X55 A;  2A49 A;  1RGY A;  3ZVW A;  4Z1W A;  2PRF A;  3T4T A;  2X71 A;  3SW1 A;  1KDW A;  1N9B A;  1BT5 A;  5CHM A;  1J3W A;  3S7N A;  4X1L A;  5E2G A;  4Y0T A;  4UQI M;  5HAP A;  3NOT C;  3QP5 A;  5GHZ A;  2XFT A;  2L0W A;  3UME A;  2PHY A;  5IHV A;  3PBN A;  3UY6 A;  2Q9M A;  4HBT A;  1Y54 A;  4ZJ1 A;  4OON A;  1K6S A;  3RFB A;  1VHM A;  2J9O A;  3QP2 A;  2EWW A;  1M6K A;  3HLF A;  2I72 A;  2ZQD A;  4OQ0 A;  1XJ4 A;  4GKU A;  3HJK A;  4KEN B;  4LCL A;  2JE5 A;  3G35 A;  1YLT A;  4GJ4 A;  3TRC A;  4GB7 A;  3HUM A;  1GA9 A;  1CF0 A;  2B02 A;  2Y4A A;  5E2F A;  3MSH A;  4OP5 A;  1PRQ A;  3V3R A;  2VGL M;  3T1R A;  4R23 A;  2Q0O A;  3B42 A;  4LLO B;  5F83 A;  1OME A;  4QHC A;  2DCF A;  3R7W A;  2XD5 A;  5G18 A;  2C5W B;  3L9K A;  1T1A A;  3QNB A;  5A93 A;  2EX2 A;  4R4R A;  3GDI A;  2V8F A;  5IT5 A;  5GLC A;  2BTF P;  1BLS A;  1DP6 A;  1CEF A;  1JWV A;  3F1N A;  5KSC A;  3ZNY A;  1XX2 A;  4FCF A;  5HWW A;  3C38 A;  2CC1 A;  2BLS A;  4CLC E;  1OTI A;  5HD5 A;  1HVB A;  3PR6 A;  4EU0 A;  1BSG A;  4WF0 A;  1W79 A;  1OT6 A;  2WKR A;  3ULF A;  1EWZ A;  2Y8H A;  2KX6 A;  5HL1 A;  3SS4 A;  5AJG A;  3VE4 A;  1PW8 A;  4U0X A;  4B9O A;  3EQV A;  4GD8 A;  4DRT A;  4G3V A;  1D06 A;  4QPR A;  4RX3 A;  3ZG9 B;  2ZC3 B;  3BM6 A;  5DTT A;  5TBM B;  3G2Y A;  4PPR A;  4DXC A;  1TD5 A;  2EX9 A;  4WMC D;  3UNW A;  1O07 A;  3SH8 A;  5EVL A;  4NET A;  2P7J A;  3IX3 A;  4X25 A;  3VMA A;  3HLC A;  4B4X A;  2VLG A;  4LV3 A;  1KE3 A;  4DMZ A;  3BFF A;  3LY4 A;  1ESI A;  3DW0 A;  4B93 A;  2Z6D A;  4DXB A;  3KSF A;  3F1P A;  3PBR A;  1OTB A;  5AQA A;  3T12 B;  2JKF A;  4IHQ A;  4S2J A;  3OPR A;  3ISG A;  4MN6 A;  3VV4 A;  4OP8 A;  1OTE A;  3NCK A;  4I3A A;  1PW1 A;  5AQ9 A;  4FSF A;  5FQ9 A;  5GHY A;  4EUV A;  4JGR A;  1WYB A;  4HP4 A;  1NZO A;  4PM8 A;  1YQS A;  2WGW B;  1IYQ A;  3VFH A;  3T4O A;  4LGW A;  3H7W B;  1E25 A;  5L8M A;  2LB5 A;  3EWK A;  2K31 A;  3ZYT A;  1E4D A;  2IA2 A;  5FAT A;  3C8C A;  1UWP X;  2V1B A;  5FL3 A;  4AFI A;  3E4Q A;  4FH2 A;  3GEC A;  2QHK A;  1TDG A;  2JHE A;  1ODV A;  2XF3 A;  1DP8 A;  1CQA A;  2PYP A;  3D72 A;  3RH8 B;  4KG2 A;  3F1N B;  2JCH A;  2ZLY A;  4ZRR A;  1FIL A;  3N7W A;  1K54 C;  1LSX A;  3OLO A;  1JVJ A;  4E3K A;  1PFL A;  4KQO A;  1KGG A;  4CLC C;  3TSG A;  1Q2P A;  4HY8 A;  2Y91 A;  1MPL A;  4BBU A;  2OLU A;  2O9A A;  4HHD A;  4BQM A;  1TF1 A;  5M18 A;  2PU4 A;  4JBF A;  3FPV A;  4GNU A;  1N9L A;  4EV4 A;  2UV0 E;  2ZM0 A;  3C30 A;  5HX9 A;  4E3J A;  3KSG A;  5CRF A;  1YLJ A;  2Y59 A;  3NBL A;  2GNX A;  3ITB A;  1XFQ A;  1MWU A;  1BLP A;  2BAS A;  2W1R A;  3M2K A;  3TW8 A;  4HH3 A;  4I38 A;  1XKZ A;  3IX8 A;  1NY0 A;  3GMW A;  1OJ5 A;  3UB9 A;  2ZQA A;  2PU2 A;  4P0M A;  3DTI A;  4WM9 A;  2ZQC A;  5DJU A;  2V20 A;  4U0T A;  3GR2 A;  5EVI C;  4WEK A;  2W3G A;  5KMW A;  2AVX A;  3AGF A;  3LFV A;  5CHU A;  1XPB A;  2KOI A;  4BD0 A;  1FCO A;  4LCM A;  2HP9 A;  4X69 A;  2EA9 A;  1F2K A;  5HD3 A;  2ZBB A;  4RVA A;  2OAQ 1;  1K54 A;  1MY8 A;  2IWB A;  2W1T B;  3U2A A;  2NUP C;  3D4F A;  2A24 A;  2A3U A;  1GSV A;  1S4R A;  2WKP A;  1ERO A;  4FTX A;  5DF7 A;  4JXS A;  5A91 A;  3I7J A;  4GLQ A;  2PBY A;  1KGE A;  1PZP A;  4JXV A;  5D3O A;  4LRY C;  2QYB A;  1BUL A;  1CJF A;  3OCL A;  4MBH A;  3B47 A;  4DKI A;  5AQB A;  2Y2P A;  3E4O A;  2VGK A;  2W3H A;  1J9M A;  2V0W A;  3C2W A;  2VK3 A;  2QMI A;  1EI5 A;  4MBK A;  4I5S A;  5E2E A;  3V39 A;  1YT4 A;  3VE3 A;  3UB8 A;  3UMD A;  1FOF A;  1JWZ A;  3SZT A;  5DTK A;  2QZ6 A;  2O99 A;  4II7 A;  1C3B A;  1N9N A;  1IEL A;  4L9G A;  1S4S A;  1JTG A;  4WZ4 A;  3LEQ A;  3K3C A;  3UN7 A;  1XFN A;  1CEG A;  2O0Y A;  2Y2M A;  3VOL A;  3V67 A;  2GZA A;  4KZ4 A;  1SDN A;  2H0T A;  3EQU A;  5J7E A;  3SOI A;  3MFD A;  2Y2G A;  2HDS A;  1ACF A;  3EEA A;  1OPX A;  3MKF A;  3T1Q B;  4WYY A;  3IWO A;  3HUO A;  2WZZ A;  3N6I A;  3PBT A;  1LL5 A;  1IEM A;  3N8R A;  1TS6 A;  4IBX A;  2XEP A;  3KYQ A;  3IQA A;  2ZQ8 A;  4DJ3 A;  1FIK A;  3LYX A;  3PTE A;  3IF5 A;  2OAP 1;  4GS9 B;  4OQH A;  1XA7 A;  1ZG6 A;  1QME A;  5G4Y A;  1OT9 A;  2WKE A;  3NI9 A;  5FQK A;  3ZNT A;  4EBN A;  2QJ7 A;  5J4E A;  4ZAM A;  1RP5 A;  4YWZ A;  2Y2L A;  5CGS A;  1T1C A;  1YMS A;  3T4S A;  2Y2I A;  3JPU A;  3UE1 A;  4BD1 A;  5U47 A;  4KZ5 A;  4DE3 A;  4LPZ A;  3SH7 A;  1N4O A;  4FH4 A;  4UAA A;  4ZBE A;  1KOU A;  3B3X A;  2X02 A;  2GX5 A;  4MEZ A;  3IWQ A;  2ZM2 A;  3UDX A;  4D60 A;  4H8R A;  2X01 A;  3M2J A;  3GRJ A;  4KZA A;  1VEU A;  3BFE A;  4NEE D;  4GZB A;  1GA0 A;  1F5M A;  3A3J A;  3IH8 A;  4N9K A;  2H10 A;  4BBV A;  3M6B A;  3T50 A;  4IUK A;  2P9V A;  2HDR A;  2XDM A;  2EXB A;  2ZL1 A;  5JYP A;  3G2Z A;  5C5K A;  2VZW A;  4GS9 A;  1VEU B;  4OQG A;  3EEH A;  2RL3 A;  4OLG A;  4DF6 A;  4ARZ A;  4GN2 A;  2Y2N A;  5K5B A;  2Q9N A;  3CIT A;  2HZ5 A;  1LL9 A;  3PXP A;  5JYO A;  1ES3 A;  4M4X A;  4R3A A;  4KQR A;  3G31 A;  4M3K A;  3LIA A;  5FI7 A;  1K56 A;  2B5R A;  3T4L A;  2XA7 M;  5HDC A;  2VV6 A;  3DWK A;  3OPL A;  4R4S A;  3BY9 A;  1LI9 A;  3AGE A;  5F1F A;  3R7W B;  3A0S A;  1LSW A;  2HJ9 C;  5HPF A;  3FKV A;  3FZC A;  3Q7Z A;  3W8K A;  1D1J A;  3T4J A;  1BYW A;  1S1Y A;  3BLS A;  2PBD P;  4YFM A;  4PM5 A;  3HUN A;  3QHY A;  4QU3 A;  1UGU A;  3BW6 A;  1E3U A;  5J8X A;  2ZMV A;  4ESP A;  3LR0 A;  3HLG A;  4S2L A;  4X1M A;  2QWS A;  5FAS A;  3V3S A;  4Y17 A;  3LGO A;  3CHW P;  4IVI A;  5EOO A;  3KX0 X;  5CHJ A;  3R4K A;  3P01 A;  1YAX A;  4PKY A;  4BL3 A;  3UE0 A;  1TEM A;  2WKI A;  1MC0 A;  3GV9 A;  3CAX A;  4OLD A;  4QY5 A;  1FR6 A;  4G3W A;  3ZG5 A;  4FOF A;  1T18 A;  2JKT I;  5G4Z A;  4KQD A;  5FQI A;  1P0Z A;  3VOZ A;  1H0M A;  5EE8 A;  3Q1F A;  4X6T A;  2WGI A;  5KIZ A;  3IHB A;  4KQQ A;  3W4Q A;  5KZH A;  3V5M A;  2JKR M;  5DF9 A;  4GOG A;  3MF0 A;  3ZDJ A;  3ZVT A;  3MZD A;  5DJT A;  4CLC B;  1PWC A;  3IHA A;  3KSI A;  4OOY A;  3WS4 A;  2B95 A;  2ZOH A;  1DJC A;  3IT9 A;  1S6R A;  1PIO A;  2XA7 S;  2EFU A;  3O3V A;  4HBU A;  1BLH A;  4LRX C;  1OJG A;  2JKG A;  1ESU A;  4OPZ A;  1XGJ A;  1VET A;  3O86 A;  3O87 A;  2HDU A;  4BEN A;  4QWO A;  3OCN A;  4D2O A;  3UE3 A;  1NYY A;  3DTK A;  2W3F A;  3PYP A;  4LV1 A;  4OOM A;  5TR7 A;  1GSW A;  4HEF A;  1STZ A;  5FEF A;  4JLF A;  3JVV A;  1H5X A;  4JXW A;  3IBR A;  2ZQ9 A;  2VV7 A;  2ZL1 B;  3S7P A;  1RGZ A;  1FCM A;  4EET B;  4S2P A;  3IS2 B;  4WLA A;  2EX8 A;  1G5U A;  2FZ0 A;  5HAQ A;  5GLD A;  4BLM A;  3W4P A;  1V9Y A;  1NRJ A;  1P9W A;  3GQZ A;  4OPR A;  1GHI A;  4MCW A;  4ZDX A;  5F5Y A;  5HDD A;  3MFX A;  2GDN A;  1ONG A;  3O88 A;  3HRE A;  1FSW A;  2I9V A;  1XXM A;  4JGP A;  2OV5 A;  5A90 A;  4MNR A;  3UDI A;  4Q0J A;  3A0V A;  1HLU P;  3DWZ A;  4OOL A;  3NOU C;  4S2M A;  3W4O A;  3Q7V B;  4ZTK A;  1A0K A;  2FFY A;  2W3D A;  3G34 A;  3CPT B;  1I2W A;  2J3T C;  1S66 L;  4YOF A;  3IH9 A;  3TG9 A;  2QJ5 A;  3NDG A;  3VP1 A;  1OTD A;  2EXA A;  1G68 A;  3BFC A;  2HPB A;  3KO6 A;  3G32 A;  4NXF A;  3DBA A;  4Y3I A;  3LIF A;  1Q2Q A;  1NJ4 A;  4UHU A;  4Y5F A;  2ZC5 B;  3HLW A;  5FEG A;  3L7H A;  3IX4 A;  4WZ5 C;  2VJW A;  3G4P A;  1HD8 A;  2JKT M;  2WZX A;  4E3N A;  3PHY A;  4N92 A;  1NZU A;  3CMZ A;  3UO9 A;  1CK3 A;  1K57 C;  3CUE A;  4PMA A;  2ZQ7 A;  1K4E A;  2FH5 A;  1LI0 A;  3LR4 A;  4XT2 B;  3UDF A;  1SKO B;  3B33 A;  1IFQ A;  4HIA A;  2HF6 A;  3ZFZ A;  5CEC A;  3HJI A;  4HJ4 A;  3OC2 A;  4ZJ2 A;  3QP1 A;  3PBO A;  1MXO A;  3HLB A;  3WS5 A;  4K91 A;  1NYM A;  3ICY A;  4OPQ A;  3WRZ A;  3BYD A;  1VQQ A;  2OWH A;  1L3L A;  3DAV A;  1SKO A;  2K2N A;  5CTN A;  4Q8I A;  4PM7 A;  4PKY G;  3NC8 A;  4DDS A;  1ES4 A;  1MBL A;  2LB9 A;  5CX7 A;  3MQO A;  4ETX A;  1TS0 A;  4EXO A;  5HDS A;  3T4Q A;  1FSY A;  1LHY A;  4XXR A;  3VOY A;  2XLN A;  1BZA A;  3CWF A;  4R38 A;  5DFY A;  2NUT C;  3JYI A;  1KGF A;  3P98 A;  5F68 A;  1VB6 A;  5EVI A;  1FR1 A;  1XJ2 A;  5L2F A;  1Z09 A;  4HH2 A;  4K0W A;  3LR5 A;  1YSQ A;  5MC7 A;  1ZHH B;  3DTM A;  2QKP A;  3BQ8 A;  1ALQ A;  5I5L A;  4PAU A;  3EGD C;  1D7E A;  4QD4 A;  4E6X A;  5FAQ A;  3IWI A;  4P6B A;  1V9Z A;  2ZMF A;  4IVK A;  5FQM A;  2J80 A;  3E2L A;  2ZJ9 A;  2R9X A;  5HSQ A;  4S2K A;  5AQ7 A;  3LI9 A;  4BJP A;  1G6O A;  4BBT A;  3T1X A;  3GVB A;  5IU1 A;  2PD7 A;  3S22 A;  3IF6 B;  4FD8 A;  4HQA A;  5TFQ A;  1KDS A;  1O7E A;  3C7V A;  3BEB A;  5HL6 A;  2Y2H A;  2V0U A;  5EUA A;  5EV0 A;  1SHV A;  3ZHH A;  1PNE A;  1Y4O A;  1T19 A; 
#chains in the Genus database with same CATH homology
 1F5M A;  3KYZ A;  2XSS A;  4CLC A;  2J3W A;  4BBV A;  3T50 A;  4IUK A;  4RQ9 A;  1T1B A;  4CQH A;  4MDZ A;  4F3L A;  5HWW A;  3C38 A;  4CLC E;  1OTI A;  5HD5 A;  4UQI S;  5C5K A;  2VZW A;  4GS9 A;  3PR6 A;  4EU0 A;  5F69 A;  4NKP A;  4WF0 A;  4WEL A;  3EEH A;  4ARZ A;  1OT6 A;  4HP9 A;  2XRN A;  2WKR A;  3ULF A;  2M7U A;  1LSV A;  5K5B A;  2Y8H A;  2KX6 A;  4UEY A;  3LIE A;  3O5Y A;  2YKH A;  3UE6 A;  3CIT A;  2R78 A;  5AJG A;  3VE4 A;  3PXP A;  4B9O A;  3H82 A;  3EQV A;  4P6Z M;  3KSH A;  4M4X A;  4R3A A;  5AVE A;  4G3V A;  1D06 A;  1Y28 A;  4QPR A;  4EER A;  4O01 A;  3LIA A;  5TBM B;  3T4L A;  2XA7 M;  5HDC A;  5HWT A;  1TD5 A;  1UWN X;  2JKR I;  2VV6 A;  2H28 A;  3BY9 A;  3CI6 A;  5DKL A;  3MQQ A;  4GCZ A;  1NWZ A;  3R7W B;  3OBF A;  3MR0 A;  3A0S A;  2P7J A;  1LSW A;  2HJ9 C;  5HPF A;  4NXB A;  4MN7 A;  2PT7 A;  4HI4 A;  1DP9 A;  1P9R A;  4MMN A;  3T4J A;  2VLG A;  1BYW A;  1S1Y A;  3H9W A;  4DMZ A;  2HV1 A;  5DFX A;  3BY8 A;  3MXQ A;  1DRM A;  4B93 A;  3LI8 A;  2Z6D A;  2L4R A;  1UGU A;  3KSF A;  3BW6 A;  3F1P A;  3PBR A;  1OTB A;  4Q0H A;  4ETZ A;  4IHQ A;  5A8B A;  2V1A A;  2VA0 A;  2ZMV A;  4MN6 A;  3VV4 A;  3E98 A;  3F1O B;  3LR0 A;  3FC7 A;  1OTE A;  4I3A A;  3W2Z A;  4EUV A;  4FSF A;  4WEJ A;  1EW0 A;  1XJ6 A;  2QWS A;  4JGR A;  4HP4 A;  3KX0 X;  4L9F A;  3R4K A;  1P97 A;  3P01 A;  4F3L B;  5DKK A;  5HZH A;  1YAX A;  2DMW A;  3FG8 A;  4NXE A;  4PKY A;  3T4O A;  3H7W B;  4ARZ B;  5L8M A;  2LB5 A;  1MC0 A;  3LUQ A;  3CAX A;  3EWK A;  2K31 A;  1H3Q A;  4G3W A;  4R6L A;  2IA2 A;  4FOF A;  3ZYT A;  1T18 A;  2JKT I;  3C8C A;  5G4Z A;  1UWP X;  4MN5 A;  4KQD A;  1P0Z A;  4HOI A;  2HJE A;  2W0N A;  2ZOI A;  5KIZ A;  2V1B A;  5FL3 A;  2KLI A;  4AFI A;  3E4Q A;  1ZTU A;  2JKR M;  3GEC A;  3UB6 A;  5DF9 A;  1TS7 A;  2QHK A;  3MF0 A;  3ZQ5 A;  4ME4 A;  3LIB A;  2JHE A;  1ODV A;  3BWL A;  1DP8 A;  5DJT A;  4CLC B;  2PYP A;  5TJJ A;  3TE8 A;  3D72 A;  3RH8 B;  3F1N B;  2PR6 A;  3KSI A;  3NHQ A;  2O9C A;  1MZU A;  1JNU A;  4ZRR A;  3PBS A;  3A0R A;  4HJ6 A;  3UB7 A;  2M1C A;  4GW9 A;  2ZOH A;  1LSX A;  1F9I A;  3OLO A;  1W63 M;  2XA7 S;  4KQO A;  3BJN A;  3D3O A;  4CLC C;  4LRX C;  4BWI A;  1IOU A;  1OJG A;  4HY8 A;  4L9E A;  3LR3 A;  5HPI A;  4BBU A;  4YNR A;  4O0P A;  2O9A A;  3NOP C;  4HHD A;  2EWV A;  1TF1 A;  5TBM A;  2OWJ A;  3OCN A;  3FPV A;  3UE3 A;  1N9L A;  2W3F A;  3E0Y A;  3PYP A;  4OOM A;  3C30 A;  2P08 A;  2D02 A;  3KSG A;  1GSW A;  4DJ2 A;  1NLZ A;  2GNX A;  1XFQ A;  1STZ A;  4K08 A;  2BAS A;  3CLO A;  2W1R A;  4EW7 A;  3TW8 A;  4HH3 A;  3JVV A;  4I38 A;  2W27 A;  3K2N A;  2P04 A;  1OJ5 A;  3UB9 A;  3H7W A;  4I39 A;  3IBJ A;  3LID A;  3IBR A;  1N9O A;  2VV7 A;  5DJU A;  4DN0 A;  3S7P A;  4KUO A;  2VKS A;  1S1Z A;  4EET B;  4WEK A;  2M7V A;  2G7U A;  2W3G A;  4WL9 A;  3IS2 B;  2VX8 A;  3LFV A;  4BMW A;  4WLA A;  4HJ3 A;  2FZ0 A;  4PHT A;  2D01 A;  2VGL S;  1V9Y A;  2PDR A;  1NRJ A;  1P9W A;  3G6O A;  2KOI A;  3F1P B;  4MCW A;  2HGV A;  5F5Y A;  5HDD A;  2PYR A;  3MFX A;  4P6Z S;  1TS8 A;  1GSX A;  2EA9 A;  4G3K A;  3S7Q A;  2I9V A;  4JGP A;  2ZBB A;  5HD3 A;  3RTY A;  2OAQ 1;  4Q0J A;  3A0V A;  2VV8 A;  2W1T B;  2XRO A;  3U2A A;  4OOL A;  3NOU C;  2NUP C;  2MJ6 A;  4HNB A;  2PR5 A;  4EQ1 A;  2A24 A;  5F6A A;  1GSV A;  1LT0 A;  2W3D A;  4XT2 A;  1LL8 A;  2B18 A;  5EFW A;  2J3T C;  1S66 L;  4H6J B;  3MQ0 A;  4L0L A;  4YOF A;  1S4R A;  2WKP A;  2QJ5 A;  1OTD A;  1H8M A;  2O9B A;  4GLQ A;  1X0O A;  3KO6 A;  4LRZ E;  4NXF A;  3MJQ A;  5LBR A;  5IS1 A;  2K7S A;  3DBA A;  4Y3I A;  3LIF A;  4KUK A;  4LRY C;  2QYB A;  2W3E A;  4Y5F A;  2A2L A;  3OCL A;  3B47 A;  1YSP A;  2VJW A;  3NJA A;  3HCY A;  3E4O A;  1S67 L;  4Q0I A;  2JKT M;  4R70 A;  2W3H A;  2V0W A;  3PHY A;  4E04 A;  4EES A;  3C2W A;  2JN7 A;  4NXG A;  2V9A A;  3CUE A;  3PBQ A;  3FPW A;  2FH5 A;  3LR4 A;  4XT2 B;  3B33 A;  4I5S A;  1MKM A;  1IFQ A;  4IUH A;  4HIA A;  1OTA A;  2HF6 A;  4CLC D;  5J3W A;  3CUE C;  3EGX C;  3VE3 A;  3HJI A;  4HJ4 A;  3UB8 A;  3OC2 A;  3UMD A;  3PBO A;  3E4P A;  3LIC A;  3ICY A;  2O99 A;  3IS2 A;  3P7N A;  4II7 A;  2OWH A;  1N9N A;  5AVF A;  5KSH A;  4WN5 A;  3K3D A;  4L9G A;  1F98 A;  1S4S A;  2K2N A;  4JGQ A;  3JVU A;  2A24 B;  3K3C A;  1G28 A;  4PKY G;  2Z6C A;  3TJZ C;  1YKD A;  2LB9 A;  1XFN A;  5CX7 A;  2O0Y A;  4Z1W A;  3T4T A;  3MQO A;  4ETX A;  1TS0 A;  3SW1 A;  4EXO A;  3VOL A;  5HDS A;  3T4Q A;  3V67 A;  3BQA A;  2GZA A;  4I3J A;  3S7N A;  3EQU A;  5J7E A;  2PD8 A;  4UQI M;  3F1O A;  3EEA A;  3NOT C;  4I3I A;  1OPX A;  2GJ3 A;  2OOL A;  2CMN A;  2L0W A;  2Y79 A;  3UME A;  2PHY A;  3PBN A;  4O8G A;  3CWF A;  4R38 A;  5DFY A;  2NUT C;  5F68 A;  5HWV A;  4JGO A;  3PBT A;  1VB6 A;  2INW A;  1XJ2 A;  3RFB A;  1TS6 A;  1VHM A;  4HH2 A;  3KYQ A;  4DJ3 A;  4Y2F A;  3LR5 A;  1YSQ A;  2EWW A;  3LYX A;  2OAP 1;  4GS9 B;  1ZHH B;  5MC7 A;  2QKP A;  3BQ8 A;  3H82 B;  4PAU A;  1OT9 A;  5G4Y A;  3EGD C;  5I5L A;  4EEU A;  4EEP A;  2QJ7 A;  1D7E A;  1XJ4 A;  5J4E A;  1WA9 A;  2W1T A;  3HJK A;  2WKQ A;  2VEA A;  2YKF A;  1V9Z A;  4YWZ A;  2ZMF A;  2L1M A;  4H6J A;  2J80 A;  4GJ4 A;  2KDK A;  3TRC A;  1T1C A;  4GHI B;  3T4S A;  5HSQ A;  3LI9 A;  2B02 A;  4BJP A;  1G6O A;  2J3T D;  3OOV A;  4BBT A;  3EOI A;  3T4K A;  5IU1 A;  4LPZ A;  2PD7 A;  2VGL M;  4HQA A;  3B42 A;  1KOU A;  4LLO B;  5HL6 A;  2GX5 A;  4WUJ A;  3R7W A;  4IJG A;  1T1A A;  1W63 Q;  3MMH A;  3GDI A;  5IT5 A;  2V0U A;  4GHI A;  3S7O A;  1XJ3 A;  4NEE D;  1DP6 A;  1T19 A;  1NLY A;  3F1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...