4WL9A

Time resolved serial femtosecond crystallography captures high resolution intermediates of pyp
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Time-resolved serial crystallography captures high-resolution intermediates of photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4wl9A00
1DP9A 2H28A 3CAXA 2CMNA 4R3AA 2P7JA 2W27A 4H6JB 4WLAA 1T1AA 4HJ4A 3EEHA 2HV1A 1OTAA 3H9WA 1OJGA 2QJ5A 1LT0A 3LYXA 2V0UA 5HWTA 3UB7A 4HH2A 1WA9A 3H7WA 1S4RA 3ULFA 5DJUA 3UB9A 3ZQ5A 1UWNX 1N9OA 3UMEA 5HWVA 2VEAA 4WF0A 1F9IA 2A24A 4GS9A 1S66L 3UB8A 4YWZA 4GW9A 2OWHA 3HJKA 3FG8A 3HJIA 4I3AA 5F6AA 3LIDA 2JHEA 1OTIA 1EW0A 4XT2B 4WL9A 4JGOA 4HQAA 1UWPX 3C8CA 3MQOA 4M4XA 4WN5A 5IU1A 3LICA 4JGQA 5HD3A 5J4EA 2B02A 2YKFA 1G28A 3CLOA 4HH3A 4EEUA 2QWSA 1OT9A 1XJ3A 3H82A 3H7WB 1V9ZA 3ICYA 1VB6A 2PD7A 2WKPA 4HOIA 4KUOA 3K3DA 1P97A 4WUJA 3BY9A 2ZOIA 2A24B 1GSXA 4GS9B 4EERA 3EWKA 3KX0X 1F98A 2D02A 3A0SA 1LSWA 2V9AA 1TS6A 3BY8A 1XJ2A 2WKRA 3IBRA 5AVFA 1TS7A 3P7NA 4NXEA 3UMDA 2V1BA 1NWZA 5G4ZA 4GHIB 4HI4A 5DJTA 4EESA 2GJ3A 1S67L 3C2WA 4EQ1A 4PKYA 5F68A 1LSVA 2PYRA 1T19A 5HD5A 3F1NA 5G4YA 3H82B 3LUQA 1XFNA 2PDRA 3VE4A 3IS2B 3LIBA 3GDIA 3MQQA 1D7EA 4JGPA 4LRYC 2QKPA 5AVEA 3LIFA 3NHQA 1KOUA 1N9LA 3NOPC 3K3CA 4LLOB 3BWLA 4HNBA 2PR6A 2EA9A 3T50A 3D72A 4RQ9A 3F1OA 3G6OA 5HDSA 3FC7A 2VV6A 1OTEA 2W0NA 1DP8A 1LSXA 5I5LA 4HP4A 3NJAA 2BASA 2PYPA 3MXQA 1DRMA 4R6LA 1P0ZA 2R78A 4HJ3A 1GSVA 4KQDA 4I39A 5DKKA 3F1NB 5HDCA 1T1CA 1TS8A 3A0RA 2L4RA 3E4PA 3B33A 4R38A 4I3JA 4MN6A 3RH8B 1OJ5A 4LRZE 2I9VA 1GSWA 4HJ6A 1TS0A 3F1PA 4JGRA 5HWWA 3F1OB 2ZBBA 3PYPA 1DP6A 4I3IA 5F5YA 4EEPA 4EXOA 1XJ6A 4PKYG 3GECA 3VE3A 1OTBA 4I5SA 5F69A 1OT6A 2Z6DA 3MJQA 3PHYA 1XFQA 4L9GA 3NOUC 4E04A 5TBMA 4DJ3A 2VLGA 5IS1A 1ODVA 4HP9A 3CWFA 2YKHA 4BBUA 1OTDA 1N9NA 4K08A 2PR5A 2VV8A 2PHYA 4GCZA 2L0WA 2JN7A 2QJ7A 4F3LA 2Z6CA 5J7EA 2OWJA 5KIZA 3OLOA 1JNUA 2V0WA 4MN5A 4BBVA 5A8BA 3F1PB 3E4QA 4DJ2A 2OOLA 4NXGA 3E4OA 4HY8A 1S1ZA 5DKLA 3NOTC 4NXFA 1T18A 4I38A 1Y28A 3UB6A 1V9YA 2VV7A 4BBTA 4H6JA 4L9FA 3LIEA 1D06A 4GHIA 4KUKA 3RTYA 1LL8A 2J80A 3SW1A 5EFWA 4EETB 4HIAA 3LI9A 5TBMB 3LIAA 2WKQA 3UE6A 5HSQA 4B9OA 1XJ4A 2INWA 1MZUA 2D01A 5J3WA 5HDDA 1UGUA 4HHDA 2QHKA 3LI8A 3IS2A 4L9EA 4F3LB 2M1CA 2KX6A 2ZOHA 2L1MA 3A0VA 2K7SA 4LRXC 4R70A 3VOLA 2V1AA 3MFXA 1BYWA 2KDKA 1S4SA 1T1BA 5HZHA 2PD8A 3MR0A 4EW7A 4LPZA 4NXBA 1X0OA 4XT2A 1S1YA
chains in the Genus database with same CATH superfamily
4Q0IA 1WE4A 5GHZA 2W27A 1W63M 1T1AA 5AQBA 3EEHA 4KG2A 3P98A 3R7WA 3LY3A 2QJ5A 4S2KA 4X6TA 1G6AA 3VOZA 2WAEA 1S4RA 3LY4A 5HFOA 2E8IA 5FA7A 2V8FA 1YMXA 3NY4A 3PAEA 1FQGA 3ZQ5A 2P04A 1A0KA 1ES5A 2XH9A 3CZDA 5HWVA 1K57C 2HP9A 2XRNA 3EEAA 4UA9A 1ZG6A 2HGVA 4UQIM 5EVLA 1ZC2A 1EI5A 4GS9A 3UB8A 4GW9A 3TRCA 1CI8A 4CLCD 2FFFB 3FG8A 2I72A 4MNRA 4I3AA 5F6AA 3LIDA 3UB5P 2JE5A 5CGWA 5CX7A 4LV0A 3G2YA 2O9BA 4P6BA 4HQAA 3HLEA 3C8CA 2Y55A 4CPKA 4S2IA 3G35A 3LICA 3GV9A 1KDSA 4BLMA 2XEPA 1K56A 1PWDA 3TJZC 1OT9A 5KSHA 2HDUA 1H8YA 3H7WB 1CEFA 1TEMA 2KOIA 2VZWA 3ICYA 1VB6A 2PD7A 2WKPA 4KUOA 1RCJA 2ZQ9A 3TSGA 3G4PA 2EXBA 5TJJA 2BTFP 4RVAA 1RGZA 2V20A 1MWRA 1S0WA 3IX8A 5I94A 1KE4A 4EERA 3Q81A 2BLSA 3EWKA 4KG6A 2D02A 5E2HA 4A5RA 4LENA 1PFLA 2J9OA 3TE8A 3DBAA 4QY5A 1LSWA 2WK0A 1KGGA 5JYOA 3C38A 1TS7A 1IELA 4Y3IA 2V1BA 4UEYA 2DRWA 4HI4A 3T4QA 3WS5A 1FR1A 2GJ3A 4EESA 5HARA 3C2WA 1W5DA 4QD4A 2BG1A 1ACFA 1BSGA 3HUOA 4QHCA 3CHWP 3W4QA 1MWSA 3FPVA 4NG2A 3WWXA 1XGIA 2H0YA 3GTCA 1VETA 1PIOA 1P9WA 3VE4A 3MMHA 1DJCA 2FH5A 3V5MA 2W1TB 5GLCA 3MQQA 1Z09A 5IHVA 3M2JA 4JXVA 3P01A 1D7EA 1PWCA 4QWOA 2VGKA 4EQIA 3LCEA 3NOPC 4RX2A 3BWLA 2PR6A 4AFIA 4Q0JA 4R3JA 3D72A 4X1MA 3Q1FA 2PU2A 1YKDA 4X1LA 1E3UD 4BD1A 1K54C 2VV6A 4LGWA 1DP8A 3VSKA 3QHYA 4HP4A 3UE1A 3HUMA 2RL3A 4E3KA 2H0TA 4JPMA 4WM9A 1GSVA 1KGFA 5EV0A 1FSWA 3VP0A 1TS8A 2ZQDA 4B88A 3CUEA 2L4RA 3E4PA 3O3VA 1YAXA 1L0DA 2WZXA 3LR4A 4ZAMA 4R23A 3KSFA 4HBTA 1MKMA 5A90A 3NC8A 1YLPA 1OJ5A 4LRZE 4Z9QA 5AJGA 3HVFA 3ITAA 4OP8A 4OQ0A 5L09A 3UE0A 3AGFA 4BMWA 1FIKA 4RYEA 3IBJA 3QP8A 1KE0A 1PZPA 4I3IA 4MBKA 3PR6A 2XGNA 4EXOA 1XJ6A 4OONA 4D2OA 3GECA 4BD0A 3NDEA 4CLCB 4N9KA 5HAPA 3ZGAB 1VEUB 3KSGA 3PHYA 2HDQA 4DMZA 1DJBA 3HBRA 4E04A 5TBMA 4DJ3A 4PM7A 3RJUA 2WKEA 3UDIA 4EBNA 2XLNA 4P85A 4BBUA 2J8YA 4WEKA 1ZHHB 3OZHA 1XX2A 5DF9A 1HZOA 2VV8A 4KZ9A 2X02A 3T1QB 4BJPA 2WGIA 2L0WA 2VGLS 5FASA 4MLLA 1L0EA 2HPBA 2OWJA 5CEDA 1MKIA 3HREA 3UDXA 5FI7A 5A8BA 2W3HA 4DJ2A 2IWDA 1PI5A 2OOLA 2M7VA 1XA1A 5DTKA 1S1ZA 2EX8A 1I5QA 4PM9A 3OPLA 2Z2MB 3NOTC 4NXFA 4BBTA 4H6JA 1D06A 1LL8A 3IWIA 5LBRA 3IF5A 3SW1A 3PAGA 1G5UA 4QJGA 2WGWA 3DAVA 3KYEA 3LIAA 1HD8A 3UE6A 3A3EA 2EWVA 1L3LA 3MS6A 3CMZA 5HDDA 1K55C 3IH9A 4R4RA 4IEDA 5TFQA 1UGUA 1ES2A 2QHKA 2JKRI 3R4KA 4IJGA 4LV1A 3LI8A 3DTEA 4EV4A 5EOEA 2M1CA 2KX6A 4ZJ1A 2VX8A 2X71A 5FQQA 1N9BA 4R70A 3VOLA 3AGEA 5U47A 3QP6A 5L2FA 4QU3A 4X25A 1T1BA 2EX9A 4EW7A 1C3BA 4LPZA 2OAP1 2Y8HA 3FZCA 3ISGA 1I2WA 2WADA 2H28A 4KQRA 3OPRA 2CMNA 1WYBA 1E4DA 4R3AA 2ZL1B 2V2FF 3LYXA 4DN0A 4KZBA 2JCHA 2V0UA 2GDNA 4MN7A 5HWTA 3ZG5A 4NETA 2ZQ8A 3CUEC 1Q2QA 5JYPA 1MXOA 4F94A 2JKRM 1UWNX 2XD1A 1N9OA 2VEAA 4KQQA 5DFXA 3ZVTA 3IWOA 2P74A 1SKOB 1I2SA 2HP5A 2XD5A 4GKUA 2GZAA 3IH8A 4H8RA 1KE3A 3GRJA 4N92A 2OWHA 3HJKA 2OV5A 2W3DA 2RCXA 4KZ5A 1W7FA 1F2KA 2JHEA 3T1XA 4ARZA 3IX3A 2OAQ1 3HLFA 1SKFA 3WRTA 4M4XA 4E3NA 2PAVP 4ETXA 1K6SA 3R7WB 4BWIA 1G28A 3CLOA 1M40A 3VFHA 2Q9NA 2XROA 1CQAA 1E25A 3MXSA 1XJ3A 3LFVA 3H82A 1XXMA 2Y2PA 2J3TD 2CC1A 2HDRA 3OCNA 3UNWA 4HOIA 4IVKA 3N8RA 2VKSA 3BY9A 3PBQA 2UWXA 2ZOIA 3QP1A 2X01A 1BUEA 3MZFA 4GS9B 4Y17A 3MSHA 4S2OA 1F98A 3T4JA 3KSIA 2B95A 1ESUA 3A0SA 5L10A 2HJEA 1GCEA 3VFFA 3C7UA 3P7NA 4NXEA 4FH4A 1NWZA 4GHIB 4WYYA 4O01A 4WZ4A 5CGSA 5DJTA 4G3KA 1S67L 4G3VA 2QZ6A 4PKYA 2JKFA 3S7OA 1ERMA 2H5SA 5EPHA 5FAPA 3MBZA 4L0LA 1W8YA 4KG5A 2PYRA 4KQOA 3F1NA 5G4YA 4FH2A 3NDGA 1MPLA 1NYMA 2MJ6A 4UQIS 3Q82A 3W8KA 3LO7A 1XFNA 2Y79A 1IYSA 2ACGA 3C4PA 1PWGA 4R1GA 1U60A 1XP4A 3BQAA 1KOUA 3E2KA 2EFXA 3DTKA 2EA9A 4OPQA 4HESA 5EVIC 3FYZA 3ZHHA 1JVJA 3G6OA 4S2PA 3BFEA 4GD6A 4RX3A 2K2NA 4OPYA 1J9MA 5FQ9A 2G2UA 5M1AA 5I5LA 2Y2MA 2BASA 3IXDA 4BL3A 1BLCA 1DRMA 3ZFZA 3Q07A 4HJ3A 3L7HA 4KQDA 3G2ZA 3HLCA 5DKKA 2Y2OA 4DE0A 2XF3A 4B93A 1NLZA 2HF6A 3M6HA 3T1RA 1AWIA 1VETB 3LR3A 2QPNA 2ZC4B 3MKFA 3PBOA 4JF6A 4OQHA 1YLWA 3WS0A 3RH8B 4DRTA 5F1FA 2I9VA 2HJ9C 2ZQAA 2WKIA 4GDNA 1LI0A 3O88A 3G31A 2W3EA 1W63Q 3M2KA 3V50A 5CERA 2Y2QA 4X68A 1PRQA 3F1PA 3RFBA 3T12B 2WUQA 5EM1A 5HWWA 4X69A 2ZBBA 4Y0OA 1MWTA 3T4KA 4PHTA 3DTMA 2ZLYA 1DP6A 3V67A 1JTDA 3BLSA 2JKTM 3E98A 5L07A 4C6YA 3FKWA 2XSSA 2ZMFA 3B47A 1OT6A 2XK1A 3EGDC 1OPXA 2A49A 3NIAA 3OPPA 2VJWA 1L0FA 4L9GA 2OSUA 3RXWA 1SHVA 4ZRRA 1K55A 2ZQ7A 5IS1A 1ODVA 3T1SA 5DVAA 4ZTKA 5CTNA 1O07A 1PZOA 5FQKA 3C5AA 4QB8A 2PR5A 2J9PA 3A3IA 4Z1WA 5FATA 4M3KA 2Y2LA 5AQ9A 3IWQA 1VHMA 1VM1A 2Z6CA 4DDYA 2B18A 2ZC7A 1STZA 2XDMA 4EU0A 1L0GA 3ZVWA 4GN2A 3IQAA 4N9LA 2HDSA 3CI6A 2PBYA 3MXRA 3PBSA 2WYXA 1BLHA 3C4OA 3OPHA 4NXGA 3E4OA 4HY8A 3BECA 4JLFA 3S22A 5DKLA 1H8MA 4HBUA 3B42A 3UB6A 2XR0A 3KYZA 3LIEA 3MQ0A 3IF6C 4KUKA 1JWPA 4K0WA 1QMEA 2IA2A 5K5BA 5TBMB 5CECA 2UV0E 1LL5A 4MDZA 4XUZA 5HSQA 4KZ3A 4C75A 5FAOA 4P87A 4WMCA 3FPWA 1IYPA 2EFUA 4HHDA 3D4FA 3CPTA 3NECA 2Y2NA 4X53A 4P6ZS 2ZOHA 1RGYA 3HUNA 2O99A 3A0VA 4DXBA 4DDSA 3BW6A 4IBRA 1BTLA 3IXGA 4P6ZM 1BLPA 1LHYA 1GA0A 4KZ4A 1P9RA 2KDKA 1S4SA 2PD8A 3MR0A 4NXBA 4XT2A 1X0OA 1MC0A 2O0YA 2ZQCA 2VGJA 2VA0A 4EBPA 2ZM2A 1DP9A 4U0XA 3E0YA 2Y59A 3A3DA 2P7JA 4K0XA 1K25A 3BEBA 4H6JB 1FSYA 1OJGA 1BT5A 3VP1A 4Q0HA 4CQHA 3A3JA 2PRFA 1GHMA 5CHJA 3DWZA 4HH2A 1WA9A 1IFQA 1HTZA 4II7A 3ULFA 5DJUA 2W1RA 5FDSA 3OBFA 3WRZA 3RXXA 3UMEA 4OOMA 4WF0A 2K31A 1F9IA 2WAFA 1K0KA 4K91A 2A24A 1SDEA 5FAQA 1S66L 4YWZA 4UA7A 4OPRA 1K56D 4WBGA 1NLYA 1CF0A 1NXYA 1YT4A 1OTIA 4ID4A 1EW0A 5HW3A 5M18A 4JGOA 2Q9MA 2Y4AA 3UO9A 1S6RA 3MQOA 1YLZA 4R0QA 5IU1A 3G30A 5HD3A 3GQZA 1K38A 3HL9A 1YPRA 4CLCA 5J4EA 2B02A 2YKFA 5G18A 2QWSA 4OLDA 4X56A 1BLSA 3BFCA 2NUTC 5CRFA 3D9YA 3LR0A 3W4OA 4Y2FA 2OLVA 4WEJA 1V9ZA 1IKGA 3WS4A 3S4XA 4DKIA 1FCNA 3N8SA 1P97A 4GD8A 5GLAA 4DE1A 4JF5A 4WUJA 4PM8A 3PBNA 3C30A 4UA6A 3LEZA 4Y7PA 3ZCZA 3O5YA 5EVIA 1ZTUA 3ZG8B 1JTGA 5A93A 3EQUA 1PNEA 2OLUA 3KX0X 2H10A 5FI6A 5CHMA 5HL1A 2V9AA 4ARZB 3BY8A 1XJ2A 1Z6FA 3PTEA 3IBRA 3EQVA 4LV2A 4E6XA 3QP4A 1CEGA 5CXWA 1QMFA 3CITA 3BLMA 1TD5A 5FEGA 3L9KA 4JKTA 5F68A 2WGVA 4O0PA 4UAAA 5EECA 1KGEA 4IVIA 2Y2GA 3G32A 1ZKJA 3MFDA 3PXPA 3DTIA 3IHBA 1EROA 4OH0A 3N6IA 3H82B 5FL3A 3UPNA 1OMEA 3LUQA 1FR6A 2Y91A 1GA9A 2PDRA 4YINA 3IS2B 3GDIA 1YQSA 4EWFA 3S7PA 1CJFA 4GZBA 5KZHA 4JGPA 4LRYC 2QKPA 5AVEA 4R4SA 3NHQA 1Q2PA 1N9LA 3K3CA 4LLOB 4PM6A 1IKIA 2HZ5A 5A92A 5HAQA 2ZC3B 1NZUA 3S7NA 1XPBA 2PBDP 2WZZA 4GDBA 4B4ZA 3F1OA 5HDSA 3FC7A 1NJ4A 4BENA 1OTEA 5HX9A 1CI9A 4ZJ2A 2J3TC 2Q0OA 3DW0A 3N7WA 3BFFA 3NJAA 2PYPA 4PMAA 4D60A 3MXQA 2G7UA 3ZDJA 1P0ZA 2R78A 5GLBA 1KDWA 3Q7ZA 3ZNYA 2P9VA 4YNRA 4X55A 4I39A 3F1NB 1D1JA 1T1CA 4NKPA 4KZ6A 1E3UA 1MWUA 5KMWA 2LB9A 3B33A 1NRFA 3UPPA 4P0MA 4CLCE 5CGXA 4R38A 4ME4A 4I3JA 3M6BA 4O7DA 1YSPA 2R9WA 3I7JA 1KVLA 1GSWA 1TVFA 2W3FA 4GJ4A 4HJ6A 1TS0A 4OOYA 1FCMA 1F5MA 1ONHA 2C5WB 2ZMAA 1HLUP 1ERQA 1FCOA 4DF6A 5F83A 2PU4A 3CJMA 3O87A 4E6WA 3PYPA 4UHUA 4U3TA 3T4TA 1SDNA 3IF6A 4R3BA 1OTBA 4OPZA 4I5SA 3VV4A 5F69A 5MC7A 4N1HA 1IYOA 1YLJA 2JBFA 4OP5A 3MJQA 3SZTA 2ZM0A 4ZBEA 2A3UA 3B3XA 1EWZA 4CLCC 4ETZA 2VLGA 3D3OA 4ESPA 2YKHA 3TOIA 1OTDA 5BOHA 4C3QA 1N9NA 3OC2A 4GCZA 2JN7A 1HVBA 4F3LA 5J7EA 3WS1A 5KIZA 3OLOA 4LCMA 3U4LP 3SS4A 5DTSA 3N8LA 4BBVA 4IUHA 3F1PB 3Q7VA 3TG9A 3T4SA 2JKGA 3A3FA 3IXHA 2JKTI 2ZD8A 1ESIA 3N4IA 2ZJ9A 5DF8A 4EUVA 1PI4A 2LB5A 3UPOA 1T18A 3W4PA 1Y28A 1V9YA 2ZMVA 3ZG0A 4S2NC 1RP5A 3LR5A 4GHIA 5FSRA 3RTYA 3S7QA 2J80A 4BL2A 3EOIA 5C5KA 4HIAA 3LI9A 5DF7A 2QYBA 3VP4A 2WKQA 3BRMA 3PBRA 3K2NA 4B9OA 1XJ4A 5EVID 3AGDA 1MZUA 1G68A 2DMWA 2D01A 2Y2KA 3BM6A 4GOGA 4QPRA 2IWCA 2XQZA 4FCFA 4OVDA 3SH7A 1XKZA 5F82A 4XUXA 5FI2A 2L1MA 3JVVA 4E3OA 2AVXA 4WZ5C 4LRXC 1JWZA 1K4FA 3HCYA 3SS5A 3MFXA 5D3OA 5HZHA 3BQ8A 1BZAA 2JC7A 3ZNTA 2V8CA 1S1YA 3NCKA 4PM5A 1ONGA 3ZG9B 4OLGA 3CAXA 2ZM8A 1AXBA 4WLAA 4HJ4A 2XFTA 2HV1A 1OTAA 2DNSA 3MKEA 3H9WA 4NK3A 1LT0A 3UN7A 1MBLA 4S2JA 4KENB 3UY6A 3UB7A 3V3RA 1ALQA 1W79A 4FOFA 3H7WA 1GHIA 1PW1A 1XGJA 2QMIA 4CJNA 3UB9A 2GX5A 2EX2A 1W8QA 5F1GA 2PT7A 3SS3A 1LI9A 3T4LA 3QP2A 2EX6A 3CPTB 4OQGA 4G3WA 1YMSA 1NYYA 3T4OA 3HJIA 4Q8IA 3FKVA 1NY0A 4XT2B 4OOLA 4WL9A 2HP6A 1PYYA 4S2LA 3ZG7B 1UWPX 1H5XA 4XXRA 4ZJ3A 5GHXA 1YSQA 4WN5A 4JGQA 2NUPC 3VP2A 3C7VA 5GL9A 5CEBA 4HH3A 4Y0UA 3ZYTA 4EEUA 2DCFA 3SH8A 3JYIA 4Y5FA 4E3LA 5L8MA 3O86A 1WYCA 1ES3A 1TDGA 5EVEA 5FQMA 1ZG4A 4NEED 4E3IA 3NBLA 3K3DA 1IOUA 3NULA 4U0TA 2W1TA 1L2SA 2Y2IA 3LEQA 5EOOA 1FILA 2A24B 1GSXA 1ES4A 3IXBA 4FUWA 5FQJA 3FV7A 3U2AA 4DE2A 1TS6A 2WKRA 5DFYA 5AVFA 4MBHA 3UMDA 2J7VA 1Y54A 1J3WA 5G4ZA 5IT5A 3KO6A 4MMNA 5J8XA 4FD8A 1YLTA 4EQ1A 3JPUA 2WGWB 3MZDA 2XFSA 1YLYA 5HL6A 4JBFA 4WELA 1LSVA 4Y0TA 2Y2HA 3KYQA 2EWWA 1T19A 5HD5A 1NZOA 2C6WB 1DY6A 3JVUA 3V3SA 4B4XA 5DTTA 1MY8A 2O9CA 4OQIA 1M6KA 3GSGA 3HLGA 1FOFA 3LIBA 3HLBA 4FTXA 3UE3A 4KZ7A 3LIFA 5EVIB 3FWLA 4EBLA 1CK3A 4HNBA 2A2LA 3OOVA 5FQIA 4JXGA 3T50A 4RQ9A 2VGLM 2W3GA 1VQQA 4OKPA 2W0NA 4JXWA 4LFUA 3VMAA 4S2MA 1BULA 1LSXA 4MBFA 5EM0A 5EE8A 1H8ZA 1LLBA 2Y2JA 1VEUA 3ITBA 4R6LA 4YFMA 3WS2A 1SZVA 5FEFA 1TDLA 1Y4OA 3MZEA 1H3QA 3IHAA 5HDCA 3MF0A 3A0RA 3NI9A 2GNXA 4O8GA 2M7UA 3SOIA 3QNBA 2E8JA 4YOFA 5TR7A 1PW8A 1K6RA 4EUZA 2ZC5B 1K57A 3BYDA 4MN6A 5HPFA 5FDHA 5AQAA 2WKHA 4RA7A 4GNUA 1G6OA 1YM1A 4JGRA 3BFDA 5CTMA 4LCLA 4PAUA 3F1OB 4JXSA 1GHPA 4S2NA 5F5YA 4EEPA 4PKYG 5HPIA 5CHUA 3VE3A 5HAIA 5AQ7A 4DE3A 1H0MA 2Z6DA 4DXCA 3GMWA 3QP5A 4JF4A 1XFQA 3NOUC 5E2GA 5GLDA 3BFGA 2P9VB 1DJAA 4HP9A 3GR2A 1KVMA 3CWFA 2XA7S 3KSHA 4E3JA 2EXAA 4ZDXA 5TGFA 3GVBA 4QY6A 4K08A 2FZ0A 4IBXA 2KLIA 1O7EA 5E2EA 2P08A 3S1YA 2PHYA 4MEZA 2XA7M 3UDFA 4WZ5A 2QJ7A 4GLQA 1JWVA 2Z2LB 1IEMA 3SH9A 4Y13A 1SCWA 3VP3A 3DWKA 2B5RA 1JNUA 2V0WA 1K4EA 4MN5A 1TF1A 2R9XA 4MCWA 3E4QA 3BJNA 5A91A 2IWBA 4GB7A 3HLDA 4KZ8A 3OCLA 4WMCD 3W2ZA 3VSLA 4N1XA 3IF6B 1NRJA 2J3WA 4I38A 5GHYA 5E43A 2VV7A 5KSCA 2ZL1A 4HEFA 4L9FA 4LV3A 3TW8A 2VK3A 5EFWA 4EETB 1N4OA 2ZC6B 4BQMA 4IUKA 2G2WA 4Y15A 5E2FA 1IYQA 2INWA 3G34A 5J3WA 2V1ZA 2FFYA 3IT9A 4E3MA 1XA7A 2O9AA 3EGXC 3IS2A 4FSFA 4L9EA 1SKOA 4F3LB 5M19A 3P09A 3PBTA 3V39A 2K7SA 3VOYA 5EUAA 3LGOA 4PPRA 3CG5A 3QNCA 3Q7VB 4KZAA 2V1AA 1BYWA 3IX4A 1LL9A 1K54A 3HLWA 4IHQA 3E2LA
chains in the Genus database with same CATH topology
4Q0IA 1DP9A 2H28A 3E0YA 3CAXA 2CMNA 4R3AA 2P7JA 2W27A 4H6JB 1W63M 4WLAA 1T1AA 4HJ4A 3EEHA 2HV1A 1OTAA 3H9WA 3R7WA 1OJGA 2QJ5A 1LT0A 4Q0HA 4CQHA 3LYXA 4DN0A 2V0UA 4MN7A 5HWTA 3UB7A 4HH2A 1WA9A 4FOFA 1IFQA 3H7WA 1S4RA 4II7A 3ULFA 3CUEC 5DJUA 2W1RA 3UB9A 2GX5A 3ZQ5A 2P04A 3OBFA 2PT7A 2JKRM 1UWNX 3T4LA 1N9OA 3UMEA 5HWVA 2VEAA 4OOMA 5DFXA 4WF0A 2K31A 1F9IA 2XRNA 3EEAA 2HGVA 4UQIM 2GZAA 2A24A 4G3WA 4GS9A 1S66L 3UB8A 4YWZA 4GW9A 3TRCA 4CLCD 2OWHA 3HJKA 2W3DA 3T4OA 3FG8A 3HJIA 4I3AA 1NLYA 5F6AA 3LIDA 2JHEA 4ARZA 1OTIA 1EW0A 4XT2B 5CX7A 2OAQ1 4OOLA 4WL9A 4JGOA 2O9BA 4HQAA 1UWPX 3C8CA 3MQOA 4M4XA 1YSQA 4WN5A 5IU1A 3LICA 4JGQA 5HD3A 2NUPC 4CLCA 4ETXA 5J4EA 3R7WB 4BWIA 2B02A 2YKFA 1G28A 3CLOA 4HH3A 3TJZC 3ZYTA 4EEUA 2XROA 2QWSA 1OT9A 5KSHA 1XJ3A 2NUTC 4Y5FA 3LFVA 3H82A 3LR0A 5L8MA 4Y2FA 3H7WB 2KOIA 4WEJA 2J3TD 2VZWA 1V9ZA 3OCNA 3ICYA 1VB6A 2PD7A 2WKPA 4HOIA 4KUOA 4NEED 3K3DA 1IOUA 1P97A 2W1TA 4WUJA 3PBNA 2VKSA 3BY9A 3C30A 5TJJA 3PBQA 3O5YA 2ZOIA 2A24B 1ZTUA 1GSXA 4GS9B 4EERA 3EQUA 3EWKA 3KX0X 1F98A 2D02A 3T4JA 3KSIA 3TE8A 3A0SA 3U2AA 3DBAA 1LSWA 2V9AA 1TS6A 2HJEA 3BY8A 1XJ2A 2WKRA 5DFYA 4ARZB 3C38A 3IBRA 5AVFA 1TS7A 3EQVA 3P7NA 4NXEA 3UMDA 4Y3IA 2V1BA 1NWZA 5G4ZA 4UEYA 4GHIB 4HI4A 4O01A 3CITA 3KO6A 4MMNA 4G3KA 2GJ3A 5DJTA 3T4QA 1S67L 4EESA 3C2WA 1TD5A 4G3VA 4EQ1A 4PKYA 3S7OA 5F68A 4L0LA 4O0PA 5HL6A 4WELA 1LSVA 2PYRA 3KYQA 2EWWA 1T19A 4KQOA 5HD5A 3F1NA 3FPVA 3PXPA 5G4YA 3JVUA 2MJ6A 3H82B 4UQIS 5FL3A 3LUQA 1XFNA 2Y79A 2O9CA 2PDRA 1P9WA 3VE4A 3MMHA 3IS2B 3LIBA 2FH5A 3GDIA 2W1TB 3MQQA 3S7PA 3P01A 1D7EA 3UE3A 4JGPA 4LRYC 2QKPA 5AVEA 3BQAA 3LIFA 3NHQA 1KOUA 1N9LA 3NOPC 3K3CA 4LLOB 3BWLA 4HNBA 2A2LA 3OOVA 2PR6A 2EA9A 4AFIA 4Q0JA 3T50A 3D72A 3S7NA 4RQ9A 2VGLM 3F1OA 1YKDA 3G6OA 2W3GA 5HDSA 3FC7A 2VV6A 1OTEA 2W0NA 2K2NA 2J3TC 1DP8A 1LSXA 5I5LA 4HP4A 3NJAA 2BASA 2PYPA 3MXQA 1DRMA 2G7UA 4R6LA 1P0ZA 2R78A 4HJ3A 1GSVA 4KQDA 4YNRA 1H3QA 4I39A 5DKKA 3F1NB 5HDCA 1T1CA 3MF0A 1TS8A 3A0RA 4NKPA 4B93A 1NLZA 2HF6A 2GNXA 4O8GA 3CUEA 2M7UA 2L4RA 3E4PA 1YAXA 2LB9A 3B33A 4CLCE 3LR3A 3LR4A 4YOFA 3KSFA 3PBOA 4ME4A 4I3JA 4R38A 1MKMA 1YSPA 4MN6A 3RH8B 5HPFA 1OJ5A 4LRZE 2I9VA 5AJGA 2HJ9C 1GSWA 2W3FA 4GJ4A 2W3EA 4HJ6A 1TS0A 1W63Q 1F5MA 1G6OA 3F1PA 4JGRA 3RFBA 4BMWA 5HWWA 4PAUA 3F1OB 2ZBBA 3IBJA 3T4KA 4PHTA 3PYPA 1DP6A 4I3IA 3T4TA 5F5YA 3V67A 4EEPA 2JKTM 3E98A 3PR6A 4EXOA 1XJ6A 4PKYG 5HPIA 3GECA 3VE3A 1OTBA 2XSSA 4I5SA 3VV4A 2ZMFA 4CLCB 5F69A 3B47A 5MC7A 1OT6A 3EGDC 1OPXA 2Z6DA 3MJQA 3KSGA 3PHYA 2VJWA 4DMZA 1XFQA 4L9GA 3NOUC 4E04A 5TBMA 4CLCC 4DJ3A 4ZRRA 4ETZA 2VLGA 5IS1A 1ODVA 4HP9A 3CWFA 2XA7S 3KSHA 3D3OA 2YKHA 4BBUA 4WEKA 1OTDA 1ZHHB 1N9NA 4K08A 5DF9A 2FZ0A 2PR5A 2VV8A 2KLIA 2P08A 4Z1WA 3OC2A 2PHYA 4BJPA 2XA7M 4GCZA 2L0WA 2JN7A 2VGLS 2QJ7A 4GLQA 1VHMA 4F3LA 2Z6CA 5J7EA 2B18A 1STZA 2OWJA 5KIZA 3OLOA 1JNUA 2V0WA 4MN5A 4BBVA 4EU0A 1TF1A 4IUHA 4MCWA 5A8BA 3F1PB 3E4QA 3T4SA 2W3HA 4DJ2A 3BJNA 3CI6A 2OOLA 3PBSA 2JKTI 2M7VA 3OCLA 4NXGA 3E4OA 4HY8A 4EUVA 3W2ZA 1S1ZA 2LB5A 1NRJA 5DKLA 2J3WA 1H8MA 3NOTC 4NXFA 1T18A 4I38A 1Y28A 3B42A 1V9YA 3UB6A 2ZMVA 2VV7A 4BBTA 3LR5A 4H6JA 4L9FA 3KYZA 3LIEA 1D06A 3MQ0A 4GHIA 4KUKA 3RTYA 3S7QA 1LL8A 2J80A 3TW8A 5LBRA 3SW1A 5EFWA 3EOIA 5C5KA 4EETB 2IA2A 4HIAA 3LI9A 5K5BA 2QYBA 5TBMB 3LIAA 4IUKA 2WKQA 3UE6A 3PBRA 4MDZA 3K2NA 5HSQA 4B9OA 1XJ4A 2EWVA 2INWA 1MZUA 2DMWA 2D01A 3FPWA 5J3WA 5HDDA 1UGUA 4QPRA 4HHDA 2QHKA 2JKRI 3R4KA 4IJGA 2O9AA 3EGXC 3LI8A 3IS2A 4FSFA 4L9EA 4F3LB 3PBTA 2M1CA 4P6ZS 2KX6A 2ZOHA 5IT5A 2L1MA 3JVVA 2VX8A 2O99A 3A0VA 2K7SA 4LRXC 3BW6A 4R70A 3HCYA 3VOLA 2V1AA 3MFXA 1BYWA 4P6ZM 1P9RA 2KDKA 1S4SA 1T1BA 5HZHA 2PD8A 3MR0A 4EW7A 4LPZA 4NXBA 2OAP1 2Y8HA 1X0OA 4XT2A 1MC0A 2O0YA 3BQ8A 4IHQA 2VA0A 1S1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DP9 A;  2H28 A;  3CAX A;  2CMN A;  4R3A A;  2P7J A;  2W27 A;  4H6J B;  4WLA A;  1T1A A;  4HJ4 A;  3EEH A;  2HV1 A;  1OTA A;  3H9W A;  1OJG A;  2QJ5 A;  1LT0 A;  3LYX A;  2V0U A;  5HWT A;  3UB7 A;  4HH2 A;  1WA9 A;  3H7W A;  1S4R A;  3ULF A;  5DJU A;  3UB9 A;  3ZQ5 A;  1UWN X;  1N9O A;  3UME A;  5HWV A;  2VEA A;  4WF0 A;  1F9I A;  2A24 A;  4GS9 A;  1S66 L;  3UB8 A;  4YWZ A;  4GW9 A;  2OWH A;  3HJK A;  3FG8 A;  3HJI A;  4I3A A;  5F6A A;  3LID A;  2JHE A;  1OTI A;  1EW0 A;  4XT2 B;  4WL9 A;  4JGO A;  4HQA A;  1UWP X;  3C8C A;  3MQO A;  4M4X A;  4WN5 A;  5IU1 A;  3LIC A;  4JGQ A;  5HD3 A;  5J4E A;  2B02 A;  2YKF A;  1G28 A;  3CLO A;  4HH3 A;  4EEU A;  2QWS A;  1OT9 A;  1XJ3 A;  3H82 A;  3H7W B;  1V9Z A;  3ICY A;  1VB6 A;  2PD7 A;  2WKP A;  4HOI A;  4KUO A;  3K3D A;  1P97 A;  4WUJ A;  3BY9 A;  2ZOI A;  2A24 B;  1GSX A;  4GS9 B;  4EER A;  3EWK A;  3KX0 X;  1F98 A;  2D02 A;  3A0S A;  1LSW A;  2V9A A;  1TS6 A;  3BY8 A;  1XJ2 A;  2WKR A;  3IBR A;  5AVF A;  1TS7 A;  3P7N A;  4NXE A;  3UMD A;  2V1B A;  1NWZ A;  5G4Z A;  4GHI B;  4HI4 A;  5DJT A;  4EES A;  2GJ3 A;  1S67 L;  3C2W A;  4EQ1 A;  4PKY A;  5F68 A;  1LSV A;  2PYR A;  1T19 A;  5HD5 A;  3F1N A;  5G4Y A;  3H82 B;  3LUQ A;  1XFN A;  2PDR A;  3VE4 A;  3IS2 B;  3LIB A;  3GDI A;  3MQQ A;  1D7E A;  4JGP A;  4LRY C;  2QKP A;  5AVE A;  3LIF A;  3NHQ A;  1KOU A;  1N9L A;  3NOP C;  3K3C A;  4LLO B;  3BWL A;  4HNB A;  2PR6 A;  2EA9 A;  3T50 A;  3D72 A;  4RQ9 A;  3F1O A;  3G6O A;  5HDS A;  3FC7 A;  2VV6 A;  1OTE A;  2W0N A;  1DP8 A;  1LSX A;  5I5L A;  4HP4 A;  3NJA A;  2BAS A;  2PYP A;  3MXQ A;  1DRM A;  4R6L A;  1P0Z A;  2R78 A;  4HJ3 A;  1GSV A;  4KQD A;  4I39 A;  5DKK A;  3F1N B;  5HDC A;  1T1C A;  1TS8 A;  3A0R A;  2L4R A;  3E4P A;  3B33 A;  4R38 A;  4I3J A;  4MN6 A;  3RH8 B;  1OJ5 A;  4LRZ E;  2I9V A;  1GSW A;  4HJ6 A;  1TS0 A;  3F1P A;  4JGR A;  5HWW A;  3F1O B;  2ZBB A;  3PYP A;  1DP6 A;  4I3I A;  5F5Y A;  4EEP A;  4EXO A;  1XJ6 A;  4PKY G;  3GEC A;  3VE3 A;  1OTB A;  4I5S A;  5F69 A;  1OT6 A;  2Z6D A;  3MJQ A;  3PHY A;  1XFQ A;  4L9G A;  3NOU C;  4E04 A;  5TBM A;  4DJ3 A;  2VLG A;  5IS1 A;  1ODV A;  4HP9 A;  3CWF A;  2YKH A;  4BBU A;  1OTD A;  1N9N A;  4K08 A;  2PR5 A;  2VV8 A;  2PHY A;  4GCZ A;  2L0W A;  2JN7 A;  2QJ7 A;  4F3L A;  2Z6C A;  5J7E A;  2OWJ A;  5KIZ A;  3OLO A;  1JNU A;  2V0W A;  4MN5 A;  4BBV A;  5A8B A;  3F1P B;  3E4Q A;  4DJ2 A;  2OOL A;  4NXG A;  3E4O A;  4HY8 A;  1S1Z A;  5DKL A;  3NOT C;  4NXF A;  1T18 A;  4I38 A;  1Y28 A;  3UB6 A;  1V9Y A;  2VV7 A;  4BBT A;  4H6J A;  4L9F A;  3LIE A;  1D06 A;  4GHI A;  4KUK A;  3RTY A;  1LL8 A;  2J80 A;  3SW1 A;  5EFW A;  4EET B;  4HIA A;  3LI9 A;  5TBM B;  3LIA A;  2WKQ A;  3UE6 A;  5HSQ A;  4B9O A;  1XJ4 A;  2INW A;  1MZU A;  2D01 A;  5J3W A;  5HDD A;  1UGU A;  4HHD A;  2QHK A;  3LI8 A;  3IS2 A;  4L9E A;  4F3L B;  2M1C A;  2KX6 A;  2ZOH A;  2L1M A;  3A0V A;  2K7S A;  4LRX C;  4R70 A;  3VOL A;  2V1A A;  3MFX A;  1BYW A;  2KDK A;  1S4S A;  1T1B A;  5HZH A;  2PD8 A;  3MR0 A;  4EW7 A;  4LPZ A;  4NXB A;  1X0O A;  4XT2 A;  1S1Y A; 
#chains in the Genus database with same CATH topology
 4Q0I A;  1WE4 A;  5GHZ A;  2W27 A;  1W63 M;  1T1A A;  5AQB A;  3EEH A;  4KG2 A;  3P98 A;  3R7W A;  3LY3 A;  2QJ5 A;  4S2K A;  4X6T A;  1G6A A;  3VOZ A;  2WAE A;  1S4R A;  3LY4 A;  5HFO A;  2E8I A;  5FA7 A;  2V8F A;  1YMX A;  3NY4 A;  3PAE A;  1FQG A;  3ZQ5 A;  2P04 A;  1A0K A;  1ES5 A;  2XH9 A;  3CZD A;  5HWV A;  1K57 C;  2HP9 A;  2XRN A;  3EEA A;  4UA9 A;  1ZG6 A;  2HGV A;  4UQI M;  5EVL A;  1ZC2 A;  1EI5 A;  4GS9 A;  3UB8 A;  4GW9 A;  3TRC A;  1CI8 A;  4CLC D;  2FFF B;  3FG8 A;  2I72 A;  4MNR A;  4I3A A;  5F6A A;  3LID A;  3UB5 P;  2JE5 A;  5CGW A;  5CX7 A;  4LV0 A;  3G2Y A;  2O9B A;  4P6B A;  4HQA A;  3HLE A;  3C8C A;  2Y55 A;  4CPK A;  4S2I A;  3G35 A;  3LIC A;  3GV9 A;  1KDS A;  4BLM A;  2XEP A;  1K56 A;  1PWD A;  3TJZ C;  1OT9 A;  5KSH A;  2HDU A;  1H8Y A;  3H7W B;  1CEF A;  1TEM A;  2KOI A;  2VZW A;  3ICY A;  1VB6 A;  2PD7 A;  2WKP A;  4KUO A;  1RCJ A;  2ZQ9 A;  3TSG A;  3G4P A;  2EXB A;  5TJJ A;  2BTF P;  4RVA A;  1RGZ A;  2V20 A;  1MWR A;  1S0W A;  3IX8 A;  5I94 A;  1KE4 A;  4EER A;  3Q81 A;  2BLS A;  3EWK A;  4KG6 A;  2D02 A;  5E2H A;  4A5R A;  4LEN A;  1PFL A;  2J9O A;  3TE8 A;  3DBA A;  4QY5 A;  1LSW A;  2WK0 A;  1KGG A;  5JYO A;  3C38 A;  1TS7 A;  1IEL A;  4Y3I A;  2V1B A;  4UEY A;  2DRW A;  4HI4 A;  3T4Q A;  3WS5 A;  1FR1 A;  2GJ3 A;  4EES A;  5HAR A;  3C2W A;  1W5D A;  4QD4 A;  2BG1 A;  1ACF A;  1BSG A;  3HUO A;  4QHC A;  3CHW P;  3W4Q A;  1MWS A;  3FPV A;  4NG2 A;  3WWX A;  1XGI A;  2H0Y A;  3GTC A;  1VET A;  1PIO A;  1P9W A;  3VE4 A;  3MMH A;  1DJC A;  2FH5 A;  3V5M A;  2W1T B;  5GLC A;  3MQQ A;  1Z09 A;  5IHV A;  3M2J A;  4JXV A;  3P01 A;  1D7E A;  1PWC A;  4QWO A;  2VGK A;  4EQI A;  3LCE A;  3NOP C;  4RX2 A;  3BWL A;  2PR6 A;  4AFI A;  4Q0J A;  4R3J A;  3D72 A;  4X1M A;  3Q1F A;  2PU2 A;  1YKD A;  4X1L A;  1E3U D;  4BD1 A;  1K54 C;  2VV6 A;  4LGW A;  1DP8 A;  3VSK A;  3QHY A;  4HP4 A;  3UE1 A;  3HUM A;  2RL3 A;  4E3K A;  2H0T A;  4JPM A;  4WM9 A;  1GSV A;  1KGF A;  5EV0 A;  1FSW A;  3VP0 A;  1TS8 A;  2ZQD A;  4B88 A;  3CUE A;  2L4R A;  3E4P A;  3O3V A;  1YAX A;  1L0D A;  2WZX A;  3LR4 A;  4ZAM A;  4R23 A;  3KSF A;  4HBT A;  1MKM A;  5A90 A;  3NC8 A;  1YLP A;  1OJ5 A;  4LRZ E;  4Z9Q A;  5AJG A;  3HVF A;  3ITA A;  4OP8 A;  4OQ0 A;  5L09 A;  3UE0 A;  3AGF A;  4BMW A;  1FIK A;  4RYE A;  3IBJ A;  3QP8 A;  1KE0 A;  1PZP A;  4I3I A;  4MBK A;  3PR6 A;  2XGN A;  4EXO A;  1XJ6 A;  4OON A;  4D2O A;  3GEC A;  4BD0 A;  3NDE A;  4CLC B;  4N9K A;  5HAP A;  3ZGA B;  1VEU B;  3KSG A;  3PHY A;  2HDQ A;  4DMZ A;  1DJB A;  3HBR A;  4E04 A;  5TBM A;  4DJ3 A;  4PM7 A;  3RJU A;  2WKE A;  3UDI A;  4EBN A;  2XLN A;  4P85 A;  4BBU A;  2J8Y A;  4WEK A;  1ZHH B;  3OZH A;  1XX2 A;  5DF9 A;  1HZO A;  2VV8 A;  4KZ9 A;  2X02 A;  3T1Q B;  4BJP A;  2WGI A;  2L0W A;  2VGL S;  5FAS A;  4MLL A;  1L0E A;  2HPB A;  2OWJ A;  5CED A;  1MKI A;  3HRE A;  3UDX A;  5FI7 A;  5A8B A;  2W3H A;  4DJ2 A;  2IWD A;  1PI5 A;  2OOL A;  2M7V A;  1XA1 A;  5DTK A;  1S1Z A;  2EX8 A;  1I5Q A;  4PM9 A;  3OPL A;  2Z2M B;  3NOT C;  4NXF A;  4BBT A;  4H6J A;  1D06 A;  1LL8 A;  3IWI A;  5LBR A;  3IF5 A;  3SW1 A;  3PAG A;  1G5U A;  4QJG A;  2WGW A;  3DAV A;  3KYE A;  3LIA A;  1HD8 A;  3UE6 A;  3A3E A;  2EWV A;  1L3L A;  3MS6 A;  3CMZ A;  5HDD A;  1K55 C;  3IH9 A;  4R4R A;  4IED A;  5TFQ A;  1UGU A;  1ES2 A;  2QHK A;  2JKR I;  3R4K A;  4IJG A;  4LV1 A;  3LI8 A;  3DTE A;  4EV4 A;  5EOE A;  2M1C A;  2KX6 A;  4ZJ1 A;  2VX8 A;  2X71 A;  5FQQ A;  1N9B A;  4R70 A;  3VOL A;  3AGE A;  5U47 A;  3QP6 A;  5L2F A;  4QU3 A;  4X25 A;  1T1B A;  2EX9 A;  4EW7 A;  1C3B A;  4LPZ A;  2OAP 1;  2Y8H A;  3FZC A;  3ISG A;  1I2W A;  2WAD A;  2H28 A;  4KQR A;  3OPR A;  2CMN A;  1WYB A;  1E4D A;  4R3A A;  2ZL1 B;  2V2F F;  3LYX A;  4DN0 A;  4KZB A;  2JCH A;  2V0U A;  2GDN A;  4MN7 A;  5HWT A;  3ZG5 A;  4NET A;  2ZQ8 A;  3CUE C;  1Q2Q A;  5JYP A;  1MXO A;  4F94 A;  2JKR M;  1UWN X;  2XD1 A;  1N9O A;  2VEA A;  4KQQ A;  5DFX A;  3ZVT A;  3IWO A;  2P74 A;  1SKO B;  1I2S A;  2HP5 A;  2XD5 A;  4GKU A;  2GZA A;  3IH8 A;  4H8R A;  1KE3 A;  3GRJ A;  4N92 A;  2OWH A;  3HJK A;  2OV5 A;  2W3D A;  2RCX A;  4KZ5 A;  1W7F A;  1F2K A;  2JHE A;  3T1X A;  4ARZ A;  3IX3 A;  2OAQ 1;  3HLF A;  1SKF A;  3WRT A;  4M4X A;  4E3N A;  2PAV P;  4ETX A;  1K6S A;  3R7W B;  4BWI A;  1G28 A;  3CLO A;  1M40 A;  3VFH A;  2Q9N A;  2XRO A;  1CQA A;  1E25 A;  3MXS A;  1XJ3 A;  3LFV A;  3H82 A;  1XXM A;  2Y2P A;  2J3T D;  2CC1 A;  2HDR A;  3OCN A;  3UNW A;  4HOI A;  4IVK A;  3N8R A;  2VKS A;  3BY9 A;  3PBQ A;  2UWX A;  2ZOI A;  3QP1 A;  2X01 A;  1BUE A;  3MZF A;  4GS9 B;  4Y17 A;  3MSH A;  4S2O A;  1F98 A;  3T4J A;  3KSI A;  2B95 A;  1ESU A;  3A0S A;  5L10 A;  2HJE A;  1GCE A;  3VFF A;  3C7U A;  3P7N A;  4NXE A;  4FH4 A;  1NWZ A;  4GHI B;  4WYY A;  4O01 A;  4WZ4 A;  5CGS A;  5DJT A;  4G3K A;  1S67 L;  4G3V A;  2QZ6 A;  4PKY A;  2JKF A;  3S7O A;  1ERM A;  2H5S A;  5EPH A;  5FAP A;  3MBZ A;  4L0L A;  1W8Y A;  4KG5 A;  2PYR A;  4KQO A;  3F1N A;  5G4Y A;  4FH2 A;  3NDG A;  1MPL A;  1NYM A;  2MJ6 A;  4UQI S;  3Q82 A;  3W8K A;  3LO7 A;  1XFN A;  2Y79 A;  1IYS A;  2ACG A;  3C4P A;  1PWG A;  4R1G A;  1U60 A;  1XP4 A;  3BQA A;  1KOU A;  3E2K A;  2EFX A;  3DTK A;  2EA9 A;  4OPQ A;  4HES A;  5EVI C;  3FYZ A;  3ZHH A;  1JVJ A;  3G6O A;  4S2P A;  3BFE A;  4GD6 A;  4RX3 A;  2K2N A;  4OPY A;  1J9M A;  5FQ9 A;  2G2U A;  5M1A A;  5I5L A;  2Y2M A;  2BAS A;  3IXD A;  4BL3 A;  1BLC A;  1DRM A;  3ZFZ A;  3Q07 A;  4HJ3 A;  3L7H A;  4KQD A;  3G2Z A;  3HLC A;  5DKK A;  2Y2O A;  4DE0 A;  2XF3 A;  4B93 A;  1NLZ A;  2HF6 A;  3M6H A;  3T1R A;  1AWI A;  1VET B;  3LR3 A;  2QPN A;  2ZC4 B;  3MKF A;  3PBO A;  4JF6 A;  4OQH A;  1YLW A;  3WS0 A;  3RH8 B;  4DRT A;  5F1F A;  2I9V A;  2HJ9 C;  2ZQA A;  2WKI A;  4GDN A;  1LI0 A;  3O88 A;  3G31 A;  2W3E A;  1W63 Q;  3M2K A;  3V50 A;  5CER A;  2Y2Q A;  4X68 A;  1PRQ A;  3F1P A;  3RFB A;  3T12 B;  2WUQ A;  5EM1 A;  5HWW A;  4X69 A;  2ZBB A;  4Y0O A;  1MWT A;  3T4K A;  4PHT A;  3DTM A;  2ZLY A;  1DP6 A;  3V67 A;  1JTD A;  3BLS A;  2JKT M;  3E98 A;  5L07 A;  4C6Y A;  3FKW A;  2XSS A;  2ZMF A;  3B47 A;  1OT6 A;  2XK1 A;  3EGD C;  1OPX A;  2A49 A;  3NIA A;  3OPP A;  2VJW A;  1L0F A;  4L9G A;  2OSU A;  3RXW A;  1SHV A;  4ZRR A;  1K55 A;  2ZQ7 A;  5IS1 A;  1ODV A;  3T1S A;  5DVA A;  4ZTK A;  5CTN A;  1O07 A;  1PZO A;  5FQK A;  3C5A A;  4QB8 A;  2PR5 A;  2J9P A;  3A3I A;  4Z1W A;  5FAT A;  4M3K A;  2Y2L A;  5AQ9 A;  3IWQ A;  1VHM A;  1VM1 A;  2Z6C A;  4DDY A;  2B18 A;  2ZC7 A;  1STZ A;  2XDM A;  4EU0 A;  1L0G A;  3ZVW A;  4GN2 A;  3IQA A;  4N9L A;  2HDS A;  3CI6 A;  2PBY A;  3MXR A;  3PBS A;  2WYX A;  1BLH A;  3C4O A;  3OPH A;  4NXG A;  3E4O A;  4HY8 A;  3BEC A;  4JLF A;  3S22 A;  5DKL A;  1H8M A;  4HBU A;  3B42 A;  3UB6 A;  2XR0 A;  3KYZ A;  3LIE A;  3MQ0 A;  3IF6 C;  4KUK A;  1JWP A;  4K0W A;  1QME A;  2IA2 A;  5K5B A;  5TBM B;  5CEC A;  2UV0 E;  1LL5 A;  4MDZ A;  4XUZ A;  5HSQ A;  4KZ3 A;  4C75 A;  5FAO A;  4P87 A;  4WMC A;  3FPW A;  1IYP A;  2EFU A;  4HHD A;  3D4F A;  3CPT A;  3NEC A;  2Y2N A;  4X53 A;  4P6Z S;  2ZOH A;  1RGY A;  3HUN A;  2O99 A;  3A0V A;  4DXB A;  4DDS A;  3BW6 A;  4IBR A;  1BTL A;  3IXG A;  4P6Z M;  1BLP A;  1LHY A;  1GA0 A;  4KZ4 A;  1P9R A;  2KDK A;  1S4S A;  2PD8 A;  3MR0 A;  4NXB A;  4XT2 A;  1X0O A;  1MC0 A;  2O0Y A;  2ZQC A;  2VGJ A;  2VA0 A;  4EBP A;  2ZM2 A;  1DP9 A;  4U0X A;  3E0Y A;  2Y59 A;  3A3D A;  2P7J A;  4K0X A;  1K25 A;  3BEB A;  4H6J B;  1FSY A;  1OJG A;  1BT5 A;  3VP1 A;  4Q0H A;  4CQH A;  3A3J A;  2PRF A;  1GHM A;  5CHJ A;  3DWZ A;  4HH2 A;  1WA9 A;  1IFQ A;  1HTZ A;  4II7 A;  3ULF A;  5DJU A;  2W1R A;  5FDS A;  3OBF A;  3WRZ A;  3RXX A;  3UME A;  4OOM A;  4WF0 A;  2K31 A;  1F9I A;  2WAF A;  1K0K A;  4K91 A;  2A24 A;  1SDE A;  5FAQ A;  1S66 L;  4YWZ A;  4UA7 A;  4OPR A;  1K56 D;  4WBG A;  1NLY A;  1CF0 A;  1NXY A;  1YT4 A;  1OTI A;  4ID4 A;  1EW0 A;  5HW3 A;  5M18 A;  4JGO A;  2Q9M A;  2Y4A A;  3UO9 A;  1S6R A;  3MQO A;  1YLZ A;  4R0Q A;  5IU1 A;  3G30 A;  5HD3 A;  3GQZ A;  1K38 A;  3HL9 A;  1YPR A;  4CLC A;  5J4E A;  2B02 A;  2YKF A;  5G18 A;  2QWS A;  4OLD A;  4X56 A;  1BLS A;  3BFC A;  2NUT C;  5CRF A;  3D9Y A;  3LR0 A;  3W4O A;  4Y2F A;  2OLV A;  4WEJ A;  1V9Z A;  1IKG A;  3WS4 A;  3S4X A;  4DKI A;  1FCN A;  3N8S A;  1P97 A;  4GD8 A;  5GLA A;  4DE1 A;  4JF5 A;  4WUJ A;  4PM8 A;  3PBN A;  3C30 A;  4UA6 A;  3LEZ A;  4Y7P A;  3ZCZ A;  3O5Y A;  5EVI A;  1ZTU A;  3ZG8 B;  1JTG A;  5A93 A;  3EQU A;  1PNE A;  2OLU A;  3KX0 X;  2H10 A;  5FI6 A;  5CHM A;  5HL1 A;  2V9A A;  4ARZ B;  3BY8 A;  1XJ2 A;  1Z6F A;  3PTE A;  3IBR A;  3EQV A;  4LV2 A;  4E6X A;  3QP4 A;  1CEG A;  5CXW A;  1QMF A;  3CIT A;  3BLM A;  1TD5 A;  5FEG A;  3L9K A;  4JKT A;  5F68 A;  2WGV A;  4O0P A;  4UAA A;  5EEC A;  1KGE A;  4IVI A;  2Y2G A;  3G32 A;  1ZKJ A;  3MFD A;  3PXP A;  3DTI A;  3IHB A;  1ERO A;  4OH0 A;  3N6I A;  3H82 B;  5FL3 A;  3UPN A;  1OME A;  3LUQ A;  1FR6 A;  2Y91 A;  1GA9 A;  2PDR A;  4YIN A;  3IS2 B;  3GDI A;  1YQS A;  4EWF A;  3S7P A;  1CJF A;  4GZB A;  5KZH A;  4JGP A;  4LRY C;  2QKP A;  5AVE A;  4R4S A;  3NHQ A;  1Q2P A;  1N9L A;  3K3C A;  4LLO B;  4PM6 A;  1IKI A;  2HZ5 A;  5A92 A;  5HAQ A;  2ZC3 B;  1NZU A;  3S7N A;  1XPB A;  2PBD P;  2WZZ A;  4GDB A;  4B4Z A;  3F1O A;  5HDS A;  3FC7 A;  1NJ4 A;  4BEN A;  1OTE A;  5HX9 A;  1CI9 A;  4ZJ2 A;  2J3T C;  2Q0O A;  3DW0 A;  3N7W A;  3BFF A;  3NJA A;  2PYP A;  4PMA A;  4D60 A;  3MXQ A;  2G7U A;  3ZDJ A;  1P0Z A;  2R78 A;  5GLB A;  1KDW A;  3Q7Z A;  3ZNY A;  2P9V A;  4YNR A;  4X55 A;  4I39 A;  3F1N B;  1D1J A;  1T1C A;  4NKP A;  4KZ6 A;  1E3U A;  1MWU A;  5KMW A;  2LB9 A;  3B33 A;  1NRF A;  3UPP A;  4P0M A;  4CLC E;  5CGX A;  4R38 A;  4ME4 A;  4I3J A;  3M6B A;  4O7D A;  1YSP A;  2R9W A;  3I7J A;  1KVL A;  1GSW A;  1TVF A;  2W3F A;  4GJ4 A;  4HJ6 A;  1TS0 A;  4OOY A;  1FCM A;  1F5M A;  1ONH A;  2C5W B;  2ZMA A;  1HLU P;  1ERQ A;  1FCO A;  4DF6 A;  5F83 A;  2PU4 A;  3CJM A;  3O87 A;  4E6W A;  3PYP A;  4UHU A;  4U3T A;  3T4T A;  1SDN A;  3IF6 A;  4R3B A;  1OTB A;  4OPZ A;  4I5S A;  3VV4 A;  5F69 A;  5MC7 A;  4N1H A;  1IYO A;  1YLJ A;  2JBF A;  4OP5 A;  3MJQ A;  3SZT A;  2ZM0 A;  4ZBE A;  2A3U A;  3B3X A;  1EWZ A;  4CLC C;  4ETZ A;  2VLG A;  3D3O A;  4ESP A;  2YKH A;  3TOI A;  1OTD A;  5BOH A;  4C3Q A;  1N9N A;  3OC2 A;  4GCZ A;  2JN7 A;  1HVB A;  4F3L A;  5J7E A;  3WS1 A;  5KIZ A;  3OLO A;  4LCM A;  3U4L P;  3SS4 A;  5DTS A;  3N8L A;  4BBV A;  4IUH A;  3F1P B;  3Q7V A;  3TG9 A;  3T4S A;  2JKG A;  3A3F A;  3IXH A;  2JKT I;  2ZD8 A;  1ESI A;  3N4I A;  2ZJ9 A;  5DF8 A;  4EUV A;  1PI4 A;  2LB5 A;  3UPO A;  1T18 A;  3W4P A;  1Y28 A;  1V9Y A;  2ZMV A;  3ZG0 A;  4S2N C;  1RP5 A;  3LR5 A;  4GHI A;  5FSR A;  3RTY A;  3S7Q A;  2J80 A;  4BL2 A;  3EOI A;  5C5K A;  4HIA A;  3LI9 A;  5DF7 A;  2QYB A;  3VP4 A;  2WKQ A;  3BRM A;  3PBR A;  3K2N A;  4B9O A;  1XJ4 A;  5EVI D;  3AGD A;  1MZU A;  1G68 A;  2DMW A;  2D01 A;  2Y2K A;  3BM6 A;  4GOG A;  4QPR A;  2IWC A;  2XQZ A;  4FCF A;  4OVD A;  3SH7 A;  1XKZ A;  5F82 A;  4XUX A;  5FI2 A;  2L1M A;  3JVV A;  4E3O A;  2AVX A;  4WZ5 C;  4LRX C;  1JWZ A;  1K4F A;  3HCY A;  3SS5 A;  3MFX A;  5D3O A;  5HZH A;  3BQ8 A;  1BZA A;  2JC7 A;  3ZNT A;  2V8C A;  1S1Y A;  3NCK A;  4PM5 A;  1ONG A;  3ZG9 B;  4OLG A;  3CAX A;  2ZM8 A;  1AXB A;  4WLA A;  4HJ4 A;  2XFT A;  2HV1 A;  1OTA A;  2DNS A;  3MKE A;  3H9W A;  4NK3 A;  1LT0 A;  3UN7 A;  1MBL A;  4S2J A;  4KEN B;  3UY6 A;  3UB7 A;  3V3R A;  1ALQ A;  1W79 A;  4FOF A;  3H7W A;  1GHI A;  1PW1 A;  1XGJ A;  2QMI A;  4CJN A;  3UB9 A;  2GX5 A;  2EX2 A;  1W8Q A;  5F1G A;  2PT7 A;  3SS3 A;  1LI9 A;  3T4L A;  3QP2 A;  2EX6 A;  3CPT B;  4OQG A;  4G3W A;  1YMS A;  1NYY A;  3T4O A;  3HJI A;  4Q8I A;  3FKV A;  1NY0 A;  4XT2 B;  4OOL A;  4WL9 A;  2HP6 A;  1PYY A;  4S2L A;  3ZG7 B;  1UWP X;  1H5X A;  4XXR A;  4ZJ3 A;  5GHX A;  1YSQ A;  4WN5 A;  4JGQ A;  2NUP C;  3VP2 A;  3C7V A;  5GL9 A;  5CEB A;  4HH3 A;  4Y0U A;  3ZYT A;  4EEU A;  2DCF A;  3SH8 A;  3JYI A;  4Y5F A;  4E3L A;  5L8M A;  3O86 A;  1WYC A;  1ES3 A;  1TDG A;  5EVE A;  5FQM A;  1ZG4 A;  4NEE D;  4E3I A;  3NBL A;  3K3D A;  1IOU A;  3NUL A;  4U0T A;  2W1T A;  1L2S A;  2Y2I A;  3LEQ A;  5EOO A;  1FIL A;  2A24 B;  1GSX A;  1ES4 A;  3IXB A;  4FUW A;  5FQJ A;  3FV7 A;  3U2A A;  4DE2 A;  1TS6 A;  2WKR A;  5DFY A;  5AVF A;  4MBH A;  3UMD A;  2J7V A;  1Y54 A;  1J3W A;  5G4Z A;  5IT5 A;  3KO6 A;  4MMN A;  5J8X A;  4FD8 A;  1YLT A;  4EQ1 A;  3JPU A;  2WGW B;  3MZD A;  2XFS A;  1YLY A;  5HL6 A;  4JBF A;  4WEL A;  1LSV A;  4Y0T A;  2Y2H A;  3KYQ A;  2EWW A;  1T19 A;  5HD5 A;  1NZO A;  2C6W B;  1DY6 A;  3JVU A;  3V3S A;  4B4X A;  5DTT A;  1MY8 A;  2O9C A;  4OQI A;  1M6K A;  3GSG A;  3HLG A;  1FOF A;  3LIB A;  3HLB A;  4FTX A;  3UE3 A;  4KZ7 A;  3LIF A;  5EVI B;  3FWL A;  4EBL A;  1CK3 A;  4HNB A;  2A2L A;  3OOV A;  5FQI A;  4JXG A;  3T50 A;  4RQ9 A;  2VGL M;  2W3G A;  1VQQ A;  4OKP A;  2W0N A;  4JXW A;  4LFU A;  3VMA A;  4S2M A;  1BUL A;  1LSX A;  4MBF A;  5EM0 A;  5EE8 A;  1H8Z A;  1LLB A;  2Y2J A;  1VEU A;  3ITB A;  4R6L A;  4YFM A;  3WS2 A;  1SZV A;  5FEF A;  1TDL A;  1Y4O A;  3MZE A;  1H3Q A;  3IHA A;  5HDC A;  3MF0 A;  3A0R A;  3NI9 A;  2GNX A;  4O8G A;  2M7U A;  3SOI A;  3QNB A;  2E8J A;  4YOF A;  5TR7 A;  1PW8 A;  1K6R A;  4EUZ A;  2ZC5 B;  1K57 A;  3BYD A;  4MN6 A;  5HPF A;  5FDH A;  5AQA A;  2WKH A;  4RA7 A;  4GNU A;  1G6O A;  1YM1 A;  4JGR A;  3BFD A;  5CTM A;  4LCL A;  4PAU A;  3F1O B;  4JXS A;  1GHP A;  4S2N A;  5F5Y A;  4EEP A;  4PKY G;  5HPI A;  5CHU A;  3VE3 A;  5HAI A;  5AQ7 A;  4DE3 A;  1H0M A;  2Z6D A;  4DXC A;  3GMW A;  3QP5 A;  4JF4 A;  1XFQ A;  3NOU C;  5E2G A;  5GLD A;  3BFG A;  2P9V B;  1DJA A;  4HP9 A;  3GR2 A;  1KVM A;  3CWF A;  2XA7 S;  3KSH A;  4E3J A;  2EXA A;  4ZDX A;  5TGF A;  3GVB A;  4QY6 A;  4K08 A;  2FZ0 A;  4IBX A;  2KLI A;  1O7E A;  5E2E A;  2P08 A;  3S1Y A;  2PHY A;  4MEZ A;  2XA7 M;  3UDF A;  4WZ5 A;  2QJ7 A;  4GLQ A;  1JWV A;  2Z2L B;  1IEM A;  3SH9 A;  4Y13 A;  1SCW A;  3VP3 A;  3DWK A;  2B5R A;  1JNU A;  2V0W A;  1K4E A;  4MN5 A;  1TF1 A;  2R9X A;  4MCW A;  3E4Q A;  3BJN A;  5A91 A;  2IWB A;  4GB7 A;  3HLD A;  4KZ8 A;  3OCL A;  4WMC D;  3W2Z A;  3VSL A;  4N1X A;  3IF6 B;  1NRJ A;  2J3W A;  4I38 A;  5GHY A;  5E43 A;  2VV7 A;  5KSC A;  2ZL1 A;  4HEF A;  4L9F A;  4LV3 A;  3TW8 A;  2VK3 A;  5EFW A;  4EET B;  1N4O A;  2ZC6 B;  4BQM A;  4IUK A;  2G2W A;  4Y15 A;  5E2F A;  1IYQ A;  2INW A;  3G34 A;  5J3W A;  2V1Z A;  2FFY A;  3IT9 A;  4E3M A;  1XA7 A;  2O9A A;  3EGX C;  3IS2 A;  4FSF A;  4L9E A;  1SKO A;  4F3L B;  5M19 A;  3P09 A;  3PBT A;  3V39 A;  2K7S A;  3VOY A;  5EUA A;  3LGO A;  4PPR A;  3CG5 A;  3QNC A;  3Q7V B;  4KZA A;  2V1A A;  1BYW A;  3IX4 A;  1LL9 A;  1K54 A;  3HLW A;  4IHQ A;  3E2L A; 
#chains in the Genus database with same CATH homology
 4Q0I A;  1DP9 A;  2H28 A;  3E0Y A;  3CAX A;  2CMN A;  4R3A A;  2P7J A;  2W27 A;  4H6J B;  1W63 M;  4WLA A;  1T1A A;  4HJ4 A;  3EEH A;  2HV1 A;  1OTA A;  3H9W A;  3R7W A;  1OJG A;  2QJ5 A;  1LT0 A;  4Q0H A;  4CQH A;  3LYX A;  4DN0 A;  2V0U A;  4MN7 A;  5HWT A;  3UB7 A;  4HH2 A;  1WA9 A;  4FOF A;  1IFQ A;  3H7W A;  1S4R A;  4II7 A;  3ULF A;  3CUE C;  5DJU A;  2W1R A;  3UB9 A;  2GX5 A;  3ZQ5 A;  2P04 A;  3OBF A;  2PT7 A;  2JKR M;  1UWN X;  3T4L A;  1N9O A;  3UME A;  5HWV A;  2VEA A;  4OOM A;  5DFX A;  4WF0 A;  2K31 A;  1F9I A;  2XRN A;  3EEA A;  2HGV A;  4UQI M;  2GZA A;  2A24 A;  4G3W A;  4GS9 A;  1S66 L;  3UB8 A;  4YWZ A;  4GW9 A;  3TRC A;  4CLC D;  2OWH A;  3HJK A;  2W3D A;  3T4O A;  3FG8 A;  3HJI A;  4I3A A;  1NLY A;  5F6A A;  3LID A;  2JHE A;  4ARZ A;  1OTI A;  1EW0 A;  4XT2 B;  5CX7 A;  2OAQ 1;  4OOL A;  4WL9 A;  4JGO A;  2O9B A;  4HQA A;  1UWP X;  3C8C A;  3MQO A;  4M4X A;  1YSQ A;  4WN5 A;  5IU1 A;  3LIC A;  4JGQ A;  5HD3 A;  2NUP C;  4CLC A;  4ETX A;  5J4E A;  3R7W B;  4BWI A;  2B02 A;  2YKF A;  1G28 A;  3CLO A;  4HH3 A;  3TJZ C;  3ZYT A;  4EEU A;  2XRO A;  2QWS A;  1OT9 A;  5KSH A;  1XJ3 A;  2NUT C;  4Y5F A;  3LFV A;  3H82 A;  3LR0 A;  5L8M A;  4Y2F A;  3H7W B;  2KOI A;  4WEJ A;  2J3T D;  2VZW A;  1V9Z A;  3OCN A;  3ICY A;  1VB6 A;  2PD7 A;  2WKP A;  4HOI A;  4KUO A;  4NEE D;  3K3D A;  1IOU A;  1P97 A;  2W1T A;  4WUJ A;  3PBN A;  2VKS A;  3BY9 A;  3C30 A;  5TJJ A;  3PBQ A;  3O5Y A;  2ZOI A;  2A24 B;  1ZTU A;  1GSX A;  4GS9 B;  4EER A;  3EQU A;  3EWK A;  3KX0 X;  1F98 A;  2D02 A;  3T4J A;  3KSI A;  3TE8 A;  3A0S A;  3U2A A;  3DBA A;  1LSW A;  2V9A A;  1TS6 A;  2HJE A;  3BY8 A;  1XJ2 A;  2WKR A;  5DFY A;  4ARZ B;  3C38 A;  3IBR A;  5AVF A;  1TS7 A;  3EQV A;  3P7N A;  4NXE A;  3UMD A;  4Y3I A;  2V1B A;  1NWZ A;  5G4Z A;  4UEY A;  4GHI B;  4HI4 A;  4O01 A;  3CIT A;  3KO6 A;  4MMN A;  4G3K A;  2GJ3 A;  5DJT A;  3T4Q A;  1S67 L;  4EES A;  3C2W A;  1TD5 A;  4G3V A;  4EQ1 A;  4PKY A;  3S7O A;  5F68 A;  4L0L A;  4O0P A;  5HL6 A;  4WEL A;  1LSV A;  2PYR A;  3KYQ A;  2EWW A;  1T19 A;  4KQO A;  5HD5 A;  3F1N A;  3FPV A;  3PXP A;  5G4Y A;  3JVU A;  2MJ6 A;  3H82 B;  4UQI S;  5FL3 A;  3LUQ A;  1XFN A;  2Y79 A;  2O9C A;  2PDR A;  1P9W A;  3VE4 A;  3MMH A;  3IS2 B;  3LIB A;  2FH5 A;  3GDI A;  2W1T B;  3MQQ A;  3S7P A;  3P01 A;  1D7E A;  3UE3 A;  4JGP A;  4LRY C;  2QKP A;  5AVE A;  3BQA A;  3LIF A;  3NHQ A;  1KOU A;  1N9L A;  3NOP C;  3K3C A;  4LLO B;  3BWL A;  4HNB A;  2A2L A;  3OOV A;  2PR6 A;  2EA9 A;  4AFI A;  4Q0J A;  3T50 A;  3D72 A;  3S7N A;  4RQ9 A;  2VGL M;  3F1O A;  1YKD A;  3G6O A;  2W3G A;  5HDS A;  3FC7 A;  2VV6 A;  1OTE A;  2W0N A;  2K2N A;  2J3T C;  1DP8 A;  1LSX A;  5I5L A;  4HP4 A;  3NJA A;  2BAS A;  2PYP A;  3MXQ A;  1DRM A;  2G7U A;  4R6L A;  1P0Z A;  2R78 A;  4HJ3 A;  1GSV A;  4KQD A;  4YNR A;  1H3Q A;  4I39 A;  5DKK A;  3F1N B;  5HDC A;  1T1C A;  3MF0 A;  1TS8 A;  3A0R A;  4NKP A;  4B93 A;  1NLZ A;  2HF6 A;  2GNX A;  4O8G A;  3CUE A;  2M7U A;  2L4R A;  3E4P A;  1YAX A;  2LB9 A;  3B33 A;  4CLC E;  3LR3 A;  3LR4 A;  4YOF A;  3KSF A;  3PBO A;  4ME4 A;  4I3J A;  4R38 A;  1MKM A;  1YSP A;  4MN6 A;  3RH8 B;  5HPF A;  1OJ5 A;  4LRZ E;  2I9V A;  5AJG A;  2HJ9 C;  1GSW A;  2W3F A;  4GJ4 A;  2W3E A;  4HJ6 A;  1TS0 A;  1W63 Q;  1F5M A;  1G6O A;  3F1P A;  4JGR A;  3RFB A;  4BMW A;  5HWW A;  4PAU A;  3F1O B;  2ZBB A;  3IBJ A;  3T4K A;  4PHT A;  3PYP A;  1DP6 A;  4I3I A;  3T4T A;  5F5Y A;  3V67 A;  4EEP A;  2JKT M;  3E98 A;  3PR6 A;  4EXO A;  1XJ6 A;  4PKY G;  5HPI A;  3GEC A;  3VE3 A;  1OTB A;  2XSS A;  4I5S A;  3VV4 A;  2ZMF A;  4CLC B;  5F69 A;  3B47 A;  5MC7 A;  1OT6 A;  3EGD C;  1OPX A;  2Z6D A;  3MJQ A;  3KSG A;  3PHY A;  2VJW A;  4DMZ A;  1XFQ A;  4L9G A;  3NOU C;  4E04 A;  5TBM A;  4CLC C;  4DJ3 A;  4ZRR A;  4ETZ A;  2VLG A;  5IS1 A;  1ODV A;  4HP9 A;  3CWF A;  2XA7 S;  3KSH A;  3D3O A;  2YKH A;  4BBU A;  4WEK A;  1OTD A;  1ZHH B;  1N9N A;  4K08 A;  5DF9 A;  2FZ0 A;  2PR5 A;  2VV8 A;  2KLI A;  2P08 A;  4Z1W A;  3OC2 A;  2PHY A;  4BJP A;  2XA7 M;  4GCZ A;  2L0W A;  2JN7 A;  2VGL S;  2QJ7 A;  4GLQ A;  1VHM A;  4F3L A;  2Z6C A;  5J7E A;  2B18 A;  1STZ A;  2OWJ A;  5KIZ A;  3OLO A;  1JNU A;  2V0W A;  4MN5 A;  4BBV A;  4EU0 A;  1TF1 A;  4IUH A;  4MCW A;  5A8B A;  3F1P B;  3E4Q A;  3T4S A;  2W3H A;  4DJ2 A;  3BJN A;  3CI6 A;  2OOL A;  3PBS A;  2JKT I;  2M7V A;  3OCL A;  4NXG A;  3E4O A;  4HY8 A;  4EUV A;  3W2Z A;  1S1Z A;  2LB5 A;  1NRJ A;  5DKL A;  2J3W A;  1H8M A;  3NOT C;  4NXF A;  1T18 A;  4I38 A;  1Y28 A;  3B42 A;  1V9Y A;  3UB6 A;  2ZMV A;  2VV7 A;  4BBT A;  3LR5 A;  4H6J A;  4L9F A;  3KYZ A;  3LIE A;  1D06 A;  3MQ0 A;  4GHI A;  4KUK A;  3RTY A;  3S7Q A;  1LL8 A;  2J80 A;  3TW8 A;  5LBR A;  3SW1 A;  5EFW A;  3EOI A;  5C5K A;  4EET B;  2IA2 A;  4HIA A;  3LI9 A;  5K5B A;  2QYB A;  5TBM B;  3LIA A;  4IUK A;  2WKQ A;  3UE6 A;  3PBR A;  4MDZ A;  3K2N A;  5HSQ A;  4B9O A;  1XJ4 A;  2EWV A;  2INW A;  1MZU A;  2DMW A;  2D01 A;  3FPW A;  5J3W A;  5HDD A;  1UGU A;  4QPR A;  4HHD A;  2QHK A;  2JKR I;  3R4K A;  4IJG A;  2O9A A;  3EGX C;  3LI8 A;  3IS2 A;  4FSF A;  4L9E A;  4F3L B;  3PBT A;  2M1C A;  4P6Z S;  2KX6 A;  2ZOH A;  5IT5 A;  2L1M A;  3JVV A;  2VX8 A;  2O99 A;  3A0V A;  2K7S A;  4LRX C;  3BW6 A;  4R70 A;  3HCY A;  3VOL A;  2V1A A;  3MFX A;  1BYW A;  4P6Z M;  1P9R A;  2KDK A;  1S4S A;  1T1B A;  5HZH A;  2PD8 A;  3MR0 A;  4EW7 A;  4LPZ A;  4NXB A;  2OAP 1;  2Y8H A;  1X0O A;  4XT2 A;  1MC0 A;  2O0Y A;  3BQ8 A;  4IHQ A;  2VA0 A;  1S1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...