4WMEA

Crystal structure of catalytically inactive mers-cov 3cl protease (c148a) in spacegroup c2
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
306
structure length
306
Chain Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Middle East respiratory syndrome coronavirus 3C-like protease reveal insights into substrate specificity.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Hydrolase
molecule keywords MERS-CoV 3CL protease
total genus 85
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4wmeA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wmeA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wmeA02
2WYJA 1BA8B 1BTHH 1KXCA 1J9CH 4WH6A 3S7KB 1EB1H 3ATLA 1K1JA 4ZMAH 1FN6A 3UTUH 4GAWA 3RXCA 1EQ9A 1AE8H 3TIUA 2Z9KA 1O2LA 2W3IA 4GVUA 1SHHB 1IQLA 2G8TA 1G30B 1UTKA 3PMBB 2WPJS 3A7XA 3E90B 1P11E 2BY9X 1FAXA 4AG2A 1WBGB 2FTLE 5SGAE 2XBYA 1L0ZA 2J34A 1DICA 3VPKA 1S6HA 5EU8A 1K1LA 4ABGA 8ESTE 4E05H 8GCHG 4WJG2 3LKWA 1GHAG 3U8RH 1MD8A 1SLUB 3BF6H 2BX4A 1FPHH 1L1GA 1BTYA 1VCWA 3ATWA 3RU4T 1TLDA 3SI4H 2ZGCA 1MKWK 1PQ8A 4JCNA 3A87A 5ESTE 1NRRH 4TWWA 1QQUA 2FOMB 4A5TS 3NXPA 4FVBA 4B2AA 1ELEE 2OCVB 1AHTH 1NRNH 1O37A 3M3SA 1BDAA 2Z9IA 1GI9B 2ANYA 1BBRH 3U8OH 1BHXF 3P6ZB 3UFAA 1ZOMA 4BOHA 2PW8H 3UWJH 3LGTA 1ORFA 1WTHD 3PM3A 1Y3VA 3BV9B 5I46H 1ZLRA 3ZZ5A 1LDTT 1MTWA 2ZTXA 4X8VH 2GTBA 1L4DA 3UR6A 1GJ9B 3RDZA 3SORA 1AKSA 1HAIH 1GG6C 2P93A 1W0YH 1LQDB 4MG3A 4PROA 1TBZH 4K8YA 3ZZAA 1GBFA 3GYLB 1C5RA 3UWIA 4WH8A 2ZHWH 2GP9B 1MD7A 1C1OA 3M5NA 1X7AC 2R3YA 3GICB 1SQAA 4IW4E 4A1VA 2G55A 2ZDKA 1C5QA 4GPGA 6ESTA 1QBVH 1CBWC 2TBSA 1JBUH 1HAVB 4AOQA 3Q3YA 4BTIB 1NM6A 2GZ7A 1NRPH 4AFUA 3SU3A 3RLYH 1UTLM 2FI4E 4NZQA 1XX9A 1Z6EA 1PFXC 1TNJA 1EJNA 1GBTA 1DANH 1SBWA 3A89A 4B76A 1KIGH 2ZG0H 4U30A 2J94A 4FUIA 4AN7A 1NFWA 1YPJH 3FVFB 5DO4H 2FTMA 2PGBB 4A7IB 1FN8A 2BY7X 5DP5A 3TJNA 3SGAE 3KQDA 2AYWA 1NROH 1A0HB 3BTTE 1O39A 1FONA 1ETRH 3MH7A 2FX4A 1DX5M 1RXPA 2RA0A 1DLKB 4AB9A 3P8FA 1BBRE 1ZMNA 2OUAA 3LDXH 1U6QA 3SOSA 3UREA 1H9HE 1VGCC 1A2CH 3P8NA 4GLYA 1O2OA 1ANDA 3NPSA 1TNKA 1GBCA 1G36A 4X6PA 4CRAA 2GV6A 4Q80A 3BG4C 4Y8ZA 4CHAB 1LKAA 2QGRA 1MTNC 2FMJA 1C5VA 3F1SB 3PO1C 5L30H 2WV5A 1KLJH 4JYUH 1HYLA 1CO7E 3VB5A 1QBNA 1G3CA 1G3DA 3MWIU 4H42U 1SLVB 1MTUA 1PQ7A 1RGQA 4O3UA 1DE7H 3U1JB 3RXQA 3M5LA 1HB0B 1AFQC 4ABBA 5ABWA 1EKBB 1BMNH 1CHOF 1C1UH 1CE5A 1TGBA 2FIRH 4MPWA 5TCAA 1TYNA 1GJ5H 1WQVH 2HPQH 2QCYA 2PSXA 1BQYA 3RC4A 3M5OA 2STAE 1VGCB 2ANWA 2F9VA 1NU9A 4NSVA 1INCA 1MTVA 3BG8A 2CJIA 1GHBG 1GMDG 1V2LT 3RC5A 2ZA5A 4Z0KA 1F2SE 1HAVA 2G52A 4YM9A 2AEIH 1W0ZU 2EI7A 4D8NA 2WYGA 4SGBE 4K1EA 3SU1A 3GISB 1P2MA 3D65E 2VIQA 1XUJA 1QNJA 1W11U 1CA0C 3F9HA 1S81A 2CGAA 3M61U 4I7YH 4I33A 3MFJA 1GBHA 2XW9A 2HLCA 1KXBA 2QN5T 3EDXB 4O03A 5CHAB 1RTLA 3RP2A 3K6YA 3FAOA 1AIXH 5T3HA 1O2GH 1NRQH 1EPTA 1YP9A 4OGXA 3FP6E 3KNXA 2WPMS 4X1PU 2ZQ1A 3GCHB 4UFGH 2O8TA 1IQJA 5FCKA 2FWWA 4X1RU 5E2OA 1P2IA 3UOUA 4K1SA 1C5PA 3A7ZA 1TOCB 3MOCA 2ZCLP 1SB1H 2V3OH 2H9TH 3JZ1B 1GBKA 3N7OA 1G2MA 1SGFG 2VH6A 2ZU2A 3LH1A 5DKMA 1P9UA 2AIPA 1AQ7A 1O2JA 4DGJA 2BY6X 1ACBE 4NFFA 3M36A 4JMYA 1ZR0A 2F9BH 1TX8A 1C2GA 1FZZA 2ALVA 3ZZ3A 1SGCA 3E16B 1C5OH 2J92A 4BXWA 4DW2U 1MTSA 1P02A 1O35A 2V0BA 4B74A 3HKIB 3UNQA 3GDUA 3OTJE 1YPGH 2Y7XA 1Y3XA 2ZU1A 4K5ZA 2PV9B 4FUBA 3NWUA 4X6NA 1E35B 1EZXC 2GZ8A 2RCEA 1VITG 2G00A 8KME2 1C5WB 1SLXB 3LGUA 2B7DH 3RXHA 3M5MA 2AGIX 2FX6A 3TNTA 2FOFA 1A61H 1O3FA 3GY8A 1W2KH 1HXFH 3UPEA 1HFDA 1FAKH 4YZUA 2Y5GA 1O3JA 2J38A 1SGTA 3ZYEA 1CT4E 1YC0A 1EXFA 4NA7A 1GCTC 1AI8H 1OWDA 2M5TA 4WMDA 4LZ4B 2ZHQH 3EE0B 5C1YA 5FBIA 1G3EA 5FPYA 2IJOB 1K1IA 2ZI2H 1BT7A 3SUEA 1A1RA 4YOGA 1HJ8A 5JBBS 3ZV8A 4CR9A 3HGNA 2A4OA 2OD3B 2VVUA 5EW2H 5DP8A 1YPEH 1YCPK 1CHOG 4AG1A 2OINA 3T62A 1BTXA 5HM2A 2ZZUH 3LOXA 1GHBF 3A7WA 4FUCA 2VH0A 3SJ8A 3PWBA 2XC5A 1D3DB 2ZPSA 1P57B 3MH5A 4CH8B 5J4SA 2ZIQH 1O3NA 1QA0A 2UUFB 1UVPA 2J9NA 2VU8E 4FUFA 3LJOA 1G9IE 1ARBA 4OGYA 2ZU3A 1SR5C 3LGIA 1AE5A 1EX3A 3KF2A 3GYMA 1PQAA 1V2JT 2IN2A 3FP7E 2THFB 2ODYB 1A3BH 1LHCH 3LC3A 2SGEE 3BTQE 4TY6A 1DWBH 2BY5X 4IBLH 2SGAA 2P3TB 3OX7U 4KKDA 1HAPH 1TNLA 1O33A 3MH4A 2A2XH 4ASHA 4Y0YE 4YLUA 1L4ZA 1S84A 1B0EA 2FYQA 2G51A 4Y0ZE 1J16A 1OPHB 2GCTC 2A5AA 3SHAH 4ZHMU 5EQSA 1VCPA 3ATKA 4AYYB 4Y76A 5E0HA 2QV1A 2R3UA 2GVFA 3AVZA 2FDAA 1MU6B 1V2NT 3I29A 1YPLH 3V3MA 1FPCH 2FODA 3RXSA 2ZTZA 5E2PA 3E6PH 4XFQA 1GMHF 1SVPA 1AD8H 2WV4A 3RMLH 1GMCG 3A8CA 2NU3E 1GJ4H 1KDQB 5AFZH 4BAQB 4JZEH 1O3GA 1W8BH 2AMPA 2WPHS 1V2UT 3SW2B 2BDBA 1ELBA 1HAHH 4D76A 1THPB 3M35A 3M7QA 1IQKA 3RXGA 1A7SA 4ESTE 2LPRA 2A32A 3H5CB 4AFSA 5GWZA 1D6WA 4RSPA 4BAHB 3RM0H 3TK6A 2BDIA 2VVCA 4NA8A 4OS6A 1GJ8B 1MTNB 1Z8JB 1SI5H 1XVOA 3GY6A 1H8DH 1GG6B 2FOCA 4ABEA 3UY9A 2ALPA 2XC4A 1ZMJA 1WQSA 2Q6FA 1W14U 2DE8A 4AZ2B 2BDGA 3TH2H 3UQOA 3DFJA 3KQBA 4ZXYH 3A8AA 4TPYA 1O3BA 1HIAB 3DA9B 1S6FA 2B9LA 3C27B 2ZEBA 2I6SA 2VIWA 1P9SA 2VJ1A 1L2EA 4YTAA 1DT2A 1GJ7B 2VB0A 1QQ4A 1NC6A 4X1SU 4B71A 1BTWA 1P09A 4LK4A 3QLPH 1O3DA 1HAZB 1QHRB 1ZGVA 2ZFQH 5TJXA 1TABE 5CHAC 4BTUB 1WV7H 4WXIA 2YOLA 2G5VA 2P8OC 3KGPA 2A1DB 1EPTC 4H6SB 4A1TA 5DP7A 4U2WA 1WAYB 4BANB 3SNDA 2AFQB 2ZFSA 1GJAB 2BYAX 1ELAA 3QTOH 4HZHA 2ZC9H 1DLEA 1XKBC 1Y5AT 1EP6A 1UCYE 5L2ZH 3MU4A 4ZKNU 2GGVB 1GL0E 1PPZA 2HNTF 1OWHA 3A8BA 1H8IH 1O2UA 1Z7KA 4KTCA 1YBWA 5DJ7A 3SV2H 8LPRA 1PYTC 1ANCA 1SMFE 5JYIA 2K1QA 3AAVA 1AGJA 4IN2A 1GI1A 2A5KA 2PUQH 4MVNA 2O8MA 1UJ1A 5A2MH 1C1TA 2NU1E 1EOLA 3QDZB 4X2XA 2EI8A 2ZFRH 2CXVA 3URCA 1P2QA 7GCHG 4CBOA 4Y8XA 1EPTB 1LPGB 1JXPA 1N8OB 1UK3A 1YKTA 3SUDA 1ANBA 1ESAA 2PGQB 2Q1JA 3P70B 2Z3DA 4JZ1A 1ESTA 3AW0A 3MO9A 2QXIA 1E37B 1EZQA 1V2VT 1BHXB 3F9EA 1Z8RA 1V2OT 4INKA 2JH0D 4ISNA 1OWKA 3V13A 2BMGB 2ZCHP 2ZP0H 4INHA 1D6RA 3RXOA 4MDSA 3T26A 3BTME 1RJXB 1YPHC 1LQEA 2CHAC 3JZ2B 2UWPA 2FOGA 5L6NH 3FZDA 2PKSC 1F0SA 2ZFPH 3FZZA 3DUXH 2Y82A 4Y8YA 1UK2A 2P59A 2Q6GA 3QGNB 1K22H 3RXLA 4KELA 1FLEE 2HOBA 1KLIH 3HK6B 1V2MT 3BEIB 3VB6A 1BZXE 3MNXA 1HJ9A 2HALA 1O5CB 1DSUA 4DURA 4NIXA 3O8RA 2R2WU 1YCPH 2IPHA 2BVSH 4K2YA 3TGIE 1C2IA 3KEEA 1ZTLA 3UUZA 1O34A 2XC0A 3O8CA 3IITA 1A46H 1D3PB 1MAXA 2ZO3H 3PLBA 3NZIA 2ESTE 7KMEH 1O3PB 2GDDA 1LCYA 1IQIA 3PLPA 2ZKSA 4MPXA 3IWMA 2FI3E 4IC5A 1ELDE 3ZZ7A 4YOJA 4BAOB 1Q3XA 2ZFTA 2A2QH 2W3KA 4D7GA 4OS4A 3TLOA 1AZZA 1P12E 3E8LA 1F5LA 1C1RA 1V2ST 3MHWU 3CS7A 3RXIA 1Z6JH 2BDYA 3KQEA 1C5NH 3QGJA 3TITA 3UQVA 1UHBA 2W26A 1QRWA 4JZFH 1IHSH 4CRDA 1P2NA 1AZ8A 1DY8A 3OSYA 1BOQA 2RA3A 1ETTH 2CMYA 3ITIA 9LPRA 3ZZCA 3SQHE 1K2I1 5AVDA 2GT7A 3OYPA 4CRGA 2OC0A 1D4PB 5GCHG 1OXGA 1AWFH 2ZGJA 1A4WH 3GCNA 4A92A 4JYTA 2TRMA 3A88A 2B8OH 5C3NA 3LT3A 1C5SA 1YLDA 3W95A 4ZHLU 2W7SA 1OP2A 2ZDNA 3MNSA 1O2RA 1GI2A 1TMBH 4X6MA 3BSQA 1QB9A 2BHGA 4X2YA 2AERH 4O9VA 5A8XA 2OC1A 4TY7A 1XM1A 1WTGH 3ZZ4A 2J95A 3E1XB 3RXRA 4VGCC 1O3AA 3KHVA 1KYNA 4WY3A 2BXUH 3UIRA 1ZMLA 2F9NA 3ODFA 4H4FA 5F8ZA 1GHVH 4ABDA 1SOZA 2XWBI 1AKSB 1BIOA 1O0DH 1HIAA 2TGTA 2WINI 1FY5A 1GBMA 1TRMA 5A0CA 1HCGA 1O2KA 1JIRA 1O2WA 5EPNA 2FP7B 2WPIS 5HYOA 4UD9H 3TGJE 1GJBB 1SQTA 3NUMA 2PLXA 2QY0B 1HDTH 1AB9B 4X8UH 5JB8S 3KCGH 1HAYB 3LU9B 1ANEA 1FV9A 1T7CA 2A5IA 1Q31A 1BCUH 4NG9H 3A84A 1YPHE 2ASUB 3KQCA 1RIWC 5A8ZA 1CT2E 1C1MA 1AU8A 3BEFB 2P3FH 1P2KA 2H6MA 2P95A 2F9PA 4AX9H 1CT0E 1RTKA 1SHYA 4FU9A 4UFFH 1GI5A 4WMEA 1V2TT 4E7RG 4UFEH 1MKXH 2BZ6H 1GPZA 2ZDVH 5IDKA 5EQRA 4KTUA 2Z3CA 1LVBA 2A4GA 2VVVA 3MNBA 1G32B 1F5RA 1BJUA 2BVRH 1S83A 1YF4A 3GDVA 4A1XA 2QXGA 1THSH 4FUDA 2FM2A 1GBJA 2HNTC 1UCYK 1VR1H 2SFAA 2QXHA 1CQQA 4ABAA 1SL3A 2ZWLH 1C2EA 3ATMA 2O8WA 3L33A 1JIMA 5AF9H 1W12U 2HRVA 5GDSH 2UUKB 1S85A 1QIXB 1N8OC 1LPZB 5F8TA 4NWKA 1JMOH 3FANA 3TPIZ 5C67A 1GMDF 1AFQB 4AGJA 4XBBA 2HVXA 1PPCE 4ZKSU 1SGFA 1NZQH 2D26C 2SGFE 3RMNH 2G4UA 4O3TA 1LVOA 4NFEA 1DXPA 1HAXB 3ODDA 3SU5A 1FY3A 1CGIE 1QGFA 1ZZZA 3DT0H 4UONA 5C20A 5ETXA 1IQHA 3NK8A 3VB3A 3PTBA 1P2JA 3BG4B 3AAUA 5L2YH 3SHCH 1CU1A 1YYY1 3TH4H 1J14A 2G4TA 1QJ7B 1UTJA 1V3XA 2BD7A 3RM2H 4DIIH 3EBNA 3SO3A 3GCTG 1SPJA 1BRBE 2BDHA 3LC5A 1OP0A 3A86A 4MNYA 2ZECA 5EXNA 2CF9H 2ZFFH 1SQOA 2GCHF 1NFYA 1XXDA 1XXFA 1GBEA 1XMNB 2XXLA 3I78A 1QRZA 4NSYA 1K1PA 4XSKU 3RXEA 1O5DH 5JDUB 2YNAA 3TU7H 5E0GA 1JRTA 2SGDE 1GHYH 1ZTKA 3A80A 5DK1A 1T4VH 1C2DA 1BTUA 4I8LA 3QUMP 3RC6A 4JK6A 2CN0H 1FMGA 2YNBA 1UCYH 1V2PT 4HGCA 1K1OA 3O8DA 2LIZA 1WOFA 1TGTA 2VWNA 1UVUH 2EA3A 3LJJA 1SLWB 1E34B 2ZU5A 1O31A 1C5YB 5DP9A 4A6LA 1BTPA 4FXGH 2Y7ZA 4Y71A 1AUTC 3K9XB 3Q77A 2VWMA 4BTTB 4K8BA 1NU7B 2BVXH 1UHBB 1O2NA 1NESE 3MO6A 4WWYA 3NCLA 1BTZA 4YLQH 4KP0A 3TGKE 4DIHH 2BD2A 4UDWH 3TJOA 2FOEA 1TPPA 5K0HA 1HBTH 2JKHA 4E06H 1B5GH 1C5TA 1P05A 1C1WH 2ZTYA 3P17H 4CRCA 3OY5U 1GDUA 3TNSA 3B8JA 5J4QA 3FP8E 4U32A 3K2UA 3ZYDA 3F9GA 1C2LA 1DM4B 1LHDH 1O5GH 3ZVFA 2TIOA 2SNWA 2P94A 1PYTD 3LONA 2BB4A 3HATH 1CHGA 1V2WT 1TONA 1H9LB 1QRXA 4LZ1H 3M3TA 3GY2A 1OYTH 1ZHRA 2VWOA 1NN6A 4IMQA 2P8OB 5F8XA 1GBDA 1QJ1B 1P10A 3PLKA 3ENSB 2BLWA 1FUJA 4B2CA 1XUIA 9ESTA 1ETSH 1Q2WA 1TWXB 4AFQA 2R9PA 2AMQA 4ZKOU 5IYTA 1YPKH 3T29A 5EQQA 1IQGA 2W7UA 2OBOA 2AIQA 4B75A 4MNVA 1Z8IB 3SGQE 4INLA 2KAIB 1KXFA 4GCHG 1TRYA 1GI6A 2H1UA 2H5DA 1Z71A 3RXAA 3VEQB 4BNRA 4XBDA 1MH0A 2SGQE 1TGNA 1BRUP 2BM2A 4K3JA 1NFUA 4D9QA 3RXMA 1FJSA 1G3BA 4THNH 1GI4A 1Z8GA 3QX5H 4B73A 1BRAA 5EOKA 1MAYA 3DD2H 1Z1IA 1TAWA 5LH8A 5GIBA 2VIVA 5HM9A 2SGPE 1FY8E 3T25A 2TGAA 1MQ5A 1GJDB 2PKAA 1UMAH 1QL9A 4GSOA 4DG4A 5EGMA 1PPFE 4CRFA 3P92A 1C5ZB 3GCTF 3MU5A 3GCOA 4NCYA 3QWCH 1TPSA 5JBTA 3CP7A 1NY22 2C3SA 2HPPH 1TFXA 3QN7A 1AVGH 5AHGH 1O2TA 1RTFB 1SGYE 1F7ZA 4FU8A 1C4V2 1LHFH 3D23A 1P04A 3TJVA 4ABFA 2G5NA 1XUKA 1AO5A 4CBNA 1TX7A 3ELAH 5C5NA 1H1BA 2ZU4A 4RKOB 1K1NA 1HAOH 2BZAA 4HTCH 2XRCA 3SJ9A 8GCHF 2A7HA 2Z9JA 1NT1A 3MH6A 1ZJDA 1J17T 1GHZA 2Y80A 2BDCA 3C1KA 1J8AA 7GCHF 2EC9H 2ZDAH 3HGPA 1FIZA 3S0NA 5JBAS 4DOQA 5JB9S 2IOTA 1MUEB 1S82A 3A85A 1NS3A 1GVLA 3A8DA 1GVKB 3SNEA 1NRSH 1EAXA 2H9HA 2JH6D 4GUXA 1C1QA 5GXPA 2FLBH 1ZYOA 4X1NU 1DWEH 4ISOA 1V2RT 5A0BA 1K21H 1TBQH 2O8LA 2FEQH 4FVDA 1TA6A 5FPSA 1DUEA 4GCHF 2PTNA 3ZVDA 2ZDMA 3VGCB 4RN6A 3RUOA 3I77A 1EP5A 5T6DA 1P0SH 1Y5UT 5T6GA 3S9CA 1V2QT 1BRCE 4DVAU 1W7GH 2STBE 1A0LA 2A7CA 1IQNA 4OS7A 2CHAB 1B7XB 4ISHH 2GCHG 3SUGA 1O2IA 4R0IA 2ZGBH 1GMCF 1PPEE 2C8ZB 2ZQ2A 1GMHG 2VGCB 1IOEA 2Y5HA 2HGTH 4K60A 1OX1A 1AVXA 1TPAE 1HPGA 5FXLA 1LHEH 4I8KA 1VITH 1Z1JA 1EATA 1OP8A 4I31A 1TNHA 1TQ7B 7LPRA 1O2MA 3GY4A 1UTPA 2GV7A 3LGWA 5F6MA 4J1YA 2TPIZ 4JZDH 4KGAA 3VGCC 3UNSA 1TQ0B 2ZHEH 3M3VA 4TPIZ 1P06A 1GVZA 1JOUB 4JYVH 3T2NA 4CR5A 2A7JA 4I32A 4YOIA 2PR3A 3LGYA 4JZIA 4NA9H 4HI3A 1Y59T 3MU1A 4Q7ZA 1Y5BT 4F4OC 4Q2KA 3K65B 4Y7AA 3P8OA 3GY5A 1BBRK 4BAMB 3A82A 3ESTA 1UTNA 1QB1A 1O2YA 5FBEA 1GI0A 2BTCE 5T6FA 3SV9A 1FI8A 1TRNA 4FUJA 1PPGE 1HUTH 2PTCE 1PPHE 1F92A 5HMAA 1OSSA 4MNWA 3GOVB 2V3HH 1MBMA 3DFLA 5LPFA 2FOHA 4ZHAA 1HAGE 1ZGIA 4AORA 4X8TH 1W10U 3RXUA 2Z94A 1JWTA 1S0RA 1ZPZA 5DP3A 2UUJB 3F68H 5H4IB 1LVYA 5C1XA 4Q7YA 1D3TB 3S9BA 4X2VA 4ZKRU 3NKKA 1HRTH 1O5AB 1AMHA 3U98H 1A0JA 1OYQA 4IGDA 4CHAC 4WVPE 4MTBA 3SUFA 1QJ6B 4M7GA 2QC2A 1B0FA 2JH5D 2AGEX 2FYRA 1GHWH 5EXLA 1SGIB 1O5BB 1EZSC 1UVTH 4ZUHA 2PFEA 2Y81A 3QZRA 2XBWA 1O3IA 2EEKA 1E36B 1EOJA 1AN1E 1Y8TA 3PMJA 1UVOA 4B1TA 5HXFA 3GCHC 5C1UA 1HXEH 1DVAH 1P3EA 1QL8A 2GMTB 1O2HA 1RS0A 1RRKA 2OLGA 1HJAB 1DOJA 2ULLA 2OC7A 1AWHB 1Y3YA 3SNBA 1T32A 2QF3A 4TWYA 4AGKA 3MU0A 4E7NA 1KTSB 3T5FH 1O3MA 2PUXB 1O36A 1O2ZA 3FFGA 1RFNA 2FO9A 3RXJA 1P8VC 1C5UA 4D9RA 2OXSA 4VGCB 3S69A 5K7RA 5LGOA 1N1LA 4IC6A 2OBQA 3Q76A 1YM0A 1OKXA 1OOKB 3CS0A 2A4QA 4NIVA 6GCHG 3ZVCA 3P95A 3SU4A 1LKBA 1CSOE 1E38B 1UTMA 3HKJB 3BTGE 5HGGA 2FI5E 2UWLA 5E8EH 2R2MB 2ZPQA 4OS2A 1K28D 1C5XB 1TMTH 2WUBA 2H5CA 3CENA 3URDA 1BMAA 4NZLA 4BXSA 2QF0A 2VIOA 2ODPA 3KL6A 5EPYA 3T27A 1QBOA 1DXWA 3G01A 3A7VA 2KAIA 2RDLA 3RU4D 3BEUA 3RMOH 1P3CA 2ZNKH 4DJZB 4R8TB 1O5FH 1A5IA 1GGDC 1N6YA 1DY9A 1FY4A 2BQ6B 1SFQB 1QA7A 1DITH 5EXMA 1BUIA 2BY8X 4CH2B 1LO6A 2P3UB 3PMAB 1H9IE 2QAAA 5DPAA 1TE0A 3U8TH 3K6ZA 1HV7A 1MCVA 4MPVA 2XTTB 2OQ5A 3T28A 2F83A 2J4IA 3MU8A 4ABJA 2B0FA 1QB6A 5PTPA 1JRSA 2BDAA 4ZROA 3DHKH 3RXDA 2ZPRA 4H6TA 1VJAU 4MQAA 3Q00A 3IG6B 4ZH8A 3RU4E 6CHAC 1GJ6A 1MKWH 2WPKS 2ODQA 2V6NA 1FQ3A 1TGCA 3RXVA 3SGBE 4YT7H 1O32A 1WSSH 1GCTB 1NO9H 4NWLA 4Y11E 5EW1H 4B2BA 4QT8C 1BB0B 1ELFA 3ZVBA 1ZHMA 3PYHA 1G37A 2O8UA 5G4BA 1THRH 1K1MA 1AVWA 1ZSLA 3F9FA 1A5GH 2B5TB 3ZZ8A 3LIWA 2JETC 4X1QU 1GCDA 4Y6DA 3L6PA 2W5EA 1LHGH 6LPRA 3MI4A 2GDEH 2A0QB 1C1SA 3SNCA 1C5MD 3PV4A 3E0NB 3M37A 2VGCC 3EA7A 3SJIA 3SV6A 1NPMA 1PQ5A 1F0TA 4MNXA 2AS9A 3M7TA 5GCHF 4AYVB 1YPMH 2TGDA 1D3QB 1ZPCA 2A31A 2H9EH 1O2QA 1XKAC 1SFIA 2OC8A 4JK5A 4XDEA 4WXVA 1O3CA 3QZQA 1SGEE 1OWEA 4ZAEA 1VZQH 1V2KT 1ZRBA 2DE9A 1TA2A 4UFDH 2VINA 2QIQA 1O5EH 1C1PA 2CV3A 1CVWH 2BD3A 1L1NA 1EAWA 1MZDA 2BOKA 4I8JA 3GY7A 1KTTB 1YCPM 2R0KA 1A5HA 3P8GA 1O3EA 1KLTA 1ZHPA 2ILNA 3EYDA 3GDSA 1TBRH 4MPUA 1RD3B 2C4FH 5FX6A 3SU0A 1SGQE 5ESBA 1EUFA 3OY6U 4J2YB 5A8YA 1SGRE 1EB2A 3ZVEA 5GJ4B 1C2JA 1XUFA 1DWDH 1FIWA 4HFPB 3MYWA 5DGJA 2F3CE 2Y6TA 1ZTJA 2PKSB 3BTEE 4DCDA 6CHAB 3HK3B 3TJUA 2C8WB 2R0LA 4U01A 1OWJA 2XNIA 1OWIA 4SGAE 1CBWB 2LNCA 3PROA 2SNVA 2VNTA 4BAKB 4LOYH 1ELCA 3RMMH 2ANMH 1UVSH 1V6DA 1SGDE 2Y5FA 2Z3EA 1T8MA 3PMHB 3E3TA 1QL7A 4YO9A 1M9UA 3BTHE 1GDQA 1QTFA 1ELTA 1PJPA 1WCZA 4GHQA 3RXTA 3U1IB 1CA0B 4GHTA 1IQMA 4NGAH 4X2WA 2D1JA 4XBCA 3SU2A 1ESBA 1FNIA 2C90B 2C8YB 2PKAB 3RXBA 3VXFH 1T4UH 1E0FD 5AFYH 1KXAA 3Q3KA 2ZGHA 3EA9A 1O3LA 5FPTA 3EA8A 3BIUH 5FX5A 2FOAA 1KXDA 1YGCH 1YLCA 3A7TA 1ABJH 3BTKE 1CGHA 4MLFB 3WY8A 1GHXH 1TIOA 1DSTA 5FAHA 1DDJA 1IQEA 3UR9A 5CMXH 1C9TA 3SV7A 5EG4A 1C1NA 1DS2E 2NWNA 5I25A 1BMLA 4OS1A 3EGKH 2ZHDA 2GX4A 1SOTA 5LPRA 2BX3A 1C1VH 4ABIA 1T8NA 2ZF0H 1BITA 4TYDA 1O3OA 1T8OA 1HLTH 4IS5A 1NFXA 1C2HA 1O2SA 1QURH 2PSYA 5EODA 2G81E 1O38A 2FPZA 2ZHFH 2WUCA 3V12A 3A7YA 1ARCA 3UOPA 1SSXA 4D7FA 5FHTA 1EASA 2I6QA 4X6OA 1MU8B 1SC8U 1AY6H 2RG3A 4AB8A 4YT6H 3ZZDA 3LPRA 3RLWH 1GI3A 2H2ZA 1DPOA 1VITF 2XCFA 1TB6H 3TVJB 1O3HA 4IN1A 3MNCA 4I8HA 1GHAF 2Z6BD 1K9OE 5LPEA 2NU0E 1FDPA 1C9PA 2J2UA 3MO3A 1IQFA 3ATIA 3LH3A 6GCHF 1ZJKA 1XVMA 1W3CA 3AASA 1TALA 1TMUH 4X0WU 2GCTB 2NU4E 2D8WA 1MKXK 3A81A 2UWOA 5B6OA 1KY9A 1KSNA 3QTVH 1P03A 1S5SA 1DFPA 1TOMH 1C4Y2 1MCTA 2JETB 5F03A 1EJAA 3PB1E 1GWAA 1T8LA 4FUEA 1A3EH 4O97A 1UK4A 2F91A 2OP9A 3ZZ9A 2CF8H 5E0JA 7ESTE 3SV8A 3UNRA 4K1TA 1GDNA 1FY1A 3SBKA 1ELVA 3ZZ6A 3SJKA 1XUGA 2F9UA 1GBIA 4CREA 1QFKH 1VJ9U 1KXEA 3VB4A 4Y7BA 3O8BA 2HNTE 2A45B 4IMZA 4ISLA 3TK9A 5A09A 4I8GA 3S7HB 3STIA 2PWXA 2QYIA 1QR3E 3MTYA 1C5LH 1ZSJA 1O2XA 3OU0A 1KDQA 1TPOA 5A0AE 1W7XH 1C2FA 2F9OA 2O9QA 2UUYA 2PHBA 3SI3H 2BD8A 2BXTH 1GI7B 3V7TA 1LVMA 3KN2A 1TNIA 4AFZA 2ANKH 2FESH 3QO6A 1TGSZ 3BTWE 2FZZA 3U69H 2GZ9A 3F6UH 3R0FA 3QK1A 1DUAA 2FS8A 1J15A 2FXRA 2TGPZ 5FCRA 4ABHA 4NIWA 2Z9LA 1VCQA 2AH4X 2FOBA 1T31A 5BRRE 3SNAA 1EJMA 3TH3H 1ABIH 3SQEE 1IAUA 3D62A 1F0UA 2GT8A 1ID5H 1MQ6A 2BLOA 1SG8B 1XUHA 4ZXXH 1UTOA 2EI6A 4FUGA 2VIPA 3PWCA 1O2VA 2OTVA 1DWCH 3SJOA 2K7XA 1IHTH 1LMWB 1GL1A 2NU2E 2Q6DA 2C8XB 2P16A 1TNGA 2BLVA 3L3TA 5DP6A 1HNEE 1G2LA 2C93B 3U9AH 2DUCA 3H7TA 1WYKA 1EAUA 2BD5A 2QXJA 3EAJA 2XBVA 5C5OA 4DY7B 3HPTB 3BTDE 1GBAA 2Z9GA 4WMFA 3E91A 5JBCS 4YESB 3ZV9A 1MBQA 2Z7FE 2VWLA 2WPLS 4RKJB 1AB9C 1N6XA 5GPIB 1C4U2 1HJAC 1WU1A 3TK5A 3AW1A 3GY3A 4XOJA 1SGPE 3RXKA 1S0QA 4ISIH 1ELGA 1QCPA 3SN8A 2GKVE 3BN9A 1O3KA 1WUNH 2ZGXH 1HGTH 3PTNA 3RXFA 1O2PA 3H7OA 3VB7A 1LPKB 1PPBH 2XWAA 5JPMH 1AFEH 3M7UA 1GGDB 1MZAA 2ZDLA 2ZCKP 4XE4A 5TCCA 3R3GB 3RXPA 1QY6A 1L1JA 2OQUA 2AGGX 2HWLB 1EZUC 4OS5A 2BOHB 5CE1A 2FLRH 1EAIA 1H4WA 2GD4B 2BD4A 4K69A 3A83A 3E0PB 3S9AA 4FUHA 1SGNE 3SZNA 1CA8B 3KIDU 3SU6A 3STJA 1FXYA 2BQ7B 4Q7XA 3LGVA 2FS9A 3EQ0H 4FU7A 4Z6AH 1GBBA 1TX6A 1ZRKA 2BD9A 1BJVA 2D2DA 5DG6A 1NTPA 4CRBA 4WF8A 2GMTC 1AUJA 2XBXA 1BMMH 4X8SH 2XYAA 3Q3XA 1ZPBA 3BIVH 4KTSA 2XCNA 1RIWB 1C2KA 1P01A 1W13U 4F49A 3BTFE 1OS8A 1C2MA 1D9IA 1LTOA 3VFEA 3V0XA 1UO6A 3MMGA 5DP4A 3PO1B 4NIYA 2QA9E 3W94A 4LXBH 2A4RA 1P2OA 1ZSKA 5BPEA 3B9FH 1F0RA 1CGJE 1UTQA 1O30A 1MMJN 4UE7H 2VIDA 4Y10E 3ZZBA 1Y3WA 2BLQA 4DT7B 3VXEH 2V35A 1GI8B 1GBLA 3ZVAA 2BQWB 5C2ZA 4Y79A 4UEHH 1F5KU 3D49H 1Y3UA 2AMDA 3ZVGA 1GJCB 3B23B
chains in the Genus database with same CATH superfamily
2WYJA 1BA8B 1BTHH 1KXCA 1J9CH 4WH6A 3S7KB 1EB1H 2QE7D 3ATLA 1K1JA 4ZMAH 1FN6A 3UTUH 4GAWA 3RXCA 1EQ9A 1AE8H 1YWUA 3TIUA 2Z9KA 1O2LA 2W3IA 4GVUA 1SHHB 1IQLA 2G8TA 1G30B 1UTKA 3PMBB 2WPJS 3A7XA 3E90B 1P11E 2BY9X 1FAXA 4AG2A 1WBGB 2FTLE 3N7EA 5SGAE 2XBYA 1L0ZA 2J34A 1DICA 3VPKA 1S6HA 5EU8A 1K1LA 4ABGA 8ESTE 4E05H 4F55A 8GCHG 3OFND 4WJG2 3ZIAD 3LKWA 1GHAG 3U8RH 1MD8A 1SLUB 3BF6H 2BX4A 1FPHH 1L1GA 1BTYA 1VCWA 3ATWA 3RU4T 1TLDA 3SI4H 2ZGCA 1MKWK 1PQ8A 4JCNA 3A87A 5ESTE 1NRRH 2KZ4A 4TWWA 1QQUA 2FOMB 2V3MA 4A5TS 3NXPA 4FVBA 4B2AA 1ELEE 2OCVB 1AHTH 1NRNH 1O37A 3M3SA 1BDAA 2Z9IA 1GI9B 2ANYA 1BBRH 3U8OH 1BHXF 3P6ZB 3UFAA 1ZOMA 4BOHA 2PW8H 3UWJH 1MABB 3LGTA 1ORFA 1WTHD 2F4LA 3PM3A 1Y3VA 3BV9B 5I46H 1ZLRA 3ZZ5A 1LDTT 1MTWA 2ZTXA 4X8VH 2GTBA 1L4DA 3UR6A 1GJ9B 3RDZA 3SORA 1AKSA 1HAIH 1GG6C 2P93A 1W0YH 1LQDB 4MG3A 4PROA 1TBZH 4K8YA 3ZZAA 1GBFA 3GYLB 1C5RA 3UWIA 4WH8A 2ZHWH 2GP9B 1MD7A 1C1OA 2KR7A 3M5NA 1X7AC 2R3YA 3GICB 1SQAA 4IW4E 4A1VA 1E1RD 2G55A 2ZDKA 1C5QA 4GPGA 6ESTA 1QBVH 4M9FA 1CBWC 2TBSA 1JBUH 1HAVB 4AOQA 3Q3YA 4BTIB 1NM6A 2GZ7A 1NRPH 4AFUA 3SU3A 3RLYH 1UTLM 2FI4E 4NZQA 1XX9A 1Z6EA 1PFXC 1TNJA 1EJNA 1GBTA 1DANH 1SBWA 3A89A 4B76A 1KIGH 2ZG0H 4U30A 2J94A 4FUIA 4AN7A 1NFWA 1YPJH 3FVFB 5DO4H 2FTMA 2PGBB 4A7IB 1FN8A 2BY7X 5DP5A 3TJNA 3SGAE 3KQDA 2AYWA 1NROH 1A0HB 3BTTE 1YLNA 3PV2A 1O39A 1FONA 1ETRH 3MH7A 2FX4A 1DX5M 1RXPA 2RA0A 1DLKB 4AB9A 3P8FA 1BBRE 1ZMNA 2OUAA 3LDXH 1U6QA 3SOSA 3UREA 1H9HE 1VGCC 1A2CH 2PP6A 3P8NA 4GLYA 1O2OA 1ANDA 2JJ1D 3NPSA 1TNKA 1GBCA 1G36A 4X6PA 4CRAA 2GV6A 5C0UA 4Q80A 3BG4C 4Y8ZA 2W6ID 1SQRA 4CHAB 1LKAA 2QGRA 1MTNC 2FMJA 2JJ2D 1C5VA 3F1SB 3PO1C 5L30H 2WV5A 1KLJH 4JYUH 1HYLA 1CO7E 2KFWA 3VB5A 1QBNA 1G3CA 3F2HA 1G3DA 3MWIU 4H42U 1SLVB 1MTUA 1PQ7A 1RGQA 4O3UA 1DE7H 3U1JB 3RXQA 3M5LA 1HB0B 1AFQC 4ABBA 5ABWA 1EKBB 1BMNH 1CHOF 1C1UH 2RDEA 4HG6A 1CE5A 1TGBA 2FIRH 4MPWA 5TCAA 1TYNA 1GJ5H 1WQVH 2HPQH 2QCYA 2PSXA 1BQYA 3RC4A 3M5OA 2EQNA 2STAE 1VGCB 4RI0A 2ANWA 2F9VA 1NU9A 4NSVA 1INCA 1MTVA 3BG8A 2CJIA 1GHBG 1GMDG 1V2LT 3RC5A 2ZA5A 4Z0KA 1F2SE 2WPDD 1HAVA 2G52A 4YM9A 2AEIH 1W0ZU 2EI7A 4D8NA 4FOUC 2WYGA 4SGBE 4K1EA 3SU1A 3GISB 1P2MA 3D65E 2VIQA 1XUJA 1QNJA 1W11U 1CA0C 3F9HA 1S81A 2KM0A 2CGAA 3M61U 4I7YH 5GNDA 4I33A 3MFJA 1GBHA 2XW9A 2HLCA 1KXBA 2QN5T 3EDXB 4O03A 5CHAB 1RTLA 3RP2A 3K6YA 3FAOA 1AIXH 5T3HA 1O2GH 1NRQH 1EPTA 1YP9A 4OGXA 3FP6E 3KNXA 2WPMS 4X1PU 4ACAA 2ZQ1A 3GCHB 4UFGH 2O8TA 1IQJA 5FCKA 2FWWA 4X1RU 5E2OA 1P2IA 3UOUA 4K1SA 1C5PA 3A7ZA 1TOCB 3MOCA 2ZCLP 1SB1H 2V3OH 2H9TH 3JZ1B 1GBKA 3N7OA 1G2MA 1SGFG 2VH6A 2ZU2A 3LH1A 5DKMA 1P9UA 2AIPA 1AQ7A 1O2JA 4DGJA 1W0KD 2BY6X 1ACBE 4NFFA 3M36A 2J97A 4JMYA 1ZR0A 2F9BH 1TX8A 1C2GA 1FZZA 2ALVA 3ZZ3A 1SGCA 3E16B 1C5OH 1YY3A 2J92A 4BXWA 4DW2U 1MTSA 1P02A 3F3BA 1O35A 2V0BA 4B74A 3HKIB 3UNQA 3GDUA 3OTJE 1YPGH 2Y7XA 4P02A 1Y3XA 2ZU1A 4K5ZA 2PV9B 4FUBA 3NWUA 4X6NA 1E35B 1EZXC 2GZ8A 1VITG 2RCEA 2G00A 8KME2 1C5WB 1SLXB 3LGUA 2B7DH 3RXHA 3M5MA 2AGIX 2FX6A 3TNTA 2FOFA 1A61H 1O3FA 3GY8A 1W2KH 1HXFH 3UPEA 1HFDA 1FAKH 4YZUA 2Y5GA 1O3JA 2J38A 3PRBA 1SGTA 3ZYEA 1CT4E 1YC0A 1EXFA 4NA7A 1GCTC 1AI8H 2KCPA 2M5TA 1OWDA 4WMDA 4LZ4B 2ZHQH 3EE0B 2CK3D 1NBME 5C1YA 5FBIA 1G3EA 5FPYA 2IJOB 1K1IA 2ZI2H 1BT7A 3SUEA 1A1RA 4YOGA 1HJ8A 1COWD 5JBBS 3ZV8A 4CR9A 3HGNA 2A4OA 2OD3B 2VVUA 5EW2H 5DP8A 1YPEH 1YCPK 1CHOG 4AG1A 2OINA 3T62A 1BTXA 5HM2A 2ZZUH 3LOXA 1GHBF 3A7WA 4FUCA 2VH0A 4XRNA 3PWBA 3SJ8A 2XC5A 1D3DB 2ZPSA 1P57B 3MH5A 4CH8B 5J4SA 2ZIQH 1O3NA 1QA0A 2UUFB 1UVPA 2J9NA 2VU8E 4FUFA 3LJOA 1G9IE 1ARBA 4OGYA 2ZU3A 1SR5C 3GS9A 3LGIA 1AE5A 1WDIA 1EX3A 3KF2A 3GYMA 2K8IA 1PQAA 1V2JT 2IN2A 3FP7E 2THFB 2ODYB 1A3BH 1LHCH 3LC3A 2SGEE 3BTQE 4TY6A 1DWBH 2BY5X 4IBLH 2SGAA 2P3TB 3OX7U 4KKDA 1HAPH 1TNLA 1O33A 3MH4A 2A2XH 4ASHA 3H09A 4Y0YE 4YLUA 1EFRD 1L4ZA 1S84A 1B0EA 2FYQA 2G51A 4Y0ZE 1J16A 1OPHB 1S6LA 2GCTC 4P00A 2A5AA 3SHAH 4ZHMU 5EQSA 1VCPA 3ATKA 4AYYB 4Y76A 5E0HA 2QV1A 2R3UA 2GVFA 3AVZA 2FDAA 1MU6B 1V2NT 3I29A 1YPLH 3V3MA 1FPCH 2WSSD 2FODA 3RXSA 2ZTZA 5E2PA 3E6PH 4XFQA 1GMHF 1SVPA 1AD8H 2WV4A 3RMLH 1GMCG 3A8CA 2NU3E 1GJ4H 1KDQB 5AFZH 4BAQB 4YXWD 4JZEH 1O3GA 1W8BH 2AMPA 2WPHS 1V2UT 3SW2B 2BDBA 1ELBA 1HAHH 4D76A 1THPB 3M35A 3M7QA 1IQKA 3RXGA 1A7SA 4ESTE 2LPRA 2A32A 3H5CB 4AFSA 5GWZA 1D6WA 4RSPA 4BAHB 3RM0H 3TK6A 2BDIA 2VVCA 4NA8A 1QZ8A 4OS6A 1GJ8B 1MTNB 1Z8JB 1SI5H 1XVOA 3GY6A 1H8DH 1GG6B 2FOCA 4ABEA 4OM9A 5EJZA 3UY9A 2ALPA 2XC4A 1ZMJA 1WQSA 2Q6FA 1W14U 2DE8A 4AZ2B 2BDGA 3TH2H 3UQOA 3DFJA 3KQBA 4ZXYH 3A8AA 2IJD1 4TPYA 1O3BA 1HIAB 3DA9B 1S6FA 2B9LA 3C27B 2ZEBA 2I6SA 2VIWA 1P9SA 2VJ1A 1L2EA 4YTAA 1DT2A 1GJ7B 2VB0A 1QQ4A 1NC6A 4X1SU 4B71A 1BTWA 1P09A 4LK4A 3QLPH 1O3DA 1HAZB 1QHRB 1ZGVA 2ZFQH 5TJXA 1TABE 5CHAC 4BTUB 1WV7H 2OK5A 4WXIA 2YOLA 1E1QD 2G5VA 2P8OC 3KGPA 3PV5A 2A1DB 1EPTC 4H6SB 4A1TA 5DP7A 4U2WA 2QF4A 1WAYB 4BANB 3SNDA 2AFQB 2ZFSA 1GJAB 2BYAX 1ELAA 3QTOH 4HZHA 2ZC9H 1DLEA 1XKBC 1Y5AT 1EP6A 1UCYE 5L2ZH 3MU4A 3U28C 2YMSB 4ZKNU 2GGVB 1GL0E 1PPZA 2HNTF 1OWHA 3A8BA 1H8IH 1O2UA 1Z7KA 4KTCA 1YBWA 5DJ7A 3SV2H 8LPRA 1PYTC 1ANCA 1SMFE 5JYIA 2K1QA 3AAVA 1AGJA 4IN2A 1GI1A 2A5KA 2PUQH 4MVNA 2O8MA 1UJ1A 5A2MH 1C1TA 2NU1E 1EOLA 3QDZB 4X2XA 2EI8A 2ZFRH 2CXVA 3URCA 1P2QA 7GCHG 4CBOA 4Y8XA 1EPTB 1LPGB 1JXPA 1N8OB 1UK3A 1YKTA 3SUDA 1ANBA 1ESAA 2PGQB 2Q1JA 3P70B 2Z3DA 4JZ1A 1ESTA 3AW0A 3MO9A 3VG8A 3WW7A 2QXIA 1E37B 1EZQA 1V2VT 3F2GA 1BHXB 3F9EA 1Z8RA 1V2OT 4INKA 2JH0D 4ISNA 1OWKA 3V13A 2BMGB 2ZCHP 2ZP0H 4INHA 1D6RA 3RXOA 4MDSA 3T26A 3BTME 1RJXB 1YPHC 1LQEA 2CHAC 3JZ2B 2UWPA 2FOGA 5L6NH 3FKSD 3FZDA 2PKSC 1F0SA 2ZFPH 3FZZA 3DUXH 2Y82A 4Y8YA 1UK2A 2P59A 2Q6GA 3QGNB 1K22H 3RXLA 4KELA 1FLEE 2HOBA 2RFKC 1KLIH 3HK6B 1V2MT 3BEIB 3VB6A 1BZXE 3MNXA 1HJ9A 2HALA 1O5CB 1DSUA 4DURA 3PRDA 4NIXA 3O8RA 1YCPH 2IPHA 2R2WU 2BVSH 4K2YA 3TGIE 1C2IA 2KCYA 3KEEA 1ZTLA 3UUZA 1O34A 2XC0A 3O8CA 3IITA 1A46H 1D3PB 1MAXA 2ZO3H 3PLBA 3NZIA 2ESTE 7KMEH 1O3PB 2GDDA 1LCYA 1IQIA 3PLPA 2ZKSA 4MPXA 3IWMA 2FI3E 4IC5A 1ELDE 3ZZ7A 4YOJA 4BAOB 1Q3XA 3KQ5A 2ZFTA 2A2QH 2W3KA 2WV9A 4D7GA 4OS4A 3TLOA 1AZZA 1P12E 3E8LA 1F5LA 1C1RA 1V2ST 3MHWU 5C17A 3CS7A 3RXIA 1Z6JH 2BDYA 3KQEA 1C5NH 3QGJA 3TITA 3UQVA 1UHBA 2GJGA 2W26A 1QRWA 4JZFH 1IHSH 4CRDA 1P2NA 1AZ8A 1DY8A 3OSYA 3N99A 1BOQA 2RA3A 1ETTH 2CMYA 3ITIA 9LPRA 3ZZCA 3SQHE 1K2I1 2M2AA 5AVDA 2GT7A 3OYPA 4CRGA 2OC0A 1D4PB 5GCHG 1OXGA 1AWFH 2ZGJA 1A4WH 3GCNA 4A92A 4JYTA 2TRMA 3A88A 5HIYA 2B8OH 5C3NA 3LT3A 1C5SA 1H8ED 1YLDA 3W95A 4ZHLU 2W7SA 1OP2A 2ZDNA 3MNSA 4RT0A 1O2RA 1GI2A 1TMBH 4X6MA 3BSQA 1QB9A 2BHGA 4X2YA 2AERH 4O9VA 5A8XA 2OC1A 4TY7A 1XM1A 1WTGH 3ZZ4A 3DSOA 2J95A 3E1XB 3RXRA 4VGCC 1O3AA 3KHVA 1KYNA 4WY3A 2BXUH 3UIRA 1ZMLA 2F9NA 3ODFA 4H4FA 5F8ZA 1GHVH 4ABDA 1SOZA 5IK2D 2XWBI 1AKSB 1BIOA 1O0DH 1HIAA 2TGTA 2WINI 1FY5A 1GBMA 1TRMA 5A0CA 1HCGA 1O2KA 1JIRA 1O2WA 5EPNA 2FP7B 2WPIS 5HYOA 4ASUD 4UD9H 3TGJE 1GJBB 1SQTA 3NUMA 2PLXA 2QY0B 1HDTH 1AB9B 4X8UH 5JB8S 3KCGH 1HAYB 2F43B 3LU9B 1ANEA 1FV9A 1T7CA 2A5IA 1Q31A 1BCUH 4NG9H 3A84A 1YPHE 2ASUB 3KQCA 1RIWC 5A8ZA 1CT2E 1C1MA 1AU8A 3BEFB 2P3FH 1P2KA 2H6MA 2P95A 2F9PA 4AX9H 1CT0E 1RTKA 1SHYA 4FU9A 4UFFH 1GI5A 4WMEA 1V2TT 4E7RG 4UFEH 1MKXH 2BZ6H 1GPZA 1WXRA 2ZDVH 5IDKA 1OHHD 5EQRA 4KTUA 2Z3CA 1LVBA 2A4GA 2VVVA 5T1VA 3MNBA 1G32B 1F5RA 1BJUA 2BVRH 1S83A 1YF4A 3GDVA 4A1XA 1THSH 2QXGA 4FUDA 2FM2A 1GBJA 2HNTC 1UCYK 1VR1H 2SFAA 2QXHA 1CQQA 4ABAA 1SL3A 2ZWLH 1C2EA 3ATMA 2O8WA 3FN8A 3L33A 1JIMA 5AF9H 1W12U 5HKKD 2HRVA 5GDSH 2UUKB 1S85A 1QIXB 1N8OC 1LPZB 2EY4C 5F8TA 4NWKA 1JMOH 3FANA 3TPIZ 5C67A 1GMDF 1AFQB 4AGJA 4XBBA 2HVXA 1PPCE 4ZKSU 1SGFA 1NZQH 2D26C 2SGFE 3RMNH 2G4UA 4O3TA 1LVOA 4NFEA 1DXPA 1HAXB 3ODDA 3SU5A 1FY3A 1CGIE 1QGFA 1ZZZA 3DT0H 4UONA 5C20A 5ETXA 1IQHA 1VKYA 3NK8A 3VB3A 3PTBA 1P2JA 3BG4B 3AAUA 5L2YH 3SHCH 1CU1A 1YYY1 3TH4H 1J14A 2G4TA 1QJ7B 1UTJA 1V3XA 2BD7A 3RM2H 4DIIH 3EBNA 3SO3A 3GCTG 1SPJA 1BRBE 2BDHA 3LC5A 1OP0A 3A86A 4MNYA 2ZECA 5EXNA 2CF9H 2ZFFH 1SQOA 2GCHF 4F48B 1NFYA 1XXDA 1XXFA 1GBEA 1XMNB 2XXLA 3WWBA 3I78A 1QRZA 4NSYA 1K1PA 4XSKU 3RXEA 1O5DH 5JDUB 2YNAA 3TU7H 2J5UA 5E0GA 1JRTA 2LELA 2SGDE 1GHYH 1ZTKA 3A80A 5DK1A 1T4VH 1C2DA 1BTUA 4I8LA 3QUMP 3RC6A 4JK6A 2CN0H 1FMGA 2YNBA 1UCYH 1V2PT 4HGCA 3KYGA 1K1OA 3O8DA 2LIZA 1WOFA 1TGTA 2VWNA 1UVUH 2EA3A 3LJJA 1SLWB 1E34B 1SKYE 2ZU5A 1O31A 1C5YB 5DP9A 4A6LA 1BTPA 4FXGH 2Y7ZA 4Y71A 1AUTC 3K9XB 3Q77A 2KCAA 1FX0B 2VWMA 4BTTB 4K8BA 1NU7B 2BVXH 2KCOA 1UHBB 1O2NA 1NESE 3MO6A 4WWYA 3OEHD 3NCLA 1BTZA 5EJLA 4YLQH 4KP0A 3TGKE 1KMHB 4DIHH 2BD2A 4UDWH 3TJOA 2FOEA 1TPPA 5K0HA 1HBTH 2JKHA 4E06H 1B5GH 1C5TA 1P05A 1C1WH 2ZTYA 3P17H 4CRCA 3OY5U 1GDUA 3TNSA 3B8JA 5J4QA 3FP8E 4U32A 3DSGA 3K2UA 3ZYDA 3F9GA 1C2LA 1DM4B 1LHDH 1O5GH 3ZVFA 2TIOA 2SNWA 2P94A 1PYTD 3LONA 2BB4A 3HATH 1CHGA 4DT4A 1V2WT 1TONA 1H9LB 1QRXA 4LZ1H 3M3TA 3GY2A 1OYTH 1ZHRA 2VWOA 1NN6A 4IMQA 2P8OB 5F8XA 1GBDA 1QJ1B 1P10A 2WHXA 3PLKA 3ENSB 2XNDD 2BLWA 2J98A 1FUJA 4B2CA 1XUIA 9ESTA 1ETSH 1Q2WA 1TWXB 4AFQA 2R9PA 2AMQA 2L6OA 4ZKOU 5IYTA 1YPKH 3T29A 5EQQA 1IQGA 2W7UA 2OBOA 2AIQA 4B75A 4MNVA 1Z8IB 3SGQE 4INLA 2KAIB 1KXFA 4GCHG 1TRYA 1GI6A 2W6JD 2H1UA 2H5DA 1Z71A 3RXAA 3VEQB 4BNRA 3CNRA 4XBDA 1MH0A 2SGQE 1TGNA 1BRUP 2BM2A 4K3JA 1E79D 1NFUA 4D9QA 3RXMA 1FJSA 1G3BA 4THNH 1GI4A 1Z8GA 3QX5H 4B73A 1BRAA 5EOKA 1MAYA 3DD2H 1Z1IA 1TAWA 5LH8A 5GIBA 2VIVA 5HM9A 2SGPE 1FY8E 3T25A 5KEDA 2TGAA 1MQ5A 1GJDB 2PKAA 1UMAH 2YMSC 1QL9A 4GSOA 4DG4A 5EGMA 1PPFE 4CRFA 3W1EA 3P92A 1C5ZB 3GCTF 3MU5A 3GCOA 4NCYA 3QWCH 1TPSA 5JBTA 3CP7A 1NY22 2C3SA 2HPPH 1TFXA 3QN7A 1AVGH 3FO8D 5AHGH 1O2TA 1RTFB 1SGYE 1F7ZA 4FU8A 1C4V2 1LHFH 3D23A 1P04A 3TJVA 4ABFA 2G5NA 1XUKA 1AO5A 4CBNA 1TX7A 3ELAH 5C5NA 1H1BA 2ZU4A 4RKOB 1K1NA 1HAOH 2BZAA 4HTCH 2XRCA 3SJ9A 8GCHF 2A7HA 2Z9JA 1NT1A 3MH6A 1ZJDA 1J17T 1GHZA 2Y80A 2BDCA 3C1KA 1J8AA 7GCHF 2EC9H 2ZDAH 3HGPA 1FIZA 3S0NA 5JBAS 4DOQA 5JB9S 2IOTA 1MUEB 1S82A 3A85A 1NS3A 1GVLA 3F2FA 3A8DA 1GVKB 3SNEA 1NRSH 1EAXA 2H9HA 2JH6D 4GUXA 2QF5A 3NRLA 1C1QA 5GXPA 2FLBH 1ZYOA 4X1NU 1DWEH 4ISOA 4TSFD 1V2RT 5A0BA 1K21H 1TBQH 2O8LA 2FEQH 4FVDA 1TA6A 5FPSA 1DUEA 4GCHF 2PTNA 3ZVDA 2ZDMA 3VGCB 4RN6A 3RUOA 3I77A 1EP5A 5T6DA 1P0SH 1Y5UT 1H8HD 5T6GA 3S9CA 1V2QT 1BRCE 4DVAU 1W7GH 2STBE 1A0LA 2A7CA 1IQNA 4OS7A 2CHAB 1B7XB 4ISHH 2GCHG 3SUGA 1O2IA 4R0IA 2ZGBH 1GMCF 1PPEE 2C8ZB 2ZQ2A 1GMHG 4TT3D 2VGCB 1IOEA 2Y5HA 2HGTH 4K60A 1OX1A 1AVXA 5CDFE 1TPAE 1HPGA 5FXLA 1LHEH 4I8KA 1VITH 1Z1JA 1EATA 1OP8A 4I31A 1TNHA 1TQ7B 4B6FA 7LPRA 1O2MA 3GY4A 1UTPA 2GV7A 3LGWA 5F6MA 4J1YA 2TPIZ 4JZDH 4KGAA 3VGCC 3UNSA 1TQ0B 2ZHEH 3M3VA 4TPIZ 1P06A 1GVZA 1JOUB 4JYVH 3T2NA 4CR5A 2A7JA 4I32A 4YOIA 2PR3A 3LGYA 4JZIA 4NA9H 4HI3A 1Y59T 3MU1A 4Q7ZA 1Y5BT 4F4OC 4Q2KA 5EIYA 3K65B 4Y7AA 3P8OA 3GY5A 1BBRK 4BAMB 3A82A 3ESTA 1UTNA 1QB1A 1O2YA 5FBEA 1GI0A 3SYJA 2BTCE 3KYFA 2L74A 5T6FA 3SV9A 1FI8A 1TRNA 3OE7D 4FUJA 1PPGE 1HUTH 2PTCE 1PPHE 1F92A 5HMAA 1OSSA 4MNWA 3GOVB 2V3HH 1MBMA 3DFLA 5LPFA 2FOHA 4ZHAA 1HAGE 1ZGIA 4AORA 4X8TH 1W10U 3RXUA 2Z94A 1JWTA 1S0RA 1ZPZA 5DP3A 2UUJB 3UAIC 3F68H 5H4IB 1LVYA 5C1XA 4Q7YA 1D3TB 3S9BA 4X2VA 4ZKRU 3NKKA 3F0PA 1HRTH 1O5AB 1AMHA 3U98H 2LP6A 1A0JA 1OYQA 4IGDA 4CHAC 4WVPE 4MTBA 3SUFA 1QJ6B 4M7GA 4AC9A 2QC2A 1B0FA 2JH5D 2AGEX 2FYRA 1GHWH 5EXLA 1SGIB 1O5BB 1EZSC 1UVTH 4ZUHA 2PFEA 2Y81A 3QZRA 2XBWA 1O3IA 2EEKA 1E36B 1EOJA 1AN1E 1Y8TA 5KGOA 3PMJA 1UVOA 4B1TA 5HXFA 4ACBA 3GCHC 5C1UA 1HXEH 1DVAH 1P3EA 1QL8A 2GMTB 1O2HA 1RS0A 1RRKA 2OLGA 1HJAB 1DOJA 2ULLA 2OC7A 1AWHB 1Y3YA 3SNBA 1T32A 2QF3A 4TWYA 4AGKA 3MU0A 4E7NA 1KTSB 3T5FH 1O3MA 2PUXB 1O36A 1O2ZA 3FFGA 1RFNA 2FO9A 3RXJA 1P8VC 1C5UA 4D9RA 2OXSA 4VGCB 3S69A 5K7RA 5LGOA 1N1LA 4IC6A 2OBQA 3Q76A 1YM0A 3OEED 1OKXA 1OOKB 3CS0A 2A4QA 4NIVA 6GCHG 3ZVCA 3P95A 3SU4A 1LKBA 1CSOE 1E38B 1UTMA 3HKJB 3BTGE 5HGGA 2FI5E 3FOAA 2UWLA 5E8EH 2R2MB 2ZPQA 4OS2A 1K28D 1C5XB 1TMTH 2WUBA 2H5CA 3CENA 3MQKC 3URDA 1BMAA 4NZLA 4BXSA 2QF0A 2VIOA 2JIZD 2ODPA 3KL6A 5EPYA 3T27A 1QBOA 4I86A 1DXWA 3G01A 3A7VA 2KAIA 2RDLA 3RU4D 3BEUA 3RMOH 1P3CA 2ZNKH 4DJZB 4R8TB 1O5FH 1A5IA 1GGDC 1N6YA 1DY9A 1FY4A 2BQ6B 1SFQB 1QA7A 1DITH 5EXMA 2KX4A 1BUIA 2BY8X 4CH2B 2K0QA 1LO6A 2P3UB 3PMAB 1H9IE 2QAAA 5DPAA 1TE0A 3U8TH 3K6ZA 1HV7A 1MCVA 4MPVA 2XTTB 2OQ5A 3T28A 2F83A 2J4IA 3MU8A 4ABJA 2B0FA 5DSFA 5F53A 1QB6A 5PTPA 1JRSA 2BDAA 4ZROA 5CHBA 3DHKH 3RXDA 2ZPRA 4H6TA 1VJAU 4MQAA 3Q00A 3IG6B 4ZH8A 3RU4E 6CHAC 1GJ6A 1MKWH 2WPKS 2ODQA 2V6NA 1FQ3A 1TGCA 3RXVA 3SGBE 4YT7H 1O32A 1WSSH 1GCTB 1NO9H 4NWLA 5C0TA 4Y11E 5EW1H 4B2BA 4QT8C 1BB0B 1ELFA 3ZVBA 1ZHMA 3PYHA 1G37A 2O8UA 5G4BA 1THRH 1K1MA 1AVWA 1ZSLA 3F9FA 1A5GH 2B5TB 3ZZ8A 3LIWA 2JETC 4X1QU 1GCDA 4Y6DA 3L6PA 2W5EA 1LHGH 6LPRA 3MI4A 2GDEH 2A0QB 1C1SA 3SNCA 1C5MD 3PV4A 2WZQA 3E0NB 3M37A 2VGCC 3EA7A 3SJIA 3SV6A 1NPMA 1PQ5A 1F0TA 4MNXA 2AS9A 3M7TA 5GCHF 4AYVB 1YPMH 2TGDA 1D3QB 1ZPCA 2A31A 2H9EH 1O2QA 1XKAC 1SFIA 2OC8A 4Q63A 4JK5A 4XDEA 4WXVA 1O3CA 3QZQA 1SGEE 1OWEA 4ZAEA 1VZQH 1V2KT 1ZRBA 2DE9A 1TA2A 4UFDH 2VINA 2QIQA 1O5EH 2IPQX 1C1PA 2CV3A 1CVWH 2BD3A 1L1NA 1EAWA 1W0JD 5B6LA 1MZDA 2BOKA 4I8JA 3GY7A 1KTTB 1YCPM 2R0KA 1A5HA 3P8GA 1O3EA 1KLTA 1ZHPA 2ILNA 3EYDA 3GDSA 1TBRH 4MPUA 1RD3B 2C4FH 5FX6A 3SU0A 1SGQE 5ESBA 1EUFA 3OY6U 4J2YB 5A8YA 1SGRE 1EB2A 3ZVEA 5GJ4B 1C2JA 1XUFA 1DWDH 1UW7A 1FIWA 5DN6D 4HFPB 3MYWA 5DGJA 2F3CE 2Y6TA 1ZTJA 2PKSB 3BTEE 4DCDA 6CHAB 3HK3B 3TJUA 3OAAD 2C8WB 2R0LA 4U01A 1OWJA 2XNIA 1OWIA 4SGAE 1CBWB 2LNCA 3PROA 4B6EA 4FETA 2SNVA 2VNTA 4BAKB 4LOYH 1ELCA 3RMMH 2ANMH 1UVSH 1V6DA 1SGDE 2Y5FA 2Z3EA 1T8MA 3PMHB 3E3TA 1QL7A 4YO9A 1BMFD 2JDID 1M9UA 3BTHE 1GDQA 1QTFA 1ELTA 1PJPA 1WCZA 4GHQA 3RXTA 3U1IB 2YMSD 1CA0B 4GHTA 5FL7D 1IQMA 4NGAH 2HLDD 4X2WA 2D1JA 4XBCA 3SU2A 1ESBA 1FNIA 2C90B 2C8YB 2PKAB 4XD7D 3RXBA 1T4UH 1E0FD 5AFYH 3VXFH 1KXAA 3Q3KA 3SZEA 2ZGHA 3EA9A 1O3LA 5FPTA 3EA8A 3BIUH 5FX5A 2FOAA 1KXDA 1YGCH 1YLCA 3A7TA 1ABJH 3BTKE 1CGHA 4MLFB 3WY8A 1GHXH 1TIOA 1DSTA 5FAHA 1DDJA 1IQEA 3UR9A 5CMXH 1C9TA 3SV7A 5EG4A 1C1NA 3N7DA 1DS2E 2NWNA 5I25A 1BMLA 4OS1A 3EGKH 2ZHDA 2GX4A 1SOTA 5LPRA 2BX3A 1C1VH 4ABIA 1T8NA 2ZF0H 1BITA 4TYDA 1O3OA 1T8OA 1HLTH 4IS5A 1NFXA 1C2HA 1O2SA 1QURH 2PSYA 5EODA 2G81E 1O38A 2FPZA 2ZHFH 2WUCA 3V12A 3A7YA 1ARCA 3UOPA 1SSXA 4D7FA 5FHTA 1EASA 2I6QA 4X6OA 1MU8B 1SC8U 1AY6H 2RG3A 4AB8A 4YT6H 3ZZDA 3LPRA 3RLWH 1GI3A 2H2ZA 1DPOA 1VITF 2XCFA 1TB6H 3TVJB 1O3HA 4IN1A 3MNCA 4I8HA 1GHAF 2Z6BD 1K9OE 5LPEA 2NU0E 1FDPA 1C9PA 2J2UA 3MO3A 1IQFA 3ATIA 3LH3A 6GCHF 1ZJKA 1XVMA 1W3CA 3AASA 1TALA 1TMUH 4X0WU 2GCTB 2NU4E 2D8WA 1MKXK 3A81A 2UWOA 5B6OA 1KY9A 1KSNA 3QTVH 1P03A 1S5SA 1DFPA 1TOMH 1C4Y2 1MCTA 3OTPA 2JETB 5F03A 1EJAA 3PB1E 1GWAA 1T8LA 2V7QD 4FUEA 1A3EH 4O97A 1UK4A 2F91A 2OP9A 3ZZ9A 2CF8H 5E0JA 7ESTE 3SV8A 3UNRA 4K1TA 1GDNA 1FY1A 3SBKA 1ELVA 3ZZ6A 3SJKA 1XUGA 2F9UA 1GBIA 4CREA 1QFKH 1VJ9U 1KXEA 3VB4A 4Y7BA 2J98B 3O8BA 2HNTE 2A45B 4IMZA 4ISLA 3TK9A 5A09A 4I8GA 3S7HB 3STIA 2PWXA 2QYIA 1QR3E 3MTYA 1C5LH 1ZSJA 3DCLA 1O2XA 3OU0A 1KDQA 1TPOA 5A0AE 1W7XH 1C2FA 2F9OA 2O9QA 2UUYA 2PHBA 3SI3H 2BD8A 2BXTH 1GI7B 3V7TA 1LVMA 3KN2A 1TNIA 4AFZA 2ANKH 4Q4LA 2FESH 3QO6A 1TGSZ 3BTWE 2FZZA 3U69H 2GZ9A 3F6UH 3R0FA 3QK1A 1DUAA 2FS8A 1J15A 2FXRA 2TGPZ 5FCRA 4ABHA 4NIWA 2Z9LA 1VCQA 5HIZA 2AH4X 2FOBA 1T31A 5BRRE 3SNAA 1EJMA 3TH3H 1ABIH 3SQEE 1IAUA 3EE7A 3AK5A 3D62A 1F0UA 2GT8A 1ID5H 1MQ6A 2BLOA 1SG8B 1XUHA 4ZXXH 1UTOA 2EI6A 4FUGA 2VIPA 3PWCA 1O2VA 2OTVA 1DWCH 3SJOA 2K7XA 1IHTH 1LMWB 1GL1A 2NU2E 2Q6DA 2C8XB 2P16A 1TNGA 2BLVA 3L3TA 5DP6A 1HNEE 1G2LA 2C93B 3U9AH 2DUCA 3H7TA 1WYKA 1EAUA 2BD5A 2QXJA 3EAJA 2XBVA 5C5OA 4DY7B 3HPTB 3BTDE 1GBAA 2Z9GA 5EJ1A 4WMFA 3E91A 2VBCA 5JBCS 4YESB 3ZV9A 1MBQA 2Z7FE 2VWLA 2WPLS 4RKJB 1K0HA 1AB9C 1N6XA 5GPIB 1C4U2 1HJAC 1WU1A 3TK5A 3AW1A 3GY3A 4XOJA 1SGPE 3RXKA 1S0QA 4Z1MD 4ISIH 1ELGA 1QCPA 3SN8A 2GKVE 3BN9A 1O3KA 1WUNH 2ZGXH 1HGTH 3PTNA 3RXFA 1O2PA 3H7OA 3VB7A 1LPKB 1PPBH 2XWAA 5JPMH 1AFEH 3M7UA 1GGDB 1MZAA 2ZDLA 2ZCKP 4XE4A 5TCCA 3R3GB 3RXPA 1QY6A 1L1JA 2OQUA 2AGGX 2HWLB 3DSPA 1EZUC 4OS5A 2BOHB 5C94A 5CE1A 3UB0A 2FLRH 1EAIA 1H4WA 2GD4B 2BD4A 4K69A 3A83A 3E0PB 3S9AA 4FUHA 1SGNE 3SZNA 1CA8B 3KIDU 3SU6A 3STJA 1FXYA 2BQ7B 4Q7XA 3LGVA 2FS9A 3EQ0H 4FU7A 4Z6AH 1GBBA 2AHME 1TX6A 1ZRKA 2BD9A 1BJVA 2D2DA 2HVYB 5DG6A 4RT1A 1NTPA 4CRBA 4WF8A 4ZCNA 2GMTC 1AUJA 2XBXA 1BMMH 4X8SH 2XYAA 3F0OA 3Q3XA 5KECA 1ZPBA 3BIVH 4KTSA 2XCNA 1RIWB 1C2KA 1P01A 1W13U 4F49A 3BTFE 1OS8A 1NBMD 1C2MA 1D9IA 1LTOA 3VFEA 3V0XA 1UO6A 3MMGA 5DP4A 3PO1B 4NIYA 2QA9E 3W94A 4LXBH 2A4RA 1P2OA 1ZSKA 5BPEA 3WWFA 3B9FH 1F0RA 1CGJE 1UTQA 1O30A 1MMJN 2XOKD 4UE7H 2VIDA 4Y10E 3ZZBA 1Y3WA 2BLQA 4DT7B 3VXEH 2V35A 1GI8B 1GBLA 3ZVAA 2BQWB 5C2ZA 4Y79A 4UEHH 1F5KU 3D49H 1Y3UA 2AMDA 3ZVGA 1GJCB 3B23B
chains in the Genus database with same CATH topology
2WYJA 1BA8B 1BTHH 1KXCA 1J9CH 4WH6A 3S7KB 1EB1H 3ATLA 1K1JA 4ZMAH 1FN6A 3UTUH 4GAWA 3RXCA 1EQ9A 1AE8H 3TIUA 2Z9KA 1O2LA 2W3IA 4GVUA 1SHHB 1IQLA 2G8TA 1G30B 1UTKA 3PMBB 2WPJS 3A7XA 3E90B 1P11E 2BY9X 1FAXA 4AG2A 1WBGB 2FTLE 5SGAE 2XBYA 1L0ZA 2J34A 1DICA 3VPKA 1S6HA 5EU8A 1K1LA 4ABGA 8ESTE 4E05H 8GCHG 4WJG2 3LKWA 1GHAG 3U8RH 1MD8A 1SLUB 3BF6H 2BX4A 1FPHH 1L1GA 1BTYA 1VCWA 3ATWA 3RU4T 1TLDA 3SI4H 2ZGCA 1MKWK 1PQ8A 4JCNA 3A87A 5ESTE 1NRRH 4TWWA 1QQUA 2FOMB 4A5TS 3NXPA 4FVBA 4B2AA 1ELEE 2OCVB 1AHTH 1NRNH 1O37A 3M3SA 1BDAA 2Z9IA 1GI9B 2ANYA 1BBRH 3U8OH 1BHXF 3P6ZB 3UFAA 1ZOMA 4BOHA 2PW8H 3UWJH 3LGTA 1ORFA 1WTHD 3PM3A 1Y3VA 3BV9B 5I46H 1ZLRA 3ZZ5A 1LDTT 1MTWA 2ZTXA 4X8VH 2GTBA 1L4DA 3UR6A 1GJ9B 3RDZA 3SORA 1AKSA 1HAIH 1GG6C 2P93A 1W0YH 1LQDB 4MG3A 4PROA 1TBZH 4K8YA 3ZZAA 1GBFA 3GYLB 1C5RA 3UWIA 4WH8A 2ZHWH 2GP9B 1MD7A 1C1OA 3M5NA 1X7AC 2R3YA 3GICB 1SQAA 4IW4E 4A1VA 2G55A 2ZDKA 1C5QA 4GPGA 6ESTA 1QBVH 1CBWC 2TBSA 1JBUH 1HAVB 4AOQA 3Q3YA 4BTIB 1NM6A 2GZ7A 1NRPH 4AFUA 3SU3A 3RLYH 1UTLM 2FI4E 4NZQA 1XX9A 1Z6EA 1PFXC 1TNJA 1EJNA 1GBTA 1DANH 1SBWA 3A89A 4B76A 1KIGH 2ZG0H 4U30A 2J94A 4FUIA 4AN7A 1NFWA 1YPJH 3FVFB 5DO4H 2FTMA 2PGBB 4A7IB 1FN8A 2BY7X 5DP5A 3TJNA 3SGAE 3KQDA 2AYWA 1NROH 1A0HB 3BTTE 1O39A 1FONA 1ETRH 3MH7A 2FX4A 1DX5M 1RXPA 2RA0A 1DLKB 4AB9A 3P8FA 1BBRE 1ZMNA 2OUAA 3LDXH 1U6QA 3SOSA 3UREA 1H9HE 1VGCC 1A2CH 3P8NA 4GLYA 1O2OA 1ANDA 3NPSA 1TNKA 1GBCA 1G36A 4X6PA 4CRAA 2GV6A 4Q80A 3BG4C 4Y8ZA 4CHAB 1LKAA 2QGRA 1MTNC 2FMJA 1C5VA 3F1SB 3PO1C 5L30H 2WV5A 1KLJH 4JYUH 1HYLA 1CO7E 3VB5A 1QBNA 1G3CA 1G3DA 3MWIU 4H42U 1SLVB 1MTUA 1PQ7A 1RGQA 4O3UA 1DE7H 3U1JB 3RXQA 3M5LA 1HB0B 1AFQC 4ABBA 5ABWA 1EKBB 1BMNH 1CHOF 1C1UH 1CE5A 1TGBA 2FIRH 4MPWA 5TCAA 1TYNA 1GJ5H 1WQVH 2HPQH 2QCYA 2PSXA 1BQYA 3RC4A 3M5OA 2STAE 1VGCB 2ANWA 2F9VA 1NU9A 4NSVA 1INCA 1MTVA 3BG8A 2CJIA 1GHBG 1GMDG 1V2LT 3RC5A 2ZA5A 4Z0KA 1F2SE 1HAVA 2G52A 4YM9A 2AEIH 1W0ZU 2EI7A 4D8NA 2WYGA 4SGBE 4K1EA 3SU1A 3GISB 1P2MA 3D65E 2VIQA 1XUJA 1QNJA 1W11U 1CA0C 3F9HA 1S81A 2CGAA 3M61U 4I7YH 4I33A 3MFJA 1GBHA 2XW9A 2HLCA 1KXBA 2QN5T 3EDXB 4O03A 5CHAB 1RTLA 3RP2A 3K6YA 3FAOA 1AIXH 5T3HA 1O2GH 1NRQH 1EPTA 1YP9A 4OGXA 3FP6E 3KNXA 2WPMS 4X1PU 2ZQ1A 3GCHB 4UFGH 2O8TA 1IQJA 5FCKA 2FWWA 4X1RU 5E2OA 1P2IA 3UOUA 4K1SA 1C5PA 3A7ZA 1TOCB 3MOCA 2ZCLP 1SB1H 2V3OH 2H9TH 3JZ1B 1GBKA 3N7OA 1G2MA 1SGFG 2VH6A 2ZU2A 3LH1A 5DKMA 1P9UA 2AIPA 1AQ7A 1O2JA 4DGJA 2BY6X 1ACBE 4NFFA 3M36A 4JMYA 1ZR0A 2F9BH 1TX8A 1C2GA 1FZZA 2ALVA 3ZZ3A 1SGCA 3E16B 1C5OH 2J92A 4BXWA 4DW2U 1MTSA 1P02A 1O35A 2V0BA 4B74A 3HKIB 3UNQA 3GDUA 3OTJE 1YPGH 2Y7XA 1Y3XA 2ZU1A 4K5ZA 2PV9B 4FUBA 3NWUA 4X6NA 1E35B 1EZXC 2GZ8A 2RCEA 1VITG 2G00A 8KME2 1C5WB 1SLXB 3LGUA 2B7DH 3RXHA 3M5MA 2AGIX 2FX6A 3TNTA 2FOFA 1A61H 1O3FA 3GY8A 1W2KH 1HXFH 3UPEA 1HFDA 1FAKH 4YZUA 2Y5GA 1O3JA 2J38A 1SGTA 3ZYEA 1CT4E 1YC0A 1EXFA 4NA7A 1GCTC 1AI8H 1OWDA 2M5TA 4WMDA 4LZ4B 2ZHQH 3EE0B 5C1YA 5FBIA 1G3EA 5FPYA 2IJOB 1K1IA 2ZI2H 1BT7A 3SUEA 1A1RA 4YOGA 1HJ8A 5JBBS 3ZV8A 4CR9A 3HGNA 2A4OA 2OD3B 2VVUA 5EW2H 5DP8A 1YPEH 1YCPK 1CHOG 4AG1A 2OINA 3T62A 1BTXA 5HM2A 2ZZUH 3LOXA 1GHBF 3A7WA 4FUCA 2VH0A 3SJ8A 3PWBA 2XC5A 1D3DB 2ZPSA 1P57B 3MH5A 4CH8B 5J4SA 2ZIQH 1O3NA 1QA0A 2UUFB 1UVPA 2J9NA 2VU8E 4FUFA 3LJOA 1G9IE 1ARBA 4OGYA 2ZU3A 1SR5C 3LGIA 1AE5A 1EX3A 3KF2A 3GYMA 1PQAA 1V2JT 2IN2A 3FP7E 2THFB 2ODYB 1A3BH 1LHCH 3LC3A 2SGEE 3BTQE 4TY6A 1DWBH 2BY5X 4IBLH 2SGAA 2P3TB 3OX7U 4KKDA 1HAPH 1TNLA 1O33A 3MH4A 2A2XH 4ASHA 4Y0YE 4YLUA 1L4ZA 1S84A 1B0EA 2FYQA 2G51A 4Y0ZE 1J16A 1OPHB 2GCTC 2A5AA 3SHAH 4ZHMU 5EQSA 1VCPA 3ATKA 4AYYB 4Y76A 5E0HA 2QV1A 2R3UA 2GVFA 3AVZA 2FDAA 1MU6B 1V2NT 3I29A 1YPLH 3V3MA 1FPCH 2FODA 3RXSA 2ZTZA 5E2PA 3E6PH 4XFQA 1GMHF 1SVPA 1AD8H 2WV4A 3RMLH 1GMCG 3A8CA 2NU3E 1GJ4H 1KDQB 5AFZH 4BAQB 4JZEH 1O3GA 1W8BH 2AMPA 2WPHS 1V2UT 3SW2B 2BDBA 1ELBA 1HAHH 4D76A 1THPB 3M35A 3M7QA 1IQKA 3RXGA 1A7SA 4ESTE 2LPRA 2A32A 3H5CB 4AFSA 5GWZA 1D6WA 4RSPA 4BAHB 3RM0H 3TK6A 2BDIA 2VVCA 4NA8A 4OS6A 1GJ8B 1MTNB 1Z8JB 1SI5H 1XVOA 3GY6A 1H8DH 1GG6B 2FOCA 4ABEA 3UY9A 2ALPA 2XC4A 1ZMJA 1WQSA 2Q6FA 1W14U 2DE8A 4AZ2B 2BDGA 3TH2H 3UQOA 3DFJA 3KQBA 4ZXYH 3A8AA 4TPYA 1O3BA 1HIAB 3DA9B 1S6FA 2B9LA 3C27B 2ZEBA 2I6SA 2VIWA 1P9SA 2VJ1A 1L2EA 4YTAA 1DT2A 1GJ7B 2VB0A 1QQ4A 1NC6A 4X1SU 4B71A 1BTWA 1P09A 4LK4A 3QLPH 1O3DA 1HAZB 1QHRB 1ZGVA 2ZFQH 5TJXA 1TABE 5CHAC 4BTUB 1WV7H 4WXIA 2YOLA 2G5VA 2P8OC 3KGPA 2A1DB 1EPTC 4H6SB 4A1TA 5DP7A 4U2WA 1WAYB 4BANB 3SNDA 2AFQB 2ZFSA 1GJAB 2BYAX 1ELAA 3QTOH 4HZHA 2ZC9H 1DLEA 1XKBC 1Y5AT 1EP6A 1UCYE 5L2ZH 3MU4A 4ZKNU 2GGVB 1GL0E 1PPZA 2HNTF 1OWHA 3A8BA 1H8IH 1O2UA 1Z7KA 4KTCA 1YBWA 5DJ7A 3SV2H 8LPRA 1PYTC 1ANCA 1SMFE 5JYIA 2K1QA 3AAVA 1AGJA 4IN2A 1GI1A 2A5KA 2PUQH 4MVNA 2O8MA 1UJ1A 5A2MH 1C1TA 2NU1E 1EOLA 3QDZB 4X2XA 2EI8A 2ZFRH 2CXVA 3URCA 1P2QA 7GCHG 4CBOA 4Y8XA 1EPTB 1LPGB 1JXPA 1N8OB 1UK3A 1YKTA 3SUDA 1ANBA 1ESAA 2PGQB 2Q1JA 3P70B 2Z3DA 4JZ1A 1ESTA 3AW0A 3MO9A 2QXIA 1E37B 1EZQA 1V2VT 1BHXB 3F9EA 1Z8RA 1V2OT 4INKA 2JH0D 4ISNA 1OWKA 3V13A 2BMGB 2ZCHP 2ZP0H 4INHA 1D6RA 3RXOA 4MDSA 3T26A 3BTME 1RJXB 1YPHC 1LQEA 2CHAC 3JZ2B 2UWPA 2FOGA 5L6NH 3FZDA 2PKSC 1F0SA 2ZFPH 3FZZA 3DUXH 2Y82A 4Y8YA 1UK2A 2P59A 2Q6GA 3QGNB 1K22H 3RXLA 4KELA 1FLEE 2HOBA 1KLIH 3HK6B 1V2MT 3BEIB 3VB6A 1BZXE 3MNXA 1HJ9A 2HALA 1O5CB 1DSUA 4DURA 4NIXA 3O8RA 2R2WU 1YCPH 2IPHA 2BVSH 4K2YA 3TGIE 1C2IA 3KEEA 1ZTLA 3UUZA 1O34A 2XC0A 3O8CA 3IITA 1A46H 1D3PB 1MAXA 2ZO3H 3PLBA 3NZIA 2ESTE 7KMEH 1O3PB 2GDDA 1LCYA 1IQIA 3PLPA 2ZKSA 4MPXA 3IWMA 2FI3E 4IC5A 1ELDE 3ZZ7A 4YOJA 4BAOB 1Q3XA 2ZFTA 2A2QH 2W3KA 4D7GA 4OS4A 3TLOA 1AZZA 1P12E 3E8LA 1F5LA 1C1RA 1V2ST 3MHWU 3CS7A 3RXIA 1Z6JH 2BDYA 3KQEA 1C5NH 3QGJA 3TITA 3UQVA 1UHBA 2W26A 1QRWA 4JZFH 1IHSH 4CRDA 1P2NA 1AZ8A 1DY8A 3OSYA 1BOQA 2RA3A 1ETTH 2CMYA 3ITIA 9LPRA 3ZZCA 3SQHE 1K2I1 5AVDA 2GT7A 3OYPA 4CRGA 2OC0A 1D4PB 5GCHG 1OXGA 1AWFH 2ZGJA 1A4WH 3GCNA 4A92A 4JYTA 2TRMA 3A88A 2B8OH 5C3NA 3LT3A 1C5SA 1YLDA 3W95A 4ZHLU 2W7SA 1OP2A 2ZDNA 3MNSA 1O2RA 1GI2A 1TMBH 4X6MA 3BSQA 1QB9A 2BHGA 4X2YA 2AERH 4O9VA 5A8XA 2OC1A 4TY7A 1XM1A 1WTGH 3ZZ4A 2J95A 3E1XB 3RXRA 4VGCC 1O3AA 3KHVA 1KYNA 4WY3A 2BXUH 3UIRA 1ZMLA 2F9NA 3ODFA 4H4FA 5F8ZA 1GHVH 4ABDA 1SOZA 2XWBI 1AKSB 1BIOA 1O0DH 1HIAA 2TGTA 2WINI 1FY5A 1GBMA 1TRMA 5A0CA 1HCGA 1O2KA 1JIRA 1O2WA 5EPNA 2FP7B 2WPIS 5HYOA 4UD9H 3TGJE 1GJBB 1SQTA 3NUMA 2PLXA 2QY0B 1HDTH 1AB9B 4X8UH 5JB8S 3KCGH 1HAYB 3LU9B 1ANEA 1FV9A 1T7CA 2A5IA 1Q31A 1BCUH 4NG9H 3A84A 1YPHE 2ASUB 3KQCA 1RIWC 5A8ZA 1CT2E 1C1MA 1AU8A 3BEFB 2P3FH 1P2KA 2H6MA 2P95A 2F9PA 4AX9H 1CT0E 1RTKA 1SHYA 4FU9A 4UFFH 1GI5A 4WMEA 1V2TT 4E7RG 4UFEH 1MKXH 2BZ6H 1GPZA 2ZDVH 5IDKA 5EQRA 4KTUA 2Z3CA 1LVBA 2A4GA 2VVVA 3MNBA 1G32B 1F5RA 1BJUA 2BVRH 1S83A 1YF4A 3GDVA 4A1XA 2QXGA 1THSH 4FUDA 2FM2A 1GBJA 2HNTC 1UCYK 1VR1H 2SFAA 2QXHA 1CQQA 4ABAA 1SL3A 2ZWLH 1C2EA 3ATMA 2O8WA 3L33A 1JIMA 5AF9H 1W12U 2HRVA 5GDSH 2UUKB 1S85A 1QIXB 1N8OC 1LPZB 5F8TA 4NWKA 1JMOH 3FANA 3TPIZ 5C67A 1GMDF 1AFQB 4AGJA 4XBBA 2HVXA 1PPCE 4ZKSU 1SGFA 1NZQH 2D26C 2SGFE 3RMNH 2G4UA 4O3TA 1LVOA 4NFEA 1DXPA 1HAXB 3ODDA 3SU5A 1FY3A 1CGIE 1QGFA 1ZZZA 3DT0H 4UONA 5C20A 5ETXA 1IQHA 3NK8A 3VB3A 3PTBA 1P2JA 3BG4B 3AAUA 5L2YH 3SHCH 1CU1A 1YYY1 3TH4H 1J14A 2G4TA 1QJ7B 1UTJA 1V3XA 2BD7A 3RM2H 4DIIH 3EBNA 3SO3A 3GCTG 1SPJA 1BRBE 2BDHA 3LC5A 1OP0A 3A86A 4MNYA 2ZECA 5EXNA 2CF9H 2ZFFH 1SQOA 2GCHF 1NFYA 1XXDA 1XXFA 1GBEA 1XMNB 2XXLA 3I78A 1QRZA 4NSYA 1K1PA 4XSKU 3RXEA 1O5DH 5JDUB 2YNAA 3TU7H 5E0GA 1JRTA 2SGDE 1GHYH 1ZTKA 3A80A 5DK1A 1T4VH 1C2DA 1BTUA 4I8LA 3QUMP 3RC6A 4JK6A 2CN0H 1FMGA 2YNBA 1UCYH 1V2PT 4HGCA 1K1OA 3O8DA 2LIZA 1WOFA 1TGTA 2VWNA 1UVUH 2EA3A 3LJJA 1SLWB 1E34B 2ZU5A 1O31A 1C5YB 5DP9A 4A6LA 1BTPA 4FXGH 2Y7ZA 4Y71A 1AUTC 3K9XB 3Q77A 2VWMA 4BTTB 4K8BA 1NU7B 2BVXH 1UHBB 1O2NA 1NESE 3MO6A 4WWYA 3NCLA 1BTZA 4YLQH 4KP0A 3TGKE