4WMEA

Crystal structure of catalytically inactive mers-cov 3cl protease (c148a) in spacegroup c2
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
306
structure length
306
Chain Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Middle East respiratory syndrome coronavirus 3C-like protease reveal insights into substrate specificity.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Hydrolase
molecule keywords MERS-CoV 3CL protease
total genus 85
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4wmeA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wmeA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wmeA02
1MD8A 2BLWA 2A7HA 2CGAA 3D23A 1Y5UT 3M7UA 1O3MA 2R0LA 2B9LA 3T5FH 3M5LA 4IMZA 2XBWA 3GCOA 5C1XA 2WUBA 1HIAA 4JYUH 4KP0A 1HJAC 1ELAA 5HMAA 5T3HA 2ZHEH 1CSOE 3KNXA 2ZPRA 1JWTA 2H9EH 1MMJN 2F9BH 5AHGH 3V12A 1TPSA 3I78A 1BUIA 3PLBA 4VGCC 3SI3H 1KXBA 2YOLA 4A1XA 1THSH 4ZHLU 1OP2A 1FUJA 1NRNH 3NWUA 3AASA 2BX4A 1BHXB 1V2MT 3M7TA 1K1IA 1WTGH 2ZHDA 1L0ZA 3NCLA 5FHTA 1W7GH 3RXJA 4ZKRU 1UVOA 1WYKA 1UMAH 4AFQA 2A4RA 4ABAA 6ESTA 2GDDA 2R2MB 4DVAU 5C67A 1S84A 2AEIH 3OY6U 3A7WA 4GCHF 4FUJA 1ZTKA 3GYMA 3HATH 3SUDA 1LPKB 4Y0ZE 1O3GA 2R3YA 1ORFA 5BPEA 3IWMA 2OC1A 2CF9H 5E2OA 5T6DA 2A7JA 4DIIH 1J14A 1RD3B 1V2NT 1A5IA 1C9PA 1LO6A 4D9QA 3H5CB 1DWBH 3D49H 3KN2A 4WMDA 3E90B 3V13A 1KXEA 2ZDMA 2OC8A 2ZDNA 1TQ7B 1HUTH 2HGTH 2BXTH 4WY3A 4E7NA 1QB9A 5A0AE 3G01A 2P8OB 4UEHH 4NA7A 3GICB 2B7DH 3KCGH 1SGFA 1OP8A 4TPIZ 2STBE 3RXFA 3C1KA 1LKBA 1HB0B 1G3DA 1WOFA 1QQ4A 1PYTC 1RXPA 3Q00A 1BRUP 5HM2A 3E0PB 3TH4H 1E0FD 1O5CB 2JH6D 2B8OH 3F6UH 3QK1A 4DURA 4H4FA 4AFSA 1BTXA 3T28A 3I77A 3A83A 4XBCA 3HPTB 1UCYH 1A46H 3BTME 1VR1H 1Y3WA 5EXNA 2QA9E 1Z8IB 2PFEA 1QBVH 2ZKSA 3O8BA 3QO6A 3LJOA 1FY1A 1IQMA 4NIVA 1Y59T 1G3BA 1O3CA 1O2OA 3VB7A 1L2EA 1AVWA 4TWWA 4AORA 1W12U 1NFUA 3Q77A 4AX9H 2GX4A 3GY5A 1ELEE 2O8MA 1DX5M 2D1JA 2Y81A 4WF8A 4A7IB 1NTPA 1GJ7B 1HV7A 1HAPH 1O3DA 1UCYK 2BM2A 3RXRA 2ZP0H 2CXVA 3ZZ7A 1YPKH 4UFFH 4OS4A 1GJ9B 2DE8A 5L6NH 1XKAC 4FUHA 4B2CA 1FN8A 1A7SA 1NFYA 1Z8JB 3MU1A 4AB9A 3SBKA 1O5FH 3LJJA 1C5XB 3URDA 3DFLA 4I33A 1ZPCA 5AFZH 3PTNA 1LCYA 2P3UB 4YM9A 1ID5H 2BVRH 3T26A 1PYTD 3ZZ5A 4SGBE 2ANMH 2ALPA 1RGQA 1AU8A 2FI5E 3MU0A 2PWXA 1QRXA 3LPRA 3S9CA 1AGJA 1AVGH 2W5EA 1WU1A 4NIWA 2CHAC 5AFYH 3QWCH 7GCHG 5K0HA 1NPMA 1GI6A 1RTKA 4X1RU 4Y8ZA 4O9VA 5JB8S 1O2KA 1GBHA 1O34A 5HM9A 1KY9A 5A8YA 2ZTYA 3RXGA 4B2BA 2NU4E 1GGDC 3KGPA 3SUGA 2ZHQH 4X8TH 1MUEB 5EW1H 5IYTA 3MU5A 1D3PB 3RU4D 2ZCHP 1DUEA 1K1PA 2HWLB 1DM4B 4KGAA 1ZRKA 4YLUA 1TBRH 2ZCKP 1EAIA 1YCPH 2ESTE 1CHOG 1UK3A 3M37A 4R8TB 5DPAA 1GHAF 1EOLA 1SGYE 3UR6A 2FZZA 1P10A 1AWFH 2ZI2H 4AGJA 5FBEA 1GCDA 5GJ4B 3M61U 2UUJB 1GJ4H 3LT3A 1ABIH 2FM2A 3KQEA 4H42U 1ELDE 1YLCA 1TA2A 3A7TA 4OGXA 1UTJA 1PPCE 2ZDVH 1MTUA 3GY2A 3FFGA 1KSNA 2J92A 3LC5A 4K1TA 5JDUB 1SGEE 5DP7A 2XNIA 4CRDA 1V2WT 2ZIQH 1GMDF 1NY22 1XUFA 1VCPA 1LHCH 1ELFA 3ZZ3A 1RJXB 1Z8GA 1EP5A 5DP3A 1O2UA 3GCNA 1ZPZA 3T27A 3T25A 1OWIA 2A4GA 1RRKA 1IOEA 1N6XA 4XOJA 3T29A 2OBOA 2ULLA 1CGIE 1MKXH 1DOJA 1ZPBA 3L33A 4CRBA 2Y7ZA 3KQCA 2BDYA 1O5AB 3A7ZA 5C5OA 1GMDG 2Z94A 1HXEH 1Y3VA 4K5ZA 4NG9H 3LU9B 5PTPA 2J34A 1TA6A 4Q80A 5SGAE 1MZAA 3RXLA 1OX1A 2FPZA 3A88A 3V7TA 2D8WA 1UK4A 4NCYA 2BY9X 1EPTC 1H9IE 2VWOA 3KQBA 2GV7A 4WXVA 3TNSA 1T31A 1V2UT 2RG3A 3UOUA 3K6ZA 4J2YB 1NS3A 1JOUB 2BD4A 5C1UA 2Z7FE 2PUXB 3ATKA 4SGAE 4BTTB 2WPKS 1O2PA 1P9SA 3UOPA 4ZXXH 3EBNA 1ZGIA 1K1NA 4AFZA 4LZ1H 2OC7A 3A82A 2I6SA 4CRGA 3P17H 1S82A 1J15A 4UDWH 5EQSA 3AAVA 3PO1C 3RLYH 3KF2A 4Y71A 1TRNA 1EAWA 3GCHB 3PTBA 1WTHD 2ZFQH 1V2QT 3U1JB 2P59A 3A87A 1SGDE 2OCVB 3RMLH 2QXJA 1VITF 4HFPB 3RXAA 3TJOA 2GP9B 1SLUB 1OWHA 4ZKSU 1DSTA 8ESTE 7GCHF 3RM0H 1FQ3A 3M3TA 3GOVB 5F8XA 3BTQE 3HK6B 3ODFA 4WMEA 2AMDA 1C2JA 3BEFB 4BAHB 1VCWA 4X1QU 5ABWA 4AG2A 4CRFA 1P04A 1H9LB 1MU6B 1O3JA 1TGSZ 2CN0H 2BQ7B 2FTLE 3RMOH 5A0BA 3F9GA 2FXRA 3BTKE 1ZRBA 2HNTC 7LPRA 1GVKB 2OQ5A 4NGAH 1GCTC 1BTYA 1FIWA 1K9OE 5ESBA 5EODA 4M7GA 7ESTE 3FVFB 3SJ9A 4FXGH 1MKWH 2A32A 1O2SA 4FUFA 1GHWH 1W3CA 3SU2A 3A8AA 3E6PH 6CHAC 4B75A 3UPEA 4WH6A 1CT2E 4IMQA 1O2JA 1QRZA 2G51A 1L4DA 3ODDA 1HAVA 3EGKH 3UFAA 2VWNA 1A4WH 1QY6A 3RP2A 1LHFH 1QQUA 1HGTH 4Y0YE 4ISLA 2G52A 1CHOF 1B0FA 2ZFTA 2GKVE 2TGPZ 2UWPA 1DICA 3ZVFA 2Z3CA 1O2TA 1CBWC 3RC4A 1D3QB 3RC6A 3RM2H 2V6NA 1YCPM 2C8WB 1DS2E 5A09A 3GISB 1C4V2 2Y5HA 3SQHE 2EA3A 1UK2A 1MH0A 1BMLA 1FY4A 1TMTH 1P01A 3A80A 1VGCC 4ZH8A 3M5OA 3RXMA 4NIYA 3U1IB 3LKWA 4BXWA 4KTUA 2ZHFH 1V2KT 3KIDU 4NA9H 3GY6A 4DT7B 3GCTF 1PJPA 4X6NA 3MNCA 1NT1A 2C8XB 2I6QA 2IJOB 2A2XH 2FOFA 3SV8A 4BTUB 4DGJA 4YT7H 1EJNA 1MD7A 1RFNA 1HCGA 1QIXB 2PKSC 3LH1A 4E05H 1Z7KA 1ANCA 6CHAB 1G3CA 2BDAA 2BOKA 1HYLA 4NSYA 1LDTT 1PPEE 4CRCA 5I46H 3UNRA 1C2DA 2JH0D 1AZZA 2BZ6H 3M5MA 3UR9A 1LVYA 2VH6A 2NU2E 1KTTB 2G5VA 5CE1A 1AFQB 4I8KA 1IQHA 1C2HA 2QXGA 3UQOA 1UVTH 3OX7U 2ZU4A 4INHA 3A89A 1XVOA 2ZQ2A 4K2YA 5FX5A 1GBFA 2FODA 1TX7A 4FU7A 1P12E 1PQ5A 5FCKA 1FPCH 2FI3E 4DCDA 3F9FA 2J95A 1HAGE 2GMTB 4GCHG 3TJUA 1C5QA 1GL1A 3SGAE 1A0LA 2SGDE 4I32A 3DUXH 1YLDA 2O9QA 2TGDA 1ZTJA 1XX9A 2FOEA 1PPFE 2D26C 1LMWB 3SU5A 4HTCH 2ZECA 3PV4A 2WPLS 1UTOA 2BHGA 9LPRA 4U30A 3HKIB 2A1DB 3P92A 1SL3A 4HZHA 4XBDA 1LHGH 2ZZUH 4U01A 5AF9H 1GJCB 2G81E 1TNGA 2GCTB 3EYDA 1EP6A 3MO6A 1F0UA 2PSXA 8GCHF 3QZRA 2W3KA 2O8LA 2FLRH 1GHBF 3VB4A 1E34B 1A3EH 1GI3A 1S6FA 3ENSB 3ELAH 4NZLA 1VJ9U 4H6SB 1NFWA 1PQ7A 2QXIA 3AW0A 3TNTA 4X1SU 1ANDA 1WAYB 1O2IA 4MNVA 1F5KU 1C1WH 2P3TB 1TGCA 2V0BA 2ANYA 2UUKB 1P57B 3SJOA 1IQLA 1BMAA 1XUKA 3O8CA 2C93B 1C5LH 4YOJA 1C5OH 1W7XH 1QA7A 2H2ZA 2R3UA 2J9NA 3SUFA 4NFFA 3SN8A 1LVMA 1L1GA 3BTWE 2C3SA 1IAUA 4MNYA 2FOMB 5EOKA 4B76A 3GYLB 2FX6A 3MNSA 3SNCA 1JIMA 3A8CA 4IS5A 2P94A 3MH6A 1VGCB 3PMAB 3UWIA 3RXIA 5F8ZA 1DUAA 1BTPA 2HLCA 3OYPA 4CHAC 3FANA 1P2MA 1G36A 1SHHB 3TGIE 1ZSKA 3ZVGA 2FP7B 1LKAA 1EATA 1XUJA 1BB0B 1FDPA 4IC6A 1AB9B 3RXUA 4H6TA 1ACBE 3VB5A 1ZZZA 3ZZ6A 3RXOA 4Y7AA 3VXEH 2FX4A 1H8IH 2DE9A 2PKAA 1K22H 4ZAEA 2PHBA 1NRSH 3RXDA 3BTEE 5JBTA 1FIZA 1TPPA 1RTLA 4OGYA 1PPHE 3MU8A 1MKXK 1DY9A 5BRRE 2ZCLP 2FOGA 2ZDKA 4OS6A 1G9IE 3W95A 2SGAA 5FPYA 1BA8B 2ODYB 5A8XA 2J94A 3KEEA 2ZDAH 1YF4A 5E0GA 3U8TH 3U8OH 1C2KA 1CA0C 1DVAH 1T8OA 1Y5AT 3T2NA 3A84A 1E37B 2WYJA 5HGGA 1ZOMA 4KELA 1ETSH 1TNHA 1O2XA 1YCPK 1F0TA 4X8VH 3TGJE 3RXKA 3SV2H 4ABDA 3ZZCA 3SNBA 2BVSH 2GCTC 1ZYOA 1QB1A 1FN6A 3M5NA 4Y8YA 4BAQB 4J1YA 1D3TB 3ATWA 4A5TS 2HPPH 1YC0A 3STIA 4CBNA 2VWMA 1J8AA 3AVZA 1GBAA 2ZU1A 1KLIH 1GJDB 1OS8A 4K69A 1K2I1 3GDSA 2O8TA 2CF8H 4AB8A 1RIWB 2BOHB 4DOQA 4CR5A 1VITH 1EZSC 1O5DH 3RDZA 1V2ST 3EA9A 5L2YH 4UD9H 2Q6FA 3RXPA 3RXSA 3BIUH 1P2QA 2XBYA 1TNJA 1QR3E 3GDUA 1GHZA 1HJ8A 1SG8B 4D7GA 1FNIA 3RMNH 1CO7E 2GCHG 2HOBA 5T6FA 3N7OA 4XE4A 4AZ2B 1TGBA 3MH7A 1AQ7A 1VCQA 2XC4A 1C5MD 1D6WA 1E35B 2FLBH 2Y5FA 3VB3A 2XWBI 2IPHA 1IHTH 2ZPQA 2XW9A 1GBCA 3BG8A 1AKSB 1NRQH 1P11E 1ANEA 3KQDA 5EXMA 1QJ1B 1KDQB 4AOQA 1ZMJA 1O2MA 2BLVA 4JZ1A 1UTQA 2ZEBA 1NFXA 5J4QA 5FCRA 3NK8A 2V3HH 1DLKB 1TX8A 1VITG 1GJ8B 2VIVA 1TNLA 2XC5A 3GY8A 2ZTXA 1GI5A 2HVXA 3A7YA 1FLEE 3KHVA 1K1MA 2SNWA 1EJMA 2SFAA 1SSXA 2THFB 3TITA 1YYY1 2BLOA 1HNEE 1EB1H 1ELCA 3CENA 1F0SA 4WXIA 5CHAB 2ZU3A 1C2IA 2QIQA 1C4U2 1AVXA 1C5TA 1GBJA 5EQQA 1LVBA 2VIOA 1BHXF 1D4PB 4JZDH 1GI0A 3TK9A 2Z9LA 1ZJKA 4NSVA 4A6LA 1YKTA 2XWAA 1DFPA 1INCA 3MYWA 1LQDB 3BTDE 4Y11E 4FU8A 1YBWA 4LOYH 1P05A 2HPQH 2Y5GA 2C4FH 4RKJB 4ABJA 1OOKB 4INLA 1SQAA 3SZNA 3TK6A 2C90B 4B2AA 4MPXA 1DY8A 1HXFH 3MU4A 2OTVA 1SGCA 3AAUA 1C4Y2 1O3NA 5ESTE 3KL6A 3MO9A 1MTSA 3JZ2B 1MBQA 2ZFFH 3LGIA 1CE5A 2UWOA 3MOCA 4TY6A 4CREA 3QGNB 3A85A 2STAE 1AMHA 3SQEE 3C27B 2BQWB 1O3HA 1S85A 4JZIA 4MVNA 4X0WU 1T32A 1EAXA 1BTUA 1MAYA 3BTHE 4F49A 3PWBA 5F6MA 1AE5A 1T8NA 2H9TH 2JETB 1K1OA 1ELGA 2BD8A 3P6ZB 1ESTA 2BLQA 4WVPE 4IW4E 1TPOA 1OSSA 5DK1A 4DW2U 1ZGVA 1SOTA 2GD4B 4GPGA 4ZROA 3SNDA 1GDQA 3PM3A 1F5LA 1L1JA 1OWKA 1GI1A 5DP9A 1HAXB 3R0FA 3S7HB 2ZGBH 1LHEH 1ZR0A 3ZVCA 3SNEA 2A5IA 1QJ6B 1MTNC 8GCHG 1Q31A 4Y6DA 1JIRA 3TJVA 4Z6AH 2AIQA 2AERH 1OP0A 3RXVA 1HAOH 1C2FA 2JH5D 3K65B 3RXHA 2ZF0H 1QTFA 2WV5A 4ABIA 3HGPA 1A2CH 5LPEA 1P2IA 2BDIA 3QTVH 2V3OH 1O2NA 3LGTA 1DXPA 4I8LA 3DFJA 5CHAC 3B23B 4NIXA 4FUEA 1IQKA 1E38B 4IC5A 1GHXH 1S0QA 4YOIA 4I31A 1O2LA 5E0JA 4XFQA 4BAMB 1GBIA 3U98H 1TGNA 1SGTA 1X7AC 1SOZA 4JMYA 2TIOA 1MAXA 1BRCE 2VH0A 4BAKB 2AIPA 3U69H 3IG6B 4K8BA 1ZTLA 2W3IA 5JBAS 4LXBH 3SNAA 7KMEH 1AFEH 2BD2A 2BY7X 1Z1IA 1TPAE 4YOGA 1Z8RA 2QC2A 2QV1A 1KYNA 5L30H 1F2SE 3A86A 1HFDA 1FZZA 3NKKA 4I8GA 2TPIZ 5K7RA 2ZU2A 2BD9A 1A0JA 1UCYE 1YPLH 2A2QH 2GGVB 4B74A 1P9UA 1Z1JA 4TY7A 2VINA 5A2MH 2AMQA 1OWDA 2G4TA 2C8ZB 4INKA 1E36B 3BN9A 4X2VA 1V2TT 2B0FA 1ESBA 1JRSA 4X6OA 1PPZA 3OSYA 3RC5A 1GMCF 3P8FA 1G2LA 2EC9H 1CT0E 2H5DA 2ALVA 3LGYA 3SU3A 3FAOA 1EB2A 1IQGA 4Y7BA 1RTFB 2WPJS 3Q76A 5LGOA 2VIDA 2XC0A 3CS7A 2GCHF 1AWHB 2IOTA 2P8OC 5E0HA 1A5GH 3P70B 3SORA 4AN7A 5DO4H 4GHQA 1B5GH 1JBUH 3L3TA 3SV7A 3RU4T 4AGKA 1L1NA 1ELTA 1TAWA 3QZQA 1P03A 3DA9B 1GHAG 2Z9KA 2OINA 3LGUA 5JBBS 2Q6DA 1YP9A 2WYGA 2QY0B 3ZZAA 1FXYA 4MPVA 3PLPA 2ODPA 4U32A 5E2PA 1P2NA 1SFQB 3RXBA 1GBTA 3SU1A 1MTWA 1NZQH 4CRAA 5A0CA 1C5RA 1LQEA 5FAHA 5HXFA 1AZ8A 1LHDH 3ATMA 5JYIA 4I8HA 1G37A 1XVMA 3ATIA 1T7CA 3O8RA 4X8UH 1H8DH 4NWKA 3ZZBA 2GZ9A 1F7ZA 1BDAA 2FWWA 1EKBB 1C5VA 3E0NB 4JZFH 1SGQE 5T6GA 1A3BH 4AFUA 3RXQA 1AY6H 3ZZ8A 1QBNA 1GBEA 5EU8A 2WPMS 2WINI 3H7TA 1D9IA 1BITA 1U6QA 1DLEA 3OTJE 3UQVA 2FOCA 4ASHA 2BY5X 1Z6EA 4UONA 1IQJA 2SGEE 1V3XA 1KXAA 4O97A 2AYWA 5TCAA 1UVSH 1SLVB 2BD5A 1YPMH 2HNTE 4TWYA 1MQ6A 1GPZA 2BDBA 2Y80A 1PQ8A 1C1SA 2SGQE 1O5GH 5ETXA 1IQNA 4IBLH 1BTZA 1C5UA 3U8RH 1SQTA 1ZMNA 3VXFH 3M3SA 1V6DA 3K9XB 1CA0B 1HAYB 3WY8A 1ZMLA 3F9HA 1NROH 1HAZB 4LZ4B 2OLGA 2GMTC 1F92A 1HJ9A 2B5TB 3DHKH 4TYDA 1TIOA 1HAIH 2Y6TA 1JXPA 1O3EA 1BBRH 5DG6A 3LOXA 1UVUH 3I29A 1ESAA 8LPRA 2R2WU 2OUAA 2ZQ1A 3FZZA 2JETC 3HK3B 1GI4A 3TJNA 1THPB 2QAAA 4K60A 3GY3A 4RN6A 4MQAA 3MO3A 1NU9A 1SBWA 2FTMA 1HDTH 1BMMH 1TALA 4GAWA 2RCEA 1DSUA 1D3DB 1VZQH 1T4VH 3E8LA 1EASA 3ZYDA 4B71A 1GL0E 1P2OA 3OU0A 4U2WA 1DITH 2PLXA 3BF6H 4NWLA 1KXCA 1GDNA 4JYVH 1ZLRA 2XBVA 1O3KA 3SO3A 1F0RA 4MG3A 3STJA 1O2GH 2UUYA 1QJ7B 1EAUA 2Z3EA 3EQ0H 2O8WA 4TPYA 1NM6A 1DWEH 1FJSA 2SNVA 2P93A 1FI8A 5I25A 4THNH 1ZJDA 1EQ9A 4X6MA 1S81A 3ZVBA 1V2PT 1V2VT 1K1LA 1P3CA 2KAIB 2TRMA 2BX3A 2BY8X 1AHTH 4GVUA 3SJKA 1W13U 1O5EH 2BVXH 2CV3A 2F83A 1O36A 4UFDH 3HKJB 5FBIA 3URCA 2ZGXH 3GCHC 4X2XA 1NO9H 5EQRA 4WH8A 4MPUA 4X8SH 2PR3A 1T8LA 3TU7H 1NU7B 5L2ZH 1MCTA 3EE0B 5TJXA 1HBTH 3K2UA 3Q3XA 3TGKE 3TLOA 5C20A 2QXHA 4Z0KA 1FV9A 4CBOA 3M36A 1CHGA 3TH2H 2ZDLA 1BRBE 1N6YA 1P06A 2J4IA 3UNQA 1BJUA 1TRYA 3BTFE 1O3LA 2FOHA 1C5SA 3EAJA 1AI8H 4KKDA 1PQAA 1C1MA 1O35A 1T8MA 2TBSA 3VEQB 2FESH 4ZKNU 4DJZB 1NRPH 3W94A 1EPTA 2W7SA 1QCPA 2PW8H 1N8OC 4YTAA 4WMFA 5E8EH 1WCZA 2F91A 1GWAA 5LH8A 4B1TA 3UTUH 1EOJA 4X1PU 4FUIA 1BIOA 4X2YA 2PTNA 4ABHA 5TCCA 4ZUHA 1ELVA 1DWCH 1UO6A 4Y79A 1DE7H 5JB9S 4IN1A 3T62A 4R0IA 4RSPA 1W10U 1CT4E 5EPYA 2J2UA 3E91A 2P3FH 4MLFB 3LDXH 1G3EA 1TQ0B 1XUIA 4A1VA 2F3CE 4BTIB 2NWNA 2K7XA 3BG4B 2EI8A 3B9FH 4GHTA 1YPJH 4Q7YA 2OQUA 3MHWU 1QRWA 1ABJH 3P8OA 1MTVA 3FZDA 3VFEA 2FDAA 2OC0A 2V35A 1TB6H 5JPMH 1BQYA 4I8JA 2G5NA 1W0YH 4OS2A 4FU9A 1YM0A 1J16A 1TE0A 2ZWLH 4ZMAH 1GI2A 3PMHB 3A8BA 5GCHG 3LGVA 2GV6A 1O3FA 1QGFA 1TFXA 2VVCA 3GCTG 2VGCB 3PMJA 1SGPE 3F68H 1O2QA 9ESTA 4CR9A 3A7VA 2GTBA 1C5WB 5DP4A 2ZFSA 1TOMH 3MNBA 2Q6GA 1WQSA 1GG6B 2JKHA 1SB1H 1AO5A 1GDUA 1A1RA 1SQOA 1UTNA 1N8OB 1W11U 1HJAB 1S0RA 1M9UA 3LIWA 2EI7A 4FVDA 4A1TA 1GCTB 1GBLA 2EEKA 2Z6BD 1QL9A 1C2GA 4KTCA 3LC3A 2SGPE 1TABE 4O03A 4DIHH 3D65E 1GMHG 1C1RA 3FP8E 4JK5A 2BB4A 1WV7H 3ZV8A 1GI7B 2BTCE 5DGJA 2G55A 1W2KH 3LGWA 2AMPA 4IGDA 4BNRA 1KLTA 1QURH 4ZHAA 2BDGA 5F03A 2FOBA 1OWEA 3MH4A 3QLPH 2CJIA 2FYQA 1G2MA 2QGRA 2GDEH 2XTTB 3RMMH 3SOSA 1SC8U 1BZXE 1GHYH 3E1XB 4CH2B 3ZZ4A 1EX3A 3SU0A 3UREA 1UJ1A 1NESE 1FY5A 1CGJE 3CS0A 1ANBA 1W0ZU 3R3GB 3ITIA 4WWYA 3TPIZ 3SV6A 1IQIA 1SMFE 4DY7B 1SVPA 3DT0H 2BZAA 3GDVA 2ANKH 4BAOB 2PTCE 2K1QA 2QYIA 2Z9GA 1O2YA 4FVBA 2XYAA 2OBQA 1C1NA 1EZQA 1FY8E 2Z9JA 3RLWH 2ILNA 1SFIA 1EPTB 1FONA 3SJIA 1OXGA 3FP7E 5LPFA 2VVVA 5EW2H 2QF3A 5H4IB 2AGGX 1FMGA 4Y10E 3O8DA 2Q1JA 1YPHE 3U9AH 1C1UH 1GBDA 1TMUH 4X6PA 1P3EA 1MZDA 2ZG0H 1ARBA 1V2LT 2Z9IA 1AUJA 2FIRH 1O3BA 2BD3A 2R9PA 3K6YA 1GJ6A 3CP7A 4OS5A 1ELBA 4UFEH 4IN2A 1C1QA 1TWXB 1Y3XA 2BDCA 4Q2KA 5B6OA 2VVUA 2FMJA 5DJ7A 1ZSLA 2ZC9H 4ABBA 2P16A 1LTOA 1SR5C 1XUGA 4GSOA 2ASUB 1Y3YA 2VIPA 1XXFA 1HAHH 2FS9A 1VJAU 2ZNKH 2BD7A 3P8GA 4GLYA 3VGCB 2CHAB 5C1YA 1S83A 1Z6JH 1O5BB 2LIZA 3SJ8A 5FX6A 4PROA 2GT8A 3ZV9A 1ZSJA 2VIWA 2H9HA 1KLJH 1O2RA 4YT6H 3HGNA 3RXEA 4X2WA 2KAIA 1HAVB 5LPRA 1AD8H 2XCFA 2WPHS 1MTNB 4FUCA 1JMOH 3M3VA 3RUOA 3UY9A 2YNBA 2F9VA 2F9NA 3TIUA 2H5CA 4JYTA 1O3IA 6GCHG 5C3NA 1EJAA 4MPWA 2DUCA 1EUFA 1NRRH 4ABGA 1D6RA 1GGDB 1EZUC 4AYYB 2G8TA 2YNAA 1N1LA 4JK6A 3QX5H 5DP6A 5CMXH 1UTPA 1UTMA 1DXWA 2W7UA 3M35A 1AFQC 3TH3H 1O30A 1S6HA 1O32A 3JZ1B 5J4SA 1QNJA 4RKOB 1QB6A 3Q3KA 5GWZA 4YO9A 1A61H 1WUNH 1LPZB 1OWJA 2VWLA 1K21H 1DWDH 4D7FA 3B8JA 2ZGHA 3RXTA 1BBRE 2RDLA 1ETTH 4FUDA 4MNXA 1Q3XA 5HYOA 1OKXA 2FOAA 1THRH 1O38A 4YESB 1GBMA 4K1SA 1SI5H 4O3UA 1C5NH 1CVWH 1TMBH 1Y8TA 2VJ1A 4HGCA 4UE7H 2HALA 2ZTZA 1A0HB 1NN6A 3BEIB 1SLXB 4MDSA 3S9AA 5EG4A 1GJ5H 1ZHRA 2A4OA 3NUMA 1RIWC 3SI4H 2G00A 1SGFG 3GY7A 3NPSA 4GUXA 4YLQH 1AUTC 3SU4A 4Q7XA 1P02A 5GDSH 3MTYA 1BCUH 2AS9A 4XBBA 3BG4C 1O2WA 1XKBC 1TONA 2H6MA 4XDEA 1MCVA 3DD2H 4ISNA 1TLDA 2A31A 2XRCA 3MI4A 3SUEA 1TBZH 5A8ZA 5EXLA 1A5HA 2VU8E 5C5NA 4Y8XA 1ZHPA 1BMNH 3PWCA 1PPBH 1KDQA 1O33A 2QF0A 1C1PA 1AB9C 1TRMA 4QT8C 3TK5A 3P95A 3E16B 3BEUA 2PGQB 1C5YB 1Y3UA 4Y76A 5DP5A 2BY6X 2ZA5A 5G4BA 2FEQH 4ABFA 2BXUH 1GMCG 1GBBA 2M5TA 1XMNB 3MFJA 1YPHC 2TGTA 4CHAB 5GIBA 1KTSB 2FI4E 2RA3A 2ZFRH 2NU1E 2AGIX 3E3TA 1OPHB 5EGMA 8KME2 3TVJB 2P95A 3ZVDA 1QHRB 1G30B 1SHYA 3H7OA 2WPIS 5JBCS 3ESTA 1K1JA 2QN5T 1O0DH 3BV9B 1BTHH 3Q3YA 3SU6A 1P2JA 1BJVA 4NA8A 1GI9B 2W26A 4BOHA 1AN1E 3GY4A 4KTSA 3NZIA 2PV9B 3F1SB 3ATLA 2GVFA 1QL8A 2VB0A 4VGCB 1AIXH 2ZGJA 2C8YB 1O3PB 2FS8A 2A0QB 2PKSB 1T4UH 3BTTE 3QGJA 1W8BH 1HLTH 1XXDA 4D8NA 1KIGH 3MH5A 3VPKA 4A92A 1SPJA 1GVLA 1AKSA 1TNIA 2ZFPH 1LPGB 1EZXC 2ZGCA 3QTOH 2AFQB 3BIVH 1HPGA 2BMGB 2R0KA 1BTWA 4ZXYH 5FXLA 1C9TA 2NU3E 4I7YH 2H1UA 3A7XA 3LH3A 2AH4X 3PYHA 1O2VA 1V2RT 3IITA 1DPOA 4FUBA 3S0NA 1O37A 3AW1A 1F5RA 5DKMA 1DT2A 3EA7A 1C2EA 1XUHA 1CA8B 3A8DA 4AYVB 1XM1A 1KXDA 1Y5BT 2ZU5A 1SGNE 1UTKA 3SGBE 1WSSH 2A45B 2BDHA 4K3JA 1TX6A 1IQFA 5FPTA 1G32B 1TNKA 2A4QA 2LPRA 3S69A 3QDZB 3S9BA 3ZZ9A 2PUQH 1MBMA 1UHBA 3SW2B 2D2DA 1B0EA 1HRTH 2A5AA 6LPRA 3BTGE 1H9HE 4Q7ZA 2VIQA 1SGRE 1YPGH 2ODQA 1QL7A 1QFKH 2ZHWH 1YPEH 1GMHF 2XCNA 1GVZA 3PMBB 1W14U 1QBOA 1RS0A 2BQ6B 2A7CA 3S7KB 3V3MA 4BANB 4JZEH 3OY5U 1CU1A 5IDKA 1O2HA 4ZHMU 1C2MA 1KXFA 1HIAB 4UFGH 1FAXA 5F8TA 1J9CH 1O3AA 2SGFE 4K1EA 3RXCA 1H1BA 1H4WA 1UVPA 2RA0A 3PB1E 1DDJA 2XBXA 2CMYA 1AE8H 1GHVH 4MNWA 5GPIB 2OP9A 1FY3A 1JRTA 1OYQA 1P2KA 1IQEA 1BRAA 1ZHMA 2BYAX 2GT7A 1NC6A 1GBKA 1C1TA 2XXLA 4NZQA 2FO9A 1GJAB 1MU8B 2WUCA 1GG6C 4B73A 1SLWB 1C5ZB 3V0XA 2LNCA 3F9EA 1O31A 4OS7A 2F9PA 1ARCA 3MMGA 4ISOA 2AGEX 1GI8B 2Y82A 3ZVAA 5DP8A 5GXPA 1GHBG 3EA8A 1O39A 3NXPA 1CBWB 3P8NA 4NFEA 4ABEA 4ISHH 3VB6A 1B7XB 2UUFB 1TBQH 1O3OA 1UTLM 2OD3B 1PPGE 3QUMP 1BBRK 3RU4E 2G4UA 2F9UA 4LK4A 2Z3DA 1TGTA 1PFXC 3UNSA 3SHCH 3LONA 3L6PA 1P0SH 1P8VC 4FUGA 1Z71A 5EPNA 4X1NU 3ZVEA 1C1OA 3ZZDA 3PLKA 3PROA 2J38A 4MTBA 2PKAB 2WV4A 1V2OT 4BXSA 1LVOA 2HNTF 2NU0E 2TGAA 2GZ8A 1BT7A 1CQQA 2VGCC 2PSYA 1FAKH 1DANH 1C1VH 3MWIU 2EI6A 3BSQA 3M7QA 3UWJH 2O8UA 1J17T 1WBGB 1QA0A 3VGCC 1WQVH 4O3TA 3EDXB 2ANWA 4CH8B 1TYNA 2UWLA 2QCYA 4WJG2 4ISIH 4D76A 1GJBB 2F9OA 2IN2A 1CGHA 4E06H 1YGCH 2OXSA 4F4OC 1L4ZA 1EXFA 1V2JT 1TOCB 4AG1A 4DG4A 1MQ5A 2Y7XA 4JCNA 1IHSH 3SV9A 1OYTH 4D9RA 4ESTE 1BOQA 2FYRA 2PGBB 3A81A 4ZKOU 5C2ZA 1FPHH 1K28D 5GCHF 2ZPSA 1C5PA 3FP6E 4YZUA 3PO1B 1P09A 4HI3A 4XSKU 2GZ7A 1UHBB 2VNTA 1O2ZA 3D62A 3MNXA 2ZO3H 4OS1A 4E7RG 1Q2WA 3SHAH 6GCHF 1MKWK 5FPSA 3SGQE 1ETRH 2HRVA 1SGIB 3ZYEA 3UIRA 1C2LA 4K8YA 3QN7A 3UUZA 1S5SA 5AVDA 2A5KA
chains in the Genus database with same CATH superfamily
5DSFA 1MD8A 2BLWA 2A7HA 2CGAA 3D23A 1Y5UT 3M7UA 1WDIA 1O3MA 2R0LA 2B9LA 3T5FH 3M5LA 4IMZA 2XBWA 3GCOA 4AC9A 5C1XA 2WUBA 1HIAA 4JYUH 4KP0A 1HJAC 1ELAA 5HMAA 5T3HA 3KYGA 2ZHEH 1CSOE 3KNXA 2ZPRA 1JWTA 2H9EH 1MMJN 2F9BH 5AHGH 3V12A 1TPSA 3I78A 4TSFD 1BUIA 3W1EA 3PLBA 4VGCC 3SI3H 1KXBA 2YOLA 4A1XA 1THSH 4F48B 4ZHLU 1OP2A 1FUJA 1NRNH 3NWUA 3SZEA 2F4LA 3AASA 2BX4A 1BHXB 1V2MT 3M7TA 1K1IA 1WTGH 2ZHDA 1L0ZA 3NCLA 5FHTA 1W7GH 2JJ2D 3RXJA 4ZKRU 1UVOA 1WYKA 1UMAH 4AFQA 2A4RA 4ABAA 6ESTA 2GDDA 2R2MB 4DVAU 5C67A 1S84A 2AEIH 3OY6U 3A7WA 4GCHF 2WPDD 4FUJA 1ZTKA 3GYMA 3HATH 3SUDA 1LPKB 4Y0ZE 1O3GA 2QF5A 1ORFA 2R3YA 5BPEA 3IWMA 2OC1A 2CF9H 5E2OA 5T6DA 2A7JA 4DIIH 3FO8D 1J14A 1RD3B 1V2NT 1A5IA 1C9PA 1LO6A 4D9QA 3H5CB 1DWBH 3D49H 3KN2A 4WMDA 3E90B 3V13A 1KXEA 2ZDMA 2OC8A 2ZDNA 1TQ7B 1HUTH 2HGTH 2BXTH 4WY3A 4E7NA 1QB9A 5A0AE 2K0QA 4YXWD 3G01A 2P8OB 1H8HD 4UEHH 4NA7A 3GICB 2VBCA 2B7DH 3KCGH 1SGFA 1OP8A 4TPIZ 2STBE 3RXFA 3C1KA 1LKBA 1HB0B 1G3DA 1WOFA 1QQ4A 1PYTC 1RXPA 3Q00A 1BRUP 5HM2A 3E0PB 3TH4H 1E0FD 1O5CB 2JH6D 2B8OH 3F6UH 3QK1A 3N7DA 4DURA 4H4FA 4AFSA 1BTXA 3T28A 3I77A 3A83A 4XBCA 3HPTB 1UCYH 1A46H 3BTME 1VR1H 1Y3WA 5EXNA 2QA9E 1Z8IB 2PFEA 1QBVH 2ZKSA 2WZQA 3O8BA 3QO6A 3LJOA 1FY1A 1FX0B 1IQMA 2GJGA 4NIVA 1Y59T 1G3BA 1O3CA 1O2OA 5KGOA 2KCYA 3VB7A 1L2EA 1AVWA 4TWWA 4AORA 1W12U 1NFUA 3Q77A 4AX9H 2GX4A 3GY5A 1ELEE 5C17A 2O8MA 1DX5M 2D1JA 3FKSD 4FETA 2Y81A 4WF8A 4A7IB 1NTPA 1GJ7B 1HV7A 1HAPH 1O3DA 1UCYK 2BM2A 3RXRA 2ZP0H 4Z1MD 2CXVA 3ZZ7A 1YPKH 2CK3D 4UFFH 4OS4A 1GJ9B 2DE8A 5L6NH 1XKAC 4FUHA 4B2CA 1FN8A 1A7SA 1NFYA 1Z8JB 3MU1A 4AB9A 3SBKA 1O5FH 3LJJA 1C5XB 3URDA 3DFLA 4I33A 1ZPCA 5AFZH 3PTNA 1LCYA 2P3UB 4YM9A 1ID5H 2BVRH 3T26A 1PYTD 3ZZ5A 4SGBE 2ANMH 2ALPA 1RGQA 1AU8A 2FI5E 3MU0A 2PWXA 1QRXA 2LELA 3LPRA 3S9CA 1AGJA 1AVGH 2W5EA 1WU1A 4NIWA 2CHAC 5AFYH 3QWCH 7GCHG 5K0HA 1NPMA 1GI6A 1RTKA 4X1RU 4Y8ZA 4O9VA 5JB8S 1O2KA 1GBHA 1O34A 5HM9A 1KY9A 5A8YA 4RT0A 2ZTYA 3RXGA 4B2BA 2NU4E 1GGDC 3KGPA 3SUGA 2ZHQH 4X8TH 1MUEB 5EW1H 5IYTA 3MU5A 1D3PB 3RU4D 2ZCHP 1DUEA 1K1PA 2HWLB 1DM4B 4KGAA 1ZRKA 1K0HA 4YLUA 1TBRH 2ZCKP 1EAIA 1YCPH 2ESTE 1CHOG 1UK3A 3M37A 3CNRA 4R8TB 1GHAF 5DPAA 1EOLA 1SGYE 3UR6A 2FZZA 1P10A 1AWFH 2ZI2H 4AGJA 5FBEA 1GCDA 2KX4A 5GJ4B 3M61U 2UUJB 1GJ4H 3LT3A 1ABIH 2FM2A 3KQEA 4H42U 1ELDE 1YLCA 1TA2A 3A7TA 4OGXA 1UTJA 1E1QD 1PPCE 2ZDVH 1MTUA 3GY2A 3FFGA 2KCAA 1KSNA 2J92A 3LC5A 4K1TA 5JDUB 1SGEE 5DP7A 2XNIA 4CRDA 1V2WT 2ZIQH 1GMDF 1NY22 1XUFA 1VCPA 1LHCH 1ELFA 3ZZ3A 1RJXB 1Z8GA 1EP5A 5DP3A 1O2UA 3GCNA 1ZPZA 3T27A 3T25A 1OWIA 2A4GA 1RRKA 1IOEA 1N6XA 4XOJA 3T29A 2OBOA 2ULLA 1CGIE 1MKXH 1DOJA 1ZPBA 3L33A 4CRBA 2Y7ZA 3KQCA 2BDYA 1O5AB 3A7ZA 5C5OA 1GMDG 2Z94A 1HXEH 1Y3VA 4K5ZA 4NG9H 3LU9B 5PTPA 2J34A 1TA6A 4Q80A 2V7QD 5SGAE 1MZAA 3RXLA 1OX1A 4B6EA 2FPZA 3A88A 3V7TA 2D8WA 1UK4A 4NCYA 2BY9X 1EPTC 1H9IE 2VWOA 3KQBA 2GV7A 4WXVA 3TNSA 5F53A 4TT3D 1T31A 1MABB 1V2UT 1OHHD 5CDFE 2RG3A 3UOUA 3K6ZA 4J2YB 1NS3A 1JOUB 2BD4A 5C1UA 2Z7FE 2PUXB 3ATKA 4SGAE 4BTTB 2WPKS 1O2PA 2EY4C 1P9SA 3UOPA 4ZXXH 3EBNA 1ZGIA 3OEED 1K1NA 4AFZA 4LZ1H 2OC7A 3A82A 2I6SA 4CRGA 3P17H 3PRDA 1S82A 1J15A 2F43B 4UDWH 3MQKC 5EQSA 3AAVA 3PO1C 3RLYH 3KF2A 4Y71A 1TRNA 1EAWA 3GCHB 3PTBA 1WTHD 2ZFQH 1V2QT 3U1JB 2P59A 3A87A 1SGDE 2OCVB 3RMLH 2QXJA 1VITF 4HFPB 3RXAA 3TJOA 2GP9B 1SLUB 1OWHA 4ZKSU 1DSTA 8ESTE 7GCHF 3RM0H 1FQ3A 3M3TA 5CHBA 3GOVB 5F8XA 3BTQE 3HK6B 3ODFA 4WMEA 2AMDA 1C2JA 3BEFB 4BAHB 1VCWA 1S6LA 4X1QU 5ABWA 4AG2A 4CRFA 1P04A 1H9LB 1MU6B 1O3JA 1TGSZ 2CN0H 2BQ7B 2FTLE 3RMOH 5A0BA 3F9GA 2FXRA 3BTKE 1ZRBA 2HNTC 7LPRA 1GVKB 2OQ5A 4NGAH 1GCTC 1BTYA 1FIWA 1K9OE 5ESBA 5EODA 4M7GA 7ESTE 3FVFB 3SJ9A 4FXGH 1MKWH 2A32A 1O2SA 4FUFA 1YY3A 1GHWH 1W3CA 3SU2A 3A8AA 3E6PH 6CHAC 4B75A 3UPEA 4WH6A 1CT2E 4IMQA 1O2JA 1QRZA 2G51A 1L4DA 3ODDA 1HAVA 2W6ID 3EGKH 2IJD1 3UFAA 2VWNA 1A4WH 1QY6A 3RP2A 1LHFH 1QQUA 1HGTH 4Y0YE 4ISLA 2G52A 1CHOF 1B0FA 5T1VA 2ZFTA 2GKVE 2TGPZ 2UWPA 1DICA 3ZVFA 2Z3CA 1O2TA 1CBWC 3RC4A 1D3QB 3RC6A 3RM2H 2V6NA 1YCPM 2C8WB 1DS2E 5A09A 4Q4LA 3GISB 1C4V2 2Y5HA 3SQHE 2EA3A 1UK2A 1MH0A 1BMLA 1FY4A 1TMTH 1P01A 3A80A 1VGCC 4ZH8A 3F2GA 3M5OA 3RXMA 4NIYA 3U1IB 3LKWA 4BXWA 4KTUA 2ZHFH 1V2KT 3KIDU 4NA9H 3GY6A 5KECA 4DT7B 3GCTF 1PJPA 4X6NA 3MNCA 1NT1A 2C8XB 2I6QA 2IJOB 2A2XH 2FOFA 3SV8A 4BTUB 4DGJA 4YT7H 1EJNA 1MD7A 1RFNA 1HCGA 1QIXB 2KCOA 2PKSC 3LH1A 4E05H 1Z7KA 1ANCA 6CHAB 1G3CA 2BDAA 2BOKA 1HYLA 4NSYA 1LDTT 1PPEE 4CRCA 5I46H 3UNRA 1C2DA 2JH0D 1AZZA 2BZ6H 3M5MA 3UR9A 1LVYA 2VH6A 2NU2E 4RT1A 1KTTB 2G5VA 5CE1A 1AFQB 4I8KA 1IQHA 1C2HA 2QXGA 3UQOA 1UVTH 3OX7U 2ZU4A 4INHA 3A89A 1XVOA 2ZQ2A 4K2YA 5FX5A 1GBFA 2FODA 1TX7A 4FU7A 1P12E 1PQ5A 5FCKA 1FPCH 2FI3E 4DCDA 3F9FA 2J95A 1HAGE 2GMTB 4GCHG 3TJUA 1C5QA 1GL1A 3SGAE 1A0LA 2SGDE 4I32A 3DUXH 1YLDA 2O9QA 2TGDA 1ZTJA 1XX9A 2FOEA 1PPFE 2D26C 1LMWB 3SU5A 4HTCH 2ZECA 3PV4A 2WPLS 1UTOA 2BHGA 9LPRA 4U30A 3HKIB 2A1DB 3P92A 1SL3A 4HZHA 4XBDA 1LHGH 2ZZUH 4U01A 5AF9H 3FOAA 1GJCB 2G81E 1TNGA 2GCTB 3EYDA 1EP6A 3MO6A 1F0UA 2PSXA 8GCHF 3QZRA 2W3KA 2O8LA 2FLRH 1GHBF 3VB4A 1E34B 3WWFA 1A3EH 1GI3A 1S6FA 3ENSB 3OE7D 3ELAH 4NZLA 1VJ9U 4H6SB 1NFWA 1PQ7A 3AW0A 3TNTA 2QXIA 4X1SU 1ANDA 1WAYB 1COWD 1O2IA 4MNVA 1F5KU 1C1WH 2P3TB 1TGCA 2V0BA 2ANYA 2UUKB 1P57B 3SJOA 1IQLA 1BMAA 1XUKA 3O8CA 2C93B 1C5LH 4YOJA 1C5OH 1W7XH 5EJLA 1QA7A 2H2ZA 2R3UA 2J9NA 3SUFA 4NFFA 5C0UA 3SN8A 1LVMA 1L1GA 3BTWE 2C3SA 1IAUA 4MNYA 2FOMB 5EOKA 4B76A 3GYLB 2FX6A 3MNSA 3SNCA 1JIMA 3A8CA 4IS5A 2P94A 3MH6A 1VGCB 3PMAB 3UWIA 3RXIA 3F2HA 5F8ZA 1DUAA 1BTPA 2HLCA 3OYPA 4CHAC 3FANA 1P2MA 1G36A 1SHHB 3TGIE 1ZSKA 3ZVGA 2FP7B 1LKAA 1EATA 1XUJA 1BB0B 1FDPA 4IC6A 1AB9B 3RXUA 4H6TA 1ACBE 3VB5A 1ZZZA 3ZZ6A 3RXOA 4Y7AA 2HVYB 3VXEH 2FX4A 1H8IH 2DE9A 2PKAA 1K22H 4ZAEA 2PHBA 1NRSH 3RXDA 3BTEE 5JBTA 1FIZA 1TPPA 1RTLA 4OGYA 1NBME 1PPHE 3MU8A 1MKXK 1DY9A 5BRRE 2ZCLP 2FOGA 2ZDKA 4OS6A 1G9IE 3W95A 2SGAA 5FPYA 1BA8B 2ODYB 5A8XA 2J94A 3KEEA 2ZDAH 1YF4A 5E0GA 3U8TH 3U8OH 1C2KA 1CA0C 1DVAH 1T8OA 4I86A 1Y5AT 3T2NA 3A84A 1E37B 2WYJA 5HGGA 1ZOMA 4KELA 1ETSH 1TNHA 1O2XA 1YCPK 1F0TA 4X8VH 3TGJE 2YMSB 3RXKA 3SV2H 4ABDA 3ZZCA 3SNBA 2BVSH 2GCTC 1ZYOA 1QB1A 1FN6A 3M5NA 4Y8YA 4BAQB 4J1YA 1D3TB 3ATWA 4A5TS 2HPPH 1YC0A 4P02A 3STIA 4CBNA 2VWMA 1J8AA 3AVZA 1GBAA 2ZU1A 1KLIH 1GJDB 1OS8A 4K69A 1K2I1 1EFRD 2O8TA 3GDSA 2CF8H 4AB8A 1BMFD 1RIWB 2BOHB 4DOQA 4CR5A 1VITH 1EZSC 1O5DH 3RDZA 1V2ST 3EA9A 5L2YH 4UD9H 2Q6FA 3RXPA 3RXSA 3UAIC 3BIUH 1P2QA 2KM0A 2XBYA 1TNJA 1QR3E 3GDUA 1GHZA 1HJ8A 1SG8B 4D7GA 1FNIA 3RMNH 1CO7E 2GCHG 2HOBA 5T6FA 3N7OA 4XE4A 4AZ2B 1TGBA 3F0PA 3MH7A 1AQ7A 1VCQA 2XC4A 1C5MD 1D6WA 1E35B 2FLBH 2Y5FA 3VB3A 3VG8A 2XWBI 2IPHA 1IHTH 2ZPQA 2XW9A 1GBCA 3WWBA 3BG8A 1AKSB 1NRQH 1P11E 3DCLA 1ANEA 3KQDA 5EXMA 1QJ1B 1KDQB 4AOQA 1ZMJA 1O2MA 2BLVA 4JZ1A 1UTQA 2ZEBA 1NFXA 4B6FA 5J4QA 5FCRA 3NK8A 2V3HH 1DLKB 1TX8A 1VITG 1GJ8B 2VIVA 1TNLA 2XC5A 3GY8A 2W6JD 2ZTXA 1GI5A 2HVXA 3A7YA 2WHXA 1FLEE 3KHVA 1K1MA 2SNWA 1EJMA 2SFAA 1SSXA 2THFB 3TITA 1YYY1 2BLOA 5KEDA 1HNEE 2QF4A 1EB1H 1ELCA 3CENA 1F0SA 4WXIA 5CHAB 2ZU3A 1C2IA 2QIQA 1C4U2 1AVXA 1C5TA 1GBJA 5EQQA 1LVBA 2VIOA 1BHXF 1D4PB 4JZDH 1GI0A 3TK9A 2Z9LA 1ZJKA 4NSVA 4HG6A 4A6LA 1YKTA 2XWAA 1DFPA 1INCA 3MYWA 1LQDB 3BTDE 4Y11E 4FU8A 1YBWA 4LOYH 1P05A 2HPQH 2Y5GA 2C4FH 4RKJB 4ABJA 1OOKB 4INLA 1SQAA 3SZNA 3TK6A 2C90B 4B2AA 4MPXA 1DY8A 1HXFH 3MU4A 2OTVA 1SGCA 3AAUA 1C4Y2 1O3NA 5ESTE 3KL6A 3MO9A 1MTSA 3JZ2B 1MBQA 2ZFFH 3LGIA 1CE5A 2UWOA 3MOCA 4TY6A 4CREA 3QGNB 3A85A 2STAE 1AMHA 3SQEE 3C27B 2BQWB 1O3HA 1S85A 2KR7A 4JZIA 4MVNA 4X0WU 1T32A 1EAXA 1BTUA 1MAYA 3BTHE 4F49A 3PWBA 5F6MA 1AE5A 1T8NA 2H9TH 2JETB 1K1OA 3OAAD 1ELGA 2BD8A 3P6ZB 1ESTA 2BLQA 4WVPE 4IW4E 1TPOA 1OSSA 5DK1A 4DW2U 1ZGVA 1SOTA 2GD4B 4GPGA 4ZROA 2YMSD 3SNDA 1GDQA 3PM3A 1F5LA 1L1JA 1OWKA 1GI1A 5DP9A 3KQ5A 2RFKC 1HAXB 3R0FA 5HKKD 3S7HB 2ZGBH 1LHEH 1ZR0A 3ZVCA 3SNEA 2A5IA 1QJ6B 1MTNC 8GCHG 1Q31A 4Y6DA 1JIRA 3TJVA 4Z6AH 2AIQA 2AERH 1OP0A 3RXVA 1HAOH 1C2FA 2JH5D 3K65B 3RXHA 2ZF0H 1QTFA 2WV5A 4ABIA 3HGPA 1A2CH 5LPEA 1P2IA 2BDIA 3QTVH 2V3OH 1O2NA 3LGTA 1DXPA 4I8LA 3DFJA 5CHAC 3B23B 4NIXA 4FUEA 1IQKA 1E38B 4IC5A 1GHXH 1S0QA 4YOIA 4I31A 1O2LA 5E0JA 4XFQA 4OM9A 4BAMB 1GBIA 3U98H 2EQNA 1TGNA 1SGTA 1X7AC 1SOZA 4JMYA 2TIOA 1MAXA 4DT4A 1BRCE 3WW7A 2VH0A 4BAKB 2OK5A 2AIPA 3U69H 3IG6B 4K8BA 1ZTLA 2W3IA 5JBAS 4LXBH 3SNAA 7KMEH 1AFEH 2BD2A 2BY7X 1Z1IA 1TPAE 4YOGA 1Z8RA 2QC2A 2QV1A 1KYNA 5L30H 1F2SE 3A86A 1HFDA 1FZZA 3NKKA 4I8GA 2TPIZ 5K7RA 2ZU2A 2BD9A 1A0JA 1UCYE 1YPLH 2A2QH 2GGVB 4B74A 1P9UA 1Z1JA 4TY7A 2VINA 5A2MH 2AMQA 1OWDA 2G4TA 2C8ZB 4INKA 1E36B 3BN9A 4X2VA 1V2TT 2B0FA 1ESBA 1JRSA 4X6OA 1PPZA 3OSYA 3RC5A 1GMCF 3P8FA 1G2LA 2EC9H 1CT0E 2H5DA 2JIZD 2K8IA 2ALVA 3LGYA 3SU3A 3FAOA 1EB2A 1IQGA 4Y7BA 1RTFB 2WPJS 3Q76A 5LGOA 2VIDA 2XC0A 3CS7A 3SYJA 2GCHF 1AWHB 2IOTA 2P8OC 5E0HA 3ZIAD 1A5GH 3P70B 3SORA 4AN7A 5DO4H 4GHQA 1B5GH 1JBUH 3L3TA 3SV7A 3RU4T 4AGKA 1L1NA 1ELTA 1TAWA 3QZQA 2IPQX 1P03A 3DA9B 1GHAG 2Z9KA 2OINA 3LGUA 5JBBS 2Q6DA 1YP9A 2WYGA 2QY0B 3ZZAA 1FXYA 4MPVA 3PLPA 2ODPA 4U32A 5E2PA 1P2NA 1SFQB 3RXBA 1GBTA 3SU1A 1MTWA 1NZQH 4CRAA 5A0CA 1C5RA 1LQEA 2QE7D 5FAHA 1AZ8A 5HXFA 1LHDH 3ATMA 5JYIA 4I8HA 1G37A 1XVMA 3ATIA 1T7CA 3O8RA 4X8UH 1H8DH 4NWKA 3ZZBA 2GZ9A 1F7ZA 1BDAA 2FWWA 1EKBB 1C5VA 3E0NB 4JZFH 1SGQE 5T6GA 1A3BH 4AFUA 3RXQA 1AY6H 3ZZ8A 1QBNA 1GBEA 5EU8A 2WPMS 2WINI 3H7TA 1D9IA 4XD7D 1BITA 1U6QA 5HIYA 1DLEA 3OTJE 3UQVA 2FOCA 4ASHA 2BY5X 1Z6EA 4UONA 1IQJA 2SGEE 1V3XA 1KXAA 4O97A 2AYWA 5TCAA 1UVSH 1SLVB 2BD5A 1YPMH 2HNTE 4TWYA 1MQ6A 1SKYE 1GPZA 2BDBA 2Y80A 1PQ8A 1C1SA 2SGQE 1O5GH 5ETXA 1IQNA 4IBLH 1BTZA 1C5UA 3U8RH 1SQTA 1ZMNA 3VXFH 5IK2D 3M3SA 1V6DA 3K9XB 1CA0B 2YMSC 1HAYB 3WY8A 1ZMLA 3F9HA 1NROH 1HAZB 4LZ4B 2OLGA 2GMTC 1F92A 1HJ9A 2B5TB 3DHKH 4TYDA 1TIOA 2M2AA 1HAIH 4Q63A 2Y6TA 1JXPA 1O3EA 1BBRH 5DG6A 3LOXA 1UVUH 3I29A 1ESAA 8LPRA 2R2WU 2OUAA 2ZQ1A 3FZZA 2JETC 3HK3B 2LP6A 1GI4A 3TJNA 1THPB 2QAAA 4K60A 3GY3A 5C0TA 4RN6A 4MQAA 3MO3A 1NU9A 1SBWA 2FTMA 1HDTH 1BMMH 1TALA 4GAWA 2RCEA 2XOKD 1DSUA 1D3DB 1VZQH 1T4VH 3E8LA 1EASA 3ZYDA 4B71A 1GL0E 1P2OA 3OU0A 4U2WA 1DITH 2PLXA 3BF6H 4NWLA 1KXCA 1GDNA 4JYVH 1W0KD 1ZLRA 2XBVA 1O3KA 3SO3A 3OEHD 1F0RA 4MG3A 3STJA 1O2GH 2UUYA 1QJ7B 1EAUA 2Z3EA 3EQ0H 2O8WA 3DSOA 4TPYA 1NM6A 1DWEH 1FJSA 2SNVA 2P93A 1FI8A 5I25A 4THNH 1ZJDA 1EQ9A 4X6MA 1S81A 3ZVBA 1V2PT 1V2VT 1K1LA 1P3CA 2KAIB 2TRMA 2BX3A 2BY8X 1AHTH 4GVUA 3SJKA 1W13U 3NRLA 1O5EH 2BVXH 2CV3A 2F83A 1O36A 4UFDH 3HKJB 5FBIA 3URCA 2ZGXH 3GCHC 4X2XA 1NO9H 5EQRA 4WH8A 4MPUA 4X8SH 2PR3A 1T8LA 3TU7H 1NU7B 5L2ZH 2RDEA 1MCTA 3EE0B 5TJXA 1HBTH 3K2UA 3Q3XA 3TGKE 3TLOA 5C20A 2QXHA 4Z0KA 1FV9A 4CBOA 3FN8A 3M36A 1CHGA 3TH2H 2ZDLA 1BRBE 1N6YA 1P06A 2J4IA 3UNQA 1QZ8A 1BJUA 1TRYA 3BTFE 1O3LA 2FOHA 4F55A 1C5SA 3EAJA 1AI8H 4KKDA 1PQAA 1C1MA 1O35A 1T8MA 2TBSA 3VEQB 2FESH 4ZKNU 4DJZB 1NRPH 3W94A 1EPTA 2W7SA 1QCPA 2PW8H 1N8OC 4YTAA 4WMFA 3KYFA 5E8EH 1WCZA 3F2FA 2F91A 2WV9A 1GWAA 5LH8A 4B1TA 3UTUH 1EOJA 4X1PU 4FUIA 1BIOA 4X2YA 2PTNA 4ABHA 5TCCA 4ZUHA 1ELVA 1DWCH 1UO6A 4Y79A 1DE7H 5JB9S 4IN1A 3T62A 4R0IA 4RSPA 1W10U 1CT4E 5EPYA 2J2UA 3E91A 2P3FH 4MLFB 3LDXH 1G3EA 1TQ0B 1XUIA 4A1VA 2F3CE 2PP6A 4BTIB 2NWNA 2K7XA 3BG4B 2EI8A 3B9FH 4GHTA 1YPJH 4Q7YA 2OQUA 3H09A 1QRWA 3MHWU 1ABJH 3P8OA 1MTVA 3FZDA 3VFEA 2FDAA 2OC0A 2V35A 1TB6H 5JPMH 1BQYA 4I8JA 2G5NA 1W0YH 4OS2A 4FU9A 5EJZA 1YM0A 1J16A 1TE0A 2ZWLH 4ZMAH 1GI2A 3PMHB 1E79D 3A8BA 3LGVA 5GCHG 2GV6A 1O3FA 1QGFA 1TFXA 2VVCA 3GCTG 2VGCB 3PMJA 1SGPE 2L74A 3F68H 1O2QA 9ESTA 4CR9A 3A7VA 2GTBA 1C5WB 5DP4A 2ZFSA 1TOMH 3MNBA 2Q6GA 1WQSA 1GG6B 2JKHA 1SB1H 1AO5A 1GDUA 1A1RA 1SQOA 1UTNA 1N8OB 1W11U 1HJAB 1S0RA 1M9UA 3LIWA 2EI7A 4FVDA 4A1TA 1GCTB 1GBLA 2EEKA 2Z6BD 1QL9A 1C2GA 4KTCA 3LC3A 3PRBA 2SGPE 1TABE 1YWUA 4O03A 4DIHH 3D65E 1GMHG 1C1RA 2WSSD 3FP8E 4ZCNA 4JK5A 2BB4A 1WV7H 3ZV8A 1GI7B 2BTCE 5DGJA 2G55A 1W2KH 3LGWA 2AMPA 4IGDA 4BNRA 1KLTA 1QURH 4ZHAA 2BDGA 5F03A 2FOBA 1OWEA 2V3MA 3MH4A 1SQRA 3QLPH 4FOUC 2CJIA 2FYQA 1G2MA 2QGRA 2GDEH 2XTTB 3RMMH 3SOSA 1SC8U 1BZXE 1GHYH 3E1XB 4CH2B 3ZZ4A 1EX3A 3SU0A 3UREA 1UJ1A 1NESE 1W0JD 1FY5A 1CGJE 2JDID 3CS0A 1ANBA 1W0ZU 3R3GB 3ITIA 4WWYA 3TPIZ 3SV6A 1IQIA 1SMFE 4DY7B 1SVPA 3DT0H 2BZAA 3GDVA 2ANKH 4BAOB 2PTCE 2K1QA 4ACAA 2QYIA 2Z9GA 1O2YA 4FVBA 2XYAA 2OBQA 1C1NA 1EZQA 1FY8E 2Z9JA 3RLWH 2ILNA 1SFIA 1EPTB 1FONA 3EE7A 3SJIA 1OXGA 3FP7E 5LPFA 2VVVA 5EW2H 2QF3A 5H4IB 2AGGX 1FMGA 4Y10E 3O8DA 2Q1JA 1YPHE 3U9AH 1C1UH 1GBDA 1TMUH 4X6PA 1P3EA 1MZDA 2KCPA 2ZG0H 1ARBA 1V2LT 2Z9IA 1AUJA 2FIRH 1O3BA 2BD3A 2R9PA 1H8ED 3K6YA 1GJ6A 3CP7A 4OS5A 1ELBA 4UFEH 4IN2A 1C1QA 1TWXB 1Y3XA 2BDCA 4Q2KA 5B6OA 2VVUA 2FMJA 5DJ7A 1ZSLA 2ZC9H 4ABBA 2P16A 1LTOA 1SR5C 1XUGA 4GSOA 2ASUB 1Y3YA 2VIPA 4M9FA 1XXFA 2XNDD 1HAHH 2AHME 2FS9A 1VJAU 2ZNKH 2BD7A 3P8GA 4GLYA 3VGCB 2CHAB 5C1YA 1S83A 1Z6JH 1O5BB 2LIZA 3SJ8A 5FX6A 4PROA 2GT8A 3ZV9A 1ZSJA 2VIWA 2H9HA 1KLJH 1O2RA 4YT6H 3HGNA 3RXEA 4X2WA 2KAIA 1HAVB 5LPRA 1AD8H 2XCFA 2WPHS 1MTNB 1KMHB 4FUCA 1JMOH 1WXRA 3M3VA 3RUOA 3UY9A 2YNBA 2F9VA 2F9NA 3TIUA 2H5CA 4JYTA 1O3IA 6GCHG 5C3NA 2J5UA 1EJAA 4MPWA 2DUCA 1EUFA 1NRRH 4ABGA 1D6RA 2KZ4A 1GGDB 1EZUC 2JJ1D 2G8TA 4AYYB 3N99A 2YNAA 1N1LA 4JK6A 3QX5H 5DP6A 5CMXH 1UTPA 1UTMA 1DXWA 2W7UA 3M35A 1AFQC 3TH3H 1O30A 1S6HA 1O32A 3JZ1B 5J4SA 1QNJA 4RKOB 1QB6A 5GNDA 3Q3KA 5GWZA 4YO9A 1A61H 1WUNH 1LPZB 1OWJA 2VWLA 1K21H 1DWDH 4D7FA 3B8JA 2ZGHA 3RXTA 1BBRE 2RDLA 1ETTH 4FUDA 4MNXA 1Q3XA 5HYOA 1OKXA 2FOAA 1THRH 4ASUD 1O38A 4YESB 1GBMA 4K1SA 1SI5H 4O3UA 1C5NH 1CVWH 1TMBH 1Y8TA 3AK5A 2VJ1A 4HGCA 4UE7H 2HALA 2ZTZA 1A0HB 1NN6A 3BEIB 1SLXB 4MDSA 3S9AA 5EG4A 1GJ5H 1ZHRA 2A4OA 3NUMA 1RIWC 3SI4H 3U28C 2G00A 3PV2A 1SGFG 3GY7A 3NPSA 2J98A 4GUXA 4YLQH 1AUTC 3SU4A 4Q7XA 1P02A 5GDSH 3MTYA 1BCUH 2AS9A 4XBBA 3BG4C 1O2WA 1XKBC 1TONA 2H6MA 3PV5A 1MCVA 4XDEA 4ISNA 3DD2H 5B6LA 1TLDA 2A31A 2XRCA 3MI4A 3SUEA 1TBZH 5A8ZA 5EXLA 1A5HA 2VU8E 5C5NA 4Y8XA 1ZHPA 1BMNH 3PWCA 1PPBH 1KDQA 1O33A 2QF0A 1C1PA 1AB9C 4ACBA 1TRMA 4QT8C 1UW7A 3TK5A 3P95A 3E16B 3BEUA 2PGQB 4RI0A 1C5YB 1Y3UA 4Y76A 5DP5A 2BY6X 2ZA5A 5G4BA 5HIZA 2FEQH 4ABFA 2BXUH 1GMCG 1GBBA 2M5TA 1XMNB 3MFJA 1YPHC 2TGTA 4CHAB 5GIBA 1KTSB 2FI4E 2RA3A 2ZFRH 2NU1E 2AGIX 3E3TA 1OPHB 5EGMA 8KME2 3TVJB 2P95A 3ZVDA 1QHRB 1G30B 1SHYA 3H7OA 2WPIS 5JBCS 3ESTA 1K1JA 2QN5T 1O0DH 3BV9B 1BTHH 3Q3YA 3SU6A 1P2JA 1BJVA 4NA8A 1GI9B 2W26A 4BOHA 1AN1E 3GY4A 4KTSA 3NZIA 2PV9B 3F1SB 3ATLA 2GVFA 1QL8A 2VB0A 4VGCB 1AIXH 5EJ1A 2ZGJA 2C8YB 1O3PB 2FS8A 2A0QB 2PKSB 1T4UH 3BTTE 3QGJA 1W8BH 1HLTH 1XXDA 4D8NA 1KIGH 3MH5A 3VPKA 4A92A 1SPJA 1GVLA 1AKSA 1TNIA 2ZFPH 1LPGB 1EZXC 5DN6D 3DSPA 2ZGCA 3QTOH 2AFQB 3BIVH 1HPGA 2BMGB 2R0KA 1BTWA 1VKYA 4ZXYH 5FXLA 1C9TA 2NU3E 4I7YH 2H1UA 3A7XA 3LH3A 2AH4X 3PYHA 1O2VA 1V2RT 3IITA 1DPOA 4FUBA 3S0NA 1O37A 1YLNA 3AW1A 1F5RA 5DKMA 1DT2A 3EA7A 1C2EA 1XUHA 2KFWA 1CA8B 3A8DA 3GS9A 4AYVB 1XM1A 1KXDA 1Y5BT 2ZU5A 1SGNE 1UTKA 3SGBE 1WSSH 2A45B 2BDHA 4K3JA 1TX6A 3OTPA 1IQFA 5FPTA 1G32B 1TNKA 2A4QA 2LPRA 4P00A 3S69A 3QDZB 3S9BA 3ZZ9A 2PUQH 1MBMA 1UHBA 3SW2B 2D2DA 1B0EA 1HRTH 2A5AA 6LPRA 3BTGE 1H9HE 4Q7ZA 5FL7D 2VIQA 1SGRE 1YPGH 2ODQA 1QL7A 1QFKH 2ZHWH 2HLDD 1YPEH 1GMHF 2XCNA 1GVZA 3PMBB 1W14U 1QBOA 1RS0A 2BQ6B 2A7CA 3S7KB 3V3MA 4BANB 4JZEH 3OY5U 1CU1A 3F0OA 5IDKA 1O2HA 4ZHMU 1C2MA 1KXFA 3UB0A 1HIAB 4UFGH 1FAXA 5F8TA 1J9CH 1O3AA 2SGFE 4K1EA 3RXCA 1H1BA 1H4WA 1UVPA 2RA0A 3PB1E 1DDJA 2XBXA 2CMYA 1AE8H 1GHVH 4MNWA 5GPIB 2OP9A 1FY3A 1JRTA 1OYQA 1P2KA 1IQEA 1BRAA 1ZHMA 2BYAX 2GT7A 1NC6A 1GBKA 1C1TA 2XXLA 4NZQA 2FO9A 1GJAB 1MU8B 2WUCA 1GG6C 4B73A 1SLWB 1C5ZB 3V0XA 2LNCA 3F9EA 1O31A 4OS7A 2F9PA 1ARCA 3MMGA 3F3BA 4ISOA 2AGEX 1GI8B 2Y82A 3ZVAA 5DP8A 5GXPA 1GHBG 3EA8A 1O39A 3NXPA 1CBWB 3P8NA 4NFEA 4ABEA 4ISHH 3VB6A 1B7XB 2UUFB 1TBQH 3N7EA 1O3OA 1UTLM 2OD3B 1PPGE 3QUMP 1BBRK 3RU4E 2G4UA 2F9UA 4LK4A 2Z3DA 1E1RD 1TGTA 1PFXC 3UNSA 3SHCH 3LONA 3L6PA 1P0SH 1P8VC 4FUGA 1Z71A 5EPNA 2J97A 4X1NU 3ZVEA 1C1OA 3ZZDA 3PLKA 3OFND 2J38A 3PROA 4MTBA 2PKAB 2WV4A 1V2OT 4BXSA 1LVOA 2HNTF 2NU0E 2TGAA 2GZ8A 1BT7A 1CQQA 2VGCC 2PSYA 1FAKH 1DANH 1C1VH 3MWIU 2EI6A 3BSQA 3M7QA 3UWJH 2O8UA 1J17T 1WBGB 1QA0A 3VGCC 1WQVH 4O3TA 3EDXB 2ANWA 4CH8B 1TYNA 2UWLA 2QCYA 4WJG2 3DSGA 5C94A 4ISIH 4D76A 1GJBB 2F9OA 2J98B 1CGHA 2IN2A 1YGCH 2OXSA 4E06H 4F4OC 1L4ZA 1EXFA 1V2JT 1TOCB 4AG1A 4DG4A 1NBMD 1MQ5A 2Y7XA 4JCNA 1IHSH 3SV9A 1OYTH 2L6OA 4D9RA 5EIYA 4ESTE 1BOQA 2FYRA 2PGBB 3A81A 4ZKOU 5C2ZA 1FPHH 1K28D 5GCHF 2ZPSA 1C5PA 3FP6E 4YZUA 3PO1B 1P09A 4HI3A 4XSKU 2GZ7A 1UHBB 2VNTA 1O2ZA 3D62A 3MNXA 2ZO3H 4OS1A 4E7RG 4XRNA 1Q2WA 3SHAH 6GCHF 1MKWK 5FPSA 3SGQE 1ETRH 2HRVA 1SGIB 3ZYEA 3UIRA 1C2LA 4K8YA 3QN7A 3UUZA 1S5SA 5AVDA 2A5KA
chains in the Genus database with same CATH topology
1MD8A 2BLWA 2A7HA 2CGAA 3D23A 1Y5UT 3M7UA 1O3MA 2R0LA 2B9LA 3T5FH 3M5LA 4IMZA 2XBWA 3GCOA 5C1XA 2WUBA 1HIAA 4JYUH 4KP0A 1HJAC 1ELAA 5HMAA 5T3HA 2ZHEH 1CSOE 3KNXA 2ZPRA 1JWTA 2H9EH 1MMJN 2F9BH 5AHGH 3V12A 1TPSA 3I78A 1BUIA 3PLBA 4VGCC 3SI3H 1KXBA 2YOLA 4A1XA 1THSH 4ZHLU 1OP2A 1FUJA 1NRNH 3NWUA 3AASA 2BX4A 1BHXB 1V2MT 3M7TA 1K1IA 1WTGH 2ZHDA 1L0ZA 3NCLA 5FHTA 1W7GH 3RXJA 4ZKRU 1UVOA 1WYKA 1UMAH 4AFQA 2A4RA 4ABAA 6ESTA 2GDDA 2R2MB 4DVAU 5C67A 1S84A 2AEIH 3OY6U 3A7WA 4GCHF 4FUJA 1ZTKA 3GYMA 3HATH 3SUDA 1LPKB 4Y0ZE 1O3GA 2R3YA 1ORFA 5BPEA 3IWMA 2OC1A 2CF9H 5E2OA 5T6DA 2A7JA 4DIIH 1J14A 1RD3B 1V2NT 1A5IA 1C9PA 1LO6A 4D9QA 3H5CB 1DWBH 3D49H 3KN2A 4WMDA 3E90B 3V13A 1KXEA 2ZDMA 2OC8A 2ZDNA 1TQ7B 1HUTH 2HGTH 2BXTH 4WY3A 4E7NA 1QB9A 5A0AE 3G01A 2P8OB 4UEHH 4NA7A 3GICB 2B7DH 3KCGH 1SGFA 1OP8A 4TPIZ 2STBE 3RXFA 3C1KA 1LKBA 1HB0B 1G3DA 1WOFA 1QQ4A 1PYTC 1RXPA 3Q00A 1BRUP 5HM2A 3E0PB 3TH4H 1E0FD 1O5CB 2JH6D 2B8OH 3F6UH 3QK1A 4DURA 4H4FA 4AFSA 1BTXA 3T28A 3I77A 3A83A 4XBCA 3HPTB 1UCYH 1A46H 3BTME 1VR1H 1Y3WA 5EXNA 2QA9E 1Z8IB 2PFEA 1QBVH 2ZKSA 3O8BA 3QO6A 3LJOA 1FY1A 1IQMA 4NIVA 1Y59T 1G3BA 1O3CA 1O2OA 3VB7A 1L2EA 1AVWA 4TWWA 4AORA 1W12U 1NFUA 3Q77A 4AX9H 2GX4A 3GY5A 1ELEE 2O8MA 1DX5M 2D1JA 2Y81A 4WF8A 4A7IB 1NTPA 1GJ7B 1HV7A 1HAPH 1O3DA 1UCYK 2BM2A 3RXRA 2ZP0H 2CXVA 3ZZ7A 1YPKH 4UFFH 4OS4A 1GJ9B 2DE8A 5L6NH 1XKAC 4FUHA 4B2CA 1FN8A 1A7SA 1NFYA 1Z8JB 3MU1A 4AB9A 3SBKA 1O5FH 3LJJA 1C5XB 3URDA 3DFLA 4I33A 1ZPCA 5AFZH 3PTNA 1LCYA 2P3UB 4YM9A 1ID5H 2BVRH 3T26A 1PYTD 3ZZ5A 4SGBE 2ANMH 2ALPA 1RGQA 1AU8A 2FI5E 3MU0A 2PWXA 1QRXA 3LPRA 3S9CA 1AGJA 1AVGH 2W5EA 1WU1A 4NIWA 2CHAC 5AFYH 3QWCH 7GCHG 5K0HA 1NPMA 1GI6A 1RTKA 4X1RU 4Y8ZA 4O9VA 5JB8S 1O2KA 1GBHA 1O34A 5HM9A 1KY9A 5A8YA 2ZTYA 3RXGA 4B2BA 2NU4E 1GGDC 3KGPA 3SUGA 2ZHQH 4X8TH 1MUEB 5EW1H 5IYTA 3MU5A 1D3PB 3RU4D 2ZCHP 1DUEA 1K1PA 2HWLB 1DM4B 4KGAA 1ZRKA 4YLUA 1TBRH 2ZCKP 1EAIA 1YCPH 2ESTE 1CHOG 1UK3A 3M37A 4R8TB 5DPAA 1GHAF 1EOLA 1SGYE 3UR6A 2FZZA 1P10A 1AWFH 2ZI2H 4AGJA 5FBEA 1GCDA 5GJ4B 3M61U 2UUJB 1GJ4H 3LT3A 1ABIH 2FM2A 3KQEA 4H42U 1ELDE 1YLCA 1TA2A 3A7TA 4OGXA 1UTJA 1PPCE 2ZDVH 1MTUA 3GY2A 3FFGA 1KSNA 2J92A 3LC5A 4K1TA 5JDUB 1SGEE 5DP7A 2XNIA 4CRDA 1V2WT 2ZIQH 1GMDF 1NY22 1XUFA 1VCPA 1LHCH 1ELFA 3ZZ3A 1RJXB 1Z8GA 1EP5A 5DP3A 1O2UA 3GCNA 1ZPZA 3T27A 3T25A 1OWIA 2A4GA 1RRKA 1IOEA 1N6XA 4XOJA 3T29A 2OBOA 2ULLA 1CGIE 1MKXH 1DOJA 1ZPBA 3L33A 4CRBA 2Y7ZA 3KQCA 2BDYA 1O5AB 3A7ZA 5C5OA 1GMDG 2Z94A 1HXEH 1Y3VA 4K5ZA 4NG9H 3LU9B 5PTPA 2J34A 1TA6A 4Q80A 5SGAE 1MZAA 3RXLA 1OX1A 2FPZA 3A88A 3V7TA 2D8WA 1UK4A 4NCYA 2BY9X 1EPTC 1H9IE 2VWOA 3KQBA 2GV7A 4WXVA 3TNSA 1T31A 1V2UT 2RG3A 3UOUA 3K6ZA 4J2YB 1NS3A 1JOUB 2BD4A 5C1UA 2Z7FE 2PUXB 3ATKA 4SGAE 4BTTB 2WPKS 1O2PA 1P9SA 3UOPA 4ZXXH 3EBNA 1ZGIA 1K1NA 4AFZA 4LZ1H 2OC7A 3A82A 2I6SA 4CRGA 3P17H 1S82A 1J15A 4UDWH 5EQSA 3AAVA 3PO1C 3RLYH 3KF2A 4Y71A 1TRNA 1EAWA 3GCHB 3PTBA 1WTHD 2ZFQH 1V2QT 3U1JB 2P59A 3A87A 1SGDE 2OCVB 3RMLH 2QXJA 1VITF 4HFPB 3RXAA 3TJOA 2GP9B 1SLUB 1OWHA 4ZKSU 1DSTA 8ESTE 7GCHF 3RM0H 1FQ3A 3M3TA 3GOVB 5F8XA 3BTQE 3HK6B 3ODFA 4WMEA 2AMDA 1C2JA 3BEFB 4BAHB 1VCWA 4X1QU 5ABWA 4AG2A 4CRFA 1P04A 1H9LB 1MU6B 1O3JA 1TGSZ 2CN0H 2BQ7B 2FTLE 3RMOH 5A0BA 3F9GA 2FXRA 3BTKE 1ZRBA 2HNTC 7LPRA 1GVKB 2OQ5A 4NGAH 1GCTC 1BTYA 1FIWA 1K9OE 5ESBA 5EODA 4M7GA 7ESTE 3FVFB 3SJ9A 4FXGH 1MKWH 2A32A 1O2SA 4FUFA 1GHWH 1W3CA 3SU2A 3A8AA 3E6PH 6CHAC 4B75A 3UPEA 4WH6A 1CT2E 4IMQA 1O2JA 1QRZA 2G51A 1L4DA 3ODDA 1HAVA 3EGKH 3UFAA 2VWNA 1A4WH 1QY6A 3RP2A 1LHFH 1QQUA 1HGTH 4Y0YE 4ISLA 2G52A 1CHOF 1B0FA 2ZFTA 2GKVE 2TGPZ 2UWPA 1DICA 3ZVFA 2Z3CA 1O2TA 1CBWC 3RC4A 1D3QB 3RC6A 3RM2H 2V6NA 1YCPM 2C8WB 1DS2E 5A09A 3GISB 1C4V2 2Y5HA 3SQHE 2EA3A 1UK2A 1MH0A 1BMLA 1FY4A 1TMTH 1P01A 3A80A 1VGCC 4ZH8A 3M5OA 3RXMA 4NIYA 3U1IB 3LKWA 4BXWA 4KTUA 2ZHFH 1V2KT 3KIDU 4NA9H 3GY6A 4DT7B 3GCTF 1PJPA 4X6NA 3MNCA 1NT1A 2C8XB 2I6QA 2IJOB 2A2XH 2FOFA 3SV8A 4BTUB 4DGJA 4YT7H 1EJNA 1MD7A 1RFNA 1HCGA 1QIXB 2PKSC 3LH1A 4E05H 1Z7KA 1ANCA 6CHAB 1G3CA 2BDAA 2BOKA 1HYLA 4NSYA 1LDTT 1PPEE 4CRCA 5I46H 3UNRA 1C2DA 2JH0D 1AZZA 2BZ6H 3M5MA 3UR9A 1LVYA 2VH6A 2NU2E 1KTTB 2G5VA 5CE1A 1AFQB 4I8KA 1IQHA 1C2HA 2QXGA 3UQOA 1UVTH 3OX7U 2ZU4A 4INHA 3A89A 1XVOA 2ZQ2A 4K2YA 5FX5A 1GBFA 2FODA 1TX7A 4FU7A 1P12E 1PQ5A 5FCKA 1FPCH 2FI3E 4DCDA 3F9FA 2J95A 1HAGE 2GMTB 4GCHG 3TJUA 1C5QA 1GL1A 3SGAE 1A0LA 2SGDE 4I32A 3DUXH 1YLDA 2O9QA 2TGDA 1ZTJA 1XX9A 2FOEA 1PPFE 2D26C 1LMWB 3SU5A 4HTCH 2ZECA 3PV4A 2WPLS 1UTOA 2BHGA 9LPRA 4U30A 3HKIB 2A1DB 3P92A 1SL3A 4HZHA 4XBDA 1LHGH 2ZZUH 4U01A 5AF9H 1GJCB 2G81E 1TNGA 2GCTB 3EYDA 1EP6A 3MO6A 1F0UA 2PSXA 8GCHF 3QZRA 2W3KA 2O8LA 2FLRH 1GHBF 3VB4A 1E34B 1A3EH 1GI3A 1S6FA 3ENSB 3ELAH 4NZLA 1VJ9U 4H6SB 1NFWA 1PQ7A 2QXIA 3AW0A 3TNTA 4X1SU 1ANDA 1WAYB 1O2IA 4MNVA 1F5KU 1C1WH 2P3TB 1TGCA 2V0BA 2ANYA 2UUKB 1P57B 3SJOA 1IQLA 1BMAA 1XUKA 3O8CA 2C93B 1C5LH 4YOJA 1C5OH 1W7XH 1QA7A 2H2ZA 2R3UA 2J9NA 3SUFA 4NFFA 3SN8A 1LVMA 1L1GA 3BTWE 2C3SA 1IAUA 4MNYA 2FOMB 5EOKA 4B76A 3GYLB 2FX6A 3MNSA 3SNCA 1JIMA 3A8CA 4IS5A 2P94A 3MH6A 1VGCB 3PMAB 3UWIA 3RXIA 5F8ZA 1DUAA 1BTPA 2HLCA 3OYPA 4CHAC 3FANA 1P2MA 1G36A 1SHHB 3TGIE 1ZSKA 3ZVGA 2FP7B 1LKAA 1EATA 1XUJA 1BB0B 1FDPA 4IC6A 1AB9B 3RXUA 4H6TA 1ACBE 3VB5A 1ZZZA 3ZZ6A 3RXOA 4Y7AA 3VXEH 2FX4A 1H8IH 2DE9A 2PKAA 1K22H 4ZAEA 2PHBA 1NRSH 3RXDA 3BTEE 5JBTA 1FIZA 1TPPA 1RTLA 4OGYA 1PPHE 3MU8A 1MKXK 1DY9A 5BRRE 2ZCLP 2FOGA 2ZDKA 4OS6A 1G9IE 3W95A 2SGAA 5FPYA 1BA8B 2ODYB 5A8XA 2J94A 3KEEA 2ZDAH 1YF4A 5E0GA 3U8TH 3U8OH 1C2KA 1CA0C 1DVAH 1T8OA 1Y5AT 3T2NA 3A84A 1E37B 2WYJA 5HGGA 1ZOMA 4KELA 1ETSH 1TNHA 1O2XA 1YCPK 1F0TA 4X8VH 3TGJE 3RXKA 3SV2H 4ABDA 3ZZCA 3SNBA 2BVSH 2GCTC 1ZYOA 1QB1A 1FN6A 3M5NA 4Y8YA 4BAQB 4J1YA 1D3TB 3ATWA 4A5TS 2HPPH 1YC0A 3STIA 4CBNA 2VWMA 1J8AA 3AVZA 1GBAA 2ZU1A 1KLIH 1GJDB 1OS8A 4K69A 1K2I1 3GDSA 2O8TA 2CF8H 4AB8A 1RIWB 2BOHB 4DOQA 4CR5A 1VITH 1EZSC 1O5DH 3RDZA 1V2ST 3EA9A 5L2YH 4UD9H 2Q6FA 3RXPA 3RXSA 3BIUH 1P2QA 2XBYA 1TNJA 1QR3E 3GDUA 1GHZA 1HJ8A 1SG8B 4D7GA 1FNIA 3RMNH 1CO7E 2GCHG 2HOBA 5T6FA 3N7OA 4XE4A 4AZ2B 1TGBA 3MH7A 1AQ7A 1VCQA 2XC4A 1C5MD 1D6WA 1E35B 2FLBH 2Y5FA 3VB3A 2XWBI 2IPHA 1IHTH 2ZPQA 2XW9A 1GBCA 3BG8A 1AKSB 1NRQH 1P11E 1ANEA 3KQDA 5EXMA 1QJ1B 1KDQB 4AOQA 1ZMJA 1O2MA 2BLVA 4JZ1A 1UTQA 2ZEBA 1NFXA 5J4QA 5FCRA 3NK8A 2V3HH 1DLKB 1TX8A 1VITG 1GJ8B 2VIVA 1TNLA 2XC5A 3GY8A 2ZTXA 1GI5A 2HVXA 3A7YA 1FLEE 3KHVA 1K1MA 2SNWA 1EJMA 2SFAA 1SSXA 2THFB 3TITA 1YYY1 2BLOA 1HNEE 1EB1H 1ELCA 3CENA 1F0SA 4WXIA 5CHAB 2ZU3A 1C2IA 2QIQA 1C4U2 1AVXA 1C5TA 1GBJA 5EQQA 1LVBA 2VIOA 1BHXF 1D4PB 4JZDH 1GI0A 3TK9A 2Z9LA 1ZJKA 4NSVA 4A6LA 1YKTA 2XWAA 1DFPA 1INCA 3MYWA 1LQDB 3BTDE 4Y11E 4FU8A 1YBWA 4LOYH 1P05A 2HPQH 2Y5GA 2C4FH 4RKJB 4ABJA 1OOKB 4INLA 1SQAA 3SZNA 3TK6A 2C90B 4B2AA 4MPXA 1DY8A 1HXFH 3MU4A 2OTVA 1SGCA 3AAUA 1C4Y2 1O3NA 5ESTE 3KL6A 3MO9A 1MTSA 3JZ2B 1MBQA 2ZFFH 3LGIA 1CE5A 2UWOA 3MOCA 4TY6A 4CREA 3QGNB 3A85A 2STAE 1AMHA 3SQEE 3C27B 2BQWB 1O3HA 1S85A 4JZIA 4MVNA 4X0WU 1T32A 1EAXA 1BTUA 1MAYA 3BTHE 4F49A 3PWBA 5F6MA 1AE5A 1T8NA 2H9TH 2JETB 1K1OA 1ELGA 2BD8A 3P6ZB 1ESTA 2BLQA 4WVPE 4IW4E 1TPOA 1OSSA 5DK1A 4DW2U 1ZGVA 1SOTA 2GD4B 4GPGA 4ZROA 3SNDA 1GDQA 3PM3A 1F5LA 1L1JA 1OWKA 1GI1A 5DP9A 1HAXB 3R0FA 3S7HB 2ZGBH 1LHEH 1ZR0A 3ZVCA 3SNEA 2A5IA 1QJ6B 1MTNC 8GCHG 1Q31A 4Y6DA 1JIRA 3TJVA 4Z6AH 2AIQA 2AERH 1OP0A 3RXVA 1HAOH 1C2FA 2JH5D 3K65B 3RXHA 2ZF0H 1QTFA 2WV5A 4ABIA 3HGPA 1A2CH 5LPEA 1P2IA 2BDIA 3QTVH 2V3OH 1O2NA 3LGTA 1DXPA 4I8LA 3DFJA 5CHAC 3B23B 4NIXA 4FUEA 1IQKA 1E38B 4IC5A 1GHXH 1S0QA 4YOIA 4I31A 1O2LA 5E0JA 4XFQA 4BAMB 1GBIA 3U98H 1TGNA 1SGTA 1X7AC 1SOZA 4JMYA 2TIOA 1MAXA 1BRCE 2VH0A 4BAKB 2AIPA 3U69H 3IG6B 4K8BA 1ZTLA 2W3IA 5JBAS 4LXBH 3SNAA 7KMEH 1AFEH 2BD2A 2BY7X 1Z1IA 1TPAE 4YOGA 1Z8RA 2QC2A 2QV1A 1KYNA 5L30H 1F2SE 3A86A 1HFDA 1FZZA 3NKKA 4I8GA