4WMEA

Crystal structure of catalytically inactive mers-cov 3cl protease (c148a) in spacegroup c2
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
306
structure length
306
Chain Sequence
b'SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MERS-CoV 3CL protease
publication title Structures of the Middle East respiratory syndrome coronavirus 3C-like protease reveal insights into substrate specificity.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Hydrolase
total genus 85
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4wmeA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wmeA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wmeA02
1LHGH 2QF3A 3ZYDA 5TJXA 2ULLA 4WH6A 1SVPA 1AY6H 1SBWA 1UO6A 1S85A 3STIA 1GHYH 1TA6A 1KXDA 6GCHF 4BAKB 5HM9A 1D4PB 2ALVA 3ZZ8A 3QTOH 1LKAA 3RXQA 2PKAB 3UPEA 5EW2H 1AB9C 3ELAH 3M3TA 2XCFA 3EAJA 1S84A 2PUQH 5T3HA 4UFDH 4FVDA 1EZQA 5C1YA 3URCA 1GVLA 1OXGA 5GDSH 4A1XA 5BRRE 2CHAC 4THNH 3KEEA 4D76A 2ZFTA 2F9OA 3MI4A 5TCCA 1SOTA 4I32A 1ELVA 1KXCA 2DE9A 2GCTC 2AMQA 1EJMA 1HPGA 2ODYB 4U30A 2AYWA 1LHDH 2C93B 3PMJA 1GG6C 2ZFRH 7ESTE 2EI7A 4JK5A 1GL0E 4Q7XA 1O2RA 1CU1A 1BDAA 1XKBC 2ZKSA 1ELGA 1Z7KA 2VWOA 3M3SA 1UHBA 2OQUA 2BOHB 5JDUB 3RXPA 3ATWA 4CBOA 1O2WA 3LT3A 2CN0H 1MTNC 2WYGA 1O34A 1DITH 1O5EH 4F49A 3M61U 4ZHAA 1TNIA 5DP8A 2ZCKP 1TOMH 1C1WH 3BTQE 5TCAA 1XVOA 1O39A 2ZTZA 1ETSH 1DSTA 1JIRA 4AZ2B 2H5CA 3L6PA 1YLDA 1C4V2 1MKXH 2J2UA 2R0KA 2WPJS 3I77A 3ATMA 3EGKH 1FAXA 1O33A 4BOHA 1W0YH 1O2ZA 2VH0A 1HYLA 3M5MA 1KDQB 1SB1H 3TJOA 1ZSLA 1INCA 3VEQB 1VITG 4XSKU 1EJNA 1FV9A 1W3CA 1C5PA 4XFQA 5E8EH 3QZQA 1RD3B 2Y5HA 3E6PH 4K69A 5ABWA 1NM6A 1SL3A 1ZPZA 1Z8JB 1V2ST 3ZV9A 1NFYA 1GMHF 1P03A 2F83A 3O8DA 2Y81A 2FI5E 3BF6H 1UMAH 2PTNA 1GDNA 1C5VA 1UCYK 1LVMA 4BXWA 2JH5D 1YP9A 1FY4A 5F8XA 1RTKA 1A3BH 8LPRA 2ZHDA 5L6NH 1OOKB 2PLXA 1OSSA 2PW8H 1GI8B 1G3DA 6LPRA 1P09A 2B9LA 2JETC 2Z3EA 4NZLA 2P3FH 3TK5A 3LONA 2V0BA 4KP0A 1UK3A 2ZNKH 1O3FA 1D9IA 2C90B 2P93A 1CHOG 2ZCHP 4NIXA 2VVVA 3M36A 2FZZA 2WPKS 1G32B 3TITA 1Y5UT 1GMDG 4SGBE 2BD9A 1P02A 3KIDU 3UIRA 4ZKNU 1NFUA 1F7ZA 1GI7B 1N8OB 1P2QA 1ESTA 2PKSC 1H4WA 3R0FA 5HMAA 1HAVA 1Q3XA 2EEKA 4XE4A 4INHA 1P3EA 4NA7A 3B9FH 4A7IB 2BD8A 1SGTA 1GHXH 2QXIA 1TBQH 1ARBA 1P2JA 1EZXC 3EE0B 1QL8A 3T2NA 3LOXA 4UD9H 1LQEA 5E0JA 3GICB 1GHZA 4ABGA 2ASUB 3GYMA 4B73A 3RC5A 4IGDA 4AFQA 5C5OA 3H7OA 3F68H 1OWJA 1WU1A 3SV2H 1MTSA 1SHYA 4J2YB 4JZ1A 1V2QT 3KHVA 2ZDLA 1UTJA 3M7UA 3F9FA 2OINA 1UK2A 5EXMA 1K1PA 3GCNA 4UONA 1BBRK 1GI2A 1T8OA 1GHBF 1Y8TA 4RKOB 1TX8A 1UTLM 1DSUA 1HAPH 1QRXA 2J38A 3MU0A 3ZZ7A 4DJZB 1YLCA 3GY3A 2R2WU 1S0QA 7KMEH 6CHAB 2QY0B 1DX5M 4WXIA 5T6GA 4NIYA 1BT7A 1IHSH 2A32A 1KYNA 2OLGA 3ZVDA 2ZU5A 4AG2A 1LMWB 1WCZA 1J16A 2FXRA 3NUMA 2Z9JA 3S0NA 3EA9A 4AYYB 2WUCA 3F6UH 1GBIA 2FI3E 1BJUA 4BTUB 3MU1A 2BLWA 4LK4A 1VR1H 1AU8A 4FUEA 3GY2A 4MPXA 3TPIZ 4DVAU 3TJVA 1SGIB 1HXFH 2AS9A 3RUOA 4X0WU 2O8UA 3D23A 5DJ7A 1QRZA 3SU3A 1T8NA 1BMMH 1TABE 5HYOA 4IBLH 1TGCA 1BMAA 2XBYA 1EPTA 4Y7AA 3V13A 4DIHH 2FOCA 5GPIB 2W3IA 1H9HE 4WMDA 1ZPBA 4WY3A 4DURA 1G3EA 5LPFA 1P9UA 3RXGA 1AVWA 1BTPA 3T62A 3LGIA 1Q31A 1O2UA 3SJKA 2OXSA 2P95A 2XWBI 3MTYA 1O38A 1XVMA 1SSXA 4LXBH 4FUCA 4DOQA 2ZQ2A 1QL7A 4YOGA 2GDEH 2Q6GA 2JKHA 5CE1A 3RC4A 1A5HA 2BD7A 1CT0E 2KAIA 2Y80A 5C2ZA 1RS0A 3SGQE 1TGTA 2FTLE 1F2SE 1O3BA 2P3TB 1GJ7B 3CENA 2GT7A 1ORFA 2OUAA 5DGJA 2FOEA 3PWCA 2CJIA 1UHBB 3A7YA 3UWIA 1KXAA 3RDZA 2VVUA 1PPGE 1UTPA 2HNTC 3I29A 4R0IA 3MO6A 3ZVEA 3SUGA 1HAGE 4XBBA 4KTUA 1LPZB 3UR9A 1C4U2 1PYTD 2C8ZB 4IW4E 2G51A 1W7GH 4NG9H 1ZMLA 3ODDA 4GUXA 2O8TA 1CE5A 5FBEA 3SGBE 1TBZH 1G3CA 2GMTB 1TFXA 4FXGH 2D2DA 1QFKH 1AN1E 2ANYA 2R3UA 4GHTA 1WAYB 4D9RA 1MTWA 1C1OA 1MAYA 1YPMH 3RXCA 3NXPA 4IN1A 5ESTE 1GBDA 1AHTH 4WXVA 2QYIA 1IQFA 1V2KT 3VB6A 3F1SB 2WPIS 3TU7H 1HAIH 2BX3A 1WTGH 4IMZA 2ZFSA 3W94A 1RFNA 3K6ZA 4AFZA 1EX3A 2WYJA 4E05H 1AB9B 2UUYA 3LGUA 5GWZA 3RXKA 1NY22 2VIPA 2SGPE 2Y7ZA 1T8LA 1O2SA 5AFZH 1GBJA 3P92A 3RXHA 2VNTA 2ZU2A 4MTBA 1TX7A 2A7HA 5EXNA 1G3BA 1C1QA 1MBMA 5E0HA 3VB7A 5C1UA 4I8JA 5HM2A 5A8ZA 3BTME 3ZZ5A 1SQOA 2AFQB 1FN8A 1O3DA 3PYHA 1CT4E 1G2MA 4E7NA 2O8LA 2AGEX 2FLRH 1A4WH 1O2PA 1D6RA 3V12A 1EAXA 1ZHMA 2FM2A 2TGPZ 4K1SA 4MG3A 1W14U 1HAVB 1HLTH 1TNLA 4IC5A 4K3JA 2VIOA 4ZAEA 1C2DA 4JYVH 4A5TS 3GOVB 2ZDAH 2H5DA 1QA0A 1HV7A 4ESTE 4INLA 1O3OA 3SV7A 2NU0E 2RG3A 1THPB 3T26A 2A0QB 1C4Y2 1M9UA 1C1UH 2AGGX 2J92A 4RN6A 4B2BA 1TNJA 1FXYA 3KL6A 1VGCC 4ABDA 1DUEA 1TRYA 2GTBA 1ZRKA 1DY8A 3KQDA 3GCOA 2FS8A 3HKIB 2QV1A 2BY6X 1E35B 1GCDA 1QY6A 1ZMJA 1RRKA 1EASA 1MD7A 2BD4A 3BTFE 1SPJA 1AI8H 1N6YA 4BAOB 1VITF 4AORA 4HI3A 1GI6A 4MPWA 1ELFA 2VIVA 1AFEH 3SV8A 5L2ZH 4D7FA 4XDEA 1OWDA 1TMTH 1ELAA 4WH8A 2P16A 4CRCA 3MOCA 2AH4X 5I46H 4MNYA 2H1UA 2IOTA 4NIWA 4Y6DA 4X1SU 2FP7B 2EI8A 1UCYH 2ZCLP 4NFFA 2BVSH 4MDSA 3SU5A 3T5FH 1C5ZB 1CGJE 1K22H 3HGNA 1MD8A 2FLBH 3RXMA 2ZHEH 1P12E 1DT2A 2V6NA 3A84A 3SJOA 2RCEA 3ZVCA 2HRVA 4UE7H 3RXAA 2ZTYA 1OYQA 3OU0A 2PV9B 3VXEH 3KQCA 3T28A 4IMQA 1B0FA 1YGCH 3RXBA 4Y0YE 1FI8A 1ZR0A 1ID5H 1LPKB 2BD5A 1CGIE 2XCNA 3AW1A 3C1KA 5GIBA 2FI4E 1GBCA 2HVXA 2A4QA 2JETB 4ABHA 3A88A 1IOEA 1D3DB 2FPZA 2F91A 5CHAC 5FX6A 3ZVGA 3T27A 3E90B 1P06A 1GHAF 2XWAA 1DWDH 1EPTB 1S83A 4ZMAH 2V35A 3UNQA 2R0LA 4HGCA 3UNSA 3S7HB 4YLUA 3RC6A 5J4SA 3QUMP 2VIQA 4D9QA 1SR5C 1UCYE 4AFUA 1ZOMA 3Q00A 4TPIZ 1TWXB 2FYQA 4YO9A 2ZDMA 2OQ5A 2BB4A 4YTAA 4DGJA 1C5MD 1NRRH 3LH3A 1BBRH 3SU2A 2GGVB 2ZPQA 4IC6A 1GVZA 2TRMA 4H6TA 1W7XH 1QJ1B 4FUBA 3HK3B 3BV9B 3PB1E 1ZJKA 3LJJA 2ANMH 1ANCA 2ZP0H 1GI0A 3KQBA 2HNTE 1V2VT 3UQOA 4BAMB 3P8NA 2ZF0H 4E06H 1V2RT 1F0UA 2A1DB 1HFDA 4ISHH 2M5TA 2VGCC 2ZECA 5EOKA 2BMGB 1O2GH 1BRBE 4OGYA 1HJ8A 1O30A 3A7TA 1ZPCA 1EP5A 1QJ6B 2ZFQH 4ZROA 5GXPA 1RXPA 4J1YA 1G2LA 3GY4A 3QWCH 1ELCA 4ASHA 1TIOA 3SI4H 1EAWA 1BTUA 1A2CH 3PM3A 3LGWA 4CR5A 4R8TB 3SW2B 1OKXA 3KN2A 1GGDB 3U1IB 2VVCA 1C2IA 6ESTA 3FZZA 5FBIA 2GT8A 1CHGA 1YYY1 1MQ5A 5DP4A 3SZNA 1HAXB 1YPJH 2P8OB 2V3OH 1GCTC 1NFXA 1MKWK 1SHHB 2YOLA 3SQEE 1A0LA 4IN2A 4U01A 2FOGA 5FCKA 1BBRE 3SJ8A 1TMUH 3KGPA 1DLEA 3LC3A 1E0FD 1OWHA 1G37A 3A8CA 5I25A 1EOLA 1QGFA 1AE8H 3RXIA 5JB8S 4AN7A 1GBAA 2OC0A 4CRGA 1GJ9B 2Z9GA 1O3GA 3E0PB 1Y59T 2XBVA 1DXWA 2FDAA 4JYTA 1TPPA 3W95A 1S81A 1QURH 3LC5A 1CVWH 1DANH 3RP2A 4E7RG 1YPHE 1ESAA 1PQ8A 3GCHC 3ZZ4A 1FAKH 1HB0B 1O3PB 1TX6A 3VFEA 2F3CE 5JBAS 1OYTH 3SV6A 2ZDNA 4MNWA 1KLJH 1KLIH 3T29A 1SGEE 2AEIH 1NROH 2UWOA 1EATA 1AUJA 5AVDA 4U32A 1YC0A 3HATH 1SGYE 1BA8B 3ATLA 1KSNA 3FP7E 1THRH 5B6OA 5ESBA 3NCLA 4OS5A 1FPCH 1NRPH 3EQ0H 3V0XA 3ATKA 3PMBB 1ELDE 3EYDA 4BXSA 1V6DA 2VWNA 3ZZ9A 2A4GA 1C5QA 1E38B 1MTUA 4AYVB 3MWIU 3K2UA 1IQLA 3U8TH 4KGAA 4CRDA 1DE7H 2PGBB 2ZQ1A 4K2YA 1GBBA 1UVSH 1WBGB 1TQ0B 2BXUH 1TRMA 4NFEA 2BM2A 2J4IA 5C67A 1GJ8B 5DO4H 1ZZZA 2GCHG 3PV4A 4A1TA 1C1TA 2BTCE 3LU9B 5EPNA 1GWAA 1D6WA 1AIXH 1UTKA 4JZIA 1A5IA 4D8NA 1QHRB 1BCUH 4I8GA 1V2MT 1Y3WA 1EAUA 3RXVA 4CH2B 1O2OA 4MVNA 2Q6FA 5EGMA 5LPRA 3Q77A 1FJSA 9LPRA 4OS1A 4K1EA 2FESH 3ZZCA 1QBVH 2WV5A 3P6ZB 3SUDA 2OTVA 5H4IB 1W8BH 1K1IA 4LOYH 1PPBH 2F9PA 1TALA 1TYNA 2ZU3A 3GCTF 4WMFA 1YPEH 1C2EA 1K28D 5JBBS 1PQ5A 2BXTH 2FOMB 3M5NA 4JMYA 2VU8E 1AMHA 1MQ6A 3GY5A 5EG4A 3RXLA 3TH4H 2XNIA 1WUNH 4Y79A 2GV7A 1O2TA 3BIVH 1BB0B 1UTNA 4X6OA 1V2JT 1B0EA 1BQYA 1PPHE 2PWXA 2GZ9A 1K1MA 1MH0A 3SJIA 4KTCA 2LPRA 1E34B 2R2MB 4H6SB 2GZ7A 4UDWH 3A7VA 4KELA 3VGCC 5A2MH 3LGVA 4Y8YA 1JXPA 1SMFE 1AVXA 4ABAA 2OCVB 2K7XA 1L2EA 4NZQA 3PO1B 1ANDA 3H7TA 2ZTXA 3BG8A 4X8VH 2C4FH 3TNSA 1UVOA 1LQDB 5K7RA 2BY5X 3CP7A 1OX1A 4MLFB 1O3HA 1AE5A 5JYIA 2XC4A 4BANB 1V2OT 1JBUH 5DP5A 1TMBH 3SU6A 4INKA 3DT0H 4Y71A 1AZZA 4FUFA 2ANKH 3S9AA 2A45B 4OS4A 1KXFA 2ZZUH 3M7TA 1S0RA 2XTTB 4X8TH 3F9HA 1F5LA 2BQWB 4HZHA 3UREA 1BTZA 2WV4A 3BG4C 1EKBB 2D26C 2CGAA 2G5NA 1B5GH 1C1RA 3TIUA 2A5AA 3D62A 3UNRA 1O3NA 4AG1A 1F0SA 2ILNA 4CHAC 1O2LA 3EA7A 4CRAA 2Z3DA 4X6NA 1C2JA 3A7WA 2RDLA 2XW9A 3SNAA 3SI3H 4JYUH 3RMLH 1L4ZA 4Y7BA 1DOJA 1HNEE 1K1OA 4O9VA 1C2LA 3FANA 4RSPA 4GHQA 4JK6A 5GCHG 3RMOH 6GCHG 4O3UA 3ZV8A 4OS2A 2OC1A 3SNEA 2AERH 1AD8H 1FY5A 3A83A 1MTVA 4NGAH 2AMDA 4CREA 1V3XA 1BMLA 1O5DH 2UWPA 4WJG2 1J17T 1BUIA 1P8VC 2J9NA 2Y5FA 1ELEE 1MAXA 1O3LA 2YNBA 4ZHLU 1O2MA 1LKBA 2FWWA 1O37A 2TGAA 1GMCG 1BOQA 1FN6A 4X2WA 1P01A 5CMXH 1JRSA 1MBQA 1C5TA 3S9BA 1GHWH 1GVKB 2B7DH 3UY9A 1EB2A 1NO9H 3L33A 4AOQA 2QAAA 4MQAA 2XYAA 3M7QA 2G55A 4ZKRU 1U6QA 5DK1A 4B2CA 1PQ7A 4ISNA 3BTEE 2Z9LA 1YBWA 3VB3A 3M35A 5E2PA 4FUHA 2Z9IA 1PPZA 2NU4E 2IN2A 2ZPSA 3ZZ3A 4X8UH 1UK4A 1DFPA 1CBWC 2XXLA 3MH4A 3MU8A 3RLWH 2ZGCA 1FDPA 1FUJA 1ZSJA 4D7GA 1GJAB 1W10U 1SQTA 2W7SA 1B7XB 5EODA 4DT7B 1H9IE 1BTXA 1NN6A 4ZH8A 2A7CA 9ESTA 1D3TB 3U1JB 1OWEA 2NWNA 1O3KA 3P8FA 1P2IA 3SV9A 1NS3A 4XBCA 2FODA 2ZDVH 4MPUA 3MNCA 1CA0B 1HJAB 3I78A 3MNXA 1W13U 2FS9A 4JCNA 4FU8A 5FX5A 1XUGA 1DWCH 2BX4A 8KME2 2ZEBA 2W3KA 1HXEH 1QL9A 2PFEA 1LCYA 1RTFB 4K60A 5K0HA 3BIUH 1GHVH 3PROA 2ZA5A 3E3TA 3RU4T 2ZFPH 4X2VA 5FCRA 1O5FH 1HAZB 1GJ6A 4IS5A 4FU9A 3D49H 2Z3CA 1MCVA 3ZYEA 4WF8A 2SGEE 5A0CA 4X2XA 3A8AA 1AQ7A 4BTTB 3SNCA 1ZYOA 2TGDA 4X6MA 1OP2A 4ZHMU 1UTMA 4ISLA 3BTWE 1BZXE 4O97A 1K21H 1GJCB 1QCPA 2BY7X 1CA8B 1F0RA 1C2GA 3VXFH 1BHXB 2AGIX 1SFQB 1G9IE 3FFGA 3A7ZA 2A2QH 1KTTB 2Q1JA 2A4RA 2FYRA 2ODQA 2WINI 1SFIA 3LGYA 4FUGA 3RXEA 4VGCC 1S6HA 3BTHE 1MZDA 1PPCE 1P2MA 1XUJA 5EQRA 1WQSA 1AKSA 2ANWA 2ZGHA 2ZHQH 1AGJA 1JRTA 1P2NA 1ZHPA 3OYPA 4B76A 2G81E 1SC8U 1T4VH 3HK6B 3T25A 1UVPA 2GZ8A 1FONA 5AFYH 2CHAB 1GBEA 1PPFE 1IQNA 2Y6TA 3L3TA 1GI5A 3UQVA 3U98H 1NRQH 1MUEB 1XXFA 3GY8A 1XUIA 3B23B 1EZUC 1O5BB 2Z9KA 4ZXYH 3MHWU 2GCTB 1YKTA 1VCPA 2B8OH 2BDYA 4I8LA 1GG6B 1N8OC 2A2XH 1BTWA 1ETRH 1LTOA 3RXRA 4F4OC 1VCQA 2ZIQH 1NFWA 3QLPH 1O35A 3AAVA 2Y7XA 2ZGJA 4GPGA 3UOPA 1GBKA 3SBKA 1FMGA 1DWEH 4X8SH 1F5KU 4X6PA 3LJOA 3VPKA 2PR3A 2QF0A 1FY1A 1RTLA 3LIWA 5FXLA 3QGJA 4LZ4B 3E0NB 1MTNB 2R9PA 1HAOH 4ZKOU 2BDIA 5DPAA 1FZZA 1OP8A 1DM4B 2WPLS 3HPTB 2H9EH 4U2WA 4Y8XA 4O3TA 4YOJA 2TIOA 2ZI2H 1QIXB 1O2KA 1XKAC 1C1PA 1LHFH 1TOCB 4XBDA 1LDTT 1O2VA 2THFB 2ZU4A 2LIZA 3TK6A 2W7UA 2OD3B 1JOUB 5IDKA 2A31A 1NRSH 1L4DA 2SGDE 1KXBA 1V2LT 2BDAA 5F8TA 5EXLA 4A1VA 3RM2H 4X2YA 2V3HH 1TRNA 3VB5A 2BQ6B 2NU2E 4H4FA 3LDXH 2BVRH 3S9CA 1OWKA 4YZUA 5FHTA 3CS0A 1YPLH 3SHCH 4AB8A 3DHKH 3UFAA 7GCHG 2XC0A 1AWFH 3SU0A 2VINA 4I33A 4AFSA 1GDUA 1Q2WA 4CBNA 2R3YA 4Y0ZE 2WUBA 3TH2H 4ZUHA 1FIWA 2VB0A 1TB6H 1C9PA 1FIZA 4WVPE 1CHOF 3S69A 1FY8E 3QN7A 2SNWA 4NIVA 1C5WB 2HOBA 4FUDA 5FPSA 2A4OA 1O3MA 1GMDF 1O3EA 4ABFA 2C3SA 2G8TA 3MYWA 1T8MA 3E91A 1DS2E 4WWYA 1W12U 2PUXB 2ALPA 3P17H 2QXJA 3IITA 2PKSB 1MZAA 2ZGBH 4FUJA 1A3EH 2P94A 4DW2U 2AIQA 4ABIA 3Q3XA 1Y5BT 1EZSC 2GVFA 2SGFE 3OX7U 4TY6A 2GD4B 5J4QA 1SLUB 4QT8C 2FOAA 4X1PU 2EI6A 3D65E 3ZZBA 7LPRA 3SNDA 1L1GA 3A8DA 4PROA 1T7CA 1Z1IA 2ZPRA 2BDHA 1IQIA 1ZTKA 4Q80A 3JZ2B 1OP0A 2VH6A 1GL1A 1QBNA 2GV6A 2ZU1A 2FX4A 3A80A 1YPGH 3AAUA 3F9EA 1ZGIA 1KXEA 4O03A 1FPHH 1TAWA 3UR6A 3G01A 1MCTA 1HRTH 2HWLB 3CS7A 5A09A 1QQ4A 2STAE 1C5XB 5A8YA 4YLQH 1IQKA 4H42U 2GMTC 3M3VA 2AMPA 4ABEA 1HBTH 3Q76A 3LKWA 4TWWA 2VJ1A 3TGKE 4CHAB 2F9BH 1GJBB 1Y3YA 1XXDA 1C9TA 1LPGB 3SUEA 1MU6B 2Z94A 1T32A 3SNBA 3MH5A 4SGAE 3LGTA 3GDVA 1HGTH 1P05A 4Y11E 5GCHF 1Z1JA 3BTTE 1S5SA 1TNHA 1DPOA 1PFXC 3RMNH 3E16B 1RJXB 3RLYH 3ESTA 1QNJA 1JIMA 1J8AA 3BTKE 2RA3A 1F0TA 3SU1A 1C1MA 4CRBA 1ANEA 5BPEA 2TPIZ 3PMAB 2BY8X 5AF9H 4Y10E 1TNGA 1FLEE 2DE8A 2SGQE 1GMCF 1XUKA 1AKSB 4GAWA 1A0JA 1S82A 1J15A 1C5SA 3RXSA 2QCYA 3UOUA 2STBE 4ZKSU 1QJ7B 2B0FA 1YCPK 4I8HA 3JZ1B 4I7YH 1UVUH 2J95A 3SU4A 1UJ1A 4ABBA 5A8XA 1FNIA 3KF2A 1O3CA 1CGHA 1BTHH 1GI4A 3U69H 1HUTH 1C1VH 3C27B 1ESBA 1GDQA 1AFQC 1LHCH 1CBWB 2OP9A 1JWTA 3GDUA 2D8WA 5DP7A 2PTCE 3QDZB 3NPSA 1NT1A 3U8RH 2BZ6H 3PTBA 1SG8B 2UUJB 1FY3A 3V7TA 5SGAE 1TLDA 1Z8RA 5L2YH 5C5NA 1AVGH 2EA3A 2BDCA 1YCPM 1SGFA 1CT2E 1P10A 3S7KB 1F5RA 3GYLB 1C5RA 1SOZA 4MNXA 2Q6DA 4RKJB 2VWLA 4A92A 3QX5H 4ABJA 1QR3E 1OPHB 2ZFFH 3QZRA 1ZHRA 5DP3A 2VIDA 4AGJA 5DP9A 1MMJN 2WPHS 1NZQH 3SOSA 2BQ7B 1ZRBA 1C5LH 1ANBA 1C2FA 1J9CH 2UUKB 4FVBA 2A5IA 1Z8GA 1SI5H 4TPYA 5EQSA 2HPQH 3MMGA 4TYDA 3SO3A 3MO9A 1NTPA 3DA9B 1XMNB 4K1TA 4AX9H 1ZMNA 3DFLA 2CV3A 4AB9A 3FP6E 1ZLRA 3A81A 2XC5A 2PSXA 2O8WA 1VITH 1K1NA 1QB9A 3NKKA 5JBCS 2YNAA 1WOFA 4NSVA 1Y3UA 2QA9E 3M5OA 4B71A 1TQ7B 1TNKA 3ENSB 3IG6B 1ARCA 3OY5U 3R3GB 4UFFH 3KQEA 1BRAA 4B1TA 1UTQA 2TGTA 3FVFB 1O31A 2FTMA 1K9OE 3E8LA 1Y5AT 1P0SH 3H5CB 4NCYA 4CRFA 1GPZA 1O2NA 1Y3XA 2ZO3H 4VGCB 1KTSB 3IWMA 1C5NH 4MNVA 4GCHG 1Z6JH 1K2I1 2XRCA 4NA9H 2BD2A 2CF9H 3MU4A 1V2NT 1O32A 5C3NA 3SQHE 2C8XB 5A0BA 1SGFG 1VZQH 1GI3A 1LO6A 3E1XB 2BDBA 4OS6A 2BOKA 1GI1A 3PLPA 4YT6H 1K1LA 2GX4A 2QN5T 3STJA 2F9UA 1IHTH 3V3MA 8GCHG 1EPTC 1GHAG 3DUXH 2G00A 4B2AA 2QXGA 3FZDA 2BY9X 2XBXA 1GJ4H 2IJOB 3RXOA 3ZVFA 1DUAA 1SQAA 2HGTH 4BTIB 3U9AH 3RMMH 2H9TH 1RIWC 3RXDA 2CXVA 5FPYA 1JMOH 4UFEH 1TONA 2A7JA 3NWUA 1EUFA 3BSQA 1QTFA 2PGQB 4NA8A 1UVTH 2ZC9H 3BEUA 3HGPA 1EJAA 1O2IA 3K9XB 1A46H 3M37A 4KTSA 4DG4A 1BJVA 2J34A 3EA8A 1WSSH 4JZDH 1RGQA 1ELTA 1P2KA 2SFAA 1PPEE 1V2WT 3URDA 2UWLA 3UTUH 1BRCE 2ODPA 4FUIA 1C2HA 2C8YB 1VGCB 4I31A 1LHEH 3TJNA 4YT7H 1X7AC 1MU8B 1O5GH 3RU4E 1LVBA 1O3AA 1G36A 1KLTA 1Z8IB 1SLWB 2BZAA 3NK8A 4X1NU 3DFJA 3PLBA 1DICA 3Q3YA 2FEQH 1OS8A 4GSOA 1IQHA 1P57B 4NWKA 2CMYA 3A82A 1Z6EA 1LVYA 2SGAA 3ODFA 4M7GA 1DXPA 4CR9A 3RXFA 5JBTA 3BEIB 1AWHB 1VCWA 3GY6A 3HKJB 3ITIA 1H8DH 1GGDC 3EDXB 3MNBA 2Z7FE 5E0GA 3A87A 1KIGH 1EOJA 1TA2A 2P8OC 4UFGH 1O2YA 4NWLA 1UTOA 1H9LB 1Z71A 4YOIA 1NU7B 5F8ZA 2C8WB 3MNSA 5F03A 2BDGA 7GCHF 1QB1A 1GJ5H 2BLOA 1TPAE 5EW1H 4XOJA 3SORA 4Y8ZA 2HALA 2P59A 1XUHA 5EU8A 2HNTF 3GY7A 3MO3A 4FU7A 3TGJE 1O2JA 4B75A 1GBTA 3TK9A 3M5LA 4JZEH 1IQMA 4NSYA 4Y76A 2J94A 3ZVBA 1YM0A 2I6SA 2GKVE 1NU9A 1NC6A 3TH3H 5CHAB 3GDSA 1ZTJA 2BD3A 2LNCA 1V2PT 1O36A 1TPOA 4X1RU 1YF4A 2G4UA 4X1QU 2BLVA 5FPTA 3DD2H 1AUTC 1TE0A 2F9NA 1XX9A 5IYTA 1FQ3A 3RXUA 5HXFA 1ZJDA 2BYAX 1TBRH 4GLYA 1O3JA 4CH8B 5L30H 2ZWLH 3BTGE 1H1BA 3OTJE 5ETXA 1W11U 3A89A 3PMHB 4OGXA 1HIAA 1LVOA 1O2HA 3MFJA 3N7OA 4JZFH 1ZTLA 5FAHA 3AASA 1DDJA 1O5CB 1PJPA 3Q3KA 4TY7A 1D3PB 2G4TA 1MKXK 2G5VA 1QB6A 5LPEA 3SGAE 3O8BA 3LPRA 2H6MA 3A7XA 2QGRA 5EPYA 1C1SA 2VGCB 1C5OH 1GBHA 1VJ9U 1SGRE 2PSYA 1E36B 1HDTH 2RA0A 3TVJB 2BHGA 3MH6A 4A6LA 2PKAA 1L0ZA 3A8BA 1S6FA 2Y5GA 1P04A 1GMHG 2O9QA 1TPSA 2XBWA 3BTDE 4LZ1H 2BVXH 3PLKA 1MKWH 1ETTH 1V2UT 3NZIA 5C20A 3ATIA 1J14A 3SN8A 1SGDE 1SLXB 1WV7H 1Y3VA 3K65B 5JPMH 1IQEA 3U8OH 1P2OA 1ZGVA 3QK1A 1GCTB 1ZSKA 4Q2KA 3GCTG 5EQQA 1O3IA 1SGCA 3MU5A 5G4BA 1T4UH 2ZDKA 4BNRA 5DKMA 1BMNH 3RU4D 1TGNA 1YPKH 1K1JA 4BAQB 2HLCA 2K1QA 1L1JA 2O8MA 1IQGA 1YCPH 4Z0KA 3ZZAA 1C2MA 4ISOA 3P70B 4UEHH 1GI9B 8ESTE 3ZVAA 4ZXXH 3K6YA 5A0AE 1QA7A 5DG6A 3ZZDA 3MH7A 2D1JA 5E2OA 4BAHB 3O8RA 1GBFA 1HAHH 2HPPH 4OS7A 2AIPA 2P3UB 3AW0A 1YPHC 2BLQA 3TLOA 3PO1C 2FIRH 3GCHB 3VB4A 1W0ZU 1O2XA 1BITA 1QBOA 1DWBH 2EC9H 1C2KA 2F9VA 1NRNH 1VJAU 4DIIH 2PHBA 4K8YA 1AO5A 1L1NA 1N6XA 1AFQB 1T31A 5HGGA 1CQQA 1DLKB 1P3CA 5C1XA 1N1LA 4YESB 2OBQA 3QGNB 1GJDB 2DUCA 1GHBG 1KDQA 1O0DH 2W26A 3P95A 2QXHA 2SNVA 2VWMA 3A86A 1A0HB 1CO7E 2CF8H 2FMJA 2IPHA 3GISB 3KCGH 5T6FA 4Z6AH 1EP6A 1C1NA 6CHAC 3QTVH 4HTCH 3UWJH 1SGQE 1HJ9A 1XM1A 1W2KH 2JH6D 2FOFA 3P8OA 2VIWA 2GCHF 1NESE 1O5AB 3RM0H 3SHAH 3UUZA 3TGIE 2B5TB 3P8GA 3SUFA 1CSOE 2OC7A 2ZHWH 3TNTA 1C5UA 4K8BA 2ZG0H 1A1RA 3QO6A 1GBMA 2OBOA 1WYKA 1O2QA 1P11E 4HFPB 4I8KA 1EB1H 2FO9A 4Q7ZA 2H2ZA 2W5EA 1BRUP 4KKDA 3LH1A 3PWBA 2NU1E 3O8CA 4WMEA 1A61H 1A5GH 2QIQA 1EQ9A 2JH0D 4GVUA 4GCHF 3AVZA 3A85A 2TBSA 4MPVA 1SGNE 3EBNA 3PTNA 1PYTC 2Y82A 3B8JA 2ESTE 1D3QB 1IAUA 1V2TT 5JB9S 3F9GA 4TWYA 1OWIA 5AHGH 2A5KA 5DP6A 1G30B 1SGPE 2I6QA 1BHXF 1WQVH 3VGCB 5PTPA 1WTHD 3RXJA 8GCHF 3TJUA 2FOHA 5GJ4B 1THSH 2G52A 1DY9A 2FX6A 2Z6BD 2OC8A 1C5YB 5F6MA 4DCDA 4Q7YA 1KY9A 1NPMA 1HAYB 1CA0C 1HJAC 1XUFA 4YM9A 1HCGA 1ABJH 1BIOA 3OY6U 3FP8E 1GBLA 4ISIH 2UUFB 4DY7B 4K5ZA 5LGOA 1P9SA 1RIWB 5T6DA 1IQJA 1TGSZ 1F92A 3FAOA 2FOBA 4B74A 1SLVB 3WY8A 3SJ9A 3BEFB 1DVAH 2GDDA 2H9HA 2NU3E 3BN9A 3RXTA 1QQUA 1QRWA 4AGKA 2QC2A 5LH8A 3KNXA 1ELBA 2KAIB 3OSYA 2WPMS 2ZHFH 1TGBA 1E37B 2GP9B 1H8IH 1AZ8A 1EXFA 3BG4B 3ZZ6A 2ZGXH 1BTYA 1A7SA 1HIAB 1ACBE 1ABIH 1EAIA 1PQAA
chains in the Genus database with same CATH superfamily
1LHGH 2QF3A 3ZYDA 1W0JD 5TJXA 2ULLA 4WH6A 1SVPA 1AY6H 1SBWA 2F4LA 1UO6A 1S85A 3STIA 1GHYH 1TA6A 1KXDA 6GCHF 4BAKB 5HM9A 1D4PB 2ALVA 3MQKC 3ZZ8A 3QTOH 1LKAA 3RXQA 2PKAB 3UPEA 5EW2H 1AB9C 3ELAH 3M3TA 2XCFA 3EAJA 1S84A 2PUQH 5T3HA 4UFDH 4FVDA 1EZQA 5C1YA 3URCA 1GVLA 1OXGA 5GDSH 4A1XA 5BRRE 2CHAC 4THNH 3KEEA 4D76A 2ZFTA 2F9OA 3MI4A 5TCCA 1SOTA 4I32A 1ELVA 1KXCA 2DE9A 2GCTC 2AMQA 1EJMA 1HPGA 2ODYB 4U30A 2AYWA 1LHDH 2C93B 3PMJA 1GG6C 2ZFRH 7ESTE 2EI7A 3DSOA 4JK5A 1GL0E 4Q7XA 3PV5A 1O2RA 4I86A 1CU1A 1BDAA 1XKBC 2ZKSA 1ELGA 1Z7KA 2VWOA 3M3SA 1UHBA 2OQUA 2BOHB 5JDUB 3RXPA 3ATWA 4CBOA 1E1QD 1O2WA 3LT3A 2CN0H 1MTNC 2WYGA 1O34A 1DITH 1O5EH 4F49A 3M61U 4ZHAA 1TNIA 5DP8A 2ZCKP 1TOMH 1C1WH 3BTQE 5TCAA 1XVOA 1O39A 2ZTZA 1ETSH 1DSTA 1JIRA 4AZ2B 4ZCNA 2H5CA 3L6PA 1YLDA 1C4V2 1MKXH 2J2UA 2R0KA 2WPJS 3I77A 3ATMA 3EGKH 1FAXA 1O33A 4BOHA 1W0YH 1O2ZA 1WXRA 2VH0A 1HYLA 3M5MA 1KDQB 4F48B 1SB1H 3TJOA 1SQRA 1ZSLA 1INCA 3VEQB 1VITG 4XSKU 1EJNA 1FV9A 1W3CA 1C5PA 4XFQA 2PP6A 3QZQA 5E8EH 1RD3B 2Y5HA 3E6PH 4K69A 5ABWA 1NM6A 1SL3A 1ZPZA 1Z8JB 1V2ST 2JJ2D 1NFYA 1GMHF 1P03A 3ZV9A 2F83A 3O8DA 2Y81A 2GJGA 2FI5E 3BF6H 1UMAH 2PTNA 1GDNA 1C5VA 1UCYK 1LVMA 4BXWA 2JH5D 5EJZA 1YP9A 1FY4A 5F8XA 1RTKA 1A3BH 8LPRA 2ZHDA 5L6NH 1OOKB 2PLXA 1OSSA 2PW8H 1GI8B 1G3DA 6LPRA 1P09A 2B9LA 2JETC 2Z3EA 4NZLA 2P3FH 3TK5A 3LONA 2V0BA 4KP0A 1UK3A 2ZNKH 1O3FA 1D9IA 2C90B 2P93A 1CHOG 2ZCHP 2CK3D 4NIXA 2VVVA 3M36A 2FZZA 2WPKS 1G32B 3TITA 1Y5UT 1GMDG 4SGBE 2BD9A 1P02A 3KIDU 3UIRA 4ZKNU 1NFUA 1F7ZA 1GI7B 1N8OB 1P2QA 1ESTA 2PKSC 1H4WA 3R0FA 5HMAA 1HAVA 1Q3XA 2EEKA 4XE4A 4INHA 1P3EA 4NA7A 3B9FH 4A7IB 2BD8A 1SGTA 1GHXH 2QXIA 1TBQH 1ARBA 1P2JA 1EZXC 3EE0B 1QL8A 3T2NA 3LOXA 2HLDD 4UD9H 1LQEA 5E0JA 3GICB 1GHZA 4ABGA 2ASUB 3GYMA 4B73A 3RC5A 4IGDA 4AFQA 5C5OA 3H7OA 3F68H 1OWJA 1WU1A 3SV2H 1MTSA 1SHYA 4J2YB 4JZ1A 1V2QT 3KHVA 2ZDLA 1UTJA 3M7UA 4ACAA 3F9FA 2OINA 1UK2A 5EXMA 1K1PA 3GCNA 4UONA 1BBRK 1GI2A 1T8OA 5HKKD 1GHBF 1Y8TA 4TT3D 3OEED 4RKOB 1TX8A 1UTLM 1DSUA 1HAPH 1QRXA 2J38A 3MU0A 3ZZ7A 4DJZB 1YLCA 3GY3A 2R2WU 1S0QA 7KMEH 6CHAB 2QY0B 1DX5M 4WXIA 5T6GA 4NIYA 1BT7A 1IHSH 5KECA 2A32A 1KYNA 2OLGA 3ZVDA 2ZU5A 4AG2A 1LMWB 1WCZA 1J16A 2FXRA 3NUMA 2Z9JA 3S0NA 3EA9A 4AYYB 2WUCA 1W0KD 3F6UH 2RFKC 1GBIA 2FI3E 1BJUA 4BTUB 3MU1A 2BLWA 4LK4A 4DT4A 1VR1H 1AU8A 4FUEA 3GY2A 4MPXA 3TPIZ 4DVAU 3TJVA 1SGIB 3F0PA 1HXFH 2AS9A 3RUOA 4X0WU 2O8UA 3D23A 5DJ7A 1QRZA 3SU3A 1T8NA 1BMMH 1TABE 5HYOA 4IBLH 1TGCA 1BMAA 2XBYA 2KZ4A 1EPTA 4Y7AA 3V13A 4DIHH 2FOCA 5GPIB 2W3IA 1H9HE 4WMDA 1ZPBA 4WY3A 4DURA 3SZEA 1G3EA 5LPFA 1P9UA 3RXGA 1AVWA 1BTPA 3T62A 3LGIA 1Q31A 1O2UA 3SJKA 2OXSA 2P95A 2XWBI 2QF5A 2VBCA 3MTYA 1O38A 1XVMA 3DSGA 1SSXA 4LXBH 4FUCA 4DOQA 2ZQ2A 1QL7A 4YOGA 2GDEH 2Q6GA 2JKHA 5CE1A 3RC4A 1A5HA 2BD7A 1CT0E 2KAIA 2Y80A 5C2ZA 1RS0A 3SGQE 1TGTA 2FTLE 1F2SE 1O3BA 2P3TB 1GJ7B 3CENA 2GT7A 1ORFA 2OUAA 5DGJA 2FOEA 3PWCA 2CJIA 2M2AA 1UHBB 3A7YA 3UWIA 1KXAA 3RDZA 2VVUA 1PPGE 1UTPA 2HNTC 3I29A 4R0IA 3MO6A 3ZVEA 3SUGA 1HAGE 4XBBA 4KTUA 1LPZB 3UR9A 1C4U2 1PYTD 2C8ZB 4IW4E 2G51A 1W7GH 4NG9H 1ZMLA 3ODDA 4GUXA 2O8TA 1CE5A 5FBEA 3SGBE 1TBZH 1G3CA 2GMTB 1TFXA 3DSPA 4FXGH 2D2DA 1QFKH 1AN1E 2J5UA 2ANYA 2R3UA 4GHTA 1WAYB 4D9RA 1MTWA 1C1OA 1MAYA 1YPMH 3RXCA 3NXPA 4IN1A 4RT1A 5ESTE 1GBDA 1AHTH 4WXVA 2QYIA 1IQFA 1V2KT 3VB6A 3F1SB 2WPIS 3TU7H 1HAIH 2BX3A 4B6FA 1WTGH 4IMZA 2ZFSA 3W94A 1RFNA 3K6ZA 4AFZA 1EX3A 2WYJA 4E05H 1AB9B 2UUYA 3LGUA 5GWZA 3RXKA 1NY22 2VIPA 2SGPE 2Y7ZA 1T8LA 1O2SA 5AFZH 1GBJA 3P92A 3RXHA 2VNTA 2ZU2A 4MTBA 1TX7A 2A7HA 5EXNA 1G3BA 1C1QA 1MBMA 5E0HA 3VB7A 5C1UA 4I8JA 5HM2A 5A8ZA 3BTME 3ZZ5A 1SQOA 2AFQB 1FN8A 1O3DA 3PYHA 1CT4E 1G2MA 4E7NA 2O8LA 2AGEX 2FLRH 1A4WH 1O2PA 1D6RA 3V12A 1EAXA 1ZHMA 2FM2A 2TGPZ 4K1SA 4MG3A 1W14U 1HAVB 2IJD1 1HLTH 1TNLA 4IC5A 4K3JA 2VIOA 4ZAEA 1C2DA 4JYVH 4A5TS 3GOVB 2ZDAH 2H5DA 1QA0A 1HV7A 4ESTE 4INLA 1O3OA 4HG6A 3SV7A 2NU0E 2RG3A 1THPB 3T26A 2A0QB 1C4Y2 1M9UA 1C1UH 2AGGX 2J92A 4RN6A 4B2BA 1TNJA 1FXYA 3KL6A 1VGCC 4ABDA 1DUEA 1TRYA 2GTBA 1ZRKA 1DY8A 3KQDA 3GCOA 2FS8A 3HKIB 3OEHD 1FX0B 2QV1A 2BY6X 1E35B 1GCDA 1QY6A 1ZMJA 1RRKA 1EASA 1MD7A 2BD4A 3BTFE 1SPJA 1AI8H 3DCLA 1N6YA 4BAOB 1VITF 4AORA 4HI3A 1GI6A 4MPWA 1ELFA 2VIVA 1E79D 1AFEH 3SV8A 5L2ZH 4D7FA 4XDEA 1OWDA 1TMTH 1ELAA 4WH8A 2P16A 4CRCA 3MOCA 2AH4X 5I46H 4MNYA 2H1UA 2IOTA 4NIWA 4Y6DA 4X1SU 2FP7B 2EI8A 1UCYH 2ZCLP 5KGOA 4NFFA 2BVSH 4MDSA 3SU5A 3T5FH 1C5ZB 1CGJE 1K22H 3HGNA 1MD8A 2FLBH 3RXMA 2ZHEH 1P12E 1DT2A 2V6NA 3A84A 3SJOA 2RCEA 3ZVCA 2HRVA 4UE7H 3RXAA 2ZTYA 1OYQA 3OU0A 2PV9B 3VXEH 3KQCA 3T28A 4IMQA 1B0FA 1YGCH 3RXBA 4Y0YE 1FI8A 1ZR0A 1ID5H 1LPKB 2BD5A 1CGIE 2XCNA 3AW1A 3C1KA 5GIBA 2FI4E 1GBCA 2HVXA 2A4QA 2JETB 5HIZA 4ABHA 3A88A 1IOEA 1D3DB 2FPZA 2F91A 2JDID 5CHAC 5FX6A 3ZVGA 3T27A 3E90B 1P06A 1GHAF 2KR7A 2XWAA 1DWDH 1EPTB 1S83A 4ZMAH 2V35A 3UNQA 2R0LA 4HGCA 3UNSA 3S7HB 4YLUA 3RC6A 5J4SA 3QUMP 2VIQA 4D9QA 1SR5C 1UCYE 4AFUA 1ZOMA 3Q00A 4TPIZ 1TWXB 4P00A 2FYQA 4YO9A 2ZDMA 2OQ5A 2BB4A 4FETA 4YTAA 3U28C 4DGJA 1C5MD 1NRRH 3LH3A 2WV9A 3KYGA 1BBRH 3SU2A 2GGVB 2ZPQA 4IC6A 1GVZA 2TRMA 4H6TA 1W7XH 1QJ1B 4FUBA 3HK3B 3BV9B 3PB1E 1ZJKA 2KCAA 3LJJA 2ANMH 1ANCA 2ZP0H 1GI0A 3KQBA 2HNTE 1V2VT 3UQOA 4BAMB 3P8NA 2ZF0H 4E06H 1V2RT 1F0UA 2A1DB 1HFDA 4ISHH 2M5TA 2VGCC 2ZECA 5EOKA 2BMGB 1O2GH 5FL7D 1BRBE 4OGYA 1HJ8A 1O30A 3A7TA 1ZPCA 1EP5A 1QJ6B 2ZFQH 4ZROA 5GXPA 1RXPA 4J1YA 1G2LA 1UW7A 3GY4A 3QWCH 1ELCA 4ASHA 1TIOA 3SI4H 1EAWA 1BTUA 1A2CH 3PM3A 3LGWA 4CR5A 4R8TB 3SW2B 1OKXA 3KN2A 1GGDB 3U1IB 2VVCA 1C2IA 6ESTA 3FZZA 5FBIA 5CDFE 2GT8A 1CHGA 1YYY1 1MQ5A 5DP4A 3SZNA 1HAXB 1YPJH 2P8OB 2V3OH 1GCTC 1NFXA 1MKWK 1SHHB 2YOLA 3SQEE 1A0LA 4IN2A 4U01A 2FOGA 5FCKA 1BBRE 3SJ8A 1TMUH 3KGPA 1DLEA 3UB0A 3LC3A 1E0FD 1OWHA 1G37A 3A8CA 5I25A 5DN6D 1EOLA 1QGFA 1AE8H 3RXIA 5JB8S 4AN7A 1GBAA 2L6OA 2OC0A 4CRGA 1GJ9B 2Z9GA 1O3GA 3E0PB 1Y59T 2XBVA 1DXWA 2FDAA 4JYTA 1TPPA 3W95A 1S81A 1QURH 3LC5A 1CVWH 1DANH 3RP2A 4E7RG 1YPHE 1ESAA 1PQ8A 3GCHC 3ZZ4A 1FAKH 1HB0B 1O3PB 1TX6A 3VFEA 2F3CE 5JBAS 1OYTH 3SV6A 2ZDNA 4MNWA 1KLJH 1KLIH 3T29A 1SGEE 2AEIH 1NROH 2UWOA 1EATA 1AUJA 5AVDA 4U32A 4ACBA 1YC0A 3HATH 1SGYE 4TSFD 1BA8B 3ATLA 1KSNA 3FP7E 1THRH 5B6OA 5ESBA 3NCLA 4OS5A 1FPCH 1NRPH 3EQ0H 3V0XA 3ATKA 3PMBB 1ELDE 3EYDA 4BXSA 1V6DA 2VWNA 3ZZ9A 2A4GA 1C5QA 1E38B 1MTUA 2KCOA 4AYVB 3MWIU 3K2UA 1IQLA 3U8TH 4KGAA 4CRDA 1DE7H 2PGBB 2ZQ1A 4K2YA 1GBBA 1UVSH 1WBGB 1TQ0B 2BXUH 1TRMA 4NFEA 2BM2A 2L74A 2J4IA 5C67A 1GJ8B 5DO4H 1ZZZA 2GCHG 3PV4A 4A1TA 1C1TA 2BTCE 3LU9B 5EPNA 3KYFA 1GWAA 5C94A 1D6WA 1AIXH 1UTKA 4JZIA 1A5IA 4D8NA 1QHRB 1H8HD 1BCUH 4I8GA 1V2MT 1Y3WA 1EAUA 3RXVA 4CH2B 1O2OA 4MVNA 2Q6FA 5EGMA 5LPRA 3Q77A 1FJSA 9LPRA 4OS1A 4K1EA 2FESH 1COWD 1QBVH 2WV5A 3ZZCA 2WHXA 3P6ZB 3SUDA 2OTVA 5H4IB 2WPDD 1W8BH 1K1IA 4LOYH 1PPBH 2F9PA 1TALA 1TYNA 2ZU3A 4XRNA 3GCTF 4WMFA 1YPEH 1C2EA 1K28D 5JBBS 1PQ5A 2BXTH 2FOMB 3M5NA 4JMYA 2VU8E 1AMHA 1MQ6A 3GY5A 5EG4A 3RXLA 3TH4H 2XNIA 1WUNH 4Y79A 2GV7A 1O2TA 3BIVH 1BB0B 1UTNA 4X6OA 1V2JT 1B0EA 1BQYA 1PPHE 2PWXA 2GZ9A 1K1MA 3GS9A 1MH0A 3SJIA 4KTCA 2LPRA 1E34B 2R2MB 4H6SB 2GZ7A 4UDWH 3A7VA 4KELA 3VGCC 5A2MH 3LGVA 4Y8YA 1JXPA 1SMFE 1AVXA 4ABAA 2OCVB 2K7XA 1L2EA 4NZQA 3PO1B 1ANDA 3H7TA 2ZTXA 3BG8A 4X8VH 5IK2D 2C4FH 2WZQA 3TNSA 3WW7A 1UVOA 1LQDB 1S6LA 5EJ1A 5K7RA 2BY5X 3CP7A 1OX1A 4MLFB 1O3HA 1AE5A 5JYIA 2XC4A 4BANB 1V2OT 1JBUH 3KQ5A 5DP5A 1TMBH 3SU6A 4INKA 3DT0H 2J98A 4Y71A 1AZZA 4FUFA 5B6LA 2ANKH 3S9AA 2A45B 4OS4A 1KXFA 2ZZUH 3M7TA 1S0RA 2XTTB 4X8TH 3F9HA 1F5LA 4AC9A 2BQWB 4HZHA 3UREA 1BTZA 2WV4A 3BG4C 1EKBB 2D26C 2CGAA 2G5NA 1B5GH 1C1RA 3TIUA 2A5AA 3D62A 3UNRA 1O3NA 5GNDA 4AG1A 1F0SA 2ILNA 4CHAC 1O2LA 3EA7A 4CRAA 2Z3DA 4X6NA 2EY4C 1C2JA 3A7WA 2RDLA 2XW9A 3SNAA 3SI3H 4JYUH 4RT0A 3RMLH 1L4ZA 4Y7BA 1DOJA 1HNEE 1OHHD 1K1OA 4O9VA 1C2LA 3FANA 4RSPA 4GHQA 4JK6A 5GCHG 3RMOH 6GCHG 4O3UA 3ZV8A 4OS2A 2OC1A 3SNEA 2AERH 1AD8H 1FY5A 3A83A 1MTVA 4NGAH 2AMDA 4CREA 1V3XA 1BMLA 1O5DH 1SKYE 2UWPA 4WJG2 1J17T 1BUIA 1P8VC 2J9NA 2Y5FA 1ELEE 1MAXA 1O3LA 2YNBA 4ZHLU 1O2MA 1LKBA 2FWWA 1O37A 2TGAA 1GMCG 1BOQA 1FN6A 4X2WA 1P01A 5CMXH 1JRSA 1MBQA 1C5TA 3S9BA 1GHWH 2KFWA 1GVKB 2B7DH 3UY9A 1EB2A 1NO9H 3L33A 4AOQA 2QAAA 4MQAA 2XYAA 3FOAA 3M7QA 2G55A 4ZKRU 1U6QA 5DK1A 4B2CA 1PQ7A 4ISNA 3BTEE 2Z9LA 1YBWA 3VB3A 3M35A 5E2PA 4FUHA 2YMSC 2Z9IA 1PPZA 2NU4E 3N7EA 2IN2A 2ZPSA 3ZZ3A 4X8UH 1UK4A 1DFPA 1CBWC 2XXLA 3MH4A 3MU8A 3RLWH 2ZGCA 1FDPA 1FUJA 1ZSJA 4D7GA 1GJAB 1W10U 1SQTA 2W7SA 1B7XB 5EODA 4DT7B 1H9IE 1BTXA 1NN6A 4ZH8A 2A7CA 9ESTA 1D3TB 3U1JB 1OWEA 2NWNA 1O3KA 3P8FA 1P2IA 3SV9A 1NS3A 4XBCA 2FODA 2ZDVH 4MPUA 3MNCA 1CA0B 1HJAB 3I78A 3MNXA 1W13U 2FS9A 4JCNA 4FU8A 5FX5A 1XUGA 1DWCH 2BX4A 8KME2 2ZEBA 2W3KA 1HXEH 1QL9A 2PFEA 1LCYA 1RTFB 4K60A 5K0HA 3BIUH 1GHVH 3PROA 2ZA5A 3E3TA 3RU4T 2ZFPH 4X2VA 5FCRA 1O5FH 1HAZB 1GJ6A 4IS5A 4FU9A 3D49H 2Z3CA 1MCVA 3ZYEA 4WF8A 2SGEE 5A0CA 4X2XA 3A8AA 1AQ7A 4BTTB 3AK5A 3SNCA 1ZYOA 2TGDA 4X6MA 1OP2A 4ZHMU 1UTMA 4ISLA 3BTWE 1BZXE 4O97A 1K21H 1GJCB 1QCPA 2BY7X 1CA8B 1F0RA 1C2GA 3VXFH 1BHXB 2AGIX 1SFQB 3OAAD 1G9IE 3FFGA 3A7ZA 2A2QH 1KTTB 2Q1JA 2A4RA 2FYRA 2ODQA 2WINI 1SFIA 3LGYA 4FUGA 3RXEA 4VGCC 1S6HA 3BTHE 1MZDA 1PPCE 1P2MA 1XUJA 5EQRA 1WQSA 1AKSA 4Q4LA 5KEDA 2ANWA 2ZGHA 2ZHQH 1AGJA 1JRTA 1P2NA 1ZHPA 3OYPA 4B76A 2G81E 1SC8U 1T4VH 3HK6B 3T25A 1UVPA 2GZ8A 1FONA 5AFYH 2CHAB 1GBEA 1PPFE 3NRLA 5T1VA 1IQNA 2Y6TA 3L3TA 1GI5A 3UQVA 3U98H 1NRQH 1MUEB 1XXFA 3GY8A 1XUIA 3B23B 1EZUC 1O5BB 2Z9KA 4ZXYH 3MHWU 2GCTB 1YKTA 1VCPA 2B8OH 2BDYA 4I8LA 1GG6B 1N8OC 2A2XH 1BTWA 1ETRH 1LTOA 1NBME 3RXRA 4F4OC 5F53A 1VCQA 2ZIQH 1NFWA 3PRBA 3QLPH 1O35A 3AAVA 2V7QD 2Y7XA 2ZGJA 4B6EA 4GPGA 2JJ1D 3UOPA 1GBKA 3SBKA 1FMGA 1DWEH 1H8ED 4X8SH 1F5KU 4X6PA 3LJOA 3VPKA 2PR3A 2QF0A 1FY1A 4FOUC 1RTLA 3LIWA 5FXLA 3QGJA 4LZ4B 3E0NB 1MTNB 2R9PA 1HAOH 4ZKOU 2BDIA 5DPAA 1FZZA 1OP8A 1DM4B 2WPLS 3HPTB 4OM9A 2H9EH 4U2WA 4Y8XA 4O3TA 4YOJA 2TIOA 2ZI2H 2IPQX 1QIXB 1O2KA 1XKAC 2J98B 1C1PA 1LHFH 1TOCB 4XBDA 1LDTT 1O2VA 2THFB 2ZU4A 2LIZA 3TK6A 2W7UA 1K0HA 2OD3B 1JOUB 5IDKA 2A31A 1NRSH 1L4DA 2SGDE 1KXBA 1V2LT 2BDAA 3FN8A 5F8TA 5EXLA 2EQNA 4A1VA 3RM2H 4X2YA 2V3HH 1TRNA 3VB5A 2BQ6B 2NU2E 4H4FA 3LDXH 2BVRH 3S9CA 1OWKA 4YZUA 5FHTA 3CS0A 1YPLH 3SHCH 4AB8A 3DHKH 3UFAA 7GCHG 2XC0A 1AWFH 3SU0A 2VINA 4I33A 2K8IA 4AFSA 1GDUA 1Q2WA 4CBNA 2R3YA 4Y0ZE 2WUBA 3TH2H 4ZUHA 1FIWA 2VB0A 1TB6H 1C9PA 1FIZA 4WVPE 1CHOF 3FKSD 3S69A 1FY8E 3QN7A 2SNWA 4NIVA 1C5WB 2HOBA 4FUDA 5FPSA 2A4OA 1O3MA 1GMDF 1O3EA 4ABFA 2C3SA 2G8TA 3MYWA 1T8MA 3OFND 3E91A 1DS2E 4WWYA 1W12U 2PUXB 2ALPA 3P17H 2W6ID 2QXJA 3IITA 2PKSB 1MZAA 2ZGBH 4FUJA 1A3EH 2P94A 4DW2U 2AIQA 4ABIA 3Q3XA 1Y5BT 1EZSC 2GVFA 2SGFE 3OX7U 4TY6A 2GD4B 5J4QA 1SLUB 4QT8C 2FOAA 4X1PU 2EI6A 3D65E 3ZZBA 5HIYA 7LPRA 5C0UA 3SNDA 1L1GA 3A8DA 4PROA 1T7CA 1Z1IA 2ZPRA 2BDHA 1IQIA 1ZTKA 2XNDD 4Q80A 1YWUA 3JZ2B 3W1EA 1OP0A 2VH6A 1GL1A 1QBNA 2GV6A 2ZU1A 2FX4A 3A80A 1YPGH 3AAUA 1NBMD 3F9EA 1ZGIA 1KXEA 4RI0A 4O03A 1FPHH 1TAWA 3UR6A 3G01A 1MCTA 1HRTH 2HWLB 3CS7A 5A09A 1QQ4A 2STAE 1C5XB 5A8YA 4YLQH 1IQKA 2V3MA 4H42U 2GMTC 3M3VA 2AMPA 4ABEA 1HBTH 3PRDA 3Q76A 3LKWA 4TWWA 2VJ1A 3TGKE 4CHAB 2F9BH 1GJBB 1Y3YA 1XXDA 1C9TA 1LPGB 3SUEA 1MU6B 2Z94A 1T32A 3SNBA 3MH5A 4SGAE 3LGTA 3GDVA 1HGTH 1P05A 4Y11E 5GCHF 1Z1JA 3BTTE 1S5SA 1TNHA 1DPOA 3H09A 1PFXC 3RMNH 3E16B 3F3BA 1RJXB 3RLYH 3ESTA 1QNJA 1JIMA 1J8AA 3BTKE 2RA3A 1F0TA 3SU1A 1C1MA 4CRBA 1ANEA 5BPEA 2TPIZ 3PMAB 2BY8X 5AF9H 4Y10E 1TNGA 1FLEE 2DE8A 2SGQE 1GMCF 1XUKA 1AKSB 4GAWA 1A0JA 1S82A 1J15A 1C5SA 3RXSA 2QCYA 3UOUA 2STBE 4ZKSU 1QJ7B 2B0FA 1YCPK 4I8HA 3JZ1B 4YXWD 4I7YH 1UVUH 2J95A 3SU4A 1UJ1A 4ABBA 5A8XA 1FNIA 3KF2A 1O3CA 1CGHA 2YMSB 1BTHH 1GI4A 3U69H 3WWFA 4Z1MD 1HUTH 1C1VH 3C27B 1ESBA 1GDQA 1AFQC 1LHCH 1CBWB 2OP9A 1JWTA 3GDUA 2D8WA 5DP7A 2PTCE 3QDZB 3NPSA 3F2GA 1NT1A 3U8RH 2BZ6H 3PTBA 1SG8B 2UUJB 1FY3A 3V7TA 5SGAE 1TLDA 1Z8RA 5L2YH 5C5NA 1AVGH 2EA3A 2BDCA 1YCPM 1SGFA 1CT2E 1P10A 3S7KB 1F5RA 3GYLB 1C5RA 1SOZA 4MNXA 2Q6DA 4RKJB 2VWLA 4A92A 3QX5H 4ABJA 1QR3E 1OPHB 2ZFFH 3QZRA 2YMSD 1ZHRA 3CNRA 5DP3A 2VIDA 4AGJA 5DP9A 1MMJN 2WPHS 1NZQH 3SOSA 2BQ7B 1ZRBA 1C5LH 1ANBA 1C2FA 1J9CH 2UUKB 4FVBA 2A5IA 1Z8GA 1SI5H 4TPYA 5EQSA 2HPQH 2KX4A 3MMGA 4TYDA 3SO3A 3MO9A 1NTPA 1VKYA 3DA9B 1XMNB 4K1TA 4AX9H 1ZMNA 3DFLA 2CV3A 4AB9A 3FP6E 1ZLRA 3A81A 2XC5A 2PSXA 2O8WA 1VITH 1K1NA 1QB9A 3NKKA 5JBCS 2YNAA 1WOFA 4NSVA 1Y3UA 2QA9E 3M5OA 1E1RD 1TQ7B 4B71A 1TNKA 3ENSB 3EE7A 1ARCA 2QF4A 3IG6B 3OY5U 3R3GB 4UFFH 3KQEA 1BRAA 4B1TA 1UTQA 2TGTA 3FVFB 1O31A 2FTMA 1K9OE 3E8LA 1Y5AT 1P0SH 3H5CB 4NCYA 1EFRD 3F2FA 4CRFA 1GPZA 1O2NA 1Y3XA 2ZO3H 3FO8D 4VGCB 1KTSB 3IWMA 2KCPA 1C5NH 4MNVA 4GCHG 1Z6JH 1K2I1 2XRCA 4NA9H 2BD2A 2CF9H 2RDEA 3MU4A 1V2NT 1O32A 5C3NA 3SQHE 2C8XB 5A0BA 2LP6A 1SGFG 1KMHB 3SYJA 1VZQH 1GI3A 1LO6A 3E1XB 2BDBA 4OS6A 2BOKA 1GI1A 3PLPA 4YT6H 1K1LA 2GX4A 2QN5T 3STJA 2F9UA 1IHTH 3V3MA 8GCHG 1EPTC 1GHAG 3DUXH 3VG8A 2G00A 4B2AA 2QXGA 3FZDA 2BY9X 2XBXA 1GJ4H 2IJOB 3RXOA 3ZVFA 1DUAA 1SQAA 2HGTH 4BTIB 3U9AH 3RMMH 2H9TH 1RIWC 3RXDA 2F43B 2CXVA 5FPYA 1JMOH 4UFEH 1TONA 1YY3A 2A7JA 3NWUA 4Q63A 1EUFA 3BSQA 1QTFA 2PGQB 4NA8A 1UVTH 2ZC9H 3BEUA 2J97A 1EJAA 1O2IA 3HGPA 1A46H 3K9XB 3M37A 4KTSA 3N7DA 4DG4A 1BJVA 2J34A 3EA8A 1WSSH 4JZDH 1RGQA 1ELTA 1P2KA 2SFAA 1PPEE 1V2WT 3URDA 2UWLA 3UTUH 1BRCE 2ODPA 4FUIA 1C2HA 2C8YB 1VGCB 4I31A 1LHEH 3TJNA 4YT7H 1X7AC 1MU8B 1O5GH 3RU4E 1LVBA 1O3AA 1G36A 1KLTA 1Z8IB 1SLWB 2BZAA 3NK8A 4X1NU 3DFJA 3PLBA 1DICA 3Q3YA 2FEQH 1OS8A 4GSOA 1IQHA 1P57B 4NWKA 2CMYA 3A82A 1Z6EA 4P02A 1LVYA 2SGAA 3ODFA 4M7GA 1DXPA 4CR9A 3RXFA 5JBTA 3BEIB 1AWHB 1VCWA 3GY6A 3HKJB 3ITIA 1H8DH 1GGDC 3EDXB 2LELA 3MNBA 2Z7FE 5E0GA 3A87A 1KIGH 1EOJA 1TA2A 2P8OC 4UFGH 1O2YA 4NWLA 1UTOA 1H9LB 1Z71A 4YOIA 1NU7B 2WSSD 5F8ZA 2C8WB 3MNSA 5F03A 2BDGA 7GCHF 1QB1A 1GJ5H 2BLOA 1TPAE 5EW1H 4XOJA 3SORA 4Y8ZA 2HALA 2P59A 1XUHA 5EU8A 2HNTF 3GY7A 3MO3A 4FU7A 3TGJE 1O2JA 4B75A 1GBTA 3TK9A 3M5LA 4JZEH 1IQMA 2JIZD 4NSYA 4Y76A 2J94A 3ZVBA 1YM0A 2I6SA 2GKVE 1NU9A 1NC6A 3TH3H 1QZ8A 5CHAB 3GDSA 1ZTJA 2BD3A 2LNCA 1V2PT 1O36A 1TPOA 4X1RU 1YF4A 2G4UA 4X1QU 2BLVA 5FPTA 3DD2H 1AUTC 1TE0A 2F9NA 1XX9A 5IYTA 1FQ3A 2QE7D 3RXUA 5HXFA 1ZJDA 2BYAX 1TBRH 4GLYA 1O3JA 4CH8B 5L30H 2ZWLH 3BTGE 1H1BA 3OTJE 5ETXA 5C0TA 1W11U 3A89A 3PMHB 3OTPA 4OGXA 1HIAA 1LVOA 1O2HA 3MFJA 4ASUD 3N7OA 4JZFH 1ZTLA 5FAHA 3AASA 1DDJA 1O5CB 1PJPA 3Q3KA 4TY7A 2KCYA 1D3PB 2AHME 2G4TA 1MKXK 2G5VA 1QB6A 3F0OA 5LPEA 3SGAE 3O8BA 5CHBA 3LPRA 2H6MA 3A7XA 2QGRA 5EPYA 1C1SA 2VGCB 1C5OH 1GBHA 1VJ9U 1SGRE 2PSYA 1E36B 1HDTH 2RA0A 3TVJB 2BHGA 3MH6A 4A6LA 2PKAA 1L0ZA 3A8BA 1S6FA 2Y5GA 1P04A 1GMHG 2O9QA 1TPSA 2XBWA 3BTDE 4LZ1H 2BVXH 3PLKA 1MKWH 1ETTH 1V2UT 3NZIA 5C20A 3ATIA 1J14A 3SN8A 1SGDE 1SLXB 1WV7H 3OE7D 1Y3VA 3K65B 5JPMH 1IQEA 3U8OH 1P2OA 1ZGVA 3QK1A 1GCTB 1ZSKA 4Q2KA 1WDIA 3UAIC 3GCTG 5EQQA 1O3IA 1SGCA 3MU5A 5G4BA 1T4UH 2ZDKA 4BNRA 5DKMA 1BMNH 3RU4D 1TGNA 1YPKH 1K1JA 2HVYB 4BAQB 2HLCA 2K1QA 1L1JA 2O8MA 1IQGA 1YCPH 4Z0KA 3ZZAA 1C2MA 4ISOA 3P70B 4UEHH 1GI9B 8ESTE 3ZVAA 4ZXXH 3K6YA 5A0AE 1QA7A 5DG6A 3ZZDA 3MH7A 2K0QA 2D1JA 5E2OA 4BAHB 3O8RA 1GBFA 1HAHH 2HPPH 4OS7A 2AIPA 2P3UB 3AW0A 1YPHC 4F55A 2BLQA 3TLOA 2W6JD 3PO1C 2FIRH 3GCHB 3VB4A 1W0ZU 1O2XA 5C17A 1BITA 1QBOA 2OK5A 1DWBH 2EC9H 1C2KA 2F9VA 1NRNH 1VJAU 3PV2A 4DIIH 2PHBA 4K8YA 1AO5A 1L1NA 1N6XA 1AFQB 1T31A 5HGGA 1CQQA 1DLKB 1P3CA 5C1XA 1N1LA 4YESB 3N99A 2OBQA 3QGNB 1GJDB 2DUCA 1GHBG 1KDQA 1O0DH 2W26A 3P95A 2QXHA 2SNVA 2VWMA 3A86A 1A0HB 1CO7E 2CF8H 2FMJA 2IPHA 3GISB 3KCGH 5T6FA 4Z6AH 1EP6A 1C1NA 6CHAC 3QTVH 4HTCH 3UWJH 1SGQE 1MABB 1HJ9A 1XM1A 1W2KH 2JH6D 2FOFA 3P8OA 2VIWA 2GCHF 1NESE 1O5AB 3RM0H 3SHAH 3UUZA 3TGIE 2B5TB 3P8GA 3SUFA 1CSOE 2OC7A 2ZHWH 3TNTA 1C5UA 4K8BA 2ZG0H 1A1RA 3QO6A 1GBMA 2OBOA 1WYKA 1O2QA 1P11E 4HFPB 4I8KA 1EB1H 2FO9A 4Q7ZA 2H2ZA 2W5EA 1BRUP 4KKDA 3LH1A 1YLNA 2NU1E 3PWBA 3O8CA 4WMEA 1A61H 1A5GH 2QIQA 1EQ9A 2JH0D 4GVUA 3WWBA 4GCHF 3AVZA 3A85A 2TBSA 4MPVA 1SGNE 3EBNA 3PTNA 1PYTC 2Y82A 3B8JA 2ESTE 1D3QB 1IAUA 1V2TT 5JB9S 3F9GA 4TWYA 1OWIA 5AHGH 2A5KA 5DP6A 1G30B 1SGPE 2I6QA 4XD7D 1BHXF 1WQVH 2KM0A 3VGCB 5PTPA 1WTHD 3RXJA 8GCHF 3TJUA 2FOHA 5GJ4B 1THSH 2G52A 1DY9A 2FX6A 2Z6BD 2OC8A 1C5YB 5F6MA 4DCDA 4Q7YA 1KY9A 1NPMA 1HAYB 5DSFA 1BMFD 1CA0C 1HJAC 1XUFA 4YM9A 1HCGA 1ABJH 1BIOA 3OY6U 3FP8E 1GBLA 4ISIH 2UUFB 4DY7B 4K5ZA 5LGOA 1P9SA 1RIWB 5T6DA 1IQJA 1TGSZ 1F92A 3FAOA 2FOBA 5EJLA 4B74A 1SLVB 3WY8A 5EIYA 3F2HA 3SJ9A 4M9FA 3BEFB 1DVAH 2GDDA 2H9HA 2NU3E 3BN9A 3RXTA 1QQUA 1QRWA 4AGKA 2QC2A 3ZIAD 5LH8A 3KNXA 1ELBA 2KAIB 2XOKD 3OSYA 2WPMS 2ZHFH 1TGBA 1E37B 2GP9B 1H8IH 1AZ8A 1EXFA 3BG4B 3ZZ6A 2ZGXH 1BTYA 1A7SA 1HIAB 1ACBE 1ABIH 1EAIA 1PQAA
chains in the Genus database with same CATH topology
1LHGH 2QF3A 3ZYDA 5TJXA 2ULLA 4WH6A 1SVPA 1AY6H 1SBWA 1UO6A 1S85A 3STIA 1GHYH 1TA6A 1KXDA 6GCHF 4BAKB 5HM9A 1D4PB 2ALVA 3ZZ8A 3QTOH 1LKAA 3RXQA 2PKAB 3UPEA 5EW2H 1AB9C 3ELAH 3M3TA 2XCFA 3EAJA 1S84A 2PUQH 5T3HA 4UFDH 4FVDA 1EZQA 5C1YA 3URCA 1GVLA 1OXGA 5GDSH 4A1XA 5BRRE 2CHAC 4THNH 3KEEA 4D76A 2ZFTA 2F9OA 3MI4A 5TCCA 1SOTA 4I32A 1ELVA 1KXCA 2DE9A 2GCTC 2AMQA 1EJMA 1HPGA 2ODYB 4U30A 2AYWA 1LHDH 2C93B 3PMJA 1GG6C 2ZFRH 7ESTE 2EI7A 4JK5A 1GL0E 4Q7XA 1O2RA 1CU1A 1BDAA 1XKBC 2ZKSA 1ELGA 1Z7KA 2VWOA 3M3SA 1UHBA 2OQUA 2BOHB 5JDUB 3RXPA 3ATWA 4CBOA 1O2WA 3LT3A 2CN0H 1MTNC 2WYGA 1O34A 1DITH 1O5EH 4F49A 3M61U 4ZHAA 1TNIA 5DP8A 2ZCKP 1TOMH 1C1WH 3BTQE 5TCAA 1XVOA 1O39A 2ZTZA 1ETSH 1DSTA 1JIRA 4AZ2B 2H5CA 3L6PA 1YLDA 1C4V2 1MKXH 2J2UA 2R0KA 2WPJS 3I77A 3ATMA 3EGKH 1FAXA 1O33A 4BOHA 1W0YH 1O2ZA 2VH0A 1HYLA 3M5MA 1KDQB 1SB1H 3TJOA 1ZSLA 1INCA 3VEQB 1VITG 4XSKU 1EJNA 1FV9A 1W3CA 1C5PA 4XFQA 5E8EH 3QZQA 1RD3B 2Y5HA 3E6PH 4K69A 5ABWA 1NM6A 1SL3A 1ZPZA 1Z8JB 1V2ST 3ZV9A 1NFYA 1GMHF 1P03A 2F83A 3O8DA 2Y81A 2FI5E 3BF6H 1UMAH 2PTNA 1GDNA 1C5VA 1UCYK 1LVMA 4BXWA 2JH5D 1YP9A 1FY4A 5F8XA 1RTKA 1A3BH 8LPRA 2ZHDA 5L6NH 1OOKB 2PLXA 1OSSA 2PW8H 1GI8B 1G3DA 6LPRA 1P09A 2B9LA 2JETC 2Z3EA 4NZLA 2P3FH 3TK5A 3LONA 2V0BA 4KP0A 1UK3A 2ZNKH 1O3FA 1D9IA 2C90B 2P93A 1CHOG 2ZCHP 4NIXA 2VVVA 3M36A 2FZZA 2WPKS 1G32B 3TITA 1Y5UT 1GMDG 4SGBE 2BD9A 1P02A 3KIDU 3UIRA 4ZKNU 1NFUA 1F7ZA 1GI7B 1N8OB 1P2QA 1ESTA 2PKSC 1H4WA 3R0FA 5HMAA 1HAVA 1Q3XA 2EEKA 4XE4A 4INHA 1P3EA 4NA7A 3B9FH 4A7IB 2BD8A 1SGTA 1GHXH 2QXIA 1TBQH 1ARBA 1P2JA 1EZXC 3EE0B 1QL8A 3T2NA 3LOXA 4UD9H 1LQEA 5E0JA 3GICB 1GHZA 4ABGA 2ASUB 3GYMA 4B73A 3RC5A 4IGDA 4AFQA 5C5OA 3H7OA 3F68H 1OWJA 1WU1A 3SV2H 1MTSA 1SHYA 4J2YB 4JZ1A 1V2QT 3KHVA 2ZDLA 1UTJA 3M7UA 3F9FA 2OINA 1UK2A 5EXMA 1K1PA 3GCNA 4UONA 1BBRK 1GI2A 1T8OA 1GHBF 1Y8TA 4RKOB 1TX8A 1UTLM 1DSUA 1HAPH 1QRXA 2J38A 3MU0A 3ZZ7A 4DJZB 1YLCA 3GY3A 2R2WU 1S0QA 7KMEH 6CHAB 2QY0B 1DX5M 4WXIA 5T6GA 4NIYA 1BT7A 1IHSH 2A32A 1KYNA 2OLGA 3ZVDA 2ZU5A 4AG2A 1LMWB 1WCZA 1J16A 2FXRA 3NUMA 2Z9JA 3S0NA 3EA9A 4AYYB 2WUCA 3F6UH 1GBIA 2FI3E 1BJUA 4BTUB 3MU1A 2BLWA 4LK4A 1VR1H 1AU8A 4FUEA 3GY2A 4MPXA 3TPIZ 4DVAU 3TJVA 1SGIB 1HXFH 2AS9A 3RUOA 4X0WU 2O8UA 3D23A 5DJ7A 1QRZA 3SU3A 1T8NA 1BMMH 1TABE 5HYOA 4IBLH 1TGCA 1BMAA 2XBYA 1EPTA 4Y7AA 3V13A 4DIHH 2FOCA 5GPIB 2W3IA 1H9HE 4WMDA 1ZPBA 4WY3A 4DURA 1G3EA 5LPFA 1P9UA 3RXGA 1AVWA 1BTPA 3T62A 3LGIA 1Q31A 1O2UA 3SJKA 2OXSA 2P95A 2XWBI 3MTYA 1O38A 1XVMA 1SSXA 4LXBH 4FUCA 4DOQA 2ZQ2A 1QL7A 4YOGA 2GDEH 2Q6GA 2JKHA 5CE1A 3RC4A 1A5HA 2BD7A 1CT0E 2KAIA 2Y80A 5C2ZA 1RS0A 3SGQE 1TGTA 2FTLE 1F2SE 1O3BA 2P3TB 1GJ7B 3CENA 2GT7A 1ORFA 2OUAA 5DGJA 2FOEA 3PWCA 2CJIA 1UHBB 3A7YA 3UWIA 1KXAA 3RDZA 2VVUA 1PPGE 1UTPA 2HNTC 3I29A 4R0IA 3MO6A 3ZVEA 3SUGA 1HAGE 4XBBA 4KTUA 1LPZB 3UR9A 1C4U2 1PYTD 2C8ZB 4IW4E 2G51A 1W7GH 4NG9H 1ZMLA 3ODDA 4GUXA 2O8TA 1CE5A 5FBEA 3SGBE 1TBZH 1G3CA 2GMTB 1TFXA 4FXGH 2D2DA 1QFKH 1AN1E 2ANYA 2R3UA 4GHTA 1WAYB 4D9RA 1MTWA 1C1OA 1MAYA 1YPMH 3RXCA 3NXPA 4IN1A 5ESTE 1GBDA 1AHTH 4WXVA 2QYIA 1IQFA 1V2KT 3VB6A 3F1SB 2WPIS 3TU7H 1HAIH 2BX3A 1WTGH 4IMZA 2ZFSA 3W94A 1RFNA 3K6ZA 4AFZA 1EX3A 2WYJA 4E05H 1AB9B 2UUYA 3LGUA 5GWZA 3RXKA 1NY22 2VIPA 2SGPE 2Y7ZA 1T8LA 1O2SA 5AFZH 1GBJA 3P92A 3RXHA 2VNTA 2ZU2A 4MTBA 1TX7A 2A7HA 5EXNA 1G3BA 1C1QA 1MBMA 5E0HA 3VB7A 5C1UA 4I8JA 5HM2A 5A8ZA 3BTME 3ZZ5A 1SQOA 2AFQB 1FN8A 1O3DA 3PYHA 1CT4E 1G2MA 4E7NA 2O8LA 2AGEX 2FLRH 1A4WH 1O2PA 1D6RA 3V12A 1EAXA 1ZHMA 2FM2A 2TGPZ 4K1SA 4MG3A 1W14U 1HAVB 1HLTH 1TNLA 4IC5A 4K3JA 2VIOA 4ZAEA 1C2DA 4JYVH 4A5TS 3GOVB 2ZDAH 2H5DA 1QA0A 1HV7A 4ESTE 4INLA 1O3OA 3SV7A 2NU0E 2RG3A 1THPB 3T26A 2A0QB 1C4Y2 1M9UA 1C1UH 2AGGX 2J92A 4RN6A 4B2BA 1TNJA 1FXYA 3KL6A 1VGCC 4ABDA 1DUEA 1TRYA 2GTBA 1ZRKA 1DY8A 3KQDA 3GCOA 2FS8A 3HKIB 2QV1A 2BY6X 1E35B 1GCDA 1QY6A 1ZMJA 1RRKA 1EASA 1MD7A 2BD4A 3BTFE 1SPJA 1AI8H 1N6YA 4BAOB 1VITF 4AORA 4HI3A 1GI6A 4MPWA 1ELFA 2VIVA 1AFEH 3SV8A 5L2ZH 4D7FA 4XDEA 1OWDA 1TMTH 1ELAA 4WH8A 2P16A 4CRCA 3MOCA 2AH4X 5I46H 4MNYA 2H1UA 2IOTA 4NIWA 4Y6DA 4X1SU 2FP7B 2EI8A 1UCYH 2ZCLP 4NFFA 2BVSH 4MDSA 3SU5A 3T5FH 1C5ZB 1CGJE 1K22H 3HGNA 1MD8A 2FLBH 3RXMA 2ZHEH 1P12E 1DT2A 2V6NA 3A84A 3SJOA 2RCEA 3ZVCA 2HRVA 4UE7H 3RXAA 2ZTYA 1OYQA 3OU0A 2PV9B 3VXEH 3KQCA 3T28A 4IMQA 1B0FA 1YGCH 3RXBA 4Y0YE 1FI8A 1ZR0A 1ID5H 1LPKB 2BD5A 1CGIE 2XCNA 3AW1A 3C1KA 5GIBA 2FI4E 1GBCA 2HVXA 2A4QA 2JETB 4ABHA 3A88A 1IOEA 1D3DB 2FPZA 2F91A 5CHAC 5FX6A 3ZVGA 3T27A 3E90B 1P06A 1GHAF 2XWAA 1DWDH 1EPTB 1S83A 4ZMAH 2V35A 3UNQA 2R0LA 4HGCA 3UNSA 3S7HB 4YLUA 3RC6A 5J4SA 3QUMP 2VIQA 4D9QA 1SR5C 1UCYE 4AFUA 1ZOMA 3Q00A 4TPIZ 1TWXB 2FYQA 4YO9A 2ZDMA 2OQ5A 2BB4A 4YTAA 4DGJA 1C5MD 1NRRH 3LH3A 1BBRH 3SU2A 2GGVB 2ZPQA 4IC6A 1GVZA 2TRMA 4H6TA 1W7XH 1QJ1B 4FUBA 3HK3B 3BV9B 3PB1E 1ZJKA 3LJJA 2ANMH 1ANCA 2ZP0H 1GI0A 3KQBA 2HNTE 1V2VT 3UQOA 4BAMB 3P8NA 2ZF0H 4E06H 1V2RT 1F0UA 2A1DB 1HFDA 4ISHH 2M5TA 2VGCC 2ZECA 5EOKA 2BMGB 1O2GH 1BRBE 4OGYA 1HJ8A 1O30A 3A7TA 1ZPCA 1EP5A 1QJ6B 2ZFQH 4ZROA 5GXPA 1RXPA 4J1YA 1G2LA 3GY4A 3QWCH 1ELCA 4ASHA 1TIOA 3SI4H 1EAWA 1BTUA 1A2CH 3PM3A 3LGWA 4CR5A 4R8TB 3SW2B 1OKXA 3KN2A 1GGDB 3U1IB 2VVCA 1C2IA 6ESTA 3FZZA 5FBIA 2GT8A 1CHGA 1YYY1 1MQ5A 5DP4A 3SZNA 1HAXB 1YPJH 2P8OB 2V3OH 1GCTC 1NFXA 1MKWK 1SHHB 2YOLA 3SQEE 1A0LA 4IN2A 4U01A 2FOGA 5FCKA 1BBRE 3SJ8A 1TMUH 3KGPA 1DLEA 3LC3A 1E0FD 1OWHA 1G37A 3A8CA 5I25A 1EOLA 1QGFA 1AE8H 3RXIA 5JB8S 4AN7A 1GBAA 2OC0A 4CRGA 1GJ9B 2Z9GA 1O3GA 3E0PB 1Y59T 2XBVA 1DXWA 2FDAA 4JYTA 1TPPA 3W95A 1S81A 1QURH 3LC5A 1CVWH 1DANH 3RP2A 4E7RG 1YPHE 1ESAA 1PQ8A 3GCHC 3ZZ4A 1FAKH 1HB0B 1O3PB 1TX6A 3VFEA 2F3CE 5JBAS 1OYTH 3SV6A 2ZDNA 4MNWA 1KLJH 1KLIH 3T29A 1SGEE 2AEIH 1NROH 2UWOA 1EATA 1AUJA 5AVDA 4U32A 1YC0A 3HATH 1SGYE 1BA8B 3ATLA 1KSNA 3FP7E 1THRH 5B6OA 5ESBA 3NCLA 4OS5A 1FPCH 1NRPH 3EQ0H 3V0XA 3ATKA 3PMBB 1ELDE 3EYDA 4BXSA 1V6DA 2VWNA 3ZZ9A 2A4GA 1C5QA 1E38B 1MTUA 4AYVB 3MWIU 3K2UA 1IQLA 3U8TH 4KGAA 4CRDA 1DE7H 2PGBB 2ZQ1A 4K2YA 1GBBA 1UVSH 1WBGB 1TQ0B 2BXUH 1TRMA 4NFEA 2BM2A 2J4IA 5C67A 1GJ8B 5DO4H 1ZZZA 2GCHG 3PV4A 4A1TA 1C1TA 2BTCE 3LU9B 5EPNA 1GWAA 1D6WA 1AIXH 1UTKA 4JZIA 1A5IA 4D8NA 1QHRB 1BCUH 4I8GA 1V2MT 1Y3WA 1EAUA 3RXVA 4CH2B 1O2OA 4MVNA 2Q6FA 5EGMA 5LPRA 3Q77A 1FJSA 9LPRA 4OS1A 4K1EA 2FESH 3ZZCA 1QBVH 2WV5A 3P6ZB 3SUDA 2OTVA 5H4IB 1W8BH 1K1IA 4LOYH 1PPBH 2F9PA 1TALA 1TYNA 2ZU3A 3GCTF 4WMFA 1YPEH 1C2EA 1K28D 5JBBS 1PQ5A 2BXTH 2FOMB 3M5NA 4JMYA 2VU8E 1AMHA 1MQ6A 3GY5A 5EG4A 3RXLA 3TH4H 2XNIA 1WUNH 4Y79A 2GV7A 1O2TA 3BIVH 1BB0B 1UTNA 4X6OA 1V2JT 1B0EA 1BQYA 1PPHE 2PWXA 2GZ9A 1K1MA 1MH0A 3SJIA 4KTCA 2LPRA 1E34B 2R2MB 4H6SB 2GZ7A 4UDWH 3A7VA 4KELA 3VGCC 5A2MH 3LGVA 4Y8YA 1JXPA 1SMFE 1AVXA 4ABAA 2OCVB 2K7XA 1L2EA 4NZQA 3PO1B 1ANDA 3H7TA 2ZTXA 3BG8A 4X8VH 2C4FH 3TNSA 1UVOA 1LQDB 5K7RA 2BY5X 3CP7A 1OX1A 4MLFB 1O3HA 1AE5A 5JYIA 2XC4A 4BANB 1V2OT 1JBUH 5DP5A 1TMBH 3SU6A 4INKA 3DT0H 4Y71A 1AZZA 4FUFA 2ANKH 3S9AA 2A45B 4OS4A 1KXFA 2ZZUH 3M7TA 1S0RA 2XTTB 4X8TH 3F9HA 1F5LA 2BQWB 4HZHA 3UREA 1BTZA 2WV4A 3BG4C 1EKBB 2D26C 2CGAA 2G5NA 1B5GH 1C1RA 3TIUA 2A5AA 3D62A 3UNRA 1O3NA 4AG1A 1F0SA 2ILNA 4CHAC 1O2LA 3EA7A 4CRAA 2Z3DA 4X6NA 1C2JA 3A7WA 2RDLA 2XW9A 3SNAA 3SI3H 4JYUH 3RMLH 1L4ZA 4Y7BA 1DOJA 1HNEE 1K1OA 4O9VA 1C2LA 3FANA 4RSPA 4GHQA 4JK6A 5GCHG 3RMOH 6GCHG 4O3UA 3ZV8A 4OS2A 2OC1A 3SNEA 2AERH 1AD8H 1FY5A 3A83A 1MTVA 4NGAH 2AMDA 4CREA 1V3XA 1BMLA 1O5DH 2UWPA 4WJG2 1J17T 1BUIA 1P8VC 2J9NA 2Y5FA 1ELEE 1MAXA 1O3LA 2YNBA 4ZHLU 1O2MA 1LKBA 2FWWA 1O37A 2TGAA 1GMCG 1BOQA 1FN6A 4X2WA 1P01A 5CMXH 1JRSA 1MBQA 1C5TA 3S9BA 1GHWH 1GVKB 2B7DH 3UY9A 1EB2A 1NO9H 3L33A 4AOQA 2QAAA 4MQAA 2XYAA 3M7QA 2G55A 4ZKRU 1U6QA 5DK1A 4B2CA 1PQ7A 4ISNA 3BTEE 2Z9LA 1YBWA 3VB3A 3M35A 5E2PA 4FUHA 2Z9IA 1PPZA 2NU4E 2IN2A 2ZPSA 3ZZ3A 4X8UH 1UK4A 1DFPA 1CBWC 2XXLA 3MH4A 3MU8A 3RLWH 2ZGC