4WMEA

Crystal structure of catalytically inactive mers-cov 3cl protease (c148a) in spacegroup c2
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
306
structure length
306
Chain Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MERS-CoV 3CL protease
publication title Structures of the Middle East respiratory syndrome coronavirus 3C-like protease reveal insights into substrate specificity.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Hydrolase
total genus 85
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4wmeA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wmeA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wmeA02
2NU4E 3SHCH 1OP8A 4O97A 2ZFQH 4ASHA 4JK6A 3EYDA 1KXAA 1A0JA 3EA8A 1A0LA 3ODDA 3F6UH 2C8ZB 4X2WA 1GHVH 1ZTLA 1AU8A 1ZPBA 4B1TA 3LH3A 1GBAA 1FDPA 1AMHA 3HGNA 1KXEA 3SGQE 2EA3A 2CGAA 4BXWA 3V7TA 4RKOB 1TX7A 1MAXA 3VXEH 6CHAC 1Q2WA 1QBOA 1OYTH 2AEIH 3NUMA 1EKBB 2BQ6B 2ALVA 1P04A 2O8WA 2DUCA 4ZROA 1YC0A 1ZPCA 1FPCH 3QGJA 5HMAA 3E91A 3MU0A 1ELTA 1OSSA 1TPOA 2HNTE 3VFEA 1Y5UT 5DP4A 1PJPA 1KIGH 3BTME 1GMCG 1GBBA 2HPQH 5JB9S 1CQQA 4INKA 3MH4A 3MH5A 1ZPZA 1RIWB 2NU2E 7LPRA 3PYHA 3P92A 1ETTH 1HRTH 1JIMA 1V2MT 1ZRKA 4X2YA 1THPB 2EI7A 2XC5A 3URDA 1H1BA 1EJAA 4E7RG 2GT7A 4D7FA 1KTSB 3F9HA 1TMTH 1CGIE 1TALA 3ATMA 1GJ6A 1IQNA 5J4SA 1MTSA 3QWCH 4BAKB 2BD5A 2SGQE 1NU9A 3CENA 4OS1A 1PPGE 3BSQA 4E05H 1FN6A 2OC0A 2TIOA 1O2KA 1T8LA 3TH3H 4Y8ZA 2A1DB 1AO5A 3FP8E 1C1VH 1VITF 5FX5A 1GBMA 4I32A 1GHAF 3E6PH 1TNKA 1V2PT 2WPHS 3P6ZB 1QB9A 2CMYA 1IQMA 3LDXH 2UUYA 9ESTA 1EZQA 1T8OA 3U8RH 3MMGA 3RXEA 1BIOA 2Q1JA 4WY3A 4SGBE 2YNBA 2W5EA 1RTFB 2BMGB 3UR9A 4LOYH 3M7UA 3IG6B 4TY7A 1GI8B 1P9UA 4TY6A 4AFQA 3U8OH 1B5GH 1N8OB 1KSNA 5EGMA 1P09A 5F8ZA 4NWLA 3RC4A 1Z8RA 1BHXF 3OY5U 5EPYA 1ANEA 1GBLA 3MU8A 4UFFH 3STJA 1HDTH 1W13U 4BOHA 1J14A 1IQJA 1GGDC 2LIZA 4X8TH 1MU8B 1FAXA 1F0UA 2FOMB 1O5DH 2PHBA 3KN2A 3TITA 2QXGA 1KDQA 1ABIH 1LPKB 2PGBB 2HPPH 3ZZBA 2GX4A 1O33A 1N1LA 2BQWB 1KXCA 3M36A 1AY6H 2RG3A 2O8MA 4DCDA 2QA9E 3ATKA 1GJDB 5LGOA 1V2WT 1PPCE 3A80A 1DITH 1GWAA 4YOIA 2ZPRA 1E35B 1H4WA 3GY3A 1Z6EA 1HAZB 1Q3XA 2IJOB 4YT7H 3A84A 2VWLA 2ZIQH 4ABFA 2BVXH 1GCDA 2BOHB 3FANA 1LHFH 2R3UA 2Z9KA 1GBFA 2Y5FA 3KQBA 1EZXC 3RM0H 1MBMA 5HYOA 4R0IA 2RA3A 3ZVAA 2BDGA 1K1PA 1CHOG 1FLEE 2VIQA 2BB4A 2PKAA 7ESTE 1HAHH 3A83A 4U30A 3RU4D 2FOFA 2XBYA 3A8BA 3GDVA 2QV1A 1UO6A 2LNCA 3H7TA 1V2VT 5EG4A 1V2QT 4FUBA 1F0SA 1LQEA 5AFZH 1A4WH 1V2LT 1UTOA 3SJ8A 3PLKA 3BIUH 3KGPA 3DFJA 2F9UA 1O2HA 4BTIB 4RN6A 1EZSC 4D8NA 2GD4B 2AIQA 1FI8A 1GBHA 2J2UA 1HAYB 2D26C 2ZTXA 2XCFA 1O2XA 2STAE 1EOJA 1OOKB 3PWBA 1GBJA 1O3BA 1ZRBA 4ESTE 1S6HA 1DSTA 3S7HB 2O8TA 3H7OA 4A1VA 3SBKA 1ARBA 2BD3A 3S9AA 5EQQA 4ISHH 2TGPZ 1C1SA 1EX3A 3DA9B 3TK5A 2LPRA 2ZTYA 1Y3VA 3LH1A 1O3FA 2A4RA 1QCPA 2M5TA 3SU0A 1YCPH 2OTVA 4DOQA 3UNRA 1G3EA 1GG6B 1NY22 1T32A 2ZU3A 5GJ4B 3L6PA 4TPIZ 1T8NA 1NT1A 3TGJE 5C3NA 1FY8E 3CS7A 4O3UA 4AB9A 1O2YA 1DUEA 1FN8A 2R9PA 2UWOA 2ZU1A 4JZ1A 4AFUA 2DE8A 2B5TB 3DT0H 2ANKH 3P70B 4ABIA 1C5QA 3FZDA 3AASA 1DFPA 3QDZB 2BLOA 3ENSB 1UK2A 4U01A 5FX6A 1BDAA 3RXBA 1SGEE 3GY4A 3SJ9A 5T6GA 1GJ7B 4NA7A 1YBWA 4CR5A 2H9HA 5A2MH 1QBVH 1BTWA 1NFUA 1VITH 4XDEA 2I6QA 2PUXB 2PGQB 1YF4A 4NFFA 3SQHE 1XVOA 1UTPA 1O3OA 1C5MD 2FOCA 3ZZDA 1GI6A 2OC1A 3UFAA 5EW1H 1HFDA 4Q7ZA 1O2LA 3EAJA 2TRMA 4NSYA 1EPTC 1TIOA 1TMUH 1HYLA 3T2NA 3BG8A 3L33A 2ZTZA 4BXSA 3TJOA 1N6YA 3MU1A 3D49H 2XBWA 2AH4X 3RLYH 3TH4H 5FXLA 1H9IE 2GCHG 3PO1C 3HK6B 1W11U 2H5CA 2WV4A 2C8XB 1ESBA 4ISNA 4Y11E 1TLDA 4MTBA 3ZZCA 5T6FA 1IQHA 4AORA 5DGJA 2TGDA 4XBBA 4BAOB 3OX7U 4H4FA 7GCHF 1DANH 3QTOH 4B71A 1GDNA 4INLA 1DLKB 5EXNA 3EA7A 4D9RA 3MNSA 3RLWH 1ANBA 4Y79A 1O2SA 1ORFA 1S83A 2O8LA 3SU2A 1QL9A 2A45B 1P2KA 1UCYE 2ZO3H 2J4IA 3K65B 3GCNA 1J17T 4IMZA 5T6DA 3C1KA 1K1IA 1EJMA 1Y5BT 3FP7E 2VGCB 1TPAE 2GP9B 2ZGHA 3FP6E 4GVUA 4DIIH 1THRH 2BYAX 2G5NA 3SV2H 3LGWA 1IQFA 1MKWH 3P8GA 1C1PA 1WU1A 3OY6U 1O3KA 1F0TA 2BY5X 3VPKA 1GBCA 4GLYA 1Z1JA 2YOLA 2ZFTA 2GCTC 3KQEA 1TRMA 2HVXA 1RTKA 1ZHRA 3SV6A 2OQUA 1C5WB 4ISIH 4AFSA 3AW1A 2Z3DA 1QNJA 1VGCC 3A7YA 3FZZA 4I8JA 1CVWH 1PQ8A 2FODA 3F9EA 1GHYH 5CE1A 1V2NT 3SO3A 2VVCA 1T8MA 1C2IA 1WYKA 1P06A 5EU8A 4XBCA 4NWKA 3UPEA 3UNQA 1NRPH 2FI4E 2PSXA 1MBQA 3R0FA 2GGVB 4PROA 8ESTE 3BTGE 2XC0A 5J4QA 1K1NA 1L0ZA 3M5LA 1O32A 2THFB 1K1MA 4UFEH 1UTJA 1G3DA 3RP2A 1EPTA 1MKXH 2VIVA 3SN8A 3RM2H 2XWAA 1O2PA 1GI2A 4Y76A 4CRAA 3V0XA 2J38A 6CHAB 3FAOA 4X6PA 1O2NA 1ZSKA 1D3DB 3B8JA 4A6LA 4GCHF 1XM1A 2J94A 2Y7ZA 1W3CA 1SGIB 3ZVEA 1TGNA 2G55A 3DD2H 1DY8A 2GZ7A 1ANCA 4U32A 3ODFA 3MO3A 3UR6A 1QJ6B 1EUFA 1TWXB 2IOTA 3UWIA 3ZZ8A 2BDAA 4NCYA 1W2KH 3SJIA 4KP0A 2PTNA 2VH0A 3BTFE 1TBQH 3RC6A 3LIWA 1LKAA 1AN1E 1A5IA 1GMDG 4NZLA 1PFXC 4ABJA 1K28D 1ZZZA 1SGNE 4FUIA 1JMOH 4E06H 3RMLH 4AFZA 3ZVCA 4ISLA 1CHGA 5FBEA 3ATIA 1IQKA 3BTKE 5FCKA 1BRBE 1GPZA 1KYNA 3MI4A 3GYLB 1TGSZ 2B9LA 1HIAA 1TNIA 2QF0A 1V2RT 2A4OA 1HAGE 2F83A 1FUJA 2H2ZA 1CA0C 2FX4A 1CGHA 1TE0A 4AYYB 4GHTA 5C1YA 1A3EH 2J34A 2SNWA 1OXGA 3PMJA 1NC6A 2R2MB 3GY7A 4BAHB 1OS8A 1P9SA 1NZQH 1DT2A 5JB8S 3PTNA 1A0HB 4DW2U 2VIPA 1KXDA 4E7NA 3T28A 4WVPE 3TIUA 2ZC9H 2P3UB 4NGAH 1YPEH 1WUNH 1O3LA 5ESTE 3SU1A 3A7XA 3UWJH 4O03A 4X8VH 4FU7A 4XE4A 2IN2A 1YPHE 2FP7B 1C1WH 2PFEA 1C1MA 3UY9A 4ABGA 1UCYK 2FTMA 1GGDB 2C8WB 5ABWA 3KNXA 5C2ZA 1ELBA 1W10U 3MU4A 5HXFA 4H6SB 3LGIA 2P3FH 2XBVA 4DY7B 4JYVH 3D23A 1HNEE 2ALPA 2A7JA 1DWDH 1ZMLA 3LONA 3RXQA 3WY8A 5BRRE 1JWTA 4ZXXH 3TJUA 1AWHB 2OUAA 1SHHB 1NU7B 1GJBB 1C2GA 4YLUA 5TCCA 3E3TA 4MNVA 3DFLA 3MHWU 1YPGH 3RXOA 5L2ZH 1MTUA 3HGPA 1K22H 2H9EH 3KQDA 1DS2E 1ARCA 3ZZ3A 1BT7A 1AGJA 2FPZA 2Z9GA 3MTYA 1NESE 1SPJA 1FZZA 1BTXA 1FNIA 1F5RA 1RFNA 2W26A 1OYQA 5TJXA 3S7KB 4IMQA 4JZDH 1O2JA 2I6SA 1QJ7B 2ULLA 3BV9B 1SLUB 3SNEA 4MPVA 4AX9H 3MFJA 1IQEA 1O2RA 1QQ4A 1C5XB 3V3MA 2CHAB 3BF6H 4GSOA 5EXLA 3GCOA 1PPBH 5EPNA 1TQ7B 2ZGCA 8LPRA 3A8AA 2G8TA 1ZLRA 1AUTC 1TBRH 2ZA5A 2Y81A 2WPIS 3F9GA 1C2LA 1ETRH 2Z94A 2FI3E 6GCHF 3LT3A 1BMAA 1SGCA 4ABHA 1LVBA 4WF8A 3BEFB 1ZMNA 1CSOE 5GIBA 4BANB 1K1OA 1TABE 1HJAB 3NPSA 3U9AH 1C5OH 2OC7A 4ZUHA 3GOVB 3SGBE 1NFXA 3CS0A 1TOMH 4YLQH 1KLIH 3K9XB 4Z0KA 2ZFPH 3RUOA 3VXFH 4NA9H 4O9VA 1HAIH 1G2LA 5FHTA 2J95A 2Z9IA 1YLCA 4K60A 3GCTF 3SHAH 5E2PA 4X6MA 1MTNB 4Z6AH 1BHXB 1DLEA 3PLPA 4DGJA 1S84A 2OD3B 1WTGH 1SOZA 1B0EA 3BEUA 3S0NA 1FV9A 1VITG 1JBUH 4FUCA 5FCRA 1TGCA 2C93B 4D7GA 1GHAG 5F6MA 4HFPB 4GHQA 4GAWA 1GMHF 1PYTD 1ZTJA 2Y5GA 1J9CH 3SV7A 3ZVFA 1UVPA 1PPFE 2GV6A 2VWMA 4DURA 4WXIA 4WMEA 4JCNA 3ESTA 4AG1A 3NZIA 2HOBA 7KMEH 2J9NA 1S81A 3RXUA 5JPMH 4JK5A 2YNAA 2ZECA 4K69A 3QO6A 2ZG0H 4NIYA 3UOUA 3UTUH 1BRAA 3D62A 2WUCA 3TVJB 2FMJA 4RSPA 1DDJA 1LO6A 1Z6JH 4MVNA 5GWZA 3MO9A 4OS6A 1ZGIA 3SU5A 2QN5T 4HZHA 1UK4A 5JBTA 1GVLA 4XFQA 1AE8H 1IQIA 2UUKB 1MQ6A 1DOJA 1ESTA 2ZDLA 1ID5H 1SI5H 1BTHH 3T62A 4U2WA 5E0GA 3TH2H 5AFYH 1KXFA 1OWJA 2STBE 1O0DH 4B2AA 3SNBA 3KCGH 2CV3A 5IYTA 2JH0D 2ZDNA 2FS8A 2UUJB 3OSYA 1O3MA 1O5GH 2SGFE 1D3QB 1SL3A 1EPTB 1CO7E 1TX6A 4K1TA 1EZUC 1FY3A 1GBTA 4CRFA 2Y6TA 1P2JA 3PMAB 1VCQA 4FUGA 1D4PB 3PO1B 5H4IB 3K2UA 3E8LA 1MTVA 3QTVH 1O2IA 4CRGA 1SHYA 2P94A 1DPOA 3KHVA 3RXSA 5E8EH 1O3CA 3KIDU 2PR3A 1TX8A 3ZZ5A 1LHEH 1SQTA 2NU3E 2AFQB 1E34B 2OBQA 1D6RA 1IQGA 1SGYE 3DHKH 3SGAE 2XWBI 1UJ1A 1IAUA 2ESTE 3EQ0H 3Q76A 1LDTT 1C4Y2 1AFQC 4LZ4B 1AB9C 4DT7B 3KEEA 1CU1A 2NU1E 1YPMH 4X1PU 1DVAH 2VIDA 2O9QA 3OU0A 3PMBB 2JH6D 2ZZUH 2V3OH 2WPLS 3RU4E 1FPHH 1GJ8B 1XXDA 2VWOA 1LTOA 4F4OC 4YESB 1BBRH 2VIWA 5LH8A 1O35A 3SV8A 2GCTB 3RXJA 1OWHA 1NRQH 2XNIA 1AD8H 1QL7A 2FEQH 3LKWA 1VGCB 1O5BB 2A2QH 1KXBA 1Z7KA 2CHAC 2UUFB 1ZHPA 1NN6A 2QYIA 5DKMA 1XUJA 4B75A 1C1OA 1Y8TA 3Q3YA 5DG6A 4MPWA 4HGCA 3M37A 2FLBH 5C20A 3ZZ7A 1ZR0A 2QIQA 1SVPA 3QZQA 2O8UA 1QBNA 2W3IA 4IW4E 4SGAE 2FESH 4I33A 3AVZA 1SLVB 4CREA 2BDYA 4VGCC 2VVVA 4QT8C 3EE0B 4Q2KA 5L6NH 1HJAC 3M7TA 3RXLA 1LCYA 5AVDA 4JMYA 1C5PA 3LGVA 1EP6A 2SFAA 3ATLA 3EDXB 1L2EA 4NFEA 1O2WA 1DY9A 3Q3XA 3O8BA 1L1GA 2F9BH 2BZAA 1YKTA 1MTNC 1HAOH 2ZPSA 1MD7A 1HAVA 2ZP0H 3URCA 4J2YB 1C5YB 1S0RA 1C2DA 3W94A 1C9PA 3SNCA 2FIRH 2D2DA 1EAWA 2C90B 1ZOMA 1D3PB 4X6NA 2G52A 5K0HA 4IN2A 2QAAA 1C2JA 3BTDE 2TPIZ 2ZU4A 4ZAEA 1MAYA 2A5IA 1AWFH 4OS5A 3U69H 1A5GH 1TONA 2B7DH 1A2CH 1OP2A 4O3TA 3RXMA 4CRDA 1O34A 3ZZ6A 1XUGA 1FIWA 1F92A 5JBBS 1CA0B 2UWPA 5L2YH 2QXIA 2NWNA 1UVSH 2VU8E 1YPLH 4AN7A 2XBXA 1ZTKA 1XKBC 1FXYA 1NROH 2HGTH 5CHAC 2BQ7B 5C67A 3VB7A 5JBCS 1F2SE 2PUQH 4ZXYH 3U98H 7GCHG 2KAIA 4JYUH 3RXTA 2FOHA 2W7UA 2ILNA 1G36A 1RXPA 1V6DA 4DG4A 1MZAA 3BIVH 5A8ZA 3RMOH 4NIWA 2UWLA 4KELA 1HUTH 2ZDAH 4NG9H 1WV7H 2FOGA 2ZHFH 4IBLH 4FXGH 2BOKA 1OP0A 5A0AE 1UTMA 3QX5H 3PV4A 1S82A 1ZMJA 3A81A 2OLGA 3ZZ9A 1NPMA 1ZSLA 1EQ9A 1O2OA 1MTWA 1FY4A 1P11E 3M5OA 3M7QA 1PQAA 4Y10E 2FM2A 2B8OH 3B9FH 3E0PB 1GCTC 2R2WU 3GY6A 2A4QA 2FDAA 3UQOA 2ZU5A 1G3CA 3HKIB 2F9NA 8GCHF 1ELCA 4B73A 3TJNA 3VGCC 1WTHD 2GVFA 1ELDE 2ODPA 2ZNKH 3H5CB 2BXUH 4THNH 2A32A 5EQRA 1HJ8A 2ZFSA 2G51A 1PPEE 1O30A 4LK4A 2G4TA 1TPPA 5DP3A 1A7SA 2RA0A 1SGDE 3RMMH 3A89A 4NSVA 6LPRA 3QN7A 3V13A 3BTEE 4I8LA 1AKSA 3SQEE 1QJ1B 5A09A 2GTBA 1ABJH 3NXPA 1O5CB 1FJSA 4CRCA 4WH8A 2OBOA 3ZV8A 5AHGH 1V2OT 1INCA 4CBNA 4GCHG 1YYY1 4AOQA 2VVUA 5SGAE 1RD3B 1YPHC 3T25A 1P2OA 3SJOA 3CP7A 4Y7AA 2ZDVH 2VIOA 1O2TA 1OWEA 1B0FA 2EI8A 1AQ7A 1GVKB 1AFEH 3T27A 1CGJE 1C5NH 4JZFH 1UTKA 1TGBA 1GBDA 1LQDB 4NZQA 1AZ8A 2BY6X 3M35A 2ANWA 1BTZA 1TMBH 1P03A 1O36A 1C5TA 2GZ8A 4UD9H 2H1UA 3VEQB 3F9FA 3G01A 1OWIA 4TWYA 3T26A 3U1IB 3M3TA 1C9TA 3BTTE 2PKSB 3C27B 1SGFA 1C1TA 4D9QA 3S9BA 2BD8A 1W7XH 2BHGA 1A61H 3QK1A 1NTPA 3A87A 1Z8JB 1O2VA 4I8KA 3SOSA 1VJAU 4MDSA 3O8DA 3R3GB 3TPIZ 3QZRA 1CBWC 2Y82A 4JZIA 1T31A 1KDQB 3PWCA 1F7ZA 1P2IA 1BUIA 2PTCE 2TGAA 1TNHA 1PQ7A 2G5VA 1C5SA 3EGKH 2P59A 4M7GA 3MH7A 5GDSH 1YLDA 1K21H 5A8YA 1UVTH 5AF9H 4Y7BA 1GHXH 1YCPK 1NO9H 3T29A 3RXVA 5CMXH 2SGPE 4BTUB 1G37A 3S69A 1XMNB 3IITA 1QIXB 1QTFA 2BDHA 2FO9A 1JRSA 3RXIA 4ZH8A 3OTJE 1DE7H 1ZGVA 1VCPA 2QXJA 1G30B 1G9IE 2AGIX 2GZ9A 1EB1H 3ZVBA 2Z3CA 3TK9A 5DJ7A 2BM2A 1QRZA 1O3DA 1E38B 4OGXA 1SR5C 5EOKA 3ZYDA 2Q6GA 1OWKA 1J16A 2PKAB 3MNXA 3ZZ4A 4MLFB 2F9OA 1O3EA 2XYAA 4TPYA 2ASUB 1FAKH 4IS5A 5B6OA 2QY0B 2FZZA 3RDZA 1LVYA 1KY9A 1PPZA 1GHZA 3GDSA 1O31A 1C2EA 2AS9A 5A8XA 1P2QA 3SU6A 1GI7B 2PV9B 1P3CA 3PROA 1XX9A 2FOBA 1ELVA 2OC8A 4A1TA 2AMDA 3BG4B 3NK8A 2AMQA 3SUDA 1QY6A 3GY5A 3HK3B 1LHDH 1SGTA 3L3TA 2EC9H 1K2I1 1NRSH 2JETB 1DWCH 2BVRH 1FY1A 2HRVA 1V2TT 1H8DH 2Y80A 5EW2H 1NFYA 5DP5A 2JH5D 2D8WA 2W7SA 4CRBA 1AHTH 1HAVB 1TOCB 2ANYA 2A0QB 2OXSA 1AFQB 2CF9H 1AB9B 3BTQE 2ZDKA 1ZJKA 2ZGXH 1EB2A 4TYDA 1DSUA 3A8CA 1BZXE 1OX1A 4UEHH 3EBNA 2XXLA 5F03A 6GCHG 1AVXA 3A85A 4AGKA 2PW8H 3QLPH 4X1QU 1DUAA 1JOUB 3TU7H 1SGRE 3P8OA 4FU9A 1TRNA 1O38A 5GXPA 1HGTH 4ZHAA 3PMHB 4KTUA 2F3CE 1SLWB 5G4BA 1NS3A 4K1SA 1LVMA 2H5DA 3NWUA 1O3IA 3VB4A 1TAWA 1MKWK 4FVDA 1D9IA 2BD2A 3RXKA 4A5TS 3A7TA 2W3KA 1GBIA 2GDDA 3FVFB 4FUJA 3UOPA 1GJ5H 4ZMAH 3GCTG 1OPHB 1HV7A 2XCNA 1KLTA 4BAQB 3IWMA 3Q77A 1GBEA 3ZV9A 1P8VC 1AVWA 5E0HA 1EAUA 2SGEE 2F9PA 3FFGA 2KAIB 3B23B 1QB6A 3M3SA 1ANDA 1GI5A 5FBIA 1ZYOA 1CE5A 1GHBF 2P3TB 3W95A 1W8BH 5DP7A 1QRXA 4J1YA 3M3VA 1GMHG 4VGCB 5DO4H 3SV9A 1D3TB 2V3HH 1DM4B 1G2MA 2C8YB 2WPMS 1GDUA 2BY9X 2PKSC 4DJZB 1MKXK 2XC4A 3HATH 3K6YA 5GCHF 1XUHA 1E0FD 1BCUH 3HKJB 3RMNH 4CHAC 4Q7XA 5T3HA 3SI4H 2WINI 1BRUP 1HAPH 3P17H 1VR1H 2BD7A 2GMTB 1BQYA 2BDCA 2FX6A 1Q31A 1BJVA 2A5KA 2QGRA 1E36B 3A88A 1BTUA 1WAYB 1DICA 1T7CA 5IDKA 4YO9A 1P02A 1WQSA 1SLXB 2A4GA 1ETSH 3ELAH 4IC5A 1GI9B 1BMMH 2GV7A 1M9UA 3GCHC 1SG8B 1A46H 1K1JA 1GI4A 2WYJA 1K1LA 1C2HA 3BEIB 3ZZAA 3SW2B 3Q3KA 5DP6A 1TRYA 1W7GH 3LU9B 2VWNA 4X2XA 4INHA 5LPRA 4IN1A 1O2UA 1TA2A 4ABAA 2WUBA 4WJG2 1CT2E 2ZCLP 1AKSB 2BD4A 2ZFRH 1G3BA 1E37B 1FY5A 1THSH 4XOJA 5ESBA 4ABBA 2VH6A 2ODQA 3MO6A 3LPRA 2ZKSA 4Y71A 2BVSH 3UUZA 3RXPA 4BNRA 1B7XB 1YM0A 1CT4E 2P8OC 5CHAB 1SBWA 1TQ0B 2FOEA 3PTBA 2PLXA 2CN0H 1P12E 4ABEA 4CBOA 1K9OE 1ACBE 1BB0B 1ELFA 5L30H 1PQ5A 2F9VA 3ATWA 1GMCF 1WBGB 5HM9A 5FPSA 1HBTH 1LKBA 1H8IH 5F8TA 3A7VA 1C1RA 3AAUA 1WQVH 1C5LH 1FIZA 4DVAU 4MG3A 1KTTB 2Z7FE 1V2JT 3BG4C 2A7CA 2ZGJA 3P8FA 1BRCE 2K1QA 3TNTA 1LHCH 2JETC 3E0NB 2ANMH 4AGJA 1TB6H 1LVOA 2J92A 1HJ9A 1Y3UA 1UVOA 3SU3A 4WMDA 3I78A 2AERH 4X2VA 4JZEH 3VB6A 1A5HA 2ZHWH 1GCTB 4H6TA 3F1SB 4LXBH 1GJ9B 1V3XA 2FS9A 1KLJH 3RXGA 1MUEB 4MPXA 1XUFA 1C1QA 3E1XB 1GL1A 1XUIA 2VB0A 4A7IB 1P2NA 9LPRA 4F49A 2ZHQH 3VGCB 1HAXB 3SZNA 3V12A 1GL0E 5FAHA 1W14U 4WWYA 1SGFG 5PTPA 2CF8H 1Y59T 1IHTH 1EJNA 1MZDA 1O2MA 3RXRA 4GPGA 4NIXA 4YZUA 4KGAA 4Y8YA 1HIAB 1V2ST 3QGNB 1JRTA 4UFDH 1NRNH 4CR9A 5I46H 4K3JA 3O8RA 2SGDE 4AB8A 1QB1A 2BY8X 2ZU2A 1F5KU 3I29A 4X6OA 4I7YH 1H9HE 3F68H 1WCZA 3PLBA 2GKVE 1QFKH 3JZ1B 4FUHA 1SB1H 4A92A 1AVGH 2ZWLH 3BTWE 1C5UA 1UTNA 3SUFA 1QA0A 2XRCA 3LGTA 1XVMA 3A82A 2AMPA 1O3NA 3SUEA 2QXHA 5EODA 4ZKOU 1BBRE 1AUJA 1RRKA 2ZGBH 2A5AA 1EP5A 1P0SH 4GUXA 4XBDA 3MYWA 4X8UH 3TNSA 5HGGA 1EATA 1WOFA 2WV5A 3N7OA 1MCVA 1CBWB 1HLTH 1TPSA 5FPTA 1C1UH 1ELGA 1P2MA 2GMTC 2BXTH 1UK3A 2H6MA 1C5RA 1UTLM 1J15A 4WXVA 1GVZA 1FMGA 1A1RA 3GYMA 1GI3A 3OYPA 3P95A 2FLRH 4FUDA 4ZKSU 4B2CA 2FI5E 4OS7A 1TNGA 3SNAA 1P3EA 1VJ9U 1CHOF 2PSYA 1C1NA 1C4V2 1IHSH 3RU4T 3Q00A 4I8HA 2Q6DA 4D76A 2QC2A 1MQ5A 1S5SA 4LZ1H 2V0BA 1J8AA 1FONA 4WMFA 3NCLA 2D1JA 2ZQ1A 5C1UA 2AIPA 5C5NA 1UTQA 1RIWC 1BTYA 1C5ZB 1GBKA 3RXHA 2XW9A 3LJJA 4KTCA 1VZQH 1QA7A 1GJCB 5K7RA 4NIVA 2FYQA 1CA8B 4ZHMU 4MNWA 2WYGA 1YGCH 2B0FA 2VNTA 3MNBA 2BDBA 1ESAA 3BTHE 5LPFA 4K1EA 1SC8U 5I25A 2JKHA 1SMFE 1MU6B 5BPEA 1UHBA 3STIA 3S9CA 3MU5A 4K2YA 3VB3A 1QQUA 1D6WA 4JYTA 5HM2A 4YM9A 1S85A 5A0CA 8GCHG 3ITIA 3AW0A 2ZHDA 2H9TH 8KME2 1EXFA 1T4VH 4FUFA 2FTLE 4KTSA 1YP9A 4WH6A 3P8NA 5E0JA 1O5FH 6ESTA 2EEKA 3TJVA 1W0YH 3T5FH 1QGFA 2ZPQA 2DE9A 1BOQA 3LC5A 1Y3WA 2Q6FA 1UCYH 1O3PB 2PWXA 1AZZA 1O2QA 1N8OC 4UONA 2VINA 2GT8A 1P01A 1ZSJA 1P57B 4AZ2B 4I31A 3EA9A 2ZQ2A 1V2KT 1F0RA 3GISB 4X1NU 2OCVB 4MNYA 2BDIA 4X0WU 3O8CA 1RJXB 3GY8A 3RXFA 1HB0B 3JZ2B 2CJIA 1JXPA 2C3SA 2FYRA 1S6FA 4FU8A 4I8GA 4K8BA 1DWBH 3U8TH 1WSSH 4XSKU 3KF2A 1EAIA 5TCAA 1BBRK 1O3JA 1BA8B 1G32B 2BY7X 4YT6H 1PPHE 1LHGH 2GCHF 3SNDA 4CH8B 2R0KA 2FWWA 4FUEA 2QF3A 2HALA 3UNSA 3PB1E 4IC6A 4Q80A 4RKJB 2Z9JA 2V35A 2FXRA 3DUXH 1TNLA 3LGYA 1O39A 2ZF0H 2FOAA 2G4UA 3A7WA 4YOJA 2IPHA 5C5OA 1OWDA 1L1JA 2OQ5A 2HNTF 1TNJA 2AYWA 1BITA 5DK1A 1ELEE 4MQAA 2Z9LA 4Y6DA 2VJ1A 3A7ZA 2ZFFH 1QRWA 4X8SH 5EQSA 1NM6A 1LPGB 2SNVA 2P95A 1C2KA 4Q7YA 2ODYB 1JIRA 3KL6A 1Y3YA 3VB5A 4IGDA 3A8DA 3M61U 4HTCH 4A1XA 4YTAA 4CHAB 1SFIA 2A7HA 2C4FH 2A31A 1C2FA 1OKXA 4R8TB 1MH0A 1VCWA 3U1JB 4K5ZA 5GPIB 3RXCA 4KKDA 3UIRA 4TWWA 3LJOA 1SFQB 2AGEX 1O5EH 3E16B 1O37A 2NU0E 1W0ZU 1BJUA 1Z8GA 2QCYA 2V6NA 2A2XH 1O2ZA 3GCHB 3MOCA 4OGYA 1BTPA 3LOXA 5E2OA 2BX3A 4ABDA 1LMWB 4BAMB 1EASA 5JDUB 1RGQA 1L1NA 2ZCHP 2ZCKP 1N6XA 5LPEA 1O3HA 3I77A 1GJ4H 4X1RU 3UQVA 3M5MA 4X1SU 1TBZH 1O3AA 3TLOA 2BX4A 1ZHMA 1S0QA 2SGAA 2WPJS 1QR3E 1ZJDA 1GG6C 2RCEA 4H42U 4AYVB 1C2MA 4CH2B 1SSXA 3TGIE 1MMJN 1HXFH 1XUKA 4AG2A 4FVBA 3TK6A 1U6QA 1EAXA 2BLVA 3MH6A 3GY2A 1ELAA 1O2GH 5F8XA 2P8OB 2XTTB 3UREA 1MCTA 2Z3EA 1HXEH 4B74A 5A0BA 1PYTC 1GHWH 1Z8IB 3SU4A 1BMLA 3MWIU 5DPAA 1AIXH 4HI3A 3SJKA 4DIHH 4MNXA 1LPZB 1H9LB 3AAVA 3SUGA 1P10A 2ZEBA 3LC3A 1TYNA 1EOLA 5JBAS 1YCPM 1GMDF 2R0LA 2AGGX 3KQCA 2ZHEH 2F91A 4ZKRU 1O5AB 1YPJH 1YPKH 1MD8A 2OP9A 3M5NA 2G00A 1AE5A 1O3GA 4ZKNU 1GDQA 1DXWA 1SGPE 2HLCA 2HNTC 1IOEA 1V2UT 1UMAH 1IQLA 2Z6BD 3BN9A 2BZ6H 3GICB 3ZYEA 4B76A 5DP9A 1AI8H 4Y0ZE 3RXAA 1TA6A 1SQAA 3QUMP 1L4ZA 2BD9A 4UDWH 1DXPA 4Y8XA 4K8YA 1Z71A 3RC5A 5DP8A 4NA8A 3SI3H 5C1XA 2ZDMA 5ETXA 1L4DA 1A3BH 4ISOA 1SOTA 5FPYA 2ZI2H 2G81E 3E90B 3SORA 3NKKA 4MPUA 1XXFA 1QL8A 1RTLA 3LGUA 1P05A 1C4U2 3A86A 1RS0A 1C5VA 1TFXA 4UFGH 1Y5AT 1UVUH 1GHBG 1QHRB 3K6ZA 5JYIA 1GI0A 1FQ3A 1F5LA 4OS2A 3ZVGA 2OINA 2EI6A 1SQOA 1X7AC 2BLQA 3PM3A 4OS4A 1BMNH 2P93A 4B2BA 1NFWA 2GDEH 1HPGA 3HPTB 2P16A 1W12U 2CXVA 3TGKE 5GCHG 1GJAB 1CT0E 2TGTA 2TBSA 2BLWA 1DX5M 1Y3XA 2VGCC 1NRRH 4UE7H 2K7XA 1HCGA 2HWLB 2WPKS 1DWEH 3MNCA 1TGTA 4BTTB 2Y7XA 4ZHLU 1SGQE 2BTCE 3RXDA 1Z1IA 2RDLA 1UHBB 4Y0YE 1XKAC 1QURH 2Y5HA 3D65E 3GDUA 1GI1A 1T4UH 2R3YA 4YOGA 5EXMA 3ZVDA
chains in the Genus database with same CATH superfamily
2NU4E 3SHCH 1OP8A 4O97A 2ZFQH 4ASHA 4JK6A 3EYDA 1KXAA 1A0JA 3EA8A 1A0LA 1NBMD 3ODDA 4RT1A 3F6UH 2C8ZB 4X2WA 1GHVH 1ZTLA 1AU8A 5B6LA 1ZPBA 4B1TA 3LH3A 1GBAA 1FDPA 1AMHA 3HGNA 1KXEA 3SGQE 2EA3A 2JIZD 2CGAA 4BXWA 3V7TA 4RKOB 1TX7A 1MAXA 3VXEH 6CHAC 1Q2WA 3N99A 1QBOA 1OYTH 2AEIH 3NUMA 1EKBB 2BQ6B 2ALVA 1P04A 2O8WA 2DUCA 4ZROA 1YC0A 1ZPCA 5HIZA 1FPCH 3QGJA 5HMAA 3E91A 3MU0A 1ELTA 1OSSA 1TPOA 2HNTE 3VFEA 1Y5UT 5DP4A 1PJPA 3FOAA 1KIGH 3BTME 1GMCG 1GBBA 2HPQH 5JB9S 1CQQA 1H8HD 4INKA 3MH4A 3MH5A 1ZPZA 1RIWB 2NU2E 4ZCNA 7LPRA 3PYHA 3P92A 1ETTH 1HRTH 1JIMA 1V2MT 1ZRKA 4X2YA 1THPB 2EI7A 2XC5A 3URDA 1H1BA 5C17A 1EJAA 4E7RG 2GT7A 4D7FA 1KTSB 3F9HA 1TMTH 1CGIE 1TALA 3ATMA 3KYGA 1GJ6A 1IQNA 5J4SA 1MTSA 3QWCH 4BAKB 2BD5A 2SGQE 1NU9A 3CENA 4OS1A 1PPGE 3BSQA 4E05H 1FN6A 2OC0A 2TIOA 1O2KA 3OAAD 1T8LA 3TH3H 4Y8ZA 2A1DB 1AO5A 3FP8E 1C1VH 1VITF 5FX5A 1GBMA 4I32A 1GHAF 3E6PH 1TNKA 1V2PT 2WPHS 3P6ZB 1QB9A 2CMYA 1IQMA 3LDXH 2UUYA 9ESTA 1EZQA 1T8OA 3U8RH 3MMGA 3RXEA 1BIOA 2Q1JA 4WY3A 4SGBE 2YNBA 2W5EA 1RTFB 2BMGB 3UR9A 4LOYH 3M7UA 3IG6B 4TY7A 1GI8B 1P9UA 4TY6A 4AFQA 3U8OH 1B5GH 1N8OB 1KSNA 5EGMA 1P09A 5F8ZA 4NWLA 3RC4A 1Z8RA 1BHXF 3OY5U 5KGOA 5EPYA 1ANEA 1GBLA 3MU8A 4UFFH 3STJA 1HDTH 1W13U 4BOHA 1J14A 1IQJA 1GGDC 2LIZA 4X8TH 1MU8B 1FAXA 1F0UA 2FOMB 1O5DH 2PHBA 3KN2A 3TITA 2QXGA 1KDQA 1ABIH 1LPKB 2PGBB 2HPPH 3ZZBA 2GX4A 1O33A 1N1LA 2BQWB 4ASUD 1KXCA 3M36A 1AY6H 2RG3A 2O8MA 4DCDA 2QA9E 3OTPA 3ATKA 3U28C 1GJDB 5LGOA 1V2WT 3F2GA 1PPCE 3A80A 4HG6A 1DITH 1GWAA 4YOIA 2ZPRA 1E35B 1H4WA 3GY3A 1Z6EA 1HAZB 1Q3XA 2IJOB 4YT7H 3A84A 2VWLA 2ZIQH 5CHBA 4ABFA 2BVXH 1GCDA 2BOHB 3FANA 1E79D 1LHFH 2R3UA 2Z9KA 1GBFA 2Y5FA 3KQBA 1EZXC 3RM0H 1MBMA 5HYOA 4R0IA 2RA3A 3ZVAA 2BDGA 1K1PA 1CHOG 1FLEE 2VIQA 3EE7A 2BB4A 2PKAA 7ESTE 1HAHH 3A83A 4U30A 3RU4D 2FOFA 2XBYA 3A8BA 3GDVA 2QV1A 1UO6A 2LNCA 3H7TA 1V2VT 5EG4A 1V2QT 4FUBA 1F0SA 1LQEA 5AFZH 1A4WH 4B6EA 1V2LT 1UTOA 3SJ8A 3PLKA 3BIUH 3KGPA 3DFJA 2F9UA 1O2HA 4BTIB 4RN6A 1EZSC 4D8NA 2GD4B 2AIQA 1FI8A 1GBHA 2J2UA 1HAYB 2D26C 2ZTXA 2XCFA 1O2XA 2STAE 1EOJA 1OOKB 3PWBA 1GBJA 1O3BA 1ZRBA 4ESTE 1S6HA 1DSTA 3S7HB 2O8TA 3H7OA 4A1VA 3SBKA 1ARBA 3FN8A 2BD3A 3S9AA 5EQQA 4ISHH 2TGPZ 1C1SA 1EX3A 3DA9B 3TK5A 2LPRA 2ZTYA 1Y3VA 4AC9A 3LH1A 1O3FA 2A4RA 1QCPA 2M5TA 3SU0A 1YCPH 2OTVA 4DOQA 3UNRA 1G3EA 1GG6B 1NY22 1T32A 2ZU3A 5GJ4B 3L6PA 4TPIZ 1T8NA 1NT1A 3OFND 3TGJE 5C3NA 1FY8E 3KQ5A 3CS7A 4O3UA 4AB9A 1O2YA 1DUEA 1VKYA 1FN8A 2R9PA 2UWOA 2ZU1A 4JZ1A 4AFUA 2DE8A 2B5TB 3DT0H 2ANKH 2XNDD 3P70B 4ABIA 1C5QA 3FZDA 3AASA 1DFPA 3QDZB 2BLOA 3ENSB 1UK2A 4U01A 5FX6A 1BDAA 3RXBA 1SGEE 3GY4A 3SJ9A 5T6GA 1GJ7B 4NA7A 1YBWA 4CR5A 2H9HA 5A2MH 1QBVH 1BTWA 4FOUC 1NFUA 1VITH 4XDEA 2I6QA 2PUXB 2PGQB 1YF4A 4NFFA 3SQHE 1XVOA 2RDEA 1UTPA 1O3OA 1C5MD 2FOCA 3ZZDA 1GI6A 2OC1A 3UFAA 5EW1H 1HFDA 4Q7ZA 1O2LA 3EAJA 3WWFA 2TRMA 4NSYA 1EPTC 1TIOA 1TMUH 2J5UA 1HYLA 3T2NA 3BG8A 3L33A 2ZTZA 4BXSA 2XOKD 3TJOA 1N6YA 3MU1A 3D49H 2XBWA 2AH4X 3RLYH 3TH4H 5FXLA 1H9IE 2GCHG 3PO1C 3HK6B 1W11U 2H5CA 2WV4A 3FKSD 2C8XB 1ESBA 4ISNA 4Y11E 1TLDA 4MTBA 3ZZCA 5T6FA 1IQHA 4AORA 5DGJA 2TGDA 4XBBA 4BAOB 3OX7U 4H4FA 7GCHF 1DANH 3QTOH 4B71A 1GDNA 4INLA 1DLKB 5EXNA 3EA7A 4D9RA 3MNSA 3RLWH 3FO8D 1ANBA 4Y79A 1O2SA 1ORFA 1S83A 2O8LA 3SU2A 1QL9A 2A45B 1P2KA 1UCYE 2KCAA 2J4IA 2ZO3H 3K65B 3GCNA 1J17T 4IMZA 5T6DA 3C1KA 1K1IA 1EJMA 1Y5BT 3FP7E 2VGCB 1TPAE 2GP9B 2ZGHA 3FP6E 4GVUA 4DIIH 1THRH 2BYAX 2G5NA 3SV2H 3LGWA 1IQFA 1MKWH 3P8GA 1C1PA 1WU1A 3OY6U 1O3KA 1F0TA 2BY5X 3VPKA 1GBCA 4GLYA 3DSGA 1Z1JA 2YOLA 2ZFTA 2GCTC 3KQEA 1TRMA 2HVXA 1RTKA 3F2HA 1ZHRA 3SV6A 2OQUA 1C5WB 4ISIH 2YMSC 3AW1A 2Z3DA 4AFSA 1QNJA 1VGCC 3A7YA 3FZZA 4I8JA 1CVWH 1PQ8A 2FODA 3F9EA 1GHYH 5CE1A 1V2NT 3SO3A 2VVCA 1T8MA 1C2IA 1WYKA 4OM9A 1P06A 5EU8A 4XBCA 4NWKA 5EJLA 3UPEA 3UNQA 1NRPH 2FI4E 2PSXA 1MBQA 3R0FA 2GGVB 4PROA 8ESTE 3BTGE 2XC0A 5J4QA 1K1NA 1L0ZA 3M5LA 1O32A 2THFB 1K1MA 4UFEH 1UTJA 1G3DA 3RP2A 1EPTA 1MKXH 3PV2A 2VIVA 3SN8A 3RM2H 4Q4LA 2XWAA 1O2PA 1GI2A 4Y76A 4CRAA 3V0XA 2J38A 6CHAB 3FAOA 4X6PA 1O2NA 1ZSKA 1D3DB 3B8JA 4A6LA 4GCHF 1XM1A 2F4LA 2J94A 2Y7ZA 1W3CA 1SGIB 3ZVEA 1TGNA 2G55A 3DD2H 1DY8A 2GZ7A 1ANCA 5EJ1A 4U32A 3ODFA 3MO3A 3UR6A 1QJ6B 1EUFA 1TWXB 2IOTA 3UWIA 3ZZ8A 2BDAA 4NCYA 1W2KH 3SJIA 4KP0A 2PTNA 2VH0A 3BTFE 1TBQH 3RC6A 3LIWA 1LKAA 1AN1E 4M9FA 1A5IA 1GMDG 4NZLA 1PFXC 4ABJA 1K28D 1ZZZA 1SGNE 4FUIA 1JMOH 4E06H 3RMLH 4AFZA 3ZVCA 4ISLA 1CHGA 5FBEA 3ATIA 1IQKA 3BTKE 5FCKA 1BRBE 1GPZA 1KYNA 3MI4A 3GYLB 1TGSZ 2B9LA 1HIAA 1TNIA 2QF0A 1V2RT 2A4OA 1HAGE 2F83A 1FUJA 2H2ZA 1CA0C 2FX4A 4RI0A 1CGHA 1TE0A 4AYYB 4GHTA 5C1YA 1A3EH 2J34A 2SNWA 1OXGA 4B6FA 3PMJA 1NC6A 2LELA 2R2MB 3GY7A 4BAHB 1OS8A 1P9SA 1NZQH 1W0JD 1DT2A 5JB8S 3PTNA 1A0HB 4DW2U 3N7EA 2VIPA 1KXDA 4E7NA 3T28A 4WVPE 3TIUA 2ZC9H 2P3UB 4NGAH 1YPEH 1K0HA 1WUNH 1O3LA 5ESTE 2KCPA 2KM0A 3A7XA 3SU1A 3UWJH 4O03A 4X8VH 4FU7A 4XE4A 2IN2A 1YPHE 2FP7B 1C1WH 2PFEA 1C1MA 3UY9A 4ABGA 1UCYK 2FTMA 1GGDB 5KECA 2C8WB 5ABWA 3KNXA 5C2ZA 1ELBA 1W10U 3MU4A 5HXFA 4H6SB 2HVYB 3LGIA 2P3FH 2XBVA 4DY7B 4JYVH 3D23A 1HNEE 3OE7D 2ALPA 2A7JA 1DWDH 1ZMLA 3LONA 3RXQA 3WY8A 5BRRE 1JWTA 4ZXXH 3TJUA 1AWHB 2OUAA 1SHHB 1NU7B 1GJBB 1C2GA 4YLUA 5TCCA 2WSSD 2KR7A 3E3TA 4MNVA 3DFLA 3MHWU 1YPGH 3RXOA 5L2ZH 1MTUA 3HGPA 1K22H 2H9EH 3KQDA 1DS2E 1ARCA 3ZZ3A 1BT7A 1AGJA 2FPZA 2WPDD 2Z9GA 3MTYA 1NESE 1SPJA 1FZZA 1BTXA 1FNIA 1F5RA 1RFNA 2W26A 1OYQA 5TJXA 1NBME 3S7KB 4IMQA 4JZDH 1O2JA 2I6SA 1QJ7B 2ULLA 3BV9B 2KX4A 1SLUB 3SNEA 4MPVA 4AX9H 3MFJA 1IQEA 1O2RA 1QQ4A 2L74A 1C5XB 3V3MA 2CHAB 3BF6H 4GSOA 5EXLA 3GCOA 1PPBH 5EPNA 1TQ7B 2ZGCA 3PRDA 8LPRA 3A8AA 5KEDA 2G8TA 1ZLRA 1AUTC 1TBRH 2ZA5A 2Y81A 2WPIS 3F9GA 1C2LA 1ETRH 2Z94A 2FI3E 6GCHF 3LT3A 1BMAA 1SGCA 4ABHA 1LVBA 4WF8A 2VBCA 3BEFB 1ZMNA 1CSOE 5GIBA 4BANB 1K1OA 1TABE 1HJAB 3NPSA 4P02A 3U9AH 1C5OH 2OC7A 4ZUHA 3GOVB 3SGBE 1NFXA 1OHHD 3CS0A 1TOMH 4YLQH 1KLIH 3K9XB 4Z0KA 2ZFPH 3RUOA 3VXFH 4NA9H 4O9VA 1HAIH 1WXRA 1G2LA 5FHTA 2J95A 2Z9IA 1YLCA 4K60A 3GCTF 3SHAH 5E2PA 2IJD1 4DT4A 4X6MA 3DSPA 1MTNB 3SZEA 4Z6AH 1BHXB 2JJ1D 5HKKD 1DLEA 3PLPA 4DGJA 1S84A 2OD3B 1WTGH 1SOZA 1B0EA 3BEUA 3S0NA 1FV9A 1VITG 1JBUH 4FUCA 5FCRA 1TGCA 2C93B 4D7GA 1GHAG 5F6MA 4HFPB 3UB0A 4GHQA 4GAWA 1GMHF 1PYTD 1ZTJA 2Y5GA 1J9CH 3SV7A 3ZVFA 1UVPA 2QE7D 1PPFE 2GV6A 2VWMA 4DURA 4WXIA 4WMEA 4JCNA 3ESTA 4AG1A 3NZIA 2HOBA 7KMEH 2J9NA 1S81A 3RXUA 5JPMH 4JK5A 2YNAA 2ZECA 4K69A 2KCYA 3QO6A 2ZG0H 4NIYA 3UOUA 3UTUH 1BRAA 3D62A 2WUCA 3TVJB 2FMJA 4RSPA 1DDJA 1LO6A 1Z6JH 4MVNA 5GWZA 3MO9A 4OS6A 1ZGIA 3SU5A 2QN5T 4HZHA 1UK4A 5JBTA 1GVLA 4XFQA 1AE8H 2JDID 1IQIA 5HIYA 2UUKB 1MQ6A 1E1QD 1DOJA 1ESTA 2ZDLA 1ID5H 1SI5H 2HLDD 3N7DA 1BTHH 3T62A 4U2WA 5E0GA 3TH2H 5AFYH 1KXFA 1OWJA 2STBE 1O0DH 4B2AA 3SNBA 3KCGH 2CV3A 5IYTA 2JH0D 2ZDNA 2FS8A 2UUJB 3OSYA 1O3MA 1O5GH 2SGFE 1D3QB 1SL3A 1EPTB 2RFKC 1CO7E 1TX6A 4K1TA 2EQNA 1EZUC 1FY3A 1GBTA 4CRFA 2Y6TA 1P2JA 3PMAB 1VCQA 4FUGA 1D4PB 3PO1B 5H4IB 3K2UA 3E8LA 1MTVA 3QTVH 1O2IA 4CRGA 1SHYA 2P94A 1DPOA 3KHVA 3RXSA 5E8EH 1O3CA 3KIDU 2PR3A 1TX8A 3ZZ5A 1LHEH 1SQTA 2NU3E 2AFQB 1E34B 2OBQA 1D6RA 1YY3A 1IQGA 1SGYE 3DHKH 3SGAE 2XWBI 1UJ1A 1IAUA 2ESTE 3EQ0H 3Q76A 1LDTT 1C4Y2 1AFQC 4LZ4B 1AB9C 4DT7B 3KEEA 1CU1A 2NU1E 1YPMH 4X1PU 1DVAH 2VIDA 2O9QA 3OU0A 3PMBB 3MQKC 2JH6D 2ZZUH 2V3OH 2WPLS 3RU4E 1FPHH 1GJ8B 1XXDA 2VWOA 1LTOA 3UAIC 4F4OC 4YESB 1BBRH 2VIWA 5LH8A 1O35A 3SV8A 2CK3D 2GCTB 1EFRD 3RXJA 1OWHA 5CDFE 1NRQH 2XNIA 1AD8H 1QL7A 2FEQH 2YMSB 3LKWA 1VGCB 1O5BB 2A2QH 1KXBA 2JJ2D 1Z7KA 2CHAC 2UUFB 1ZHPA 1NN6A 2QYIA 4P00A 5DKMA 1XUJA 4B75A 1C1OA 1Y8TA 3Q3YA 5DG6A 4MPWA 4HGCA 3M37A 2FLBH 2W6ID 5C20A 3ZZ7A 3F0OA 1ZR0A 2QIQA 1SVPA 3QZQA 2O8UA 1QBNA 2W3IA 4IW4E 4SGAE 2FESH 4I33A 3AVZA 1SLVB 4CREA 3DSOA 2BDYA 4VGCC 2VVVA 4QT8C 3EE0B 4Q2KA 5L6NH 1HJAC 3M7TA 3RXLA 1LCYA 5AVDA 4JMYA 1C5PA 3LGVA 1EP6A 2SFAA 3ATLA 3EDXB 1L2EA 4NFEA 1O2WA 1DY9A 2LP6A 3Q3XA 2PP6A 3AK5A 3O8BA 1L1GA 2F9BH 2BZAA 1YKTA 1MTNC 1HAOH 2ZPSA 1MD7A 1HAVA 2ZP0H 3URCA 4J2YB 1C5YB 1S0RA 1C2DA 3W94A 1C9PA 3SNCA 2FIRH 2D2DA 1EAWA 2C90B 1ZOMA 1D3PB 4X6NA 2G52A 5K0HA 4IN2A 2QAAA 1C2JA 3BTDE 2TPIZ 2ZU4A 4ZAEA 1MAYA 1UW7A 2A5IA 1AWFH 4OS5A 3U69H 1A5GH 1TONA 2B7DH 1A2CH 1OP2A 4O3TA 3RXMA 4CRDA 1O34A 3ZZ6A 1XUGA 1FIWA 1F92A 5JBBS 1FX0B 1CA0B 2UWPA 4F48B 5L2YH 2QXIA 2NWNA 1UVSH 2VU8E 1YPLH 1S6LA 4AN7A 2XBXA 1ZTKA 1XKBC 1FXYA 1NROH 2HGTH 5CHAC 2BQ7B 3OEHD 5C67A 3VB7A 5JBCS 1F2SE 2PUQH 4ZXYH 3U98H 7GCHG 2KAIA 4JYUH 3RXTA 2FOHA 2W6JD 2W7UA 2ILNA 1G36A 1RXPA 1V6DA 4DG4A 1MZAA 3BIVH 5A8ZA 3RMOH 4NIWA 2UWLA 4KELA 1HUTH 2ZDAH 4NG9H 1WV7H 2FOGA 2ZHFH 4IBLH 4FXGH 2BOKA 1OP0A 5A0AE 1UTMA 3QX5H 3PV4A 5EJZA 1S82A 1ZMJA 3A81A 2OLGA 3ZZ9A 1NPMA 1YLNA 1ZSLA 1EQ9A 1O2OA 1MTWA 1FY4A 1P11E 3M5OA 3M7QA 1PQAA 4Y10E 2FM2A 2B8OH 3B9FH 3E0PB 1GCTC 2R2WU 3GY6A 2A4QA 2FDAA 3UQOA 2ZU5A 1G3CA 3HKIB 2F9NA 8GCHF 1ELCA 4B73A 3TJNA 3VGCC 1WTHD 2GVFA 1ELDE 2ODPA 2ZNKH 3H5CB 2BXUH 4THNH 2A32A 5EQRA 1HJ8A 2ZFSA 2G51A 1PPEE 1O30A 4LK4A 2G4TA 1TPPA 2F43B 5DP3A 1A7SA 2RA0A 1SGDE 3RMMH 3A89A 4NSVA 6LPRA 3QN7A 3V13A 3BTEE 4I8LA 1AKSA 3SQEE 1QJ1B 5A09A 2GTBA 1ABJH 3NXPA 1O5CB 1FJSA 4CRCA 4WH8A 2OBOA 3ZV8A 5AHGH 1V2OT 1INCA 4CBNA 4GCHG 1YYY1 4AOQA 2VVUA 5SGAE 1RD3B 1YPHC 3T25A 1P2OA 3SJOA 3CP7A 4Y7AA 2ZDVH 2VIOA 1O2TA 1OWEA 1B0FA 2EI8A 1AQ7A 1GVKB 1AFEH 3T27A 1CGJE 1C5NH 4JZFH 2J98A 1UTKA 1TGBA 1GBDA 1LQDB 4NZQA 1AZ8A 2BY6X 3M35A 2ANWA 1BTZA 1TMBH 1P03A 1O36A 1C5TA 2GZ8A 4UD9H 2H1UA 3VEQB 3F9FA 3G01A 1OWIA 4TWYA 3T26A 3U1IB 3M3TA 1C9TA 3BTTE 2PKSB 3C27B 1SGFA 1C1TA 1H8ED 4D9QA 3S9BA 2BD8A 1W7XH 2BHGA 1A61H 3QK1A 2V7QD 1NTPA 3A87A 1Z8JB 1O2VA 4I8KA 3SOSA 1VJAU 4MDSA 3O8DA 3R3GB 3TPIZ 3QZRA 1QZ8A 1CBWC 2Y82A 3NRLA 4JZIA 1T31A 1KDQB 3PWCA 1F7ZA 1P2IA 1BUIA 2KFWA 2PTCE 2TGAA 1TNHA 1PQ7A 2G5VA 1C5SA 3EGKH 2P59A 4M7GA 3W1EA 3MH7A 5GDSH 1YLDA 1K21H 5A8YA 1UVTH 5AF9H 4Y7BA 1GHXH 1YCPK 1NO9H 3F0PA 3T29A 5F53A 3RXVA 5CMXH 2SGPE 4BTUB 1G37A 3S69A 1XMNB 3IITA 1QIXB 1QTFA 2BDHA 2FO9A 1JRSA 3RXIA 4ZH8A 3OTJE 1DE7H 1ZGVA 2K8IA 1VCPA 2QXJA 1G30B 1G9IE 2AGIX 2GZ9A 1EB1H 3ZVBA 2Z3CA 3TK9A 5DJ7A 2BM2A 1QRZA 1O3DA 1E38B 4OGXA 1BMFD 1SR5C 5EOKA 3ZYDA 2Q6GA 1OWKA 1J16A 2PKAB 3MNXA 3ZZ4A 4MLFB 5C0UA 2F9OA 1O3EA 2XYAA 4TPYA 2ASUB 1FAKH 4IS5A 5B6OA 2QY0B 2FZZA 3RDZA 1LVYA 1KY9A 1PPZA 1GHZA 3GDSA 1O31A 1C2EA 2AS9A 5A8XA 1P2QA 3SU6A 1GI7B 2PV9B 1P3CA 3PROA 1XX9A 2FOBA 1ELVA 2OC8A 4A1TA 2AMDA 3BG4B 3PV5A 3NK8A 2AMQA 3SUDA 1QY6A 3GY5A 3HK3B 1LHDH 1SGTA 3L3TA 2EC9H 1K2I1 1NRSH 2JETB 1DWCH 2BVRH 1FY1A 2HRVA 1V2TT 1H8DH 2Y80A 5EW2H 1NFYA 5DP5A 2JH5D 2D8WA 2W7SA 4CRBA 1AHTH 1HAVB 1TOCB 2ANYA 2A0QB 3SYJA 2OXSA 1AFQB 2CF9H 1AB9B 3BTQE 2ZDKA 1ZJKA 2ZGXH 1EB2A 4TYDA 1DSUA 3A8CA 1BZXE 1OX1A 4UEHH 2OK5A 3EBNA 2XXLA 5F03A 6GCHG 1AVXA 3A85A 4AGKA 2PW8H 2YMSD 3QLPH 4X1QU 1DUAA 4Q63A 1JOUB 3TU7H 1SGRE 3P8OA 4FU9A 1TRNA 1O38A 5GXPA 3WW7A 1HGTH 4ZHAA 3PMHB 4KTUA 2F3CE 1SLWB 5G4BA 1NS3A 4K1SA 1LVMA 2H5DA 3NWUA 1O3IA 3VB4A 1TAWA 1MKWK 4FVDA 1D9IA 2BD2A 2EY4C 3RXKA 1YWUA 4A5TS 3A7TA 2W3KA 1GBIA 2GDDA 3FVFB 4FUJA 3UOPA 1GJ5H 4ZMAH 3GCTG 1OPHB 1HV7A 2XCNA 1KLTA 4BAQB 3IWMA 4XRNA 3Q77A 1GBEA 3ZV9A 1P8VC 1AVWA 5E0HA 1EAUA 2SGEE 2WZQA 2F9PA 3FFGA 2KAIB 3B23B 1QB6A 5C0TA 3M3SA 1ANDA 1GI5A 5FBIA 1ZYOA 1CE5A 1GHBF 2P3TB 3W95A 1W8BH 5DP7A 1QRXA 4J1YA 3M3VA 1GMHG 4VGCB 5DO4H 3SV9A 1D3TB 2V3HH 1DM4B 1G2MA 2C8YB 2WPMS 1GDUA 2BY9X 2PKSC 4DJZB 1MKXK 2XC4A 3HATH 3K6YA 5GCHF 1XUHA 1E0FD 3WWBA 1BCUH 3HKJB 3RMNH 4CHAC 4Q7XA 5T3HA 3SI4H 5EIYA 2WINI 1BRUP 1HAPH 3P17H 1VR1H 2BD7A 2GMTB 1BQYA 2BDCA 2FX6A 1Q31A 1BJVA 2A5KA 2QGRA 1E36B 3A88A 1BTUA 1WAYB 1DICA 1T7CA 5IDKA 4YO9A 1P02A 1WQSA 1SLXB 2A4GA 1ETSH 3OEED 3ELAH 4IC5A 1GI9B 1BMMH 2GV7A 1M9UA 3GCHC 1SG8B 4Z1MD 1A46H 1K1JA 1GI4A 2WYJA 1K1LA 1C2HA 3BEIB 3ZZAA 3SW2B 3Q3KA 5DP6A 3ZIAD 1TRYA 1W7GH 3LU9B 2VWNA 4X2XA 4INHA 5LPRA 4IN1A 1O2UA 1TA2A 4ABAA 2WUBA 4WJG2 1CT2E 2ZCLP 1AKSB 2BD4A 2ZFRH 1G3BA 1E37B 1FY5A 1THSH 4XOJA 2KCOA 5ESBA 4ABBA 2VH6A 2ODQA 3MO6A 3LPRA 2ZKSA 4Y71A 2BVSH 3UUZA 3RXPA 4BNRA 1B7XB 1YM0A 1CT4E 2P8OC 5CHAB 1SBWA 1TQ0B 2FOEA 3PTBA 2PLXA 2CN0H 1P12E 4ABEA 4CBOA 1K9OE 1ACBE 1BB0B 1ELFA 5L30H 1PQ5A 5DN6D 2J98B 2F9VA 3ATWA 1GMCF 1WBGB 5HM9A 5FPSA 1HBTH 1LKBA 1H8IH 5F8TA 3A7VA 1C1RA 5C94A 3AAUA 1WQVH 1C5LH 1FIZA 4DVAU 4ACAA 4MG3A 1KTTB 2Z7FE 1V2JT 3BG4C 2A7CA 2ZGJA 3P8FA 1BRCE 2K1QA 3TNTA 1LHCH 2JETC 3E0NB 2ANMH 4AGJA 1TB6H 1LVOA 2J92A 1HJ9A 1Y3UA 1UVOA 3SU3A 4WMDA 3I78A 2AERH 4X2VA 4JZEH 3VB6A 1A5HA 2ZHWH 1GCTB 4H6TA 3F1SB 4LXBH 1GJ9B 1V3XA 2FS9A 1KLJH 3RXGA 1MUEB 4MPXA 1XUFA 1C1QA 3E1XB 1GL1A 1XUIA 2VB0A 4A7IB 1P2NA 9LPRA 4F49A 2ZHQH 3VGCB 1HAXB 3SZNA 3V12A 1GL0E 3VG8A 5FAHA 1W14U 4WWYA 1SGFG 5PTPA 2CF8H 1Y59T 1IHTH 1EJNA 1MZDA 1O2MA 3RXRA 4GPGA 4NIXA 4YZUA 4KGAA 4I86A 4Y8YA 1HIAB 1V2ST 3QGNB 1JRTA 4UFDH 1SKYE 1NRNH 4CR9A 5I46H 4K3JA 3O8RA 2SGDE 4AB8A 1QB1A 2BY8X 2ZU2A 1F5KU 3I29A 4X6OA 4I7YH 1H9HE 3F68H 2IPQX 1WCZA 3PLBA 2GKVE 1QFKH 3JZ1B 4FUHA 1SB1H 4A92A 1AVGH 2ZWLH 3BTWE 1C5UA 1UTNA 1COWD 3SUFA 1QA0A 2KZ4A 2XRCA 3LGTA 1XVMA 3A82A 2AMPA 1O3NA 3SUEA 2QXHA 5EODA 4ZKOU 2AHME 1WDIA 1BBRE 1AUJA 1RRKA 2ZGBH 2A5AA 1EP5A 1P0SH 4GUXA 4XBDA 3MYWA 4X8UH 2J97A 3TNSA 5HGGA 1EATA 1WOFA 5FL7D 3F2FA 4FETA 2WV5A 3N7OA 1MCVA 1CBWB 1HLTH 1TPSA 5FPTA 1C1UH 1ELGA 1P2MA 2GMTC 2BXTH 1UK3A 2H6MA 1C5RA 4YXWD 1UTLM 1J15A 4WXVA 1GVZA 1FMGA 1A1RA 3GYMA 1GI3A 3OYPA 3P95A 2FLRH 4FUDA 4ZKSU 4B2CA 2FI5E 4OS7A 1TNGA 3SNAA 1P3EA 1VJ9U 1CHOF 2PSYA 1C1NA 1C4V2 1IHSH 3RU4T 3Q00A 4I8HA 2Q6DA 4D76A 2QC2A 1MQ5A 1S5SA 3H09A 4LZ1H 2V3MA 2V0BA 1J8AA 1FONA 4WMFA 2QF4A 3NCLA 2D1JA 2ZQ1A 5C1UA 2AIPA 5C5NA 1UTQA 1RIWC 1BTYA 1C5ZB 1GBKA 3RXHA 2GJGA 1E1RD 2XW9A 3LJJA 4KTCA 1VZQH 1QA7A 1GJCB 5K7RA 4NIVA 2FYQA 1CA8B 4ZHMU 4MNWA 2WYGA 1YGCH 2B0FA 2VNTA 3MNBA 2BDBA 1ESAA 3KYFA 3BTHE 5LPFA 4K1EA 1SC8U 5I25A 2JKHA 1SMFE 1MU6B 5BPEA 1UHBA 3STIA 3S9CA 4ACBA 3MU5A 4K2YA 3VB3A 1QQUA 1D6WA 4JYTA 5HM2A 4YM9A 1S85A 5A0CA 8GCHG 3ITIA 3AW0A 2ZHDA 2H9TH 8KME2 1EXFA 1KMHB 1T4VH 4FUFA 2FTLE 4KTSA 5GNDA 2L6OA 1YP9A 4WH6A 3P8NA 2M2AA 5E0JA 1O5FH 2WV9A 6ESTA 2EEKA 3GS9A 3TJVA 1W0YH 3T5FH 1QGFA 2ZPQA 2DE9A 1BOQA 5IK2D 3LC5A 1Y3WA 2Q6FA 1UCYH 1O3PB 2PWXA 1AZZA 1O2QA 1N8OC 4UONA 2VINA 3PRBA 2GT8A 1P01A 1ZSJA 1P57B 4AZ2B 4I31A 3EA9A 2ZQ2A 1V2KT 1F0RA 3GISB 4X1NU 2OCVB 4MNYA 2BDIA 4X0WU 3O8CA 1RJXB 3GY8A 3RXFA 1HB0B 3JZ2B 4TT3D 2CJIA 1JXPA 2C3SA 2FYRA 1S6FA 4FU8A 4I8GA 4K8BA 1DWBH 3U8TH 1WSSH 4XSKU 3KF2A 4RT0A 1EAIA 5TCAA 1BBRK 1O3JA 1BA8B 1G32B 2BY7X 4YT6H 1PPHE 1LHGH 2GCHF 3SNDA 4CH8B 2R0KA 2FWWA 4FUEA 2QF3A 2HALA 3UNSA 3PB1E 4IC6A 4Q80A 4RKJB 2Z9JA 2V35A 2FXRA 3DUXH 1TNLA 3LGYA 1O39A 2ZF0H 2FOAA 2G4UA 3A7WA 4YOJA 2IPHA 5C5OA 1OWDA 1L1JA 2OQ5A 2HNTF 1TNJA 1W0KD 2AYWA 1BITA 5DK1A 1ELEE 4MQAA 2Z9LA 4Y6DA 2VJ1A 3A7ZA 2ZFFH 1QRWA 4F55A 4X8SH 1SQRA 5EQSA 1NM6A 1LPGB 2SNVA 2P95A 1C2KA 4Q7YA 2ODYB 1JIRA 3KL6A 1Y3YA 3VB5A 4IGDA 3A8DA 3M61U 4HTCH 4A1XA 4YTAA 4CHAB 1SFIA 2A7HA 2C4FH 2A31A 1C2FA 1OKXA 4R8TB 1MH0A 1VCWA 3U1JB 4K5ZA 5GPIB 3RXCA 4KKDA 4TSFD 3UIRA 4TWWA 3LJOA 1SFQB 2AGEX 1O5EH 3E16B 1O37A 2NU0E 1W0ZU 1BJUA 1Z8GA 2QCYA 2V6NA 2A2XH 1O2ZA 3GCHB 3MOCA 4OGYA 1BTPA 3LOXA 5E2OA 2BX3A 4ABDA 1LMWB 4BAMB 1EASA 5JDUB 1RGQA 1L1NA 2ZCHP 2ZCKP 1N6XA 5LPEA 1O3HA 3I77A 1GJ4H 4X1RU 3UQVA 3M5MA 4X1SU 5DSFA 1TBZH 1O3AA 3TLOA 2BX4A 1ZHMA 1S0QA 2SGAA 2WPJS 1QR3E 1ZJDA 1GG6C 2RCEA 4H42U 4AYVB 1C2MA 4CH2B 1SSXA 3TGIE 1MMJN 1HXFH 1XUKA 4AG2A 4FVBA 3TK6A 1U6QA 1EAXA 2BLVA 3MH6A 3GY2A 1ELAA 1O2GH 5F8XA 2P8OB 2XTTB 3UREA 1MCTA 2Z3EA 1HXEH 4B74A 5A0BA 1PYTC 3F3BA 1GHWH 1Z8IB 2QF5A 3SU4A 1BMLA 3MWIU 5DPAA 1AIXH 4HI3A 3SJKA 4DIHH 4MNXA 1LPZB 1H9LB 3AAVA 3SUGA 1P10A 2ZEBA 3LC3A 1TYNA 1EOLA 5JBAS 1YCPM 1GMDF 2R0LA 2AGGX 3KQCA 2ZHEH 2F91A 4ZKRU 1O5AB 1YPJH 1YPKH 1MD8A 2OP9A 3M5NA 2G00A 1AE5A 1MABB 1O3GA 4ZKNU 1GDQA 1DXWA 2WHXA 3CNRA 1SGPE 2HLCA 2HNTC 1IOEA 1V2UT 1UMAH 1IQLA 2Z6BD 3BN9A 2BZ6H 3GICB 3ZYEA 5T1VA 4B76A 5DP9A 1AI8H 4Y0ZE 3RXAA 1TA6A 1SQAA 3QUMP 1L4ZA 2BD9A 4UDWH 1DXPA 4Y8XA 4K8YA 1Z71A 3RC5A 5DP8A 2K0QA 4NA8A 3SI3H 5C1XA 2ZDMA 5ETXA 1L4DA 1A3BH 4ISOA 1SOTA 5FPYA 2ZI2H 2G81E 3E90B 3SORA 3NKKA 4MPUA 1XXFA 1QL8A 1RTLA 3LGUA 1P05A 1C4U2 3A86A 1RS0A 1C5VA 1TFXA 4UFGH 1Y5AT 1UVUH 1GHBG 1QHRB 3K6ZA 5JYIA 1GI0A 1FQ3A 1F5LA 4OS2A 3ZVGA 2OINA 2EI6A 1SQOA 1X7AC 2BLQA 3PM3A 4OS4A 1BMNH 2P93A 4B2BA 1NFWA 2GDEH 1HPGA 3HPTB 2P16A 1W12U 2CXVA 3TGKE 5GCHG 1GJAB 1CT0E 2TGTA 2TBSA 2BLWA 1DX5M 1Y3XA 2VGCC 1NRRH 4UE7H 2K7XA 1HCGA 2HWLB 2WPKS 1DWEH 3MNCA 1TGTA 4BTTB 2Y7XA 4ZHLU 1SGQE 2BTCE 3RXDA 1Z1IA 2RDLA 1UHBB 3DCLA 4Y0YE 1XKAC 1QURH 4XD7D 2Y5HA 3D65E 3GDUA 1GI1A 1T4UH 2R3YA 4YOGA 5EXMA 3ZVDA
chains in the Genus database with same CATH topology
2NU4E 3SHCH 1OP8A 4O97A 2ZFQH 4ASHA 4JK6A 3EYDA 1KXAA 1A0JA 3EA8A 1A0LA 3ODDA 3F6UH 2C8ZB 4X2WA 1GHVH 1ZTLA 1AU8A 1ZPBA 4B1TA 3LH3A 1GBAA 1FDPA 1AMHA 3HGNA 1KXEA 3SGQE 2EA3A 2CGAA 4BXWA 3V7TA 4RKOB 1TX7A 1MAXA 3VXEH 6CHAC 1Q2WA 1QBOA 1OYTH 2AEIH 3NUMA 1EKBB 2BQ6B 2ALVA 1P04A 2O8WA 2DUCA 4ZROA 1YC0A 1ZPCA 1FPCH 3QGJA 5HMAA 3E91A 3MU0A 1ELTA 1OSSA 1TPOA 2HNTE 3VFEA 1Y5UT 5DP4A 1PJPA 1KIGH 3BTME 1GMCG 1GBBA 2HPQH 5JB9S 1CQQA 4INKA 3MH4A 3MH5A 1ZPZA 1RIWB 2NU2E 7LPRA 3PYHA 3P92A 1ETTH 1HRTH 1JIMA 1V2MT 1ZRKA 4X2YA 1THPB 2EI7A 2XC5A 3URDA 1H1BA 1EJAA 4E7RG 2GT7A 4D7FA 1KTSB 3F9HA 1TMTH 1CGIE 1TALA 3ATMA 1GJ6A 1IQNA 5J4SA 1MTSA 3QWCH 4BAKB 2BD5A 2SGQE 1NU9A 3CENA 4OS1A 1PPGE 3BSQA 4E05H 1FN6A 2OC0A 2TIOA 1O2KA 1T8LA 3TH3H 4Y8ZA 2A1DB 1AO5A 3FP8E 1C1VH 1VITF 5FX5A 1GBMA 4I32A 1GHAF 3E6PH 1TNKA 1V2PT 2WPHS 3P6ZB 1QB9A 2CMYA 1IQMA 3LDXH 2UUYA 9ESTA 1EZQA 1T8OA 3U8RH 3MMGA 3RXEA 1BIOA 2Q1JA 4WY3A 4SGBE 2YNBA 2W5EA 1RTFB 2BMGB 3UR9A 4LOYH 3M7UA 3IG6B 4TY7A 1GI8B 1P9UA 4TY6A 4AFQA 3U8OH 1B5GH 1N8OB 1KSNA 5EGMA 1P09A 5F8ZA 4NWLA 3RC4A 1Z8RA 1BHXF 3OY5U 5EPYA 1ANEA 1GBLA 3MU8A 4UFFH 3STJA 1HDTH 1W13U 4BOHA 1J14A 1IQJA 1GGDC 2LIZA 4X8TH 1MU8B 1FAXA 1F0UA 2FOMB 1O5DH 2PHBA 3KN2A 3TITA 2QXGA 1KDQA 1ABIH 1LPKB 2PGBB 2HPPH 3ZZBA 2GX4A 1O33A 1N1LA 2BQWB 1KXCA 3M36A 1AY6H 2RG3A 2O8MA 4DCDA 2QA9E 3ATKA 1GJDB 5LGOA 1V2WT 1PPCE 3A80A 1DITH 1GWAA 4YOIA 2ZPRA 1E35B 1H4WA 3GY3A 1Z6EA 1HAZB 1Q3XA 2IJOB 4YT7H 3A84A 2VWLA 2ZIQH 4ABFA 2BVXH 1GCDA 2BOHB 3FANA 1LHFH 2R3UA 2Z9KA 1GBFA 2Y5FA 3KQBA 1EZXC 3RM0H 1MBMA 5HYOA 4R0IA 2RA3A 3ZVAA 2BDGA 1K1PA 1CHOG 1FLEE 2VIQA 2BB4A 2PKAA 7ESTE 1HAHH 3A83A 4U30A 3RU4D 2FOFA 2XBYA 3A8BA 3GDVA 2QV1A 1UO6A 2LNCA 3H7TA 1V2VT 5EG4A 1V2QT 4FUBA 1F0SA 1LQEA 5AFZH 1A4WH 1V2LT 1UTOA 3SJ8A 3PLKA 3BIUH 3KGPA 3DFJA 2F9UA 1O2HA 4BTIB 4RN6A 1EZSC 4D8NA 2GD4B 2AIQA 1FI8A 1GBHA 2J2UA 1HAYB 2D26C 2ZTXA 2XCFA 1O2XA 2STAE 1EOJA 1OOKB 3PWBA 1GBJA 1O3BA 1ZRBA 4ESTE 1S6HA 1DSTA 3S7HB 2O8TA 3H7OA 4A1VA 3SBKA 1ARBA 2BD3A 3S9AA 5EQQA 4ISHH 2TGPZ 1C1SA 1EX3A 3DA9B 3TK5A 2LPRA 2ZTYA 1Y3VA 3LH1A 1O3FA 2A4RA 1QCPA 2M5TA 3SU0A 1YCPH 2OTVA 4DOQA 3UNRA 1G3EA 1GG6B 1NY22 1T32A 2ZU3A 5GJ4B 3L6PA 4TPIZ 1T8NA 1NT1A 3TGJE 5C3NA 1FY8E 3CS7A 4O3UA 4AB9A 1O2YA 1DUEA 1FN8A 2R9PA 2UWOA 2ZU1A 4JZ1A 4AFUA 2DE8A 2B5TB 3DT0H 2ANKH 3P70B 4ABIA 1C5QA 3FZDA 3AASA 1DFPA 3QDZB 2BLOA 3ENSB 1UK2A 4U01A 5FX6A 1BDAA 3RXBA 1SGEE 3GY4A 3SJ9A 5T6GA 1GJ7B 4NA7A 1YBWA 4CR5A 2H9HA 5A2MH 1QBVH 1BTWA 1NFUA 1VITH 4XDEA 2I6QA 2PUXB 2PGQB 1YF4A 4NFFA 3SQHE 1XVOA 1UTPA 1O3OA 1C5MD 2FOCA 3ZZDA 1GI6A 2OC1A 3UFAA 5EW1H 1HFDA 4Q7ZA 1O2LA 3EAJA 2TRMA 4NSYA 1EPTC 1TIOA 1TMUH 1HYLA 3T2NA 3BG8A 3L33A 2ZTZA 4BXSA 3TJOA 1N6YA 3MU1A 3D49H 2XBWA 2AH4X 3RLYH 3TH4H 5FXLA 1H9IE 2GCHG 3PO1C 3HK6B 1W11U 2H5CA 2WV4A 2C8XB 1ESBA 4ISNA 4Y11E 1TLDA 4MTBA 3ZZCA 5T6FA 1IQHA 4AORA 5DGJA 2TGDA 4XBBA 4BAOB 3OX7U 4H4FA 7GCHF 1DANH 3QTOH 4B71A 1GDNA 4INLA 1DLKB 5EXNA 3EA7A 4D9RA 3MNSA 3RLWH 1ANBA 4Y79A 1O2SA 1ORFA 1S83A 2O8LA 3SU2A 1QL9A 2A45B 1P2KA 1UCYE 2ZO3H 2J4IA 3K65B 3GCNA 1J17T 4IMZA 5T6DA 3C1KA 1K1IA 1EJMA 1Y5BT 3FP7E 2VGCB 1TPAE 2GP9B 2ZGHA 3FP6E 4GVUA 4DIIH 1THRH 2BYAX 2G5NA 3SV2H 3LGWA 1IQFA 1MKWH 3P8GA 1C1PA 1WU1A 3OY6U 1O3KA 1F0TA 2BY5X 3VPKA 1GBCA 4GLYA 1Z1JA 2YOLA 2ZFTA 2GCTC 3KQEA 1TRMA 2HVXA 1RTKA 1ZHRA 3SV6A 2OQUA 1C5WB 4ISIH 4AFSA 3AW1A 2Z3DA 1QNJA 1VGCC 3A7YA 3FZZA 4I8JA 1CVWH 1PQ8A 2FODA 3F9EA 1GHYH 5CE1A 1V2NT 3SO3A 2VVCA 1T8MA 1C2IA 1WYKA 1P06A 5EU8A 4XBCA 4NWKA 3UPEA 3UNQA 1NRPH 2FI4E 2PSXA 1MBQA 3R0FA 2GGVB 4PROA 8ESTE 3BTGE 2XC0A 5J4QA 1K1NA 1L0ZA 3M5LA 1O32A 2THFB 1K1MA 4UFEH 1UTJA 1G3DA 3RP2A 1EPTA 1MKXH 2VIVA 3SN8A 3RM2H 2XWAA 1O2PA 1GI2A 4Y76A 4CRAA 3V0XA 2J38A 6CHAB 3FAOA 4X6PA 1O2NA 1ZSKA 1D3DB 3B8JA 4A6LA 4GCHF 1XM1A 2J94A 2Y7ZA 1W3CA 1SGIB 3ZVEA 1TGNA 2G55A 3DD2H 1DY8A 2GZ7A 1ANCA 4U32A 3ODFA 3MO3A 3UR6A 1QJ6B 1EUFA 1TWXB 2IOTA 3UWIA 3ZZ8A 2BDAA 4NCYA 1W2KH 3SJIA 4KP0A 2PTNA 2VH0A 3BTFE 1TBQH 3RC6A 3LIWA 1LKAA 1AN1E 1A5IA 1GMDG 4NZLA 1PFXC 4ABJA 1K28D 1ZZZA 1SGNE 4FUIA 1JMOH 4E06H 3RMLH 4AFZA 3ZVCA 4ISLA 1CHGA 5FBEA 3ATIA 1IQKA 3BTKE 5FCKA 1BRBE 1GPZA 1KYNA 3MI4A 3GYLB 1TGSZ 2B9LA 1HIAA 1TNIA 2QF0A 1V2RT 2A4OA 1HAGE 2F83A 1FUJA 2H2ZA 1CA0C 2FX4A 1CGHA 1TE0A 4AYYB 4GHTA 5C1YA 1A3EH 2J34A 2SNWA 1OXGA 3PMJA 1NC6A 2R2MB 3GY7A 4BAHB 1OS8A 1P9SA 1NZQH 1DT2A 5JB8S 3PTNA 1A0HB 4DW2U 2VIPA 1KXDA 4E7NA 3T28A 4WVPE 3TIUA 2ZC9H 2P3UB 4NGAH 1YPEH 1WUNH 1O3LA 5ESTE 3SU1A 3A7XA 3UWJH 4O03A 4X8VH 4FU7A 4XE4A 2IN2A 1YPHE 2FP7B 1C1WH 2PFEA 1C1MA 3UY9A 4ABGA 1UCYK 2FTMA 1GGDB 2C8WB 5ABWA 3KNXA 5C2ZA 1ELBA 1W10U 3MU4A 5HXFA 4H6SB 3LGIA 2P3FH 2XBVA 4DY7B 4JYVH 3D23A 1HNEE 2ALPA 2A7JA 1DWDH 1ZMLA 3LONA 3RXQA 3WY8A 5BRRE 1JWTA 4ZXXH 3TJUA 1AWHB 2OUAA 1SHHB 1NU7B 1GJBB 1C2GA 4YLUA 5TCCA 3E3TA 4MNVA 3DFLA 3MHWU 1YPGH 3RXOA 5L2ZH 1MTUA 3HGPA 1K22H 2H9EH 3KQDA 1DS2E 1ARCA 3ZZ3A 1BT7A 1AGJA 2FPZA 2Z9GA 3MTYA 1NESE 1SPJA 1FZZA 1BTXA 1FNIA 1F5RA 1RFNA 2W26A 1OYQA 5TJXA 3S7KB 4IMQA 4JZDH 1O2JA 2I6SA 1QJ7B 2ULLA 3BV9B 1SLUB 3SNEA 4MPVA 4AX9H 3MFJA 1IQEA 1O2RA 1QQ4A 1C5XB 3V3MA 2CHAB 3BF6H 4GSOA 5EXLA 3GCOA 1PPBH 5EPNA 1TQ7B 2ZGCA 8LPRA 3A8AA 2G8TA 1ZLRA 1AUTC 1TBRH 2ZA5A 2Y81A 2WPIS 3F9GA 1C2LA 1ETRH 2Z94A 2FI3E 6GCHF 3LT3A 1BMAA 1SGCA 4ABHA 1LVBA 4WF8A 3BEFB 1ZMNA 1CSOE 5GIBA 4BANB 1K1OA 1TABE 1HJAB 3NPSA 3U9AH 1C5OH 2OC7A 4ZUHA 3GOVB 3SGBE 1NFXA 3CS0A 1TOMH 4YLQH 1KLIH 3K9XB 4Z0KA 2ZFPH 3RUOA 3VXFH 4NA9H 4O9VA 1HAIH 1G2LA 5FHTA 2J95A 2Z9IA 1YLCA 4K60A 3GCTF 3SHAH 5E2PA 4X6MA 1MTNB 4Z6AH 1BHXB 1DLEA 3PLPA 4DGJA 1S84A 2OD3B 1WTGH 1SOZA 1B0EA 3BEUA 3S0NA 1FV9A 1VITG 1JBUH 4FUCA 5FCRA 1TGCA 2C93B 4D7GA 1GHAG 5F6MA 4HFPB 4GHQA 4GAWA 1GMHF 1PYTD 1ZTJA 2Y5GA 1J9CH 3SV7A 3ZVFA 1UVPA 1PPFE 2GV6A 2VWMA 4DURA 4WXIA 4WMEA 4JCNA 3ESTA 4AG1A 3NZIA 2HOBA 7KMEH 2J9NA 1S81A 3RXUA 5JPMH 4JK5A 2YNAA 2ZECA 4K69A 3QO6A 2ZG0H 4NIYA 3UOUA 3UTUH 1BRAA 3D62A 2WUCA 3TVJB 2FMJA 4RSPA 1DDJA 1LO6A 1Z6JH 4MVNA 5GWZA 3MO9A 4OS6A 1ZGIA 3SU5A 2QN5T 4HZHA 1UK4A 5JBTA 1GVLA 4XFQA 1AE8H 1IQIA 2UUKB 1MQ6A 1DOJA 1ESTA 2ZDLA 1ID5H 1SI5H 1BTHH 3T62A 4U2WA 5E0GA 3TH2H 5AFYH 1KXFA 1OWJA 2STBE 1O0DH 4B2AA 3SNBA 3KCGH 2CV3A 5IYTA 2JH0D 2ZDNA 2FS8A 2UUJB 3OSYA 1O3MA 1O5GH 2SGFE 1D3QB 1SL3A 1EPTB 1CO7E 1TX6A 4K1TA 1EZUC 1FY3A 1GBTA 4CRFA 2Y6TA 1P2JA 3PMAB 1VCQA 4FUGA 1D4PB 3PO1B 5H4IB 3K2UA 3E8LA 1MTVA 3QTVH 1O2IA 4CRGA 1SHYA 2P94A 1DPOA 3KHVA 3RXSA 5E8EH 1O3CA 3KIDU 2PR3A 1TX8A 3ZZ5A 1LHEH 1SQTA 2NU3E 2AFQB 1E34B 2OBQA 1D6RA 1IQGA 1SGYE 3DHKH 3SGAE 2XWBI 1UJ1A 1IAUA 2ESTE 3EQ0H 3Q76A 1LDTT 1C4Y2 1AFQC 4LZ4B 1AB9C 4DT7B 3KEEA 1CU1A 2NU1E 1YPMH 4X1PU 1DVAH 2VIDA 2O9QA 3OU0A 3PMBB 2JH6D 2ZZUH 2V3OH 2WPLS 3RU4E 1FPHH 1GJ8B 1XXDA 2VWOA 1LTOA 4F4OC 4YESB 1BBRH 2VIWA 5LH8A 1O35A 3SV8A 2GCTB 3RXJA 1OWHA 1NRQH 2XNIA 1AD8H 1QL7A 2FEQH 3LKWA 1VGCB 1O5BB 2A2QH 1KXBA 1Z7KA 2CHAC 2UUFB 1ZHPA 1NN6A 2QYIA 5DKMA 1XUJA 4B75A 1C1OA 1Y8TA 3Q3YA 5DG6A 4MPWA 4HGCA 3M37A 2FLBH 5C20A 3ZZ7A 1ZR0A 2QIQA 1SVPA 3QZQA 2O8UA 1QBNA 2W3IA 4IW4E 4SGAE 2FESH 4I33A 3AVZA 1SLVB 4CREA 2BDYA 4VGCC 2VVVA 4QT8C 3EE0B 4Q2KA 5L6NH 1HJAC 3M7TA 3RXLA 1LCYA 5AVDA 4JMYA 1C5PA 3LGVA 1EP6A 2SFAA 3ATLA 3EDXB 1L2EA 4NFEA 1O2WA 1DY9A 3Q3XA 3O8BA 1L1GA 2F9BH 2BZAA 1YKTA 1MTNC 1HAOH 2ZPSA 1MD7A 1HAVA 2ZP0H 3URCA 4J2YB 1C5YB 1S0RA 1C2DA 3W94A 1C9PA 3SNCA 2FIRH 2D2DA 1EAWA 2C90B 1ZOMA 1D3PB 4X6NA 2G52A 5K0HA 4IN2A 2QAAA 1C2JA 3BTDE 2TPIZ 2ZU4A 4ZAEA 1MAYA 2A5IA 1AWFH 4OS5A 3U69H 1A5GH 1TONA 2B7DH 1A2CH 1OP2A 4O3TA 3RXMA 4CRDA 1O34A 3ZZ6A 1XUGA 1FIWA 1F92A 5JBBS 1CA0B 2UWPA 5L2YH 2QXIA 2NWNA 1UVSH 2VU8E 1YPLH 4AN7A 2XBXA 1ZTKA 1XKBC 1FXYA 1NROH 2HGTH 5CHAC 2BQ7B 5C67A 3VB7A 5JBCS 1F2SE 2PUQH 4ZXYH 3U98H 7GCHG 2KAIA 4JYUH 3RXTA 2FOHA 2W7UA 2ILNA 1G36A 1RXPA 1V6DA 4DG4A 1MZAA 3BIVH 5A8ZA 3RMOH