4WMEA

Crystal structure of catalytically inactive mers-cov 3cl protease (c148a) in spacegroup c2
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
306
structure length
306
Chain Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Middle East respiratory syndrome coronavirus 3C-like protease reveal insights into substrate specificity.
pubmed doi rcsb
molecule keywords MERS-CoV 3CL protease
molecule tags Hydrolase
source organism Middle east respiratory syndrome coronavirus
total genus 85
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4wmeA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wmeA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wmeA02
3V0XA 5L2ZH 3UWIA 1QBNA 2F91A 1GBIA 3FZDA 2QF0A 1H9LB 2PKAB 4X8VH 4WF8A 1ELTA 1DXWA 1SQAA 3A7XA 3HK6B 4ABAA 3A88A 2ZEBA 1LVMA 2R0KA 3SGQE 1SG8B 2GCHG 5ESTE 2PGQB 3ENSB 4X2YA 1GI5A 3F1SB 1SPJA 3QGNB 1GBHA 1DICA 3C1KA 4E06H 2ODPA 5A09A 2SGDE 1TQ7B 4YLQH 2FOGA 4TYDA 1N1LA 2P16A 2V3OH 1GHYH 4ABBA 2WPIS 3WY8A 2HGTH 4AN7A 4D76A 1MAXA 1OWDA 2H9EH 1P01A 1NPMA 1WTHD 3SHCH 3T28A 3RXRA 1C2DA 1XX9A 1K28D 1FJSA 1NFUA 1TOCB 4E7NA 4IN2A 1IHTH 1DITH 5A0AE 4Y71A 3MU1A 3HGNA 1EX3A 2AS9A 1T4UH 3VGCC 3UFAA 5K0HA 4XE4A 4JCNA 1O2SA 3KCGH 3PMAB 3S9BA 3SZNA 1IQHA 2BVXH 4TY7A 1QCPA 1G3CA 2Z3CA 3FP7E 1O38A 2OD3B 1BIOA 3A81A 1PPGE 3ZVAA 2HNTC 4OS2A 3KQCA 1AKSA 1MTNC 1J9CH 4I31A 1AE8H 2A5AA 3QLPH 1SMFE 3EDXB 2NU3E 5HYOA 1ELDE 2A7CA 1V2QT 2Q6FA 1DANH 1JRTA 3TNSA 1P2MA 1TX7A 1S82A 1NRRH 3C27B 4MPVA 3RXIA 2A2XH 4NIXA 4AFQA 2BTCE 1QQ4A 1NU9A 4BXWA 1MKWH 3ZVBA 1EZSC 1P02A 1NS3A 3A80A 4Y11E 1S0QA 2VVVA 3ATKA 3TJUA 1TABE 4CHAB 1O2RA 1BZXE 1IQLA 3KNXA 1KLIH 4GPGA 3UNQA 1ESTA 1FDPA 2ZF0H 1GG6B 1FY4A 1P57B 1K1PA 1T32A 1TRYA 1TNHA 3RDZA 5JDUB 2AMQA 1N6YA 3Q00A 1GBBA 4GLYA 4AX9H 1ZZZA 1V2WT 4VGCC 1FONA 1W0YH 3A85A 1PYTD 1P04A 1P06A 1MAYA 1PPZA 1QNJA 4TPYA 1GHWH 1NRQH 2JETB 1GJAB 2Z3DA 4DT7B 1CGHA 3URCA 5G4BA 1J16A 1SGCA 5F8XA 1THSH 2FOCA 1F0UA 1O3GA 2FXRA 2F9NA 3E3TA 3SU0A 1UCYK 1GBLA 1ZGVA 1BUIA 4X6MA 3KQDA 1O3HA 1ANBA 3BEFB 5HM2A 2D8WA 5A8ZA 7GCHF 1DS2E 2ZPQA 1HJ9A 3FVFB 4A6LA 1TMUH 1W11U 1ELGA 1HAVB 4HTCH 4FVDA 3PYHA 3BV9B 5GCHG 3RLWH 1HDTH 3MO9A 1GHZA 1O2JA 2ZECA 3UQOA 1UK3A 2AGGX 2UUKB 4Y10E 4X2XA 3F9GA 2FODA 4Y6DA 3OY5U 4FUIA 1KDQA 3MH4A 1FMGA 1NFYA 3A7ZA 5JYIA 1L2EA 2HNTF 6CHAC 1SGDE 2AMPA 1T8NA 3ZZ9A 1P2JA 4LZ4B 3P8GA 1GI7B 2ZCKP 2OP9A 2GCTB 4ZH8A 2FPZA 1QRWA 1BT7A 3SOSA 1RJXB 1SI5H 1C1UH 2OQUA 4KTSA 1C5OH 3UPEA 1JMOH 3A83A 1LVOA 1UVOA 1V2VT 1YC0A 4MLFB 5E0JA 1LKAA 1ZSKA 2G00A 4BAQB 1O2YA 2Q6GA 2P93A 1BOQA 1BRAA 1TB6H 3IG6B 2GZ8A 1D4PB 3U69H 1EP5A 4JZIA 4Y8ZA 4NCYA 5A8YA 1E37B 4JZFH 1O39A 4IN1A 3VB4A 2IOTA 4MPXA 4XOJA 5T6GA 1C1NA 1UTPA 3RXLA 1W10U 2NU4E 3E91A 1Z7KA 1V3XA 4HFPB 5T3HA 2QIQA 1W0ZU 1CHOF 4IMZA 2A4QA 2FYQA 3Q3KA 1HAZB 3RXFA 1EPTA 4K3JA 1T4VH 5T6FA 3LGUA 4XBDA 1GMCG 2HNTE 3GY3A 3PROA 1MD8A 1CA0C 1QRZA 1Y3UA 1O5AB 1XUFA 3VEQB 4B75A 1G3EA 2STBE 4WMDA 2BMGB 1V2PT 3ESTA 3MNCA 1NESE 3RXSA 5EG4A 2SGFE 3DHKH 1IQFA 2TGAA 2ZGJA 3BTGE 2D26C 2C3SA 2Y82A 1O2IA 2ZWLH 5FCRA 2TIOA 3CS0A 2FS8A 4YM9A 1IQNA 2ZU2A 1ETTH 1P9SA 3M61U 2ZGXH 1FNIA 1YPLH 1GL0E 1VR1H 1P8VC 2CF8H 1V6DA 3QZRA 1EATA 3UIRA 4JK6A 3BIVH 2BX3A 1SLXB 2FO9A 2RA3A 4PROA 5GPIB 3RXGA 2JH5D 1DFPA 1SFIA 2UUYA 5L30H 2FOEA 2D2DA 4MNXA 3TPIZ 1HAXB 4D8NA 1VGCB 4RN6A 1N6XA 1FPCH 1ZMLA 3AW1A 1K9OE 1TOMH 4CBNA 2GCHF 1ZJDA 2BM2A 1YPHE 3BN9A 4MVNA 2BY5X 2WPMS 4NSVA 3GOVB 2BZAA 3EE0B 2ANKH 3KEEA 1A46H 3W94A 1Y3WA 2TGDA 4FUHA 4F4OC 5GIBA 3M5MA 4H6SB 2CHAB 1EAIA 1YF4A 4ZHLU 2Y7XA 2WINI 2FOFA 1CT2E 1BTYA 2RCEA 4O03A 3MWIU 2HVXA 4NIVA 1F0SA 4UDWH 3K6YA 4IBLH 3PWCA 3SNCA 3MO3A 1ZMJA 1Z8RA 3A7WA 1IQKA 1GGDC 1SGIB 2OBQA 2QA9E 4KGAA 4HGCA 2HLCA 4AYVB 3A8DA 1EP6A 3F9EA 4X1RU 2GZ9A 3RMMH 1GPZA 1O35A 1Q3XA 2NU0E 1HFDA 2WPLS 1FZZA 1OSSA 3AW0A 3D23A 4CH8B 5FPTA 4H4FA 2XNIA 1WU1A 1TNKA 1XUGA 1LDTT 1MKXH 2TRMA 1DE7H 4MPUA 1UHBB 4K1EA 2HPPH 5GJ4B 3SJOA 3UWJH 4UE7H 4X1SU 4BTTB 4I8LA 5JBTA 3MMGA 1O2TA 3T26A 3U1JB 3SJIA 2ZGHA 2Y7ZA 3E16B 1SFQB 3RMNH 3PMBB 1S5SA 3VB6A 4CHAC 5DO4H 1BJUA 5HMAA 3FFGA 3UOPA 1QL8A 1LPZB 1KTSB 1DWEH 3SI3H 2PSYA 1GG6C 1ZTKA 1O36A 1TA6A 1EKBB 3NWUA 2FP7B 1GI6A 3NXPA 1ZSLA 1CU1A 2CF9H 2UWPA 2VIPA 3ZVCA 4ABFA 2OLGA 4OGXA 2G81E 4AG1A 1C1VH 2OC0A 2R0LA 1ABJH 5CE1A 2P59A 2GZ7A 4YTAA 3UREA 1JIRA 1O2VA 2G4TA 2JETC 1ZPCA 3RXKA 1O3PB 5DP5A 1P2KA 5JBBS 1X7AC 3SV7A 1XVMA 1N8OB 1QA7A 1C9PA 1MH0A 1ZHMA 3LGTA 3S7HB 1C4Y2 4B2AA 1O2ZA 2ZQ2A 5SGAE 3SU4A 3Q77A 4AGJA 1O2QA 3GDSA 1SOZA 2BLOA 3RXBA 1C9TA 4LXBH 1ELFA 1EAUA 2V3HH 1YPGH 4D7GA 3I29A 1ANEA 1GDQA 1GI4A 1SHHB 3CP7A 1WUNH 2J95A 3DFLA 4AORA 2AYWA 2BVSH 3TJVA 1AZZA 3EGKH 2PR3A 2R2WU 1QQUA 1HJAC 1UVSH 1UK2A 2QXJA 3RP2A 1GJ6A 4NIWA 3U1IB 1PQ8A 1LQDB 1HV7A 2PKAA 1CE5A 5GCHF 2YNAA 4HZHA 1O5CB 1TNIA 3OSYA 5IDKA 1S81A 1XXDA 4B74A 1XKAC 3JZ2B 1C5SA 3MHWU 2WUBA 3ATWA 2ZFSA 1GJDB 2ALPA 2ZU5A 2ZQ1A 3SORA 3SU2A 3A7TA 3MH6A 3M7QA 1A7SA 4K8BA 3L33A 4WH8A 2FX4A 1K1NA 1L1GA 1MTWA 4BNRA 5I25A 1G2MA 1EQ9A 2XXLA 1DY9A 1MBMA 1TBQH 4JYUH 2ZDMA 2NWNA 3ATMA 5AF9H 4BAKB 4ISOA 3I77A 3EAJA 1YLDA 2ZFFH 3PMJA 3D49H 1HAYB 5TCAA 3H7TA 4H6TA 3TGIE 1HGTH 1GBJA 1RD3B 1KY9A 1E0FD 1BCUH 5DGJA 1YPEH 1D6RA 2OQ5A 3MU8A 1GI0A 2BQWB 3QGJA 1P2NA 1TX6A 1AY6H 1L4DA 2BLVA 2A1DB 1ZTJA 1C2JA 4X2VA 1WTGH 1ELBA 2UWLA 1TLDA 3TK5A 3K2UA 1BTPA 3E8LA 5DJ7A 1TBZH 2VGCB 1WAYB 2ANYA 4XBBA 2FOAA 3MU0A 1C5RA 1CBWB 1F5KU 5C3NA 2IJOB 2ZU3A 2FLBH 1HBTH 3M7TA 1K1LA 1TMBH 2P3FH 3ZVDA 1D3QB 4JYTA 1P09A 1EOJA 3P6ZB 3SHAH 1PPEE 4MDSA 3SV6A 4I8KA 1D3PB 1GMCF 1FY3A 1HAHH 3U8RH 4X6PA 1B0FA 1GBCA 1P10A 3BTWE 1AMHA 1EUFA 4Y8YA 2ZFTA 2EI6A 1B0EA 1B7XB 4ZXYH 5C1YA 1QFKH 3A7VA 3TVJB 1P2QA 2V6NA 4GCHG 4X6OA 2SNWA 1YPKH 2BD9A 3BTHE 5FXLA 3SGBE 1A5HA 3MTYA 1QJ7B 2ZDLA 4F49A 2ZGCA 2SGPE 4AZ2B 1DXPA 1QL7A 2VWMA 3DUXH 2AIPA 3P8NA 3LOXA 2KAIA 1UJ1A 4X8UH 2BD3A 2ZI2H 1HUTH 4B76A 2VIOA 2CHAC 2OINA 4Y7AA 1GMHG 2M5TA 2O8UA 3BTEE 1GVZA 2R3YA 3ELAH 3S7KB 5FBEA 2FDAA 4KKDA 2GTBA 1AN1E 4YESB 4INLA 1XUIA 2ZC9H 3GY8A 1FLEE 2ZFRH 1TNGA 1TGTA 4THNH 3VB5A 5EOKA 1O3KA 2FI3E 4I33A 1KYNA 4Q7ZA 1HNEE 3RC6A 1ZPZA 2IN2A 1NRPH 2I6SA 4A5TS 2PTNA 3UY9A 1PPHE 1SL3A 2LPRA 2ZA5A 2ZG0H 4UFGH 4CREA 1SGNE 3KIDU 2OC7A 1SSXA 1T8MA 3GY5A 2ASUB 4K5ZA 2XWBI 1NC6A 3QDZB 4YZUA 4E05H 4UFFH 4NSYA 1WQVH 4ZMAH 3QK1A 5AFYH 1AUJA 3PTBA 1O2KA 3ZZ3A 1JBUH 1V2RT 3B23B 1OYQA 2ILNA 3QTOH 3SQEE 2VJ1A 4NA9H 2ZCLP 3OX7U 4MQAA 1A5GH 5AHGH 1O30A 2ZHWH 1BMNH 1V2OT 2A5IA 5JBAS 4B2BA 1K1IA 1CQQA 2GD4B 2STAE 1EZQA 1MBQA 8LPRA 2G8TA 1DPOA 2C4FH 5FHTA 3S0NA 5DPAA 1H4WA 2A7JA 1RFNA 1O3OA 1QL9A 4FU9A 1IQEA 1W7GH 5DP6A 4RKOB 3V13A 3UNSA 4DIHH 4ZKOU 1UK4A 2FS9A 2TPIZ 1ZYOA 2ZDNA 1AQ7A 4DY7B 4I8JA 4TY6A 4X1NU 1GJ7B 1C1QA 1N8OC 3ODFA 2ANMH 1BQYA 1LHGH 2Z9IA 1KXBA 4BANB 3RXJA 2Z3EA 3GCTF 2BY8X 1J17T 4AYYB 2A4RA 1A61H 3ZZ5A 1BMAA 3CENA 2ODYB 2BB4A 2FLRH 4K8YA 1B5GH 1O3NA 3GICB 4ZAEA 8ESTE 1O2LA 1HAOH 1O3CA 1NO9H 1PQ5A 1BTZA 4A1XA 4ABIA 1C5VA 4UFDH 1HB0B 1T8LA 5EODA 3A89A 1AWHB 1C5UA 2VIDA 5FX5A 1AFQB 3RXMA 3ZVFA 1GMDF 1XUKA 1EB2A 5HGGA 1GVKB 3W95A 3RXHA 1W13U 2F3CE 3KHVA 2FI4E 1BMMH 2FEQH 4O97A 4K2YA 1F5RA 3TIUA 2C8ZB 4ZKSU 4FU7A 1OPHB 3LU9B 1A4WH 4FUEA 4NWKA 1E38B 3P8FA 2B5TB 1BTUA 1D3DB 1TGSZ 4TPIZ 1RTFB 5E8EH 2BQ6B 4IGDA 3VXEH 1RRKA 1TNJA 1YBWA 1NTPA 2PHBA 1ELEE 1FN6A 2Z9LA 1DX5M 1F5LA 3DT0H 1O2HA 1HAPH 3M5NA 1GHVH 1G9IE 1XXFA 3RM0H 1WBGB 1XMNB 1E34B 4WY3A 4ZHMU 1FV9A 4CRAA 1QURH 3FP6E 4BTIB 3BG4B 2QGRA 5C67A 2GT8A 1IQGA 5FBIA 1O34A 3P17H 2BD2A 1JXPA 1KXCA 1W8BH 5DP7A 1Y3VA 2BXUH 3OYPA 2Z9JA 3MU4A 3UUZA 1ZR0A 5FAHA 2H5CA 1FAKH 1OWEA 1V2UT 2VH6A 2B8OH 2BY9X 3QZQA 1OWKA 1C5MD 1GHXH 2FOHA 3QWCH 2C90B 4NA8A 3CS7A 2JH0D 4A1TA 1NT1A 1AZ8A 4A7IB 3FZZA 1NRSH 1E35B 4NFFA 1KTTB 2QV1A 1M9UA 3QTVH 1ANCA 2JH6D 2BDBA 1EZXC 4DJZB 2ZPSA 1SQOA 3GDVA 1ELAA 1NFXA 2VGCC 1MMJN 2XBYA 1P05A 1EXFA 3LC3A 1CBWC 1RIWC 5EQRA 2XC0A 2QXGA 5ABWA 1GI9B 1SGRE 1NM6A 1JRSA 4YLUA 1UCYE 1ZRKA 2J2UA 3A8BA 1UO6A 3T5FH 5L6NH 1MD7A 1O5GH 1SR5C 2XCNA 1V2NT 2GMTB 2A31A 1GJ5H 2BDGA 3BTTE 4DIIH 1HAGE 3NZIA 1O32A 2W5EA 1UTJA 1LO6A 3Q76A 1NU7B 3ZVEA 1PFXC 1AB9B 1CSOE 2HRVA 1VJ9U 4NZLA 1UHBA 1D9IA 1DWBH 2PUQH 5EW2H 4MTBA 1A1RA 1L4ZA 3Q3XA 1H8IH 1PQAA 1MTUA 3ATIA 1TAWA 3LDXH 2H9HA 2DE9A 2YNBA 2ZCHP 4X2WA 4BAHB 3SW2B 3JZ1B 1LVBA 1V2TT 1TBRH 1O0DH 2VVCA 3ZZAA 1TQ0B 2UUFB 4ISIH 1ESBA 2GV6A 1XM1A 1MTVA 1O2WA 2JKHA 2BDAA 1UTKA 3TJOA 1AD8H 2Y6TA 2WV4A 1IAUA 3V7TA 1AVWA 3NPSA 4INHA 1O5DH 4YT6H 1V2KT 2ZU4A 2G5VA 1GHBG 3SUFA 1OWJA 1W12U 4OS1A 3F6UH 1A0LA 3M7UA 1G2LA 1S84A 3S69A 1ANDA 5EQSA 2J94A 1G3BA 4GCHF 3LH1A 1YCPM 4YO9A 2C8WB 1AUTC 1LHEH 1O31A 1GBDA 3P70B 4AFUA 6ESTA 3GY4A 3GYMA 1KIGH 3LGVA 3RLYH 1G32B 4JYVH 5E2OA 4MNYA 5HM9A 4DOQA 1EASA 2PTCE 1HIAA 1W2KH 3VPKA 1GMHF 1TIOA 2ZHFH 2K7XA 4Q7YA 1ZSJA 4WWYA 3D62A 2Y81A 2WUCA 3HKJB 4I8GA 1ELCA 2VWLA 2A7HA 1D6WA 4FUFA 3KN2A 4Z0KA 5H4IB 2ZO3H 3M5LA 2DE8A 5FPYA 3U8OH 1QB1A 2C93B 2PLXA 1ZTLA 1AE5A 4UONA 1HXEH 1TGCA 1QY6A 1O3FA 1EAXA 3K9XB 1UTQA 1Z1JA 1C5PA 1C2IA 4UD9H 1U6QA 4CH2B 1O3EA 2ZNKH 1TPOA 2VINA 2PFEA 4UEHH 1K2I1 1EB1H 1VITF 2VIWA 3G01A 3LC5A 1DUAA 3VB3A 4OS5A 1MUEB 2PV9B 3HK3B 1DM4B 3PM3A 3QO6A 5K7RA 2PSXA 1TGNA 1EPTB 3BIUH 4FUJA 4M7GA 2HALA 1O5FH 2BVRH 1OWIA 1GL1A 3URDA 1ETSH 3GCTG 1A3BH 3F68H 3BTKE 2GX4A 1MCTA 2P3TB 4ABEA 2FOBA 1K1JA 1C4U2 3SV2H 5B6OA 1RXPA 4INKA 3N7OA 2HOBA 1PYTC 3M3SA 1AFQC 2FOMB 2P95A 5EPNA 5A0BA 2PWXA 1MTNB 4CR5A 1KXFA 1GVLA 4WXVA 3RXVA 4KP0A 1ARBA 3RXDA 3TGKE 4ESTE 3KQBA 3E0PB 1SGFG 2EC9H 4NA7A 1GMDG 2HWLB 1QIXB 4XBCA 4IC6A 3T25A 1DWDH 2BY7X 3RC4A 1GI1A 2B7DH 2XBVA 3QX5H 2BDIA 2THFB 3EA8A 2TBSA 3KGPA 5AVDA 1BTWA 2O8TA 3GCNA 1DUEA 5EGMA 2BLWA 1O3DA 3ZZBA 1O2PA 1C5TA 4U32A 1K21H 1WCZA 1ZGIA 2VIVA 3ZZ6A 3ITIA 1JIMA 3STIA 4MG3A 2F83A 2H2ZA 3BG4C 1DWCH 2AGIX 3RXEA 1EOLA 1PQ7A 4NIYA 3E6PH 5EPYA 3O8BA 3KL6A 2ZP0H 2CXVA 1BBRK 3SJ9A 1FUJA 1T7CA 3SUEA 3UNRA 4E7RG 4JZ1A 3SQHE 3MOCA 2GCTC 3MI4A 4NFEA 1QGFA 3LT3A 2TGPZ 4Y8XA 2EI7A 3SJKA 1QBVH 2A2QH 4X8SH 3RXUA 1C1RA 5JBCS 1O3JA 1GCDA 2GGVB 5PTPA 4CRFA 3LGIA 3BTDE 5DP3A 1K1MA 1G30B 3MFJA 5ESBA 4BAOB 5J4QA 2RA0A 3UTUH 1H9IE 4DG4A 1OWHA 5L2YH 2G52A 1MTSA 4X8TH 3KF2A 3ZZ4A 3M35A 3EA9A 1UTLM 1LPKB 5F8ZA 3RU4E 1HCGA 2BDHA 3NK8A 2Y5FA 3BTFE 2GMTC 2OTVA 2R3UA 1BTXA 1LHCH 4QT8C 4X1PU 3SN8A 6CHAB 1GI2A 7KMEH 2V35A 2H6MA 1AB9C 1S6HA 5EU8A 4KTUA 2GT7A 1FY1A 3HATH 2BD8A 3RXQA 2ZHEH 1KLTA 1YCPK 1HRTH 4XDEA 2FYRA 4K1SA 1VJAU 2Z7FE 1DY8A 4ZUHA 4D9RA 4BTUB 5A0CA 1AVXA 1A3EH 1CT0E 1RGQA 1BBRE 3RMLH 3SBKA 2G51A 2VWNA 3F9HA 4LOYH 3A84A 3T62A 3GCHB 2Y5HA 6GCHG 4U2WA 2PKSB 4ZHAA 3F9FA 2VB0A 2FM2A 1GBTA 1BJVA 2WPJS 4NG9H 2AERH 3M36A 4ZROA 1SGEE 4WVPE 1OS8A 2AIQA 2W3IA 1SOTA 3RXPA 1DT2A 1A5IA 4R8TB 1TNLA 1O2MA 2ZDKA 2FTMA 1NY22 1TA2A 1VGCC 4HI3A 4Y0ZE 1ZHPA 3NKKA 4SGAE 2AH4X 1Z6JH 3LONA 1GHBF 1GJCB 1GDUA 3TU7H 1UTMA 5C2ZA 3LGWA 2QF3A 3OTJE 5FX6A 5JB9S 3PWBA 1SGPE 5CMXH 1EAWA 2BXTH 4Q2KA 1W3CA 1JOUB 1C4V2 4GHTA 1W7XH 1HPGA 1XKBC 4IC5A 4ABGA 2BDYA 1TMTH 1GI3A 4NZQA 4WMFA 5FPSA 3PMHB 2VWOA 3SUGA 4O3UA 2FIRH 1OOKB 1ZMNA 4ABHA 7LPRA 3ZZCA 1TPSA 5LPRA 1SBWA 2CN0H 2ZTYA 1NN6A 1VCWA 1YGCH 4RKJB 1C5NH 1MZDA 1BITA 2NU2E 3VXFH 2Q6DA 2J9NA 4Y7BA 1C1MA 1GDNA 1DVAH 2ODQA 1FY5A 1IHSH 1SGQE 2BDCA 2ULLA 3ZV8A 2OXSA 1ARCA 3QUMP 4D9QA 4I8HA 1QRXA 1SLWB 2I6QA 1HAVA 3PB1E 4ZKRU 1PPCE 3EYDA 5J4SA 1OP8A 3UR6A 1PPBH 3PTNA 3S9AA 1Y59T 2QXIA 1Z8JB 3SNEA 4JZEH 5EW1H 2ALVA 2ZDVH 4NWLA 1BHXB 4YT7H 2ZKSA 1UCYH 1WQSA 1QJ6B 3OY6U 1FPHH 4Q7XA 1QJ1B 3MH7A 1VITG 3EA7A 1NFWA 3SGAE 4TWYA 2A32A 3BTME 2A4GA 1EPTC 1L1NA 3RXOA 2GV7A 3MYWA 3ZZDA 1ZPBA 4KTCA 3RU4D 1C1WH 1AHTH 5F6MA 3STJA 1AIXH 3U8TH 4J2YB 1P3CA 1K1OA 2SGQE 2QN5T 1QTFA 4FU8A 1S0RA 1ZLRA 2VNTA 4ABJA 2BLQA 1GGDB 5C1XA 1GCTB 1SQTA 3VB7A 1Y5UT 1GBAA 1QA0A 2WYGA 1ORFA 1FN8A 1L1JA 1C5WB 4ABDA 1KSNA 1ESAA 1C1PA 4FXGH 2OUAA 1GHAG 3RXAA 2P8OB 3H5CB 1THPB 1O2XA 1E36B 4LZ1H 4AB8A 3MU5A 3ZZ8A 3SV8A 4JMYA 4OGYA 3PLBA 2J4IA 1F92A 3ZV9A 1DLKB 3GCOA 8GCHG 3SV9A 3L3TA 1Y5AT 1QHRB 3A82A 3ZYEA 1C2EA 1KLJH 2CGAA 1P2OA 3P8OA 2CV3A 1LKBA 3OU0A 5CHAB 5F03A 3BTQE 1ETRH 2F9OA 1C1SA 1GI8B 2AEIH 1TX8A 1S85A 3QN7A 5EXLA 2ZHQH 3K6ZA 2G5NA 1GWAA 1SGTA 1V2ST 1Z1IA 1CO7E 1H8DH 4XFQA 2Z9GA 1C2KA 2KAIB 1W14U 1DLEA 2W26A 4ISHH 5BRRE 2V0BA 2A5KA 4X6NA 1UTNA 3HKIB 5EXMA 3SO3A 3MH5A 1YYY1 5EQQA 4FVBA 1YPHC 4WJG2 8KME2 3UQVA 2ZPRA 2VVUA 4JK5A 2FX6A 4ISNA 1V2JT 1G3DA 1D3TB 1OP0A 3BSQA 1C1TA 1GJ4H 3H7OA 4MPWA 1BRBE 1Y3XA 2A4OA 2OC1A 2WPKS 3SI4H 1VZQH 1O3AA 1EJMA 1P9UA 1AU8A 3SNBA 1Z8IB 4RSPA 1J15A 4SGBE 1S6FA 1CVWH 5C1UA 3TGJE 4I32A 2FTLE 1GBKA 1BMLA 2ZFQH 1OKXA 4OS6A 1FXYA 4R0IA 1TFXA 3EBNA 1SLVB 4MNWA 1GBMA 1ZJKA 4CRCA 3P92A 1DSTA 5IYTA 3MNBA 1K22H 1BRCE 3FP8E 3LJJA 3PLKA 1LPGB 1OYTH 5C5NA 1O3LA 3EQ0H 2Y80A 1MKWK 1T8OA 1C1OA 2OCVB 4BXSA 2F9UA 3M37A 4BOHA 2GP9B 3ZYDA 1AKSB 5JPMH 4WH6A 1GBFA 1HJAB 2UWOA 3GY2A 5LPFA 3A87A 3UOUA 1S83A 2PW8H 3GDUA 5EXNA 1SGFA 2Z6BD 1FI8A 3AVZA 3RC5A 2W3KA 3SJ8A 1O3BA 4FUGA 3V12A 3AAVA 1HJ8A 2FMJA 3GCHC 1ID5H 4Z6AH 1WV7H 2B0FA 2PKSC 2ZFPH 1XVOA 3E90B 3R0FA 1ELVA 2SGEE 4U01A 3RMOH 2SFAA 2GVFA 4J1YA 2J92A 3DA9B 2XC5A 2B9LA 1Q2WA 1FQ3A 2F9VA 1LMWB 1SC8U 2R9PA 1HAIH 1CGIE 1H1BA 3RUOA 5F8TA 5JB8S 4B73A 3PLPA 1WOFA 5HXFA 1LTOA 4DGJA 1C2MA 1FIZA 3BEUA 6GCHF 5LH8A 1INCA 1CHGA 1VITH 3KQEA 3GYLB 4AB9A 1ZHRA 2C8XB 1C2FA 4GUXA 1IQJA 2BYAX 1LVYA 4CRBA 5DP4A 2P3UB 4FUCA 1FAXA 1UVUH 5A2MH 2J38A 1Y5BT 4FUDA 1UTOA 4IW4E 5DK1A 2DUCA 1AFEH 4DCDA 1P3EA 1ABIH 1O3IA 2XRCA 3RXTA 5E0GA 3RXCA 1LQEA 1ZRBA 1V2LT 4TWWA 3RU4T 3T27A 1GJ8B 2RDLA 3T29A 2BX4A 1C5YB 4WXIA 3SU3A 4Q80A 2PGBB 7ESTE 2ZTZA 1BTHH 1C5ZB 1P0SH 1KDQB 3PO1B 5GDSH 1TYNA 2FWWA 2OBOA 5BPEA 4X1QU 2AFQB 3MO6A 2K1QA 4OS7A 3ODDA 4CBOA 2O8MA 1TONA 1TRNA 2EEKA 2BHGA 4UFEH 2RG3A 1L0ZA 5I46H 2ZGBH 1F2SE 1AO5A 2QY0B 2ZU1A 1SVPA 3IITA 3A8AA 1O3MA 3DFJA 1NZQH 3Q3YA 4H42U 3LPRA 1BRUP 2GDEH 3ZVGA 4B1TA 2AGEX 1MU8B 1THRH 3O8RA 3SNAA 2Y5GA 1XUJA 5C20A 1SLUB 4GSOA 1LHFH 1Y8TA 3SU5A 2OC8A 1QR3E 3BG8A 2LNCA 2AMDA 1VCQA 3S9CA 4BAMB 3LKWA 2GKVE 1ZOMA 2O8LA 1DDJA 2R2MB 1MZAA 1Q31A 2XWAA 5GXPA 3FAOA 3TK6A 1H9HE 1IQMA 2BQ7B 2G55A 2QCYA 1PPFE 1Z71A 2BOHB 4MNVA 3O8DA 3ZZ7A 3LIWA 1QB9A 1WYKA 5DP8A 1GCTC 1QB6A 3BF6H 2XW9A 1DSUA 1DOJA 2ZIQH 1TRMA 1PJPA 1BBRH 2ZDAH 3IWMA 2FESH 3TNTA 1O2UA 4O3TA 3MNXA 2P8OC 4AGKA 1RS0A 1KXAA 4I7YH 2QXHA 3A86A 1ACBE 1P2IA 3VGCB 2H5DA 2XC4A 3GY6A 4DURA 1EJNA 1F0RA 2ZTXA 6LPRA 2TGTA 3M3TA 1P03A 3BEIB 1O2NA 2Q1JA 5CHAC 3L6PA 4CRDA 1IQIA 1YPJH 1FIWA 1SB1H 4OS4A 2NU1E 5C5OA 5GWZA 1TPPA 2PUXB 2QYIA 1YM0A 1GHAF 1O2OA 2BD4A 5T6DA 1Z6EA 1KXDA 4JZDH 3U9AH 4Y76A 3SU6A 2SGAA 4Y79A 3SNDA 4DW2U 2EA3A 3A7YA 3I78A 4B2CA 1TGBA 3ATLA 2XBWA 5TCCA 1NROH 8GCHF 1MQ5A 2QAAA 3E0NB 1SHYA 1O5BB 1YPMH 1FY8E 2QC2A 3MNSA 2FZZA 1LCYA 3GISB 1A0JA 1TWXB 2ZZUH 3PV4A 2FI5E 1MU6B 2CJIA 4GAWA 3B8JA 1BB0B 3K65B 1BHXF 4GHQA 1YCPH 3TH2H 1HYLA 2BZ6H 1HIAB 1AGJA 1C2GA 1Y3YA 3B9FH 3RM2H 3FANA 3NCLA 2O8WA 1VCPA 1F0TA 2F9BH 7GCHG 3AASA 1UVPA 1GJBB 2EI8A 2ZHDA 1MCVA 5FCKA 3SUDA 4D7FA 4VGCB 1YP9A 1A2CH 3TLOA 1UVTH 1MKXK 5TJXA 4ISLA 4XSKU 1OXGA 4AG2A 4CRGA 3R3GB 2XTTB 4Y0YE 1O33A 2BD7A 1QBOA 1T31A 1JWTA 1KXEA 9LPRA 5LPEA 1A0HB 1O37A 1G37A 1AWFH 5DKMA 1Z8GA 5E0HA 3UR9A 1EJAA 2J34A 3LH3A 3NUMA 1F7ZA 1SGYE 1YLCA 2VH0A 2GDDA 4AFZA 5AFZH 3LJOA 4IS5A 1O2GH 3D65E 4X0WU 3V3MA 1GJ9B 2VIQA 1V2MT 2XBXA 4DVAU 1TALA 1C2LA 3GY7A 4U30A 3TJNA 1TE0A 4YOIA 1J8AA 5DP9A 3HPTB 3LGYA 3O8CA 2IPHA 4ZKNU 1C5QA 1AI8H 1MQ6A 1LHDH 1BA8B 1BDAA 5LGOA 2A45B 2C8YB 1P12E 4IMQA 4B71A 1EZUC 3E1XB 1HLTH 4ZXXH 2SNVA 4A1VA 1C5XB 1YKTA 4WMEA 2CMYA 1NRNH 2BOKA 4CR9A 2H1UA 1RTKA 1RTLA 4GVUA 1HXFH 2WYJA 1C2HA 9ESTA 2W7UA 2W7SA 2P94A 4ASHA 2D1JA 2Z9KA 1CHOG 2ANWA 4K69A 1CGJE 4YOGA 2BD5A 3U98H 2O9QA 1G36A 5DG6A 4K60A 3AAUA 3TH3H 2H9TH 3M3VA 2BY6X 1RIWB 4FUBA 1P11E 3M5OA 1GBEA 3HGPA 3A8CA 2G4UA 3TH4H 3VFEA 1OX1A 1XUHA 5A8XA 1J14A 2WV5A 2HPQH 2XCFA 5ETXA 2Z94A 3TITA 3T2NA 2WPHS 2XYAA 3P95A 4K1TA 4KELA 5E2PA 4AFSA 4YOJA 1UMAH 4AOQA 3DD2H 1CT4E 1OP2A 1IOEA 2UUJB 4LK4A 4NGAH 2A0QB 1AVGH 2F9PA 4O9VA 2YOLA 1C5LH 1TPAE 3SU1A 2ESTE 3PO1C 2VU8E 1CA8B 1O5EH 4A92A 1CA0B 1WSSH 3TK9A 2LIZA
chains in the Genus database with same CATH superfamily
3V0XA 1YLNA 5L2ZH 3UWIA 1QBNA 2F91A 1GBIA 3FZDA 2QF0A 1H9LB 2PKAB 4X8VH 4WF8A 3WW7A 1ELTA 1DXWA 2K0QA 1SQAA 3FO8D 3OFND 3A7XA 3HK6B 4ABAA 3A88A 2ZEBA 1LVMA 2R0KA 3SGQE 1SG8B 2GCHG 5ESTE 2PGQB 3ENSB 4X2YA 1GI5A 3F1SB 1SPJA 3QGNB 1GBHA 1DICA 4RT1A 3C1KA 4E06H 2ODPA 5A09A 2J98A 2SGDE 1TQ7B 4YLQH 2FOGA 4TYDA 1N1LA 2P16A 2V3OH 2QE7D 1GHYH 4ABBA 2WPIS 3WY8A 2HGTH 4AN7A 4D76A 1MAXA 1OWDA 2H9EH 1P01A 1NPMA 1WTHD 3SHCH 3T28A 3RXRA 1C2DA 1XX9A 1K28D 1FJSA 1NFUA 1TOCB 4E7NA 4IN2A 1IHTH 1DITH 5A0AE 4Y71A 3MU1A 3HGNA 1EX3A 2AS9A 1T4UH 3VGCC 3UFAA 5CDFE 5K0HA 4XE4A 4JCNA 1O2SA 3KCGH 3PMAB 3S9BA 3SZNA 1IQHA 2BVXH 4TY7A 1E1QD 1QCPA 1G3CA 2Z3CA 3FP7E 1O38A 2OD3B 1BIOA 3A81A 1PPGE 2KCPA 3ZVAA 2HNTC 4OS2A 3KQCA 1AKSA 1MTNC 1J9CH 4I31A 1AE8H 2A5AA 3QLPH 1SMFE 3EDXB 2NU3E 5HYOA 1ELDE 2A7CA 1V2QT 2Q6FA 1DANH 1JRTA 3TNSA 1P2MA 1TX7A 1S82A 1NRRH 1H8HD 3C27B 4MPVA 3RXIA 2A2XH 4NIXA 4AFQA 2BTCE 1QQ4A 1NU9A 4BXWA 2RFKC 1MKWH 3ZVBA 1EZSC 1P02A 1NS3A 3A80A 4Y11E 1S0QA 2VVVA 3ATKA 3TJUA 1TABE 4CHAB 1O2RA 1BZXE 1IQLA 3KNXA 1KLIH 4GPGA 3UNQA 1ESTA 1FDPA 2ZF0H 1GG6B 1FY4A 2LELA 1P57B 1UW7A 4HG6A 1K1PA 1T32A 1TRYA 1TNHA 3RDZA 5JDUB 2AMQA 4RT0A 1N6YA 3Q00A 1GBBA 4GLYA 4AX9H 1ZZZA 1V2WT 4VGCC 1FONA 1W0YH 3U28C 3A85A 1PYTD 1P04A 1P06A 2KCAA 1MAYA 1PPZA 5F53A 1QNJA 4TPYA 1GHWH 1NRQH 2JETB 1GJAB 2Z3DA 4DT7B 1CGHA 3URCA 5G4BA 1J16A 1SGCA 5F8XA 1THSH 2FOCA 1F0UA 1O3GA 2FXRA 2F9NA 3E3TA 3SU0A 1UCYK 1GBLA 1ZGVA 1BUIA 4X6MA 3KQDA 1O3HA 1ANBA 3BEFB 5HM2A 2D8WA 5A8ZA 7GCHF 1DS2E 2ZPQA 1HJ9A 3FVFB 4A6LA 1TMUH 1W11U 1ELGA 1HAVB 4HTCH 4FVDA 3PYHA 3BV9B 5GCHG 3RLWH 1HDTH 3MO9A 1GHZA 1O2JA 2ZECA 3UQOA 1UK3A 5EIYA 2AGGX 2UUKB 4Y10E 4X2XA 3F9GA 2FODA 4Y6DA 3OY5U 4FUIA 1KDQA 3MH4A 1FMGA 1NFYA 3A7ZA 5JYIA 1L2EA 2HNTF 6CHAC 1SGDE 2AMPA 1T8NA 3ZZ9A 1P2JA 4LZ4B 3P8GA 1NBMD 1GI7B 2ZCKP 2OP9A 2GCTB 3F0OA 4ZH8A 2FPZA 1QRWA 4RI0A 1BT7A 3SOSA 1RJXB 1SI5H 1C1UH 2OQUA 4KTSA 1C5OH 3UPEA 1JMOH 3A83A 1LVOA 1UVOA 1V2VT 1YC0A 4MLFB 5E0JA 1LKAA 1ZSKA 2AHME 2G00A 4BAQB 1O2YA 2Q6GA 2P93A 1BOQA 1BRAA 1TB6H 3IG6B 2GZ8A 1D4PB 3U69H 1EP5A 4JZIA 4Y8ZA 4NCYA 5A8YA 1E37B 4JZFH 1O39A 4IN1A 3DSGA 3VB4A 2IOTA 4MPXA 4XOJA 5T6GA 1C1NA 1UTPA 3RXLA 1W10U 2NU4E 3E91A 1Z7KA 1V3XA 4HFPB 5T3HA 2QIQA 1W0ZU 1CHOF 4IMZA 2A4QA 2FYQA 3Q3KA 1HAZB 3RXFA 1EPTA 4K3JA 1T4VH 5T6FA 3LGUA 4XBDA 1GMCG 2HNTE 3GY3A 3PROA 1MD8A 1CA0C 1QRZA 1Y3UA 1O5AB 1XUFA 3H09A 3VEQB 4B75A 1G3EA 2STBE 4WMDA 2BMGB 1V2PT 3ESTA 3SZEA 3MNCA 1NESE 3RXSA 5EG4A 2SGFE 3DHKH 1IQFA 2TGAA 2ZGJA 3BTGE 2D26C 2C3SA 2Y82A 1O2IA 2ZWLH 5FCRA 2TIOA 3CS0A 2FS8A 4YM9A 1IQNA 2ZU2A 1ETTH 1P9SA 3M61U 2ZGXH 1FNIA 3GS9A 1YPLH 2YMSD 2WPDD 1GL0E 1VR1H 1P8VC 2CF8H 1V6DA 3QZRA 1EATA 3UIRA 4JK6A 3BIVH 2BX3A 1SLXB 2FO9A 4TT3D 2RA3A 4PROA 5GPIB 3RXGA 2JH5D 1DFPA 1SFIA 2UUYA 5L30H 2FOEA 2D2DA 4MNXA 3TPIZ 1HAXB 4D8NA 1VGCB 4RN6A 1N6XA 1FPCH 1ZMLA 3AW1A 1K9OE 1TOMH 4CBNA 2GCHF 1ZJDA 2BM2A 1YPHE 3BN9A 4MVNA 2BY5X 2WPMS 4NSVA 3GOVB 2BZAA 3EE0B 2ANKH 3KEEA 1A46H 3W94A 1Y3WA 2TGDA 4FUHA 4F4OC 5GIBA 3M5MA 4H6SB 2CHAB 1EAIA 1YF4A 4ZHLU 2Y7XA 2WINI 2FOFA 5HIZA 1CT2E 1BTYA 2RCEA 4O03A 3MWIU 2HVXA 4NIVA 4ACAA 1F0SA 4UDWH 3K6YA 4IBLH 3PWCA 3SNCA 3MO3A 1ZMJA 1Z8RA 3A7WA 1IQKA 1GGDC 1SGIB 2OBQA 2QA9E 4KGAA 4HGCA 2HLCA 4AYVB 3A8DA 1EP6A 3F9EA 4X1RU 2GZ9A 4Q63A 3RMMH 1GPZA 1O35A 1Q3XA 2NU0E 1HFDA 2WPLS 1FZZA 1OSSA 3AW0A 3D23A 4CH8B 5FPTA 4H4FA 2XNIA 1WU1A 1TNKA 1XUGA 3F0PA 1LDTT 1MKXH 2TRMA 1DE7H 4MPUA 1UHBB 4K1EA 2HPPH 5GJ4B 3SJOA 3UWJH 4UE7H 4X1SU 4BTTB 4I8LA 5JBTA 3MMGA 1O2TA 3T26A 3U1JB 3SJIA 2ZGHA 2Y7ZA 3E16B 1SFQB 5EJZA 3PMBB 3RMNH 1S5SA 3VB6A 4CHAC 5DO4H 1BJUA 5HMAA 3FFGA 3UOPA 1QL8A 1LPZB 1KTSB 4M9FA 1DWEH 3SI3H 1SKYE 2PSYA 1GG6C 1ZTKA 1O36A 1TA6A 1EKBB 3NWUA 2FP7B 1GI6A 3NXPA 1ZSLA 1CU1A 2CF9H 2UWPA 2VIPA 3ZVCA 4ABFA 2OLGA 4OGXA 1FX0B 2G81E 4AG1A 1C1VH 2OC0A 2R0LA 1ABJH 5CE1A 3OAAD 2P59A 2GZ7A 4YTAA 3UREA 1JIRA 1O2VA 2G4TA 2JETC 1ZPCA 2XOKD 3KYFA 3RXKA 1O3PB 5DP5A 1P2KA 5JBBS 1X7AC 3SV7A 1XVMA 1N8OB 1QA7A 1C9PA 1MH0A 1ZHMA 3LGTA 3S7HB 1C4Y2 4B2AA 1O2ZA 2ZQ2A 5SGAE 3SU4A 3Q77A 4AGJA 1O2QA 3GDSA 1SOZA 2BLOA 3RXBA 1C9TA 4LXBH 1ELFA 1EAUA 2V3HH 1YPGH 4D7GA 3I29A 1ANEA 1GDQA 1GI4A 1SHHB 3CP7A 1WUNH 2J95A 3DFLA 4AORA 2AYWA 2BVSH 3TJVA 1AZZA 3EGKH 2PR3A 2R2WU 1QQUA 1HJAC 1UVSH 1UK2A 2QXJA 3RP2A 1GJ6A 4NIWA 3U1IB 1PQ8A 1LQDB 1HV7A 2PKAA 1CE5A 5GCHF 2YNAA 4HZHA 1O5CB 1TNIA 3OSYA 5IDKA 1S81A 1XXDA 4B74A 2KFWA 3KQ5A 1XKAC 3JZ2B 1C5SA 3MHWU 2WUBA 3ATWA 2ZFSA 1GJDB 2ALPA 2ZU5A 1K0HA 2ZQ1A 3SORA 3SU2A 2VBCA 3A7TA 3MH6A 5B6LA 3M7QA 1A7SA 4K8BA 3L33A 4WH8A 2FX4A 1K1NA 1L1GA 1MTWA 3UB0A 1QZ8A 4BNRA 5I25A 1G2MA 1EQ9A 2XXLA 1DY9A 1MBMA 3N7DA 1TBQH 4JYUH 2ZDMA 2NWNA 3ATMA 3DSPA 4B6FA 5AF9H 4BAKB 4ISOA 3I77A 3EAJA 1YLDA 2ZFFH 3PMJA 3D49H 1HAYB 5TCAA 3N99A 3H7TA 4H6TA 3TGIE 1HGTH 1GBJA 1RD3B 1KY9A 1E0FD 1BCUH 5DGJA 1YPEH 1D6RA 1OHHD 2OQ5A 3SYJA 3MU8A 1GI0A 2BQWB 3QGJA 1P2NA 1TX6A 1AY6H 1L4DA 2BLVA 4YXWD 2A1DB 1ZTJA 1C2JA 4X2VA 1WTGH 1ELBA 2UWLA 1TLDA 3TK5A 3K2UA 1BTPA 3E8LA 5DJ7A 1TBZH 2VGCB 1WAYB 2ANYA 4XBBA 2FOAA 3MU0A 1C5RA 1CBWB 1F5KU 5C3NA 2IJOB 2ZU3A 2FLBH 1HBTH 3M7TA 1K1LA 1TMBH 2P3FH 3ZVDA 1D3QB 4JYTA 1P09A 1EOJA 3OTPA 3P6ZB 3SHAH 1PPEE 4MDSA 3SV6A 4I8KA 1D3PB 1GMCF 1FY3A 1HAHH 3U8RH 2L6OA 4X6PA 1B0FA 1GBCA 1P10A 3BTWE 1AMHA 1EUFA 4Y8YA 2ZFTA 2EI6A 1B0EA 2LP6A 1B7XB 4ZXYH 5C1YA 1QFKH 3A7VA 3TVJB 1P2QA 2V6NA 4GCHG 4X6OA 2SNWA 1YPKH 2BD9A 3BTHE 4Q4LA 5FXLA 3SGBE 1A5HA 3MTYA 1QJ7B 2ZDLA 4F49A 2ZGCA 2SGPE 4AZ2B 1DXPA 1QL7A 2VWMA 3DUXH 2AIPA 3P8NA 3LOXA 2KAIA 1UJ1A 4X8UH 2BD3A 2ZI2H 1HUTH 4B76A 2VIOA 2CHAC 2OINA 4Y7AA 1GMHG 2M5TA 3OEHD 2O8UA 3BTEE 1GVZA 2R3YA 3ELAH 3S7KB 5FBEA 2FDAA 4KKDA 2GTBA 1AN1E 4YESB 4INLA 1XUIA 2ZC9H 3GY8A 1FLEE 2ZFRH 1TNGA 1TGTA 4THNH 3VB5A 5EOKA 1O3KA 2FI3E 4I33A 1KYNA 4Q7ZA 1HNEE 3RC6A 3PRDA 1ZPZA 2IN2A 1NRPH 2I6SA 4A5TS 2PTNA 3UY9A 1PPHE 1KMHB 1SL3A 2LPRA 2ZA5A 2ZG0H 4UFGH 4CREA 1SGNE 3KIDU 2OC7A 1SSXA 1T8MA 3GY5A 2ASUB 4K5ZA 2XWBI 1NC6A 3QDZB 4YZUA 4E05H 4UFFH 4NSYA 1WQVH 4ZMAH 3QK1A 5AFYH 1AUJA 3PTBA 1O2KA 3ZZ3A 1JBUH 1V2RT 3B23B 1OYQA 2ILNA 3QTOH 3SQEE 2VJ1A 3F2HA 4NA9H 2ZCLP 3OX7U 4MQAA 1A5GH 5AHGH 1O30A 2ZHWH 1BMNH 1V2OT 2A5IA 5JBAS 4B2BA 1K1IA 4ASUD 3UAIC 1CQQA 2GD4B 2STAE 1EZQA 1MBQA 8LPRA 2G8TA 1DPOA 2C4FH 5FHTA 3S0NA 5DPAA 1H4WA 2A7JA 1BMFD 1O3OA 1RFNA 1QL9A 4FU9A 1IQEA 1W7GH 3EE7A 5DP6A 4RKOB 3V13A 3UNSA 4DIHH 4ZKOU 1UK4A 2FS9A 2TPIZ 1ZYOA 2WSSD 1AQ7A 2ZDNA 4DY7B 4DT4A 4I8JA 4TY6A 4X1NU 2KCYA 1GJ7B 1C1QA 1N8OC 3ODFA 2ANMH 1BQYA 1LHGH 2Z9IA 1KXBA 4BANB 3RXJA 2Z3EA 3GCTF 2OK5A 2BY8X 4F55A 1J17T 4AYYB 2A4RA 1A61H 3ZZ5A 1BMAA 3CENA 2ODYB 2BB4A 2FLRH 4K8YA 1B5GH 1O3NA 3GICB 4ZAEA 8ESTE 1O2LA 2V7QD 5DN6D 1HAOH 5GNDA 1O3CA 1NO9H 1PQ5A 1BTZA 4A1XA 4ABIA 1C5VA 4UFDH 1HB0B 2CK3D 1T8LA 5EODA 3A89A 1AWHB 1C5UA 2VIDA 5FX5A 1AFQB 3RXMA 3ZVFA 1GMDF 1XUKA 1EB2A 5HGGA 1GVKB 3W95A 3RXHA 1W13U 2F3CE 3KHVA 2FI4E 1BMMH 2FEQH 4O97A 4K2YA 1F5RA 3TIUA 2C8ZB 4ZKSU 1YY3A 4FU7A 1OPHB 3LU9B 1A4WH 4FUEA 3ZIAD 4NWKA 1E38B 3P8FA 2J98B 2B5TB 1BTUA 1D3DB 1TGSZ 4TPIZ 1RTFB 5E8EH 2BQ6B 4IGDA 3VXEH 1RRKA 1TNJA 1YBWA 1NTPA 2PHBA 1ELEE 1FN6A 2Z9LA 1DX5M 1F5LA 3DT0H 1O2HA 1HAPH 3M5NA 1GHVH 1G9IE 1XXFA 3RM0H 1WBGB 1XMNB 1E34B 4WY3A 4ZHMU 1FV9A 4CRAA 1QURH 3FP6E 4BTIB 3BG4B 3DSOA 2QGRA 5C67A 2GT8A 1IQGA 5FBIA 1O34A 3P17H 2BD2A 1JXPA 1KXCA 1W8BH 5DP7A 1Y3VA 2BXUH 3OYPA 5C17A 2Z9JA 3MU4A 4P02A 1ZR0A 3UUZA 5FAHA 2H5CA 1FAKH 1OWEA 1V2UT 2VH6A 2B8OH 2BY9X 3QZQA 1OWKA 1C5MD 1GHXH 2FOHA 3QWCH 2C90B 4NA8A 3CS7A 2JH0D 4A1TA 3AK5A 1NT1A 1AZ8A 4A7IB 3FZZA 1NRSH 1E35B 4NFFA 1KTTB 2QV1A 1M9UA 3QTVH 1ANCA 2JH6D 2BDBA 1EZXC 4DJZB 2ZPSA 1SQOA 3GDVA 1ELAA 1NFXA 4OM9A 2VGCC 1MMJN 2XBYA 1P05A 1EXFA 1MABB 3LC3A 1CBWC 1RIWC 5EQRA 3F2FA 2XC0A 2QXGA 5ABWA 1GI9B 1SGRE 1NM6A 1JRSA 4YLUA 1UCYE 1ZRKA 2J2UA 3A8BA 1UO6A 3T5FH 5L6NH 1MD7A 1O5GH 1SR5C 2XCNA 1V2NT 2GMTB 2A31A 1GJ5H 2BDGA 3BTTE 4DIIH 1HAGE 3NZIA 1O32A 2W5EA 1UTJA 1LO6A 3Q76A 1NU7B 3ZVEA 1PFXC 4B6EA 1AB9B 1CSOE 2HRVA 1VJ9U 4NZLA 1UHBA 1D9IA 1DWBH 2PUQH 5EW2H 4MTBA 1A1RA 1L4ZA 3Q3XA 1H8IH 1PQAA 1MTUA 3ATIA 1TAWA 5HIYA 3LDXH 2H9HA 2DE9A 2YNBA 2ZCHP 4X2WA 4BAHB 5C0TA 3SW2B 3JZ1B 1LVBA 1V2TT 1TBRH 1O0DH 2VVCA 3ZZAA 1TQ0B 2UUFB 4ISIH 1ESBA 2GV6A 1XM1A 1MTVA 2J97A 1O2WA 2JKHA 2BDAA 1UTKA 3TJOA 1AD8H 2Y6TA 2WV4A 1IAUA 3V7TA 1AVWA 3NPSA 4INHA 1O5DH 4YT6H 1V2KT 2ZU4A 2G5VA 1GHBG 3SUFA 1OWJA 3PV2A 5C94A 1W12U 4OS1A 2YMSB 1A0LA 3F6UH 3M7UA 3F2GA 3FOAA 1G2LA 1S84A 3S69A 1ANDA 5EQSA 2J94A 1G3BA 4GCHF 3LH1A 1YCPM 4YO9A 2C8WB 1AUTC 1LHEH 1O31A 1SQRA 2WZQA 2W6JD 1YWUA 1GBDA 3P70B 4AFUA 6ESTA 3GY4A 3GYMA 1KIGH 3LGVA 3RLYH 1G32B 4JYVH 5E2OA 4MNYA 5HM9A 4DOQA 2KCOA 1EASA 2PTCE 1HIAA 1W2KH 3VPKA 1GMHF 1TIOA 2ZHFH 2K7XA 4Q7YA 1ZSJA 2HVYB 4P00A 4WWYA 3D62A 2Y81A 2WUCA 3HKJB 4I8GA 1ELCA 2VWLA 2A7HA 1D6WA 4FUFA 3KN2A 4Z0KA 5H4IB 2ZO3H 3M5LA 2DE8A 5FPYA 3U8OH 1QB1A 2C93B 2PLXA 1ZTLA 1AE5A 4UONA 1HXEH 1TGCA 1QY6A 2V3MA 1O3FA 1EAXA 3K9XB 1UTQA 1Z1JA 1C5PA 1C2IA 5IK2D 4UD9H 1U6QA 4CH2B 1O3EA 2ZNKH 1TPOA 2VINA 2PFEA 4UEHH 1K2I1 2K8IA 1EB1H 1VITF 2QF4A 2VIWA 3G01A 3LC5A 1DUAA 3VB3A 4OS5A 2M2AA 1MUEB 2PV9B 3HK3B 1DM4B 3PM3A 3QO6A 5K7RA 2PSXA 1TGNA 1EPTB 3BIUH 4FUJA 4M7GA 2HALA 5T1VA 1O5FH 2BVRH 1OWIA 1GL1A 3URDA 1ETSH 3GCTG 1A3BH 3F68H 3BTKE 2GX4A 1MCTA 2P3TB 4ABEA 2FOBA 1K1JA 1C4U2 2KX4A 5B6OA 3SV2H 1RXPA 4INKA 3N7OA 2HOBA 1PYTC 3M3SA 1AFQC 2FOMB 2P95A 5EPNA 5A0BA 2PWXA 1MTNB 4CR5A 1KXFA 1GVLA 4WXVA 3RXVA 4KP0A 1ARBA 3RXDA 3TGKE 4ESTE 3KQBA 3E0PB 1SGFG 2EC9H 4NA7A 1GMDG 2HWLB 1QIXB 3F3BA 4XBCA 4IC6A 3T25A 1DWDH 2BY7X 3RC4A 1GI1A 2B7DH 2XBVA 3QX5H 2BDIA 2THFB 3EA8A 2TBSA 3KGPA 5AVDA 1H8ED 1BTWA 2O8TA 3GCNA 1DUEA 5EGMA 2BLWA 1O3DA 3ZZBA 1O2PA 1C5TA 4U32A 1K21H 1WCZA 1ZGIA 2VIVA 3ZZ6A 3ITIA 3WWBA 1JIMA 3STIA 4MG3A 2F83A 2H2ZA 3BG4C 1DWCH 2AGIX 3RXEA 1EOLA 1PQ7A 4NIYA 3E6PH 5EPYA 3O8BA 3KL6A 2ZP0H 2CXVA 1BBRK 3SJ9A 1FUJA 1T7CA 3SUEA 3UNRA 4E7RG 4JZ1A 3SQHE 3MOCA 3KYGA 2GCTC 3MI4A 4NFEA 1QGFA 4Z1MD 3LT3A 2TGPZ 4Y8XA 2EI7A 3SJKA 1QBVH 2A2QH 4X8SH 2KM0A 3RXUA 1C1RA 5JBCS 3DCLA 1O3JA 1GCDA 2GGVB 5PTPA 4I86A 4CRFA 3LGIA 3BTDE 5DP3A 1K1MA 1G30B 3MFJA 5ESBA 4BAOB 5J4QA 2RA0A 3UTUH 1H9IE 4DG4A 1OWHA 5L2YH 2G52A 1MTSA 4X8TH 3KF2A 5FL7D 3ZZ4A 3M35A 3EA9A 1UTLM 1LPKB 5F8ZA 3RU4E 1HCGA 2BDHA 3NK8A 2Y5FA 3BTFE 2GMTC 2OTVA 2R3UA 1BTXA 1LHCH 4QT8C 4X1PU 3SN8A 6CHAB 1GI2A 7KMEH 2V35A 2H6MA 1AB9C 5KECA 1S6HA 5EU8A 4KTUA 3W1EA 2GT7A 1FY1A 3HATH 2BD8A 3RXQA 2ZHEH 1KLTA 1YCPK 1HRTH 4XDEA 2FYRA 4K1SA 1VJAU 2Z7FE 3FN8A 1DY8A 4ZUHA 4D9RA 4BTUB 5A0CA 1AVXA 1A3EH 1CT0E 1RGQA 1BBRE 3RMLH 3SBKA 2G51A 2VWNA 3F9HA 4LOYH 3A84A 3T62A 3GCHB 2Y5HA 6GCHG 2IJD1 4U2WA 2PKSB 4ZHAA 3F9FA 1COWD 2VB0A 2FM2A 5EJLA 2YMSC 1GBTA 2RDEA 1BJVA 2WPJS 4NG9H 2AERH 3M36A 4ZROA 1SGEE 4WVPE 1OS8A 1W0JD 2AIQA 2W3IA 1SOTA 3RXPA 1DT2A 1A5IA 4R8TB 1TNLA 1O2MA 2ZDKA 2FTMA 1NY22 1TA2A 1VGCC 4HI3A 4Y0ZE 1ZHPA 3NKKA 4SGAE 2AH4X 1Z6JH 3LONA 1GHBF 1GJCB 1GDUA 3TU7H 1UTMA 5C2ZA 3LGWA 2QF3A 3OTJE 5FX6A 5JB9S 3PWBA 1SGPE 5CMXH 1EAWA 2BXTH 4Q2KA 1W3CA 1JOUB 1C4V2 4GHTA 2W6ID 1W7XH 1HPGA 1XKBC 4IC5A 4ABGA 3FKSD 2BDYA 1TMTH 1GI3A 4NZQA 4WMFA 3OE7D 5FPSA 3PMHB 2VWOA 3SUGA 4O3UA 2FIRH 1OOKB 1ZMNA 4ABHA 7LPRA 3ZZCA 1TPSA 5LPRA 1SBWA 2CN0H 2ZTYA 1NN6A 1VCWA 1YGCH 4RKJB 1C5NH 1MZDA 1BITA 2NU2E 3VXFH 2Q6DA 2J9NA 4Y7BA 1C1MA 1GDNA 1DVAH 2ODQA 1FY5A 1IHSH 1SGQE 2BDCA 2ULLA 1VKYA 3ZV8A 2OXSA 1ARCA 3QUMP 4D9QA 4I8HA 1QRXA 1SLWB 2I6QA 1HAVA 3PB1E 4ZKRU 1PPCE 3EYDA 5J4SA 1OP8A 3UR6A 1PPBH 3PTNA 3S9AA 1Y59T 2QXIA 1Z8JB 3SNEA 4JZEH 5EW1H 2ALVA 2ZDVH 4NWLA 1BHXB 1NBME 4YT7H 2ZKSA 1UCYH 1WQSA 1QJ6B 3OY6U 1FPHH 4Q7XA 1QJ1B 3MH7A 1VITG 3EA7A 1NFWA 3SGAE 4TWYA 2A32A 3BTME 2A4GA 1EPTC 1L1NA 3RXOA 2GV7A 2XNDD 3MYWA 3ZZDA 1ZPBA 4KTCA 3RU4D 1C1WH 1AHTH 5F6MA 3STJA 1AIXH 3U8TH 4ACBA 3MQKC 4J2YB 1P3CA 1K1OA 5HKKD 2SGQE 2QN5T 1QTFA 4FU8A 4TSFD 1S0RA 1ZLRA 2VNTA 4ABJA 2BLQA 1GGDB 4AC9A 5C1XA 1GCTB 1SQTA 3VB7A 1Y5UT 1GBAA 1QA0A 2WYGA 1ORFA 1FN8A 1L1JA 1C5WB 4ABDA 1KSNA 1ESAA 1E79D 1C1PA 4FXGH 2OUAA 1GHAG 3RXAA 2P8OB 3H5CB 1THPB 1O2XA 1E36B 4LZ1H 4AB8A 3MU5A 3ZZ8A 3SV8A 4JMYA 4OGYA 3PLBA 2J4IA 1F92A 3ZV9A 1DLKB 3GCOA 8GCHG 3SV9A 3L3TA 1Y5AT 1QHRB 3A82A 3ZYEA 1C2EA 1KLJH 2CGAA 1P2OA 3P8OA 2CV3A 1LKBA 3OU0A 5CHAB 5F03A 3BTQE 1ETRH 2F9OA 1C1SA 1GI8B 2AEIH 1TX8A 3NRLA 1S85A 3QN7A 2GJGA 5EXLA 2ZHQH 3K6ZA 2G5NA 1GWAA 1SGTA 1V2ST 1Z1IA 1CO7E 1H8DH 4XFQA 2Z9GA 1C2KA 2KAIB 1E1RD 1W14U 1DLEA 2W26A 4ISHH 5BRRE 2V0BA 2A5KA 4X6NA 1UTNA 3HKIB 5EXMA 3SO3A 3MH5A 1YYY1 5EQQA 4FVBA 1YPHC 4WJG2 8KME2 3UQVA 2ZPRA 2VVUA 4JK5A 2FX6A 4ISNA 1S6LA 1V2JT 1G3DA 1D3TB 1EFRD 1OP0A 3BSQA 1C1TA 1GJ4H 3H7OA 4MPWA 1BRBE 1Y3XA 2A4OA 2OC1A 2WPKS 3SI4H 1VZQH 1O3AA 1EJMA 1P9UA 1AU8A 3SNBA 1Z8IB 4RSPA 1J15A 4SGBE 1S6FA 1CVWH 5C1UA 3TGJE 4I32A 2FTLE 1GBKA 1BMLA 2ZFQH 2WV9A 1OKXA 4OS6A 1FXYA 4R0IA 1TFXA 3EBNA 1SLVB 4MNWA 1GBMA 1ZJKA 4CRCA 3P92A 1DSTA 3OEED 5IYTA 3MNBA 1K22H 1BRCE 3FP8E 3LJJA 3PLKA 1LPGB 3PRBA 1OYTH 5C5NA 1O3LA 4FOUC 3EQ0H 2Y80A 1MKWK 1T8OA 1C1OA 2OCVB 4BXSA 2F9UA 3M37A 4BOHA 2GP9B 3ZYDA 1AKSB 5JPMH 4WH6A 1GBFA 1HJAB 2UWOA 3GY2A 5CHBA 5LPFA 3A87A 3UOUA 1S83A 2PW8H 3GDUA 5EXNA 1SGFA 2Z6BD 1FI8A 3AVZA 3RC5A 2W3KA 3SJ8A 1O3BA 4FUGA 3V12A 3AAVA 1HJ8A 2FMJA 3N7EA 3GCHC 1ID5H 2PP6A 4Z6AH 1WV7H 2B0FA 2PKSC 2ZFPH 1XVOA 3E90B 3R0FA 1ELVA 2SGEE 4U01A 3RMOH 2SFAA 2GVFA 4J1YA 2J92A 3DA9B 2XC5A 2B9LA 1Q2WA 1FQ3A 2F9VA 1LMWB 1SC8U 2R9PA 1HAIH 1CGIE 1H1BA 3RUOA 5F8TA 5JB8S 4B73A 3PLPA 1WOFA 5HXFA 1LTOA 4DGJA 1C2MA 1FIZA 3BEUA 5DSFA 6GCHF 5LH8A 5KGOA 1INCA 1CHGA 1VITH 3KQEA 3GYLB 4AB9A 1ZHRA 2C8XB 1C2FA 4GUXA 1IQJA 2BYAX 1LVYA 4CRBA 5DP4A 5KEDA 2P3UB 4FUCA 1FAXA 1UVUH 5A2MH 2J38A 1Y5BT 2IPQX 1WDIA 4FUDA 1UTOA 4IW4E 5DK1A 2DUCA 1AFEH 4DCDA 1P3EA 1ABIH 1O3IA 2XRCA 3RXTA 5E0GA 3RXCA 1LQEA 1ZRBA 1V2LT 4TWWA 3RU4T 3T27A 1GJ8B 2RDLA 3T29A 2BX4A 1C5YB 4WXIA 3SU3A 2J5UA 4Q80A 2PGBB 7ESTE 2ZTZA 1BTHH 1C5ZB 1P0SH 1KDQB 3PO1B 5GDSH 1TYNA 2FWWA 2OBOA 5BPEA 4X1QU 2AFQB 3MO6A 2K1QA 4OS7A 3ODDA 4CBOA 2O8MA 1TONA 1TRNA 2EEKA 2BHGA 4UFEH 2RG3A 1L0ZA 5I46H 2ZGBH 1F2SE 1AO5A 2QY0B 2ZU1A 1SVPA 3IITA 3A8AA 1O3MA 3DFJA 1NZQH 3Q3YA 4H42U 3LPRA 1BRUP 2GDEH 3ZVGA 4B1TA 2AGEX 1MU8B 2HLDD 1THRH 3O8RA 3SNAA 2KR7A 2Y5GA 1XUJA 2L74A 1SLUB 5C20A 4GSOA 1LHFH 1Y8TA 3SU5A 2OC8A 2EY4C 1QR3E 2JJ1D 2JJ2D 3BG8A 2LNCA 2AMDA 1VCQA 3S9CA 2QF5A 4BAMB 3LKWA 2GKVE 1ZOMA 2O8LA 1DDJA 2R2MB 1MZAA 1Q31A 2XWAA 5GXPA 3FAOA 3TK6A 1H9HE 1IQMA 2BQ7B 2G55A 2QCYA 1PPFE 1Z71A 2BOHB 4MNVA 3O8DA 3ZZ7A 3LIWA 1QB9A 1WYKA 5DP8A 1GCTC 1QB6A 3BF6H 2XW9A 1DSUA 1DOJA 2ZIQH 3CNRA 1TRMA 1PJPA 1BBRH 2ZDAH 3IWMA 2FESH 3TNTA 1O2UA 4O3TA 3MNXA 2P8OC 4AGKA 1RS0A 1KXAA 4I7YH 2QXHA 3A86A 1ACBE 1P2IA 3VGCB 2H5DA 2XC4A 3GY6A 4DURA 1EJNA 1F0RA 2ZTXA 6LPRA 2TGTA 3M3TA 1P03A 3BEIB 1O2NA 2Q1JA 5CHAC 3L6PA 4CRDA 1IQIA 1YPJH 1FIWA 1SB1H 4OS4A 2NU1E 5C5OA 5GWZA 1TPPA 2PUXB 4XD7D 2QYIA 1YM0A 1GHAF 1O2OA 2BD4A 5T6DA 1Z6EA 1KXDA 4JZDH 3U9AH 4Y76A 3SU6A 2SGAA 4Y79A 3SNDA 4DW2U 2EA3A 3A7YA 3I78A 4B2CA 1TGBA 3ATLA 4F48B 2XBWA 5TCCA 1NROH 8GCHF 1MQ5A 2QAAA 3E0NB 1SHYA 1O5BB 1YPMH 1FY8E 2QC2A 3MNSA 2FZZA 1LCYA 3GISB 1A0JA 1TWXB 2ZZUH 4ZCNA 3PV4A 2FI5E 1MU6B 2CJIA 4GAWA 3B8JA 1BB0B 3K65B 1BHXF 4GHQA 1YCPH 3TH2H 2JIZD 1HYLA 2BZ6H 3WWFA 1HIAB 1AGJA 2EQNA 1C2GA 1Y3YA 3B9FH 3RM2H 3FANA 3NCLA 5C0UA 2O8WA 1VCPA 1F0TA 2F9BH 7GCHG 3AASA 1UVPA 1GJBB 2EI8A 2ZHDA 1MCVA 5FCKA 2KZ4A 3SUDA 4D7FA 4VGCB 1YP9A 1A2CH 3TLOA 1UVTH 1MKXK 5TJXA 4ISLA 4XSKU 1OXGA 4AG2A 4CRGA 3R3GB 2XTTB 4Y0YE 1O33A 2BD7A 1QBOA 1T31A 1JWTA 1KXEA 9LPRA 5LPEA 1A0HB 1O37A 5EJ1A 1G37A 1AWFH 5DKMA 1Z8GA 5E0HA 3UR9A 1EJAA 2J34A 4FETA 3LH3A 3NUMA 1F7ZA 1SGYE 1YLCA 2VH0A 2GDDA 4AFZA 5AFZH 2WHXA 3LJOA 4IS5A 1O2GH 3D65E 4X0WU 3V3MA 1GJ9B 2VIQA 1V2MT 2XBXA 4DVAU 1TALA 1C2LA 3PV5A 3GY7A 4U30A 3TJNA 1TE0A 4YOIA 1J8AA 5DP9A 3HPTB 3LGYA 3O8CA 2IPHA 4ZKNU 1C5QA 1AI8H 1MQ6A 1LHDH 1BA8B 1BDAA 3VG8A 5LGOA 2A45B 2C8YB 1P12E 4IMQA 4B71A 1EZUC 3E1XB 1HLTH 4ZXXH 2SNVA 4A1VA 1C5XB 1YKTA 4WMEA 2CMYA 1NRNH 2F43B 2BOKA 4CR9A 2H1UA 1RTKA 1RTLA 4GVUA 1HXFH 2WYJA 1WXRA 1C2HA 9ESTA 2W7UA 2W7SA 2P94A 4ASHA 2D1JA 2Z9KA 1CHOG 2ANWA 4K69A 1CGJE 4YOGA 2F4LA 2BD5A 3U98H 1W0KD 2O9QA 1G36A 5DG6A 4K60A 3AAUA 3TH3H 2H9TH 3M3VA 2BY6X 1RIWB 4FUBA 1P11E 3M5OA 1GBEA 3HGPA 3A8CA 2G4UA 3TH4H 3VFEA 1OX1A 1XUHA 5A8XA 1J14A 2WV5A 2HPQH 2XCFA 5ETXA 2Z94A 3TITA 3T2NA 2WPHS 2XYAA 3P95A 4K1TA 4KELA 5E2PA 4AFSA 4YOJA 1UMAH 4XRNA 4AOQA 3DD2H 1CT4E 1OP2A 1IOEA 2UUJB 2JDID 4LK4A 4NGAH 2A0QB 1AVGH 2F9PA 4O9VA 2YOLA 1C5LH 1TPAE 3SU1A 2ESTE 3PO1C 2VU8E 1CA8B 1O5EH 4A92A 1CA0B 1WSSH 3TK9A 2LIZA
chains in the Genus database with same CATH topology
3V0XA 5L2ZH 3UWIA 1QBNA 2F91A 1GBIA 3FZDA 2QF0A 1H9LB 2PKAB 4X8VH 4WF8A 1ELTA 1DXWA 1SQAA 3A7XA 3HK6B 4ABAA 3A88A 2ZEBA 1LVMA 2R0KA 3SGQE 1SG8B 2GCHG 5ESTE 2PGQB 3ENSB 4X2YA 1GI5A 3F1SB 1SPJA 3QGNB 1GBHA 1DICA 3C1KA 4E06H 2ODPA 5A09A 2SGDE 1TQ7B 4YLQH 2FOGA 4TYDA 1N1LA 2P16A 2V3OH 1GHYH 4ABBA 2WPIS 3WY8A 2HGTH 4AN7A 4D76A 1MAXA 1OWDA 2H9EH 1P01A 1NPMA 1WTHD 3SHCH 3T28A 3RXRA 1C2DA 1XX9A 1K28D 1FJSA 1NFUA 1TOCB 4E7NA 4IN2A 1IHTH 1DITH 5A0AE 4Y71A 3MU1A 3HGNA 1EX3A 2AS9A 1T4UH 3VGCC 3UFAA 5K0HA 4XE4A 4JCNA 1O2SA 3KCGH 3PMAB 3S9BA 3SZNA 1IQHA 2BVXH 4TY7A 1QCPA 1G3CA 2Z3CA 3FP7E 1O38A 2OD3B 1BIOA 3A81A 1PPGE 3ZVAA 2HNTC 4OS2A 3KQCA 1AKSA 1MTNC 1J9CH 4I31A 1AE8H 2A5AA 3QLPH 1SMFE 3EDXB 2NU3E 5HYOA 1ELDE 2A7CA 1V2QT 2Q6FA 1DANH 1JRTA 3TNSA 1P2MA 1TX7A 1S82A 1NRRH 3C27B 4MPVA 3RXIA 2A2XH 4NIXA 4AFQA 2BTCE 1QQ4A 1NU9A 4BXWA 1MKWH 3ZVBA 1EZSC 1P02A 1NS3A 3A80A 4Y11E 1S0QA 2VVVA 3ATKA 3TJUA 1TABE 4CHAB 1O2RA 1BZXE 1IQLA 3KNXA 1KLIH 4GPGA 3UNQA 1ESTA 1FDPA 2ZF0H 1GG6B 1FY4A 1P57B 1K1PA 1T32A 1TRYA 1TNHA 3RDZA 5JDUB 2AMQA 1N6YA 3Q00A 1GBBA 4GLYA 4AX9H 1ZZZA 1V2WT 4VGCC 1FONA 1W0YH 3A85A 1PYTD 1P04A 1P06A 1MAYA 1PPZA 1QNJA 4TPYA 1GHWH 1NRQH 2JETB 1GJAB 2Z3DA 4DT7B 1CGHA 3URCA 5G4BA 1J16A 1SGCA 5F8XA 1THSH 2FOCA 1F0UA 1O3GA 2FXRA 2F9NA 3E3TA 3SU0A 1UCYK 1GBLA 1ZGVA 1BUIA 4X6MA 3KQDA 1O3HA 1ANBA 3BEFB 5HM2A 2D8WA 5A8ZA 7GCHF 1DS2E 2ZPQA 1HJ9A 3FVFB 4A6LA 1TMUH 1W11U 1ELGA 1HAVB 4HTCH 4FVDA 3PYHA 3BV9B 5GCHG 3RLWH 1HDTH 3MO9A 1GHZA 1O2JA 2ZECA 3UQOA 1UK3A 2AGGX 2UUKB 4Y10E 4X2XA 3F9GA 2FODA 4Y6DA 3OY5U 4FUIA 1KDQA 3MH4A 1FMGA 1NFYA 3A7ZA 5JYIA 1L2EA 2HNTF 6CHAC 1SGDE 2AMPA 1T8NA 3ZZ9A 1P2JA 4LZ4B 3P8GA 1GI7B 2ZCKP 2OP9A 2GCTB 4ZH8A 2FPZA 1QRWA 1BT7A 3SOSA 1RJXB 1SI5H 1C1UH 2OQUA 4KTSA 1C5OH 3UPEA 1JMOH 3A83A 1LVOA 1UVOA 1V2VT 1YC0A 4MLFB 5E0JA 1LKAA 1ZSKA 2G00A 4BAQB 1O2YA 2Q6GA 2P93A 1BOQA 1BRAA 1TB6H 3IG6B 2GZ8A 1D4PB 3U69H 1EP5A 4JZIA 4Y8ZA 4NCYA 5A8YA 1E37B 4JZFH 1O39A 4IN1A 3VB4A 2IOTA 4MPXA 4XOJA 5T6GA 1C1NA 1UTPA 3RXLA 1W10U 2NU4E 3E91A 1Z7KA 1V3XA 4HFPB 5T3HA 2QIQA 1W0ZU 1CHOF 4IMZA 2A4QA 2FYQA 3Q3KA 1HAZB 3RXFA 1EPTA 4K3JA 1T4VH 5T6FA 3LGUA 4XBDA 1GMCG 2HNTE 3GY3A 3PROA 1MD8A 1CA0C 1QRZA 1Y3UA 1O5AB 1XUFA 3VEQB 4B75A 1G3EA 2STBE 4WMDA 2BMGB 1V2PT 3ESTA 3MNCA 1NESE 3RXSA 5EG4A 2SGFE 3DHKH 1IQFA 2TGAA 2ZGJA 3BTGE 2D26C 2C3SA 2Y82A 1O2IA 2ZWLH 5FCRA 2TIOA 3CS0A 2FS8A 4YM9A 1IQNA 2ZU2A 1ETTH 1P9SA 3M61U 2ZGXH 1FNIA 1YPLH 1GL0E 1VR1H 1P8VC 2CF8H 1V6DA 3QZRA 1EATA 3UIRA 4JK6A 3BIVH 2BX3A 1SLXB 2FO9A 2RA3A 4PROA 5GPIB 3RXGA 2JH5D 1DFPA 1SFIA 2UUYA 5L30H 2FOEA 2D2DA 4MNXA 3TPIZ 1HAXB 4D8NA 1VGCB 4RN6A 1N6XA 1FPCH 1ZMLA 3AW1A 1K9OE 1TOMH 4CBNA 2GCHF 1ZJDA 2BM2A 1YPHE 3BN9A 4MVNA 2BY5X 2WPMS 4NSVA 3GOVB 2BZAA 3EE0B 2ANKH 3KEEA 1A46H 3W94A 1Y3WA 2TGDA 4FUHA 4F4OC 5GIBA 3M5MA 4H6SB 2CHAB 1EAIA 1YF4A 4ZHLU 2Y7XA 2WINI 2FOFA 1CT2E 1BTYA 2RCEA 4O03A 3MWIU 2HVXA 4NIVA 1F0SA 4UDWH 3K6YA 4IBLH 3PWCA 3SNCA 3MO3A 1ZMJA 1Z8RA 3A7WA 1IQKA 1GGDC 1SGIB 2OBQA 2QA9E 4KGAA 4HGCA 2HLCA 4AYVB 3A8DA 1EP6A 3F9EA 4X1RU 2GZ9A 3RMMH 1GPZA 1O35A 1Q3XA 2NU0E 1HFDA 2WPLS 1FZZA 1OSSA 3AW0A 3D23A 4CH8B 5FPTA 4H4FA 2XNIA 1WU1A 1TNKA 1XUGA 1LDTT 1MKXH 2TRMA 1DE7H 4MPUA 1UHBB 4K1EA 2HPPH 5GJ4B 3SJOA 3UWJH 4UE7H 4X1SU 4BTTB 4I8LA 5JBTA 3MMGA 1O2TA 3T26A 3U1JB 3SJIA 2ZGHA 2Y7ZA 3E16B 1SFQB 3RMNH 3PMBB 1S5SA 3VB6A 4CHAC 5DO4H 1BJUA 5HMAA 3FFGA 3UOPA 1QL8A 1LPZB 1KTSB 1DWEH 3SI3H 2PSYA 1GG6C 1ZTKA 1O36A 1TA6A 1EKBB 3NWUA 2FP7B 1GI6A 3NXPA 1ZSLA 1CU1A 2CF9H 2UWPA 2VIPA 3ZVCA 4ABFA 2OLGA 4OGXA 2G81E 4AG1A 1C1VH 2OC0A 2R0LA 1ABJH 5CE1A 2P59A 2GZ7A 4YTAA 3UREA 1JIRA 1O2VA 2G4TA 2JETC 1ZPCA 3RXKA 1O3PB 5DP5A 1P2KA 5JBBS 1X7AC 3SV7A 1XVMA 1N8OB 1QA7A 1C9PA 1MH0A 1ZHMA 3LGTA 3S7HB 1C4Y2 4B2AA 1O2ZA 2ZQ2A 5SGAE 3SU4A 3Q77A 4AGJA 1O2QA 3GDSA 1SOZA 2BLOA 3RXBA 1C9TA 4LXBH 1ELFA 1EAUA 2V3HH 1YPGH 4D7GA 3I29A 1ANEA 1GDQA 1GI4A 1SHHB 3CP7A 1WUNH 2J95A 3DFLA 4AORA 2AYWA 2BVSH 3TJVA 1AZZA 3EGKH 2PR3A 2R2WU 1QQUA 1HJAC 1UVSH 1UK2A 2QXJA 3RP2A 1GJ6A 4NIWA 3U1IB 1PQ8A 1LQDB 1HV7A 2PKAA 1CE5A 5GCHF 2YNAA 4HZHA 1O5CB 1TNIA 3OSYA 5IDKA 1S81A 1XXDA 4B74A 1XKAC 3JZ2B 1C5SA 3MHWU 2WUBA 3ATWA 2ZFSA 1GJDB 2ALPA 2ZU5A 2ZQ1A 3SORA 3SU2A 3A7TA 3MH6A 3M7QA 1A7SA 4K8BA 3L33A 4WH8A 2FX4A 1K1NA 1L1GA 1MTWA 4BNRA 5I25A 1G2MA 1EQ9A 2XXLA 1DY9A 1MBMA 1TBQH 4JYUH 2ZDMA 2NWNA 3ATMA 5AF9H 4BAKB 4ISOA 3I77A 3EAJA 1YLDA 2ZFFH 3PMJA 3D49H 1HAYB 5TCAA 3H7TA 4H6TA 3TGIE 1HGTH 1GBJA 1RD3B 1KY9A 1E0FD 1BCUH 5DGJA 1YPEH 1D6RA 2OQ5A 3MU8A 1GI0A 2BQWB 3QGJA 1P2NA 1TX6A 1AY6H 1L4DA 2BLVA 2A1DB 1ZTJA 1C2JA 4X2VA 1WTGH 1ELBA 2UWLA 1TLDA 3TK5A 3K2UA 1BTPA 3E8LA 5DJ7A 1TBZH 2VGCB 1WAYB 2ANYA 4XBBA 2FOAA 3MU0A 1C5RA 1CBWB 1F5KU 5C3NA 2IJOB 2ZU3A 2FLBH 1HBTH 3M7TA 1K1LA 1TMBH 2P3FH 3ZVDA 1D3QB 4JYTA 1P09A 1EOJA 3P6ZB 3SHAH 1PPEE 4MDSA 3SV6A 4I8KA 1D3PB 1GMCF 1FY3A 1HAHH 3U8RH 4X6PA 1B0FA 1GBCA 1P10A 3BTWE 1AMHA 1EUFA 4Y8YA 2ZFTA 2EI6A 1B0EA 1B7XB 4ZXYH 5C1YA 1QFKH 3A7VA 3TVJB 1P2QA 2V6NA 4GCHG 4X6OA 2SNWA 1YPKH 2BD9A 3BTHE 5FXLA 3SGBE 1A5HA 3MTYA 1QJ7B 2ZDLA 4F49A 2ZGCA 2SGPE 4AZ2B 1DXPA 1QL7A 2VWMA 3DUXH 2AIPA 3P8NA 3LOXA 2KAIA 1UJ1A 4X8UH 2BD3A 2ZI2H 1HUTH 4B76A 2VIOA 2CHAC 2OINA 4Y7AA 1GMHG 2M5TA 2O8UA 3BTEE 1GVZA 2R3YA 3ELAH 3S7KB 5FBEA 2FDAA 4KKDA 2GTBA 1AN1E 4YESB 4INLA 1XUIA 2ZC9H 3GY8A 1FLEE 2ZFRH 1TNGA 1TGTA 4THNH 3VB5A 5EOKA 1O3KA 2FI3E 4I33A 1KYNA 4Q7ZA 1HNEE 3RC6A 1ZPZA 2IN2A 1NRPH 2I6SA 4A5TS 2PTNA 3UY9A 1PPHE 1SL3A 2LPRA 2ZA5A 2ZG0H 4UFGH 4CREA 1SGNE 3KIDU 2OC7A 1SSXA 1T8MA 3GY5A 2ASUB 4K5ZA 2XWBI 1NC6A 3QDZB 4YZUA 4E05H 4UFFH 4NSYA 1WQVH 4ZMAH 3QK1A 5AFYH 1AUJA 3PTBA 1O2KA 3ZZ3A 1JBUH 1V2RT 3B23B 1OYQA 2ILNA 3QTOH 3SQEE 2VJ1A 4NA9H 2ZCLP 3OX7U 4MQAA 1A5GH 5AHGH 1O30A 2ZHWH 1BMNH 1V2OT 2A5IA 5JBAS 4B2BA 1K1IA 1CQQA 2GD4B 2STAE 1EZQA 1MBQA 8LPRA 2G8TA 1DPOA 2C4FH 5FHTA 3S0NA 5DPAA 1H4WA 2A7JA 1RFNA 1O3OA 1QL9A 4FU9A 1IQEA 1W7GH 5DP6A 4RKOB 3V13A 3UNSA 4DIHH 4ZKOU 1UK4A 2FS9A 2TPIZ 1ZYOA 2ZDNA 1AQ7A 4DY7B 4I8JA 4TY6A 4X1NU 1GJ7B 1C1QA 1N8OC 3ODFA 2ANMH 1BQYA 1LHGH 2Z9IA 1KXBA 4BANB 3RXJA 2Z3EA 3GCTF 2BY8X 1J17T 4AYYB 2A4RA 1A61H 3ZZ5A 1BMAA 3CENA 2ODYB 2BB4A 2FLRH 4K8YA 1B5GH 1O3NA 3GICB 4ZAEA 8ESTE 1O2LA 1HAOH 1O3CA 1NO9H 1PQ5A 1BTZA 4A1XA 4ABIA 1C5VA 4UFDH 1HB0B 1T8LA 5EODA 3A89A 1AWHB 1C5UA 2VIDA 5FX5A 1AFQB 3RXMA 3ZVFA 1GMDF 1XUKA 1EB2A 5HGGA 1GVKB 3W95A 3RXHA 1W13U 2F3CE 3KHVA 2FI4E 1BMMH 2FEQH 4O97A 4K2YA 1F5RA 3TIUA 2C8ZB 4ZKSU 4FU7A 1OPHB 3LU9B 1A4WH 4FUEA 4NWKA 1E38B 3P8FA 2B5TB 1BTUA 1D3DB 1TGSZ 4TPIZ 1RTFB 5E8EH 2BQ6B 4IGDA 3VXEH 1RRKA 1TNJA 1YBWA 1NTPA 2PHBA 1ELEE 1FN6A 2Z9LA 1DX5M 1F5LA 3DT0H 1O2HA 1HAPH 3M5NA 1GHVH 1G9IE 1XXFA 3RM0H 1WBGB 1XMNB 1E34B 4WY3A 4ZHMU 1FV9A 4CRAA 1QURH 3FP6E 4BTIB 3BG4B 2QGRA 5C67A 2GT8A 1IQGA 5FBIA 1O34A 3P17H 2BD2A 1JXPA 1KXCA 1W8BH 5DP7A 1Y3VA 2BXUH 3OYPA 2Z9JA 3MU4A 3UUZA 1ZR0A 5FAHA 2H5CA 1FAKH 1OWEA 1V2UT 2VH6A 2B8OH 2BY9X 3QZQA 1OWKA 1C5MD 1GHXH 2FOHA 3QWCH 2C90B 4NA8A 3CS7A 2JH0D 4A1TA 1NT1A 1AZ8A 4A7IB 3FZZA 1NRSH 1E35B 4NFFA 1KTTB 2QV1A 1M9UA 3QTVH 1ANCA 2JH6D 2BDBA 1EZXC 4DJZB 2ZPSA 1SQOA 3GDVA 1ELAA 1NFXA 2VGCC 1MMJN 2XBYA 1P05A 1EXFA 3LC3A 1CBWC 1RIWC 5EQRA 2XC0A 2QXGA 5ABWA 1GI9B 1SGRE 1NM6A 1JRSA 4YLUA 1UCYE 1ZRKA 2J2UA 3A8BA 1UO6A 3T5FH 5L6NH 1MD7A 1O5GH 1SR5C 2XCNA 1V2NT 2GMTB 2A31A 1GJ5H 2BDGA 3BTTE 4DIIH 1HAGE 3NZIA 1O32A 2W5EA 1UTJA 1LO6A 3Q76A 1NU7B 3ZVEA 1PFXC 1AB9B 1CSOE 2HRVA 1VJ9U 4NZLA 1UHBA 1D9IA 1DWBH 2PUQH 5EW2H 4MTBA 1A1RA 1L4ZA 3Q3XA 1H8IH 1PQAA 1MTUA 3ATIA 1TAWA 3LDXH 2H9HA 2DE9A 2YNBA 2ZCHP 4X2WA 4BAHB 3SW2B 3JZ1B 1LVBA 1V2TT 1TBRH 1O0DH 2VVCA 3ZZAA 1TQ0B 2UUFB 4ISIH 1ESBA 2GV6A 1XM1A 1MTVA 1O2WA 2JKHA 2BDAA 1UTKA 3TJOA 1AD8H 2Y6TA 2WV4A 1IAUA 3V7TA 1AVWA 3NPSA 4INHA 1O5DH 4YT6H 1V2KT 2ZU4A 2G5VA 1GHBG 3SUFA 1OWJA 1W12U 4OS1A