4WMEA

Crystal structure of catalytically inactive mers-cov 3cl protease (c148a) in spacegroup c2
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
306
structure length
306
Chain Sequence
b'SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MERS-CoV 3CL protease
molecule tags Hydrolase
source organism Middle east respiratory syndrome coronavirus
publication title Structures of the Middle East respiratory syndrome coronavirus 3C-like protease reveal insights into substrate specificity.
pubmed doi rcsb
total genus 85
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4wmeA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wmeA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wmeA02
4ABHA 5A8XA 3A89A 2VU8E 1V2PT 2JH0D 1C2JA 1XX9A 1SGRE 2VH0A 1NO9H 1U6QA 3Q3XA 3TH2H 1N6XA 1NRNH 2A2QH 2F9UA 5EOKA 1UK2A 2UUJB 3CS7A 2ULLA 3EAJA 1P04A 3GY5A 4B73A 2B9LA 1FPCH 4F49A 1UMAH 2ZFPH 3SI4H 3F9EA 5E8EH 2P3UB 3D62A 3RC4A 1O3HA 1IQLA 1P9SA 1KXFA 4X1SU 1AMHA 1BRUP 5ABWA 1HLTH 3SQEE 5B6OA 5GIBA 1BRBE 1ANBA 1HIAA 1P2NA 1SGFA 3GCOA 3BG8A 4NWLA 1B0EA 4X6OA 5C67A 7GCHG 3RXKA 1W12U 4DT7B 1C2FA 5CHAC 3NZIA 3V3MA 1QB9A 1HUTH 1X7AC 2AH4X 3SQHE 2D26C 3M36A 2A5IA 2D2DA 4A7IB 1C1RA 1YC0A 2ZA5A 1QA0A 3BEIB 4K8BA 1RXPA 1WU1A 1TB6H 2G4TA 1AU8A 3GCHB 1YM0A 1C1MA 4KTUA 1HPGA 5C20A 2VIQA 3E3TA 4ZXYH 2Y7ZA 3SV7A 1HAIH 2OC1A 2BD2A 4ZUHA 1W14U 2XBYA 4BAQB 1RFNA 2ZFQH 2ZTXA 5FCKA 2Z6BD 3V12A 1GMCF 2P3FH 2V6NA 2P8OB 2XWAA 1ID5H 3OX7U 1FY8E 3OU0A 5EPYA 2OBQA 1ABJH 5IYTA 4I32A 1V2UT 1QRZA 2GX4A 4IBLH 4BTUB 3D65E 1SQOA 3GY4A 4AFUA 1C5YB 1C1TA 1OP0A 5C1YA 5FAHA 4D8NA 4D76A 1GI6A 1XUIA 1OWKA 3SU3A 1NESE 1JMOH 4Y6DA 2Z9GA 3U98H 1NN6A 3BSQA 2V3OH 1MKWK 1TQ0B 1OWDA 5GDSH 1AUTC 4Y8ZA 3MU5A 2XC5A 2IJOB 1LPKB 5EXNA 2C8WB 1MTNB 4FUHA 1SGFG 1BMMH 5L6NH 5LPFA 1QURH 1V2KT 2BX3A 1AN1E 1CHOF 3BTQE 3O8BA 2XCNA 4FUJA 2FMJA 1C5MD 4BXWA 5DJ7A 3A87A 2G5VA 2QGRA 1T4VH 1GCDA 1C4Y2 1PQ5A 3ZVFA 1EPTA 3ZVCA 2B7DH 4XSKU 1TMUH 3PROA 3RC5A 1HRTH 2BVRH 3B23B 3PM3A 2UWPA 1GBAA 1LPGB 1OS8A 2BD3A 2C93B 2ZWLH 4DIIH 1KXAA 1A5HA 1QQUA 5EQSA 1P2JA 1O5DH 3RXCA 2R3UA 2Z3DA 3DT0H 3E6PH 3UPEA 2TGDA 1FAXA 1THPB 3MO9A 3TJUA 2OC0A 2JH5D 1O2HA 5E2OA 2O9QA 2VWNA 2BQ6B 2LIZA 3UY9A 1EPTB 1AVGH 1DFPA 4BAOB 1P3CA 1XVOA 2G8TA 2A4RA 4DOQA 1O3DA 1BBRH 2GKVE 3RP2A 4Y0YE 1DX5M 1EQ9A 2QAAA 4KTCA 4AB9A 1H8IH 4WMDA 3V0XA 2C8ZB 3HGPA 2ZGBH 1PJPA 1C2EA 5ESBA 1B0FA 1A0LA 1AVWA 4DURA 1HGTH 1SI5H 2Y80A 3TU7H 4SGAE 1AZZA 4X2WA 3UREA 2QY0B 1S81A 4NWKA 4I8GA 4AORA 3Q77A 3VB6A 3MHWU 2JETB 5GXPA 1ZRBA 2PW8H 2Q6GA 2NU1E 1B5GH 4MPUA 6GCHF 3OSYA 1P2MA 1AKSB 1LCYA 2FOHA 2HNTE 2VIPA 4ISNA 1ZGIA 4JZIA 1XKBC 4DY7B 3F6UH 1AHTH 4FU8A 2OBOA 1F5RA 3RMMH 5F8XA 1Q31A 2QF0A 1C5LH 4X6PA 1PPZA 1HAOH 4ZKNU 1LQEA 1DS2E 1OKXA 1TALA 2ZFFH 2J34A 1GL1A 2NU4E 1D6WA 3AAUA 3W95A 3I78A 3RXEA 2V0BA 3CENA 1EASA 1IQIA 4X8TH 1QTFA 2FS9A 1TIOA 2GCTC 1NTPA 3UR6A 1AD8H 2FZZA 2UUFB 1HIAB 3SGAE 2ZQ2A 2V3HH 1A4WH 3SV2H 3HKJB 1P03A 1VCQA 3QK1A 3O8DA 1DICA 4E06H 2P16A 2GV7A 2XRCA 3KL6A 4NIVA 1UHBB 2WYGA 1G3CA 4CHAB 3MH6A 4WF8A 3BF6H 4AFQA 4YOIA 2FI5E 1C5QA 2FLRH 4OS7A 3GY8A 4LOYH 4WJG2 2BY5X 4IN1A 2Y5GA 1O30A 1Y3WA 3A7WA 1YCPM 2PSXA 4Y8YA 4K69A 3VXFH 1FXYA 1SOTA 1Z8RA 1AGJA 5FPYA 1UVPA 1PQAA 3BV9B 3BTKE 1ELBA 1XUHA 3HKIB 1ETTH 1A7SA 4X8UH 3M5MA 1YYY1 2K7XA 2R9PA 2TPIZ 2SGFE 1C5NH 2SGPE 4NA9H 3TITA 1GHXH 1SB1H 1WUNH 1ZGVA 3HGNA 4ISOA 2H9TH 1HXFH 2G52A 2WV4A 3ZZBA 1C2DA 1C5PA 2A7JA 2FDAA 1AFQC 3SUGA 4K8YA 3STIA 1JRTA 3AAVA 2ZGHA 4I8HA 2ZHWH 1O2GH 5AFZH 2Y5FA 1EAUA 1GVKB 1O3EA 2OC8A 2V35A 4A5TS 5K7RA 1WAYB 1BMNH 1FI8A 1BCUH 3G01A 4AN7A 2J92A 5EQQA 1OYQA 4XBDA 1OPHB 1RJXB 1QBOA 2NU2E 5FPSA 1HAHH 4YOJA 2VVCA 4GAWA 2ZF0H 2BX4A 1PPFE 2WYJA 3L6PA 2XWBI 4BTTB 1K28D 4HFPB 4YLUA 3LH3A 3DHKH 1T8LA 2R2MB 1GI4A 2PGQB 4AGKA 1F5LA 2ILNA 1OWEA 1F0RA 3K6YA 5F03A 3FP7E 1C9TA 7ESTE 4M7GA 1SGCA 4CR5A 4DIHH 6LPRA 5FX6A 4DJZB 1T32A 2GT8A 1SGQE 1XXFA 5L30H 1QJ6B 1AFEH 1AVXA 1O38A 2GZ9A 2OQUA 1BTXA 1G32B 1KIGH 2A32A 2GMTB 1GMHF 4MG3A 2FOFA 1XM1A 2IOTA 2BD4A 3SHAH 3EGKH 5F6MA 1C1QA 5DKMA 1UTNA 2OLGA 4YZUA 1EAIA 2EEKA 7KMEH 1TX6A 1NU9A 1BA8B 1C4V2 1VITF 3K6ZA 2YOLA 1VCPA 1AO5A 4FVDA 2HVXA 2FOAA 4FUFA 3QTVH 3MNSA 2OCVB 3LGYA 4O9VA 2VIDA 2I6QA 1ZMJA 3RXJA 1YLCA 2GMTC 3D23A 1P02A 1GG6B 1MBMA 1D3QB 1BRAA 1EX3A 1FN6A 1QRWA 2ANKH 5T6GA 3LH1A 2A4GA 2XC0A 4B2BA 2FESH 4NFFA 1F0UA 1HB0B 2QN5T 3SUFA 2G81E 1KDQA 2BXTH 1O5GH 3S7HB 1ZPZA 5BPEA 3SU1A 3RXSA 2DE8A 3NK8A 5LGOA 1O2SA 3RU4E 3T28A 2ZU3A 3MO3A 1TGTA 5E2PA 3ZZ6A 4Q7XA 2OD3B 3QLPH 2AIQA 1AZ8A 1K1LA 4I33A 1A0JA 4OS4A 3SW2B 1IQEA 4JMYA 1SGEE 3VPKA 2CXVA 1ELEE 1SHHB 2PKAA 1MZDA 1D6RA 3P8FA 2C90B 4WY3A 1QIXB 3LC3A 3KQEA 2BLVA 4OGYA 2PV9B 1HFDA 5EW2H 1N6YA 5CMXH 2VGCC 4MLFB 2BD8A 2Y6TA 2HALA 1ARCA 3STJA 1WQSA 1AFQB 4O3UA 4XBCA 1J8AA 1QHRB 4XFQA 1NFWA 1T31A 1Z8JB 3TGJE 2XBVA 3SBKA 4VGCC 5A09A 1GGDC 5C1UA 2PSYA 3RDZA 1A5IA 4ZMAH 5DGJA 4HI3A 4RSPA 1SLXB 3BIUH 1FY1A 1EAWA 2QV1A 4B2CA 2PUQH 2W7UA 2DE9A 5FXLA 3LGIA 3P8GA 2SGQE 1E36B 1S84A 1FAKH 2A2XH 3BTDE 2BOKA 3A86A 1H9IE 3N7OA 2TGPZ 3KGPA 4OS6A 1LVOA 1ZSLA 5FCRA 2AIPA 5T6FA 2ZU2A 4ABAA 1GWAA 3ODFA 1C2HA 1GJAB 3V13A 3QUMP 4FVBA 1G30B 1AE5A 3LIWA 1JXPA 3T2NA 1C2KA 1TGCA 3LPRA 3GY2A 3ZZCA 1CGHA 1P06A 4ISLA 2G51A 3EQ0H 1ELDE 5T3HA 1HAZB 3MMGA 5GWZA 3FFGA 1FQ3A 4B1TA 3MH5A 1AI8H 1EB2A 1N8OB 1E0FD 2FYQA 3NUMA 1QJ7B 1O3NA 6CHAB 6GCHG 2XCFA 4ZAEA 4ZHMU 2ODYB 5AFYH 1ETSH 1Y5AT 4K1SA 1TNIA 4ABBA 1DLKB 3BTWE 4CREA 2RA3A 4NCYA 4MPWA 2O8UA 1TMTH 2OUAA 2PLXA 1VZQH 2SGEE 4GHTA 8KME2 3HPTB 3SJ8A 4A1TA 1SLUB 3UNSA 1CGIE 4CRAA 4MQAA 4RN6A 4FUIA 2QXIA 2ZG0H 5C5OA 5L2YH 1ZYOA 4UFEH 1QJ1B 1PPEE 3KHVA 5L2ZH 1O35A 1P3EA 1DWCH 1CT4E 1UHBA 1ELFA 2ZFRH 1UTOA 1F5KU 3S69A 1ZSJA 4NSYA 2ZHEH 4GPGA 1VR1H 4FU7A 5DPAA 1E38B 2QXHA 1BHXF 2A45B 1QQ4A 1ZSKA 1GMDF 2JETC 1GPZA 3TH3H 1AIXH 4DGJA 1HAVB 3U1JB 1FDPA 5EU8A 2XTTB 3AVZA 2FI4E 1YPKH 2TGTA 1GHBG 1O2VA 4B74A 1AY6H 5JB9S 3PO1C 2Y7XA 2EA3A 3H5CB 2ANYA 1VJ9U 1HAPH 3F9FA 4K60A 1ZPBA 5A0BA 3S9BA 2RCEA 1KSNA 2HWLB 2VIWA 4H4FA 2HNTC 2JH6D 4Q80A 1O3IA 3TJNA 4KP0A 4ZXXH 1QL9A 3EA7A 2B0FA 1SGPE 3GYLB 2H2ZA 1HAVA 2FIRH 2GZ8A 1MQ5A 1NM6A 4U30A 5JYIA 1PFXC 1V2TT 4ESTE 2BD5A 4DCDA 3NPSA 2XBXA 1INCA 1LVBA 1ANDA 3TH4H 4PROA 3MU8A 4A1VA 4TY6A 1C1VH 4KELA 1TNLA 3IG6B 2BB4A 2VWLA 1DY9A 1O3MA 2ZGCA 2P95A 3PLBA 1V2QT 1HV7A 3LJOA 2J94A 1W0YH 2HNTF 1K1NA 1MAXA 1BJVA 1G37A 4GCHF 3SJIA 2PKAB 2ZGXH 1FLEE 1QRXA 1UTKA 3DUXH 1J9CH 1GI9B 5J4QA 3LONA 3DFLA 1K9OE 1ORFA 2C8XB 1PPCE 1YPHC 3A7YA 4JYUH 1FUJA 1TGNA 1C5XB 2PTCE 4AFZA 4K1EA 3ZVAA 4WMEA 2J4IA 1P2OA 2R0KA 5TCAA 2EC9H 3UWJH 1RTFB 5JBTA 1KTSB 1L1GA 4IC6A 5F8ZA 3DA9B 3M7QA 1ZMLA 1O3PB 1RRKA 3WY8A 5FBEA 1NS3A 1G2MA 3B9FH 1P2QA 1O2OA 4OS5A 4KKDA 5JBAS 2I6SA 1J16A 1V2MT 1GMHG 4KTSA 3A7ZA 3IITA 1RTKA 3E16B 5T6DA 4UEHH 3QGNB 2KAIB 5EXLA 2O8WA 2BY9X 3QZQA 1H9LB 1ELAA 3PO1B 5JDUB 2A5AA 1DVAH 1VCWA 1GJ8B 2Z9JA 2J95A 1UTQA 3SHCH 3PMHB 4GUXA 2VIOA 3SV9A 1CSOE 1TPPA 3A8DA 1SGNE 1HAYB 1YPGH 1GBCA 1SFQB 3HK6B 3MYWA 3ZZ7A 2GD4B 1IQKA 1S0RA 1MKXH 2FOBA 3VFEA 1UVTH 2BZ6H 1O2ZA 2QIQA 1EZXC 2QXGA 2BXUH 2TBSA 2W3IA 2HGTH 3KQDA 3KNXA 4BXSA 4DW2U 3L33A 1GGDB 3CS0A 4Y8XA 2WV5A 1GBTA 1O5FH 1KXEA 5A2MH 1W13U 2H5CA 3VGCC 2ZCLP 3P6ZB 1DWDH 2J2UA 2STAE 2WPIS 1G36A 3MU1A 4NZLA 1OX1A 1TE0A 1KY9A 1JIMA 1QFKH 3UIRA 1ZMNA 3SN8A 2BY6X 2OTVA 3SU0A 2FLBH 1C5TA 3RXRA 3HATH 1HCGA 1BTHH 2FP7B 1KDQB 4K5ZA 1UK3A 3FANA 1TPSA 1CT0E 2EI8A 4H6SB 4INLA 2VWOA 1ZTLA 1GJ5H 2JKHA 2ZHQH 2WINI 4YT6H 3SGBE 2PTNA 3SJKA 3MNCA 1FMGA 3ATKA 2OQ5A 3P92A 4D7GA 5EQRA 1TX8A 1S0QA 1QNJA 2STBE 1O2TA 1ZOMA 4F4OC 1AB9B 2YNBA 2Y81A 4Y7BA 1CQQA 1F2SE 1G3BA 2IPHA 1NZQH 5FPTA 4YOGA 3ZZ3A 2VWMA 1SGIB 1H4WA 1ZTJA 4YESB 5DP5A 2FPZA 3BIVH 4J2YB 3KQBA 4MPVA 5TJXA 1C2GA 2EI7A 3K2UA 3DD2H 1QBNA 4FUCA 4K3JA 1W11U 1HJ8A 2QA9E 3SU5A 3SNDA 2WPKS 2ZZUH 4UFDH 5EPNA 1TBZH 2PHBA 4B71A 6ESTA 1GHVH 1Z8GA 2AMPA 4I8LA 1NY22 2BZAA 4THNH 3ZYEA 2F9VA 1C1PA 2ZCKP 3RXAA 9ESTA 1P11E 3GYMA 1TFXA 3T29A 5DK1A 2ZCHP 1CE5A 1O5EH 1ZZZA 4K1TA 4AOQA 5A8ZA 1S6FA 1AE8H 1ZHRA 3U1IB 3QDZB 3MFJA 3UOPA 1OOKB 1YPLH 1E34B 1Y5UT 5GJ4B 1OP8A 1C2MA 1JIRA 4B2AA 1YP9A 1C5RA 1FZZA 2W3KA 1MU8B 5EW1H 1GHYH 4OS1A 5I25A 1P2IA 2AS9A 2GGVB 1BOQA 2BDGA 2ZHDA 4FUGA 2Z9IA 4WXVA 1T8MA 2NWNA 3ZV8A 3LGTA 4AYYB 1HNEE 2BDAA 3ODDA 4TPIZ 1SMFE 1LVYA 2WUCA 3L3TA 8LPRA 1T7CA 3RU4T 3UUZA 3LT3A 1CA0C 1ANEA 1NRPH 2FODA 2XXLA 3M7UA 4IGDA 3ZZ5A 2HRVA 3PYHA 5AVDA 1DDJA 1HDTH 1IHSH 2A31A 1O2LA 2Z7FE 3BEFB 3VB4A 1Y8TA 3LKWA 3RXDA 2G55A 5PTPA 2Q6DA 1Y3UA 2ANWA 1O2UA 3MH4A 3GISB 3PMAB 1J15A 1GDQA 1XUFA 5JPMH 5BRRE 5ESTE 1ZR0A 1C5WB 2ZNKH 2YNAA 2A7HA 3UOUA 1O37A 3IWMA 2ZECA 4VGCB 3Q3KA 3OYPA 4JZDH 1GBFA 2VJ1A 1WTHD 4JYVH 1DUAA 1TMBH 1BB0B 1C1NA 3MO6A 2F9BH 2RG3A 1UVOA 4IW4E 1V2JT 1DSTA 4WWYA 3TVJB 3O8RA 1ZJKA 4ABEA 1O33A 4Q2KA 2ODPA 1GVLA 1W3CA 1GHBF 1GI3A 1GI5A 1C5ZB 1GJ4H 1YPEH 2AYWA 1GBKA 1GHAF 1EJAA 1ELVA 2GDDA 4R8TB 2RA0A 3PWBA 4BAKB 3S0NA 1H9HE 1TNGA 2P94A 1TNJA 1SGTA 3ATWA 1O2KA 2K1QA 3PLKA 1O3CA 3RMLH 5CE1A 2O8LA 3U8TH 3ZVDA 3EE0B 1NFYA 1SLVB 3M3SA 1DOJA 2AERH 2CJIA 2KAIA 3NKKA 2FX6A 1EOJA 1TGSZ 2WPLS 1Y3VA 1F0SA 1CU1A 3QWCH 1C4U2 1GBLA 3EBNA 2ZPQA 1KLJH 2PGBB 1T4UH 2WPHS 1MD7A 3LOXA 1M9UA 3LGWA 3M7TA 1ZJDA 1DSUA 3RXTA 3T25A 3RLWH 3OY6U 3FP6E 2FYRA 1BIOA 1DWBH 4A6LA 1EB1H 2UWOA 1AWHB 1HJAC 1HBTH 2GDEH 2UWLA 2VIVA 4HTCH 4MNXA 2P3TB 3T5FH 2SNVA 3GDVA 5LPEA 2GP9B 4XDEA 1O2NA 4NIYA 4CRCA 3S7KB 1C5UA 2FX4A 1FONA 2F9NA 1VGCC 1O3FA 1PQ8A 3QO6A 5H4IB 1T8OA 3JZ2B 2FWWA 1MTSA 1O2MA 1TWXB 3QX5H 2ZPSA 4X2XA 1SSXA 1UTLM 3SJOA 1ELGA 5AF9H 3DFJA 2ESTE 2A7CA 1IQGA 1GJ6A 5DO4H 3GCTG 1BJUA 4NSVA 3SUEA 1UCYH 2FXRA 1GJDB 1XUJA 1SOZA 3GICB 1P2KA 2BLOA 1UJ1A 2ZDKA 1K1PA 5DP6A 1GI2A 3VB5A 1YPHE 4X8VH 1IHTH 3ATMA 2ZQ1A 5TCCA 3M5NA 1AB9C 1BUIA 1W0ZU 4U32A 5AHGH 3BTGE 4XE4A 3SV8A 1CA0B 4CBOA 4WH8A 4A1XA 1O3LA 1XMNB 2Y5HA 4TYDA 1TLDA 2OINA 2NU3E 1ZPCA 1LVMA 4WH6A 1QY6A 1SLWB 1CA8B 1ESTA 1VJAU 2GCTB 3MU0A 1V6DA 1MQ6A 4HGCA 2OP9A 1S6HA 3Q00A 3PWCA 2HPQH 4HZHA 4BANB 1A0HB 2AGIX 1JBUH 1OXGA 1QB1A 2C8YB 1BRCE 1RD3B 2XBWA 1OWIA 1QA7A 3A7VA 1TRNA 3MOCA 3T62A 1EZQA 1WOFA 4NIXA 2FTMA 3ZZ4A 4JZ1A 1BBRK 1MTNC 2P8OC 5DP4A 1FV9A 1TGBA 1LHFH 3TIUA 4CHAC 4B76A 5FHTA 1HAXB 1O2JA 3A85A 1W8BH 2Z3EA 3MNBA 1C2IA 1L1NA 2XW9A 1ARBA 1O2WA 1H8DH 1K2I1 4IMQA 4NFEA 3TJVA 4WXIA 2CV3A 1F7ZA 2BQWB 2VH6A 5DP9A 1GBHA 1ABIH 1CBWC 3SU2A 4UDWH 3BG4B 1O31A 2CHAB 1TRYA 2D1JA 1NROH 2F91A 1O34A 1UK4A 1Y5BT 3UQOA 4Y79A 7LPRA 3Q3YA 4ZKSU 4NIWA 4UE7H 4UD9H 1P9UA 4I7YH 1EXFA 4MNVA 3FZZA 3F9HA 4CR9A 2ZIQH 1GBDA 1GBEA 1CGJE 2HOBA 2VNTA 1BTUA 1YF4A 2ALVA 1QB6A 1GCTB 1MTVA 1BQYA 2AGEX 1UO6A 5GCHG 1FPHH 1DE7H 3A8BA 2XYAA 3EYDA 3UR9A 4JZFH 5DP3A 3BTFE 1C5SA 2SFAA 3M5OA 3B8JA 1L4ZA 2PKSC 2ZDMA 1S5SA 3LU9B 1H1BA 1MD8A 1SFIA 2H6MA 1IQNA 1XKAC 3TJOA 1MTUA 1O3BA 1A3EH 4ZHAA 1K1IA 5HMAA 1QL7A 2QYIA 2XNIA 3M3VA 3ELAH 1SGYE 3EDXB 2FOEA 1CBWB 4O03A 1Z6JH 1D3DB 1OSSA 1KYNA 1EUFA 4OGXA 2TGAA 4MTBA 1Y3YA 2Q1JA 1O0DH 1SGDE 4Q7YA 2A1DB 3PV4A 1GJ9B 1F0TA 1PPBH 1C1OA 2OC7A 2ZHFH 4X2YA 3D49H 4SGBE 2NU0E 1O5BB 5C5NA 3LC5A 1C1SA 3RXQA 4UFFH 3ATIA 4H6TA 2Z9LA 3UQVA 1O5AB 1V2LT 3S9CA 2HPPH 1DT2A 3A7TA 3I29A 4BNRA 1LHCH 3FVFB 1IAUA 3PMBB 1G9IE 2ZO3H 1GL0E 1KLIH 2C4FH 2PFEA 1Q2WA 3MWIU 1SHYA 4TWYA 2ZC9H 1WV7H 1TOMH 3GCHC 3QTOH 1E37B 4WVPE 4ABFA 4RKJB 1ZLRA 3TGKE 3M35A 2BDYA 1TQ7B 3ZV9A 3NWUA 1GMCG 2O8MA 3SNBA 3LJJA 2UUYA 4YO9A 1EP5A 1O2RA 1TBRH 1GI0A 2CF9H 1W10U 4AGJA 1EKBB 1W2KH 3ITIA 1GVZA 1MKWH 5EODA 4NA7A 2GT7A 1C5VA 1W7GH 5EGMA 4YLQH 4K2YA 4GLYA 3VB3A 3RXMA 4CRBA 4FUDA 3P95A 2OXSA 1BMLA 2Q6FA 5FBIA 1C1WH 3QGJA 3V7TA 1GJBB 4LXBH 1IQJA 2WPJS 1YBWA 1P12E 5EXMA 4X0WU 2FO9A 1BT7A 2B8OH 1GBMA 1V2ST 3TNSA 3AW0A 2BMGB 3FP8E 2W26A 5SGAE 3PTNA 4O97A 1SBWA 3BTME 2ODQA 2FS8A 1KLTA 1O2PA 3E91A 1A5GH 3U9AH 4AYVB 1IOEA 5HXFA 3FZDA 1C9PA 2P93A 2IN2A 2LPRA 3BTEE 3NCLA 4FXGH 1BDAA 3SNEA 1EATA 3PB1E 4NZQA 1GI1A 2A4OA 2H1UA 4JCNA 1VITG 4MPXA 2BD7A 1RTLA 3Q76A 3MU4A 1DXPA 1Q3XA 3RMNH 4JK6A 4IC5A 2O8TA 1BBRE 1QL8A 3RXBA 2BVXH 2W5EA 4UFGH 1K1JA 2BDBA 5CHAB 5LPRA 1IQHA 1NRRH 3P17H 2WPMS 4U01A 1D3TB 1EP6A 1UTMA 4YT7H 1PPGE 1PYTD 3SZNA 1QGFA 4X2VA 2AMDA 2ZI2H 4NG9H 1S82A 1GBJA 1Z71A 2Z94A 4LZ4B 3A8AA 3A80A 5E0GA 3A88A 3TNTA 3UWIA 1GI8B 2AMQA 4D9RA 1V2OT 1GCTC 2R3YA 3QN7A 3BTTE 2ZTZA 1YCPH 5C3NA 1WSSH 3LDXH 1DPOA 1GBIA 3PLPA 2F9OA 3LGVA 4INHA 1UCYE 2FOGA 1XUKA 2G00A 1E35B 4LK4A 3GY7A 3H7OA 1HJAB 4X6MA 5E0HA 3VEQB 3K9XB 4TY7A 1KXDA 4X1NU 5A8YA 1IQMA 2CF8H 1CHOG 4QT8C 3RM2H 1LQDB 4INKA 3U8RH 1RIWB 2BDHA 2ASUB 5HM9A 5A0AE 2BLQA 2ZPRA 4KGAA 1FNIA 4BAMB 1LHGH 5GPIB 2QXJA 5HM2A 4TWWA 3ZVEA 1C1UH 2GCHF 1P0SH 2BYAX 2XC4A 1O3OA 3RM0H 1ELTA 4AFSA 2G5NA 2J38A 2ALPA 1A1RA 4CRGA 8ESTE 4XOJA 1HJ9A 1BTPA 1MCTA 1KTTB 1LHEH 3RXIA 1C5OH 1NU7B 4MNYA 1MKXK 3ZVBA 3E0NB 4AG1A 3SO3A 1AWFH 2W7SA 5HGGA 2QF3A 4Y7AA 4GSOA 3SUDA 2BDIA 2SGAA 3I77A 5K0HA 3BN9A 1Y59T 3UNQA 1LHDH 2Z9KA 1O3GA 4IN2A 2ANMH 2CMYA 3ATLA 1EAXA 1EJNA 2LNCA 3KEEA 3KF2A 1F92A 3MH7A 4JK5A 4FUEA 1VITH 1J14A 1QR3E 3GY6A 3RUOA 3SV6A 3VGCB 3SU6A 2H9HA 3TK9A 4Y0ZE 4CRDA 3F68H 4RKOB 3R3GB 3TK5A 1ANCA 3E8LA 2WUBA 1CT2E 3RXHA 1O2XA 1D9IA 1OWHA 2CN0H 1HAGE 4NA8A 4AX9H 1PQ7A 1LMWB 4ZHLU 1NRQH 1A2CH 2H5DA 2ZDVH 3KQCA 4B75A 4GCHG 2EI6A 1EJMA 1N8OC 3MTYA 3M5LA 4DVAU 1TABE 1TRMA 2BTCE 2F9PA 1WBGB 1LDTT 2CHAC 1K1MA 1S83A 3HK3B 1TOCB 2C3SA 3SORA 4NGAH 1GHWH 1DWEH 3RC6A 5E0JA 3VXEH 1GG6C 3EA9A 8GCHF 5JBCS 5A0CA 3S9AA 3TK6A 1OWJA 4X1RU 2FTLE 1W7XH 2H9EH 4GHQA 1ACBE 1Z6EA 1O39A 2THFB 1RIWC 3BEUA 3UNRA 4IS5A 3URDA 2ZEBA 1BZXE 4MNWA 3SU4A 1LO6A 4ABIA 4ISHH 1TNHA 1A61H 1O3KA 1ESBA 2G4UA 1D4PB 3SNAA 4I8JA 3TGIE 3H7TA 2ZTYA 1BITA 5DP7A 4J1YA 1T8NA 3MI4A 1MZAA 3VB7A 1EZUC 1GMDG 2PUXB 4ASHA 4XBBA 1NC6A 4BAHB 1MTWA 3UTUH 1DITH 1P09A 1GHAG 2CGAA 1AQ7A 2FM2A 2QCYA 1BMAA 2AFQB 3LGUA 3A7XA 3A81A 1OP2A 2UUKB 3R0FA 3NXPA 3RXFA 3RXLA 4Y11E 1FIWA 4CBNA 1NRSH 3E1XB 4I31A 3ZVGA 2BM2A 1MH0A 3T26A 4Y76A 1GJCB 2ZFTA 1DXWA 1YLDA 1RS0A 1QBVH 3SGQE 2ZU5A 2R0LA 1ESAA 3AASA 3O8CA 1D3PB 1DLEA 1TX7A 1ZRKA 3QZRA 2BVSH 2ZDNA 1SG8B 2ZP0H 1A46H 1AUJA 2M5TA 1IQFA 2DUCA 1OYTH 1QCPA 1TPOA 4BOHA 2BY8X 2TRMA 1SR5C 1YKTA 2F83A 1K21H 5FX5A 1DANH 3ZZAA 3A84A 2PKSB 2F3CE 4MVNA 2BDCA 1XUGA 3W94A 4D7FA 3GDUA 1B7XB 1G3EA 1V2NT 3M37A 1GDUA 3KIDU 4ABDA 2AGGX 4ISIH 1THSH 1NFXA 2TIOA 1UVSH 1FY4A 1TAWA 2PR3A 3ZZ8A 4CH2B 2FOMB 4R0IA 1UVUH 2BOHB 3BTHE 5DP8A 3CP7A 2BD9A 1N1LA 2R2WU 1UTPA 2ZFSA 1O2YA 1O32A 8GCHG 5JBBS 1BTWA 2FOCA 5C2ZA 1TA6A 3K65B 1ZHMA 3E0PB 1LKBA 3BG4C 3AW1A 3U69H 1LTOA 1SQTA 2GTBA 3TLOA 1BTZA 3C1KA 1WQVH 1RGQA 1V2RT 4GVUA 1Y3XA 1O2QA 1SC8U 9LPRA 3SJ9A 5DG6A 4Z6AH 2ZGJA 1UCYK 4AG2A 1ELCA 1FN8A 4A92A 1TPAE 1G2LA 4UONA 1DY8A 4CRFA 2J9NA 2BY7X 3SOSA 5G4BA 1NFUA 1O3AA 1Z8IB 3GDSA 3ESTA 1G3DA 1GHZA 1DM4B 1CVWH 2ZU4A 2ZDAH 3GCTF 1YCPK 4MDSA 4O3TA 1A3BH 1EOLA 1KXCA 3P8OA 1HXEH 1MBQA 4U2WA 4ZKRU 1L0ZA 4Q7ZA 1Z7KA 1MMJN 1P57B 1HYLA 1YPJH 1GDNA 1V3XA 1C2LA 3URCA 2FI3E 1EPTC 1YPMH 1WTGH 4Y10E 4YM9A 6CHAC 2QC2A 3GCNA 3M61U 3PMJA 2BLWA 1AKSA 4LZ1H 2ZU1A 1YGCH 1K1OA 2D8WA 2AEIH 1SVPA 4CH8B 1L1JA 2ZKSA 1CHGA 2RDLA 1SPJA 1XVMA 4E7NA 1BHXB 1O2IA 1J17T 1THRH 2VVUA 1V2VT 4Y71A 4OS2A 2A4QA 2GVFA 1JOUB 4BTIB 3M3TA 1O3JA 3A83A 2SGDE 4YTAA 4FUBA 3UFAA 1GI7B 5IDKA 1DUEA 4H42U 2GZ7A 4I8KA 7GCHF 1FY3A 1P05A 1FIZA 2A0QB 2GCHG 3RXVA 1JWTA 1V2WT 4ZH8A 1GJ7B 1O36A 1SL3A 4ZROA 1MU6B 1TNKA 1XXDA 3TPIZ 1O5CB 3GOVB 3SI3H 1WCZA 1TBQH 2ZDLA 4ABJA 3EA8A 3MNXA 1PYTC 5GCHF 1MCVA 5I46H 3ZYDA 3RXPA 1LKAA 4WMFA 4JZEH 2FEQH 1K22H 3RMOH 5J4SA 4Z0KA 4X6NA 1SQAA 2VVVA 2HLCA 3KN2A 1P10A 4D9QA 5JB8S 2P59A 3C27B 2A5KA 1VGCB 3P8NA 5ETXA 1UTJA 5HYOA 2Y82A 1NT1A 1EZSC 3F9GA 3U8OH 3T27A 1FY5A 5LH8A 1TYNA 3F1SB 1ZTKA 1L2EA 4E05H 3ZZ9A 3A8CA 2BQ7B 2B5TB 1CO7E 1ZHPA 3RXOA 1FJSA 3JZ1B 3PTBA 4JYTA 3OTJE 1P8VC 1PPHE 2VGCB 4IMZA 3RXGA 2PWXA 1JRSA 3GY3A 1P01A 3SNCA 5EG4A 1TONA 3P70B 3A82A 3OY5U 1WYKA 3KCGH 3ZZDA 5F8TA 2Z3CA 4FU9A 5C1XA 1MAYA 3FAOA 1NPMA 3RXUA 1BTYA 1Z1IA 1L4DA 1LPZB 4X8SH 3RLYH 3ENSB 1GBBA 4ABGA 4ZKOU 1S85A 1TA2A 1ETRH 3E90B 2SNWA 2VB0A 2GV6A 4DG4A 1MUEB 4TPYA 4AB8A 1Z1JA 4AZ2B 2VINA 3RU4D 1KXBA 2BHGA 4E7RG 4X1QU 4X1PU
chains in the Genus database with same CATH superfamily
4ABHA 5A8XA 3A89A 2VU8E 3OTPA 1V2PT 2JH0D 1C2JA 1XX9A 1SGRE 2VH0A 3OE7D 1NO9H 1U6QA 3Q3XA 3TH2H 1N6XA 1NRNH 2A2QH 2F9UA 5EOKA 1UK2A 2UUJB 3CS7A 2ULLA 3EAJA 1P04A 3GY5A 4B73A 2B9LA 1FPCH 4F49A 1UMAH 2ZFPH 3SI4H 3F9EA 2JDID 5E8EH 2P3UB 3D62A 3RC4A 1O3HA 1IQLA 1P9SA 1KXFA 4X1SU 1AMHA 1BRUP 5ABWA 1HLTH 3SQEE 5B6OA 5GIBA 1BRBE 1ANBA 1HIAA 1P2NA 1SGFA 3GCOA 3BG8A 4NWLA 1B0EA 4X6OA 5C67A 7GCHG 3RXKA 1W12U 4DT7B 1C2FA 5CHAC 3NZIA 3V3MA 1QB9A 1HUTH 2W6ID 1X7AC 2AH4X 4B6FA 3SQHE 2D26C 3M36A 2A5IA 2D2DA 4A7IB 1C1RA 1YC0A 2ZA5A 1QA0A 3BEIB 4K8BA 1RXPA 1WU1A 1TB6H 2G4TA 1AU8A 3GCHB 1YM0A 1C1MA 2KR7A 4KTUA 1HPGA 5C20A 2VIQA 3E3TA 4ZXYH 2Y7ZA 3SV7A 1HAIH 2OC1A 2BD2A 4ZUHA 2JJ1D 1W14U 2XBYA 4BAQB 1RFNA 2ZFQH 2ZTXA 5FCKA 2Z6BD 3V12A 1GMCF 2P3FH 2V6NA 2P8OB 5DN6D 2XWAA 1ID5H 3OX7U 1FY8E 3N7EA 3OU0A 5EPYA 4ZCNA 2OBQA 1ABJH 5DSFA 5IYTA 4I32A 1V2UT 1QRZA 2GX4A 4IBLH 4BTUB 3D65E 1SQOA 3GY4A 4AFUA 1C5YB 1C1TA 1SKYE 1OP0A 5C1YA 5FAHA 4D8NA 4D76A 1GI6A 1XUIA 1OWKA 3SU3A 1NESE 1JMOH 4Y6DA 2Z9GA 3U98H 1NN6A 3BSQA 4HG6A 2V3OH 1MKWK 1TQ0B 1OWDA 5GDSH 1AUTC 4Y8ZA 2WV9A 3MU5A 2XC5A 2IJOB 1LPKB 5EXNA 2C8WB 1MTNB 4FUHA 1SGFG 1BMMH 5L6NH 5LPFA 1QURH 1V2KT 2BX3A 1AN1E 1CHOF 3BTQE 3O8BA 2XCNA 4FUJA 2FMJA 1C5MD 4BXWA 5DJ7A 3A87A 2G5VA 2QGRA 1T4VH 1GCDA 1C4Y2 1E1QD 1PQ5A 3ZVFA 1EPTA 3ZVCA 2B7DH 4XSKU 1TMUH 3PROA 3RC5A 1HRTH 2BVRH 3B23B 3PM3A 2UWPA 1GBAA 1LPGB 1OS8A 2BD3A 2C93B 2ZWLH 5T1VA 4DIIH 1KXAA 1A5HA 1QQUA 5EQSA 1P2JA 1O5DH 3RXCA 2R3UA 2Z3DA 3DT0H 3E6PH 3UPEA 2TGDA 1FAXA 1THPB 3MO9A 3TJUA 2OC0A 2JH5D 1O2HA 5E2OA 2O9QA 1E1RD 2VWNA 2BQ6B 2LIZA 3UY9A 1EPTB 1AVGH 1DFPA 4BAOB 1P3CA 1XVOA 2G8TA 5EJLA 2A4RA 4DOQA 1O3DA 1BBRH 2GKVE 3RP2A 4Y0YE 1DX5M 1EQ9A 2QAAA 4KTCA 4AB9A 1H8IH 4WMDA 1YWUA 2IPQX 3GS9A 3V0XA 2C8ZB 3HGPA 2ZGBH 1PJPA 1C2EA 3PV5A 5ESBA 1B0FA 1A0LA 1AVWA 3FN8A 4DURA 1HGTH 1SI5H 2Y80A 3TU7H 4SGAE 1AZZA 4X2WA 3UREA 2QY0B 1S81A 4NWKA 4I8GA 4AORA 3Q77A 3KYGA 3VB6A 1WXRA 2KM0A 3MHWU 2JETB 5GXPA 1ZRBA 2PW8H 2Q6GA 2NU1E 1B5GH 4MPUA 6GCHF 3OSYA 1P2MA 1AKSB 1LCYA 2FOHA 2HNTE 2VIPA 4ISNA 1ZGIA 4JZIA 1XKBC 4DY7B 3F6UH 1AHTH 4FU8A 2OBOA 1F5RA 3RMMH 5F8XA 1Q31A 2QF0A 1C5LH 4X6PA 1PPZA 1HAOH 4ZKNU 1LQEA 1DS2E 1OKXA 1TALA 2ZFFH 2J34A 1GL1A 2NU4E 1D6WA 3AAUA 3W95A 3I78A 3RXEA 1VKYA 2V0BA 3CENA 1EASA 1IQIA 4X8TH 1QTFA 2FS9A 1TIOA 2GCTC 1NTPA 3UR6A 1AD8H 2FZZA 2J5UA 2UUFB 1HIAB 3SGAE 2ZQ2A 2V3HH 1A4WH 3SV2H 2WPDD 3HKJB 1P03A 1VCQA 3QK1A 3O8DA 1DICA 4E06H 2P16A 2GV7A 2XRCA 3KL6A 4NIVA 1UHBB 2WYGA 1G3CA 3WW7A 4CHAB 3MH6A 4WF8A 4F48B 3BF6H 4AFQA 4YOIA 2FI5E 1C5QA 2FLRH 4OS7A 3GY8A 4LOYH 4WJG2 2BY5X 3KYFA 4IN1A 2Y5GA 1O30A 1Y3WA 2OK5A 4TT3D 3A7WA 1YCPM 5C0UA 2PSXA 4Y8YA 4K69A 3VXFH 1FXYA 1SOTA 1Z8RA 1AGJA 5FPYA 1UVPA 1PQAA 3BV9B 4F55A 3BTKE 1ELBA 1XUHA 3HKIB 1ETTH 1A7SA 4X8UH 3M5MA 2WZQA 1YYY1 2K7XA 2R9PA 2TPIZ 2SGFE 1C5NH 2SGPE 4NA9H 3TITA 1GHXH 1SB1H 1WUNH 1ZGVA 3HGNA 4ISOA 2H9TH 1HXFH 2G52A 2WV4A 3ZZBA 1C2DA 1C5PA 2A7JA 2FDAA 1AFQC 3SUGA 4K8YA 3STIA 1JRTA 3AAVA 2ZGHA 4I8HA 2ZHWH 1O2GH 2AHME 2Y5FA 5AFZH 1EAUA 1GVKB 1W0JD 1O3EA 2OC8A 2V35A 4A5TS 5K7RA 1WAYB 1BMNH 1FI8A 1BCUH 3G01A 4AN7A 2J92A 5EQQA 1OYQA 4XBDA 1OPHB 1RJXB 1QBOA 2NU2E 5FPSA 1HAHH 4YOJA 2VVCA 4GAWA 2ZF0H 2BX4A 1PPFE 2WYJA 3L6PA 2XWBI 4BTTB 1K28D 1FX0B 4HFPB 4YLUA 3LH3A 3DHKH 1T8LA 2R2MB 1GI4A 2PGQB 4AGKA 1F5LA 2ILNA 1OWEA 1F0RA 3K6YA 5F03A 3FP7E 1C9TA 7ESTE 4M7GA 1SGCA 4CR5A 4DIHH 6LPRA 4ASUD 5FX6A 4DJZB 1T32A 2GT8A 1SGQE 1XXFA 5L30H 1YY3A 1QJ6B 1AFEH 1AVXA 1O38A 2GZ9A 2OQUA 1BTXA 1G32B 1KIGH 2GMTB 2A32A 1GMHF 4ACAA 4MG3A 2FOFA 1XM1A 2IOTA 2BD4A 3SHAH 3EGKH 5F6MA 1C1QA 4OM9A 5DKMA 1UTNA 2OLGA 4YZUA 1EAIA 2EEKA 7KMEH 1TX6A 1NU9A 1BA8B 1C4V2 1VITF 3K6ZA 2YOLA 1VCPA 1AO5A 4FVDA 2HVXA 2LP6A 2FOAA 4FUFA 3QTVH 3MNSA 2OCVB 3LGYA 4O9VA 2VIDA 2I6QA 1ZMJA 5KGOA 3RXJA 4RT0A 1YLCA 2GMTC 3D23A 1P02A 1GG6B 1MBMA 1D3QB 1BRAA 1EX3A 1FN6A 1QRWA 2ANKH 5T6GA 3LH1A 2A4GA 2XC0A 4B2BA 2FESH 4NFFA 1F0UA 1HB0B 2QN5T 3SUFA 2G81E 1KDQA 2BXTH 1O5GH 3S7HB 1ZPZA 5BPEA 3SU1A 3RXSA 2XNDD 2DE8A 3NK8A 5LGOA 1O2SA 1NBME 3F2GA 3RU4E 2ZU3A 3MO3A 3T28A 1TGTA 5E2PA 3ZZ6A 4Q7XA 2OD3B 3QLPH 2AIQA 1AZ8A 1K1LA 4I33A 1A0JA 4OS4A 3SW2B 1IQEA 4JMYA 1SGEE 2LELA 3VPKA 2CXVA 1ELEE 1SHHB 2PKAA 1MZDA 1D6RA 3P8FA 2C90B 4WY3A 1QIXB 3LC3A 3KQEA 2BLVA 4OGYA 2PV9B 1HFDA 5EW2H 1N6YA 5CMXH 2VGCC 4MLFB 2BD8A 1S6LA 2HALA 2Y6TA 1ARCA 3STJA 1WQSA 1AFQB 4O3UA 4XBCA 1J8AA 1QHRB 4XFQA 1NFWA 1T31A 1Z8JB 3TGJE 2XBVA 3SBKA 3OEED 4VGCC 5A09A 1GGDC 5C1UA 2PSYA 3RDZA 1A5IA 4ZMAH 5DGJA 4HI3A 4RSPA 1SLXB 3BIUH 1FY1A 1EAWA 2QV1A 4B2CA 2PUQH 2W7UA 2DE9A 5FXLA 3LGIA 3P8GA 2SGQE 1E36B 1S84A 1FAKH 2A2XH 3BTDE 2BOKA 3A86A 1H9IE 3N7OA 2TGPZ 3KGPA 4OS6A 1LVOA 4FETA 1ZSLA 5FCRA 2AIPA 5T6FA 2ZU2A 5GNDA 2F43B 1GWAA 3ODFA 1C2HA 1GJAB 4ABAA 3V13A 2F4LA 3QUMP 4FVBA 1G30B 1AE5A 3LIWA 1JXPA 3T2NA 1C2KA 1TGCA 3LPRA 3GY2A 3ZZCA 1CGHA 1P06A 4ISLA 2G51A 3EQ0H 1ELDE 3W1EA 5T3HA 1HAZB 3MMGA 5GWZA 3FFGA 1FQ3A 4B1TA 3MH5A 1AI8H 1EB2A 1N8OB 1E0FD 2FYQA 3NUMA 1QJ7B 1O3NA 6CHAB 6GCHG 2XCFA 4ZAEA 4ZHMU 2ODYB 5AFYH 1ETSH 1Y5AT 4B6EA 4K1SA 1TNIA 4ABBA 1DLKB 3BTWE 4CREA 2RA3A 4NCYA 4MPWA 4DT4A 2O8UA 1TMTH 2OUAA 2PLXA 1VZQH 2SGEE 4GHTA 2VBCA 8KME2 3HPTB 3SJ8A 4A1TA 1SLUB 3UNSA 1CGIE 4CRAA 4MQAA 4RN6A 4FUIA 2QXIA 2ZG0H 5C5OA 5L2YH 1ZYOA 4UFEH 1QJ1B 2KCOA 3PV2A 1PPEE 3KHVA 5L2ZH 1O35A 1P3EA 1DWCH 1CT4E 1UHBA 1ELFA 2ZFRH 1UTOA 3F0OA 1F5KU 3S69A 1ZSJA 4NSYA 2ZHEH 4GPGA 1VR1H 4FU7A 5DPAA 1E38B 2QXHA 1BHXF 1H8HD 2A45B 1QQ4A 1ZSKA 1GMDF 2JETC 1GPZA 3TH3H 1AIXH 4DGJA 1HAVB 3U1JB 1FDPA 5EU8A 4P02A 2XTTB 3AVZA 2FI4E 1YPKH 2TGTA 1GHBG 1O2VA 4B74A 1AY6H 5JB9S 3PO1C 2Y7XA 2EA3A 3H5CB 2ANYA 1VJ9U 1HAPH 3F9FA 4K60A 1KMHB 1ZPBA 5A0BA 2RCEA 3S9BA 1KSNA 2HWLB 2VIWA 4H4FA 2HNTC 2JH6D 3DSPA 4Q80A 1O3IA 3TJNA 1EFRD 4KP0A 4ZXXH 1QL9A 3EA7A 2B0FA 1SGPE 3GYLB 5HKKD 2H2ZA 1HAVA 2FIRH 2GZ8A 1MQ5A 1NM6A 4U30A 5JYIA 1PFXC 1V2TT 4ESTE 2BD5A 4DCDA 3NPSA 2XBXA 1INCA 1LVBA 1ANDA 3TH4H 4PROA 3MU8A 4A1VA 4TY6A 1C1VH 4KELA 1TNLA 3IG6B 2BB4A 2VWLA 1DY9A 1O3MA 2ZGCA 2P95A 3PLBA 1V2QT 1HV7A 3LJOA 2J94A 5KEDA 1W0YH 2HNTF 1K1NA 1MAXA 2EY4C 1BJVA 1G37A 4GCHF 3SJIA 2PKAB 2ZGXH 1FLEE 1QRXA 1UTKA 3DUXH 1J9CH 1GI9B 2QE7D 5J4QA 3LONA 3DFLA 1K9OE 1ORFA 2C8XB 1PPCE 1YPHC 3A7YA 3WWFA 4JYUH 1FUJA 1TGNA 1C5XB 2PTCE 4AFZA 3F2HA 4K1EA 3ZVAA 4WMEA 2J4IA 1P2OA 2R0KA 5TCAA 5KECA 2EC9H 3UWJH 1RTFB 5JBTA 1KTSB 1L1GA 4IC6A 5F8ZA 3DA9B 3M7QA 1ZMLA 1O3PB 1RRKA 3WY8A 5FBEA 1NS3A 1G2MA 3B9FH 1P2QA 1O2OA 4OS5A 4KKDA 5JBAS 2I6SA 2KCYA 1J16A 1V2MT 1GMHG 4KTSA 3A7ZA 3IITA 1RTKA 3E16B 5T6DA 4UEHH 3QGNB 4ACBA 2KAIB 5EXLA 2O8WA 2BY9X 3QZQA 1H9LB 1ELAA 3PO1B 5JDUB 2A5AA 1DVAH 1VCWA 1GJ8B 2Z9JA 2J95A 1UTQA 4P00A 3SHCH 3PMHB 4GUXA 2VIOA 3SV9A 1CSOE 1TPPA 3A8DA 1SGNE 1HAYB 1YPGH 1GBCA 1SFQB 3HK6B 3MYWA 3ZZ7A 3SZEA 2GD4B 1IQKA 1S0RA 5B6LA 1MKXH 5HIZA 2FOBA 3VFEA 1UVTH 2BZ6H 1O2ZA 2QIQA 1EZXC 2QXGA 2BXUH 2TBSA 2W3IA 2HGTH 3KQDA 3KNXA 4BXSA 4DW2U 3L33A 1GGDB 3CS0A 4Y8XA 2JIZD 2WV5A 1GBTA 1O5FH 1KXEA 5A2MH 1W13U 2H5CA 3VGCC 2ZCLP 3P6ZB 1DWDH 2J2UA 2STAE 2WPIS 1G36A 3MU1A 4NZLA 1OX1A 4Q4LA 1TE0A 1KY9A 1JIMA 1QFKH 3UIRA 1ZMNA 3SN8A 2BY6X 2OTVA 3SU0A 2FLBH 1C5TA 3RXRA 2RDEA 3HATH 1HCGA 1BTHH 2FP7B 1KDQB 4K5ZA 1UK3A 3FANA 1TPSA 1CT0E 2EI8A 4H6SB 4INLA 2VWOA 1ZTLA 1GJ5H 2JKHA 2ZHQH 2WINI 4YT6H 3SGBE 2PTNA 3SJKA 3MNCA 1FMGA 3ATKA 2OQ5A 3P92A 4D7GA 5EQRA 1TX8A 1S0QA 1QNJA 2STBE 5HIYA 1O2TA 1ZOMA 4F4OC 1AB9B 2YNBA 2Y81A 4Y7BA 1CQQA 1F2SE 1G3BA 2IPHA 1NZQH 5FPTA 4YOGA 1WDIA 3ZZ3A 2VWMA 1SGIB 1H4WA 1ZTJA 4YESB 5DP5A 2FPZA 3BIVH 4J2YB 2V7QD 3KQBA 4TSFD 4MPVA 5TJXA 1C2GA 2EI7A 3K2UA 3DD2H 1QBNA 4FUCA 4K3JA 1W11U 1HJ8A 2QA9E 3SU5A 1E79D 3SNDA 2WPKS 2ZZUH 4UFDH 5EPNA 1TBZH 2PHBA 4B71A 6ESTA 1GHVH 1Z8GA 2AMPA 4I8LA 1NY22 2BZAA 4THNH 3ZYEA 2F9VA 2GJGA 3SYJA 1C1PA 2ZCKP 3RXAA 9ESTA 1P11E 3GYMA 1TFXA 4I86A 3T29A 5DK1A 2ZCHP 1CE5A 1O5EH 1ZZZA 4K1TA 4AOQA 5A8ZA 2J97A 1S6FA 5C94A 1H8ED 1AE8H 1ZHRA 3U1IB 3QDZB 3MFJA 3UOPA 1OOKB 1YPLH 1E34B 1Y5UT 3FOAA 5GJ4B 1OP8A 1C2MA 1JIRA 4B2AA 1YP9A 1C5RA 1FZZA 2W3KA 1MU8B 5EW1H 1GHYH 4OS1A 5I25A 1P2IA 2AS9A 2GGVB 1BOQA 2BDGA 2ZHDA 4FUGA 2Z9IA 4WXVA 1T8MA 2NWNA 3ZV8A 3LGTA 4AYYB 1HNEE 2BDAA 3ODDA 4TPIZ 1SMFE 1LVYA 2WUCA 3L3TA 8LPRA 1T7CA 3RU4T 3UUZA 3LT3A 1CA0C 1ANEA 1NRPH 2FODA 2XXLA 5EJZA 3M7UA 4IGDA 3ZZ5A 2HRVA 3PYHA 5AVDA 1DDJA 3ZIAD 1HDTH 1IHSH 2A31A 1O2LA 4Q63A 2Z7FE 3BEFB 2L6OA 3VB4A 1Y8TA 3LKWA 2RFKC 3RXDA 2G55A 5PTPA 2Q6DA 1Y3UA 2ANWA 1O2UA 3MH4A 3GISB 3PMAB 1J15A 1GDQA 1XUFA 5JPMH 5BRRE 5ESTE 1ZR0A 1C5WB 1YLNA 2ZNKH 5IK2D 2YNAA 2A7HA 3UOUA 1O37A 3IWMA 2ZECA 4VGCB 3Q3KA 3OYPA 5FL7D 4JZDH 1GBFA 2M2AA 2VJ1A 1WTHD 4JYVH 1DUAA 1TMBH 1BB0B 1C1NA 3MO6A 2F9BH 2PP6A 1UVOA 2RG3A 1V2JT 4IW4E 1DSTA 4WWYA 3TVJB 3O8RA 3DCLA 3PRBA 1UW7A 1ZJKA 4ABEA 1O33A 4Q2KA 2ODPA 1GVLA 1W3CA 1GHBF 1GI3A 1GI5A 1C5ZB 1GJ4H 1YPEH 2AYWA 1GBKA 1GHAF 1EJAA 1ELVA 2GDDA 4R8TB 2RA0A 3PWBA 4BAKB 3S0NA 1H9HE 1TNGA 2KFWA 2P94A 1TNJA 1SGTA 3ATWA 1O2KA 2K1QA 3PLKA 4RI0A 1O3CA 3RMLH 3FKSD 5CE1A 2O8LA 5EIYA 3U8TH 3ZVDA 3EE0B 1NFYA 1SLVB 3M3SA 1DOJA 2AERH 2CJIA 2KAIA 3NKKA 2FX6A 1EOJA 1TGSZ 2WPLS 1Y3VA 1F0SA 1CU1A 3QWCH 1C4U2 1GBLA 3EBNA 2ZPQA 1KLJH 2PGBB 1T4UH 2WPHS 1MD7A 3LOXA 1M9UA 3LGWA 3M7TA 1ZJDA 1DSUA 3RXTA 3T25A 3RLWH 3OY6U 3CNRA 2HVYB 3FP6E 2FYRA 1BIOA 1DWBH 4A6LA 1EB1H 2UWOA 1AWHB 1HJAC 1HBTH 2GDEH 2UWLA 2VIVA 4HTCH 4MNXA 2P3TB 3T5FH 2SNVA 3GDVA 5LPEA 5F53A 2GP9B 4XDEA 4YXWD 1O2NA 4NIYA 4CRCA 3S7KB 1C5UA 2FX4A 1FONA 2F9NA 1VGCC 1O3FA 1PQ8A 1BMFD 3QO6A 5H4IB 1T8OA 3JZ2B 2FWWA 4AC9A 1MTSA 2KX4A 1O2MA 1TWXB 3QX5H 2ZPSA 4X2XA 1SSXA 1UTLM 3SJOA 1ELGA 5AF9H 3DFJA 2ESTE 2A7CA 1IQGA 1GJ6A 5DO4H 3GCTG 1BJUA 4NSVA 3SUEA 1UCYH 2FXRA 1GJDB 1XUJA 1SOZA 3GICB 1P2KA 2BLOA 2KCPA 1UJ1A 2ZDKA 1K1PA 2QF4A 5DP6A 1GI2A 3VB5A 1YPHE 4X8VH 1IHTH 3ATMA 2ZQ1A 5TCCA 3M5NA 3F3BA 1AB9C 1BUIA 1W0ZU 4U32A 5AHGH 3BTGE 4XE4A 3SV8A 1CA0B 3UB0A 4WH8A 4CBOA 4A1XA 1O3LA 1MABB 1XMNB 2Y5HA 4TYDA 1TLDA 2OINA 2NU3E 1ZPCA 1LVMA 4WH6A 1QY6A 1SLWB 1CA8B 1ESTA 1VJAU 2GCTB 3MU0A 1V6DA 3OAAD 1MQ6A 4HGCA 2OP9A 2J98A 1S6HA 3Q00A 3PWCA 2HPQH 4HZHA 4BANB 1A0HB 2AGIX 1JBUH 1OXGA 1QB1A 2C8YB 1BRCE 1RD3B 2XBWA 1OWIA 1QA7A 3A7VA 1TRNA 3MOCA 3T62A 1EZQA 1WOFA 4NIXA 2FTMA 3ZZ4A 4JZ1A 1BBRK 1MTNC 2P8OC 5DP4A 1FV9A 1TGBA 3DSGA 1LHFH 3TIUA 4CHAC 4B76A 5FHTA 1HAXB 1O2JA 3A85A 3KQ5A 1W8BH 2Z3EA 3MNBA 1C2IA 1L1NA 2XW9A 1ARBA 1O2WA 1H8DH 1K2I1 4IMQA 4NFEA 3TJVA 4WXIA 2CV3A 3WWBA 1F7ZA 2BQWB 2J98B 2VH6A 5DP9A 1GBHA 2W6JD 1ABIH 1CBWC 3SU2A 4UDWH 3BG4B 1O31A 2CHAB 2K8IA 1TRYA 2D1JA 1NROH 2F91A 1O34A 1UK4A 1Y5BT 3UQOA 4Y79A 7LPRA 3Q3YA 4ZKSU 4NIWA 4UE7H 4UD9H 1P9UA 4I7YH 1EXFA 4MNVA 3FZZA 3F9HA 4CR9A 2ZIQH 1GBDA 1GBEA 1CGJE 2HOBA 2VNTA 1BTUA 1YF4A 2ALVA 1QB6A 1GCTB 1MTVA 1BQYA 2AGEX 1UO6A 5GCHG 1FPHH 4XD7D 1DE7H 3A8BA 2XYAA 3F2FA 3EYDA 3UR9A 4JZFH 5DP3A 3BTFE 1C5SA 2SFAA 3M5OA 3B8JA 1L4ZA 2PKSC 2ZDMA 1S5SA 3LU9B 1H1BA 1MD8A 1SFIA 2H6MA 1IQNA 1XKAC 3TJOA 1MTUA 1O3BA 1A3EH 4ZHAA 1K1IA 5HMAA 1QL7A 2QYIA 2XNIA 3M3VA 3ELAH 1SGYE 3EDXB 2FOEA 1CBWB 4O03A 1Z6JH 1D3DB 1OSSA 1KYNA 2EQNA 1EUFA 4OGXA 2TGAA 2YMSB 4MTBA 1Y3YA 4FOUC 2Q1JA 1O0DH 1SGDE 4Q7YA 2A1DB 3PV4A 1GJ9B 1F0TA 1PPBH 1C1OA 2OC7A 1SQRA 2ZHFH 4X2YA 3D49H 4SGBE 2NU0E 1O5BB 5C5NA 3LC5A 1C1SA 3RXQA 4UFFH 3ATIA 4H6TA 2Z9LA 3UQVA 1O5AB 1V2LT 3S9CA 2L74A 2HPPH 1DT2A 3A7TA 3I29A 4BNRA 4M9FA 3F0PA 1LHCH 3FVFB 2K0QA 1IAUA 3PMBB 1G9IE 2ZO3H 1GL0E 2YMSD 1KLIH 2C4FH 2PFEA 1Q2WA 3MWIU 1SHYA 4TWYA 2ZC9H 1WV7H 1TOMH 3GCHC 3QTOH 1E37B 4WVPE 4ABFA 4RKJB 1ZLRA 3TGKE 3M35A 2BDYA 1TQ7B 3ZV9A 3NWUA 1GMCG 2O8MA 3SNBA 3LJJA 2UUYA 4YO9A 1EP5A 1O2RA 1TBRH 1GI0A 2CF9H 1W10U 4AGJA 1EKBB 1W2KH 3ITIA 1GVZA 1MKWH 5EODA 4NA7A 2GT7A 1C5VA 1W7GH 5EGMA 4YLQH 4K2YA 4GLYA 3VB3A 3RXMA 4CRBA 4FUDA 3P95A 2OXSA 3U28C 1BMLA 2Q6FA 5FBIA 1C1WH 3QGJA 3V7TA 1GJBB 4LXBH 3N99A 1IQJA 2WPJS 1YBWA 1P12E 5EXMA 4X0WU 2FO9A 2CK3D 1BT7A 2B8OH 1GBMA 1V2ST 3TNSA 3AW0A 2BMGB 3FP8E 2W26A 4XRNA 5SGAE 3PTNA 4O97A 1SBWA 3BTME 2ODQA 2FS8A 1KLTA 3OFND 1O2PA 3E91A 1A5GH 3U9AH 4AYVB 1IOEA 5HXFA 3FZDA 1C9PA 2P93A 2IN2A 2LPRA 3BTEE 3NCLA 4FXGH 1BDAA 2WHXA 3SNEA 1EATA 3PB1E 4NZQA 1GI1A 2A4OA 2H1UA 4JCNA 5CDFE 1VITG 4MPXA 2BD7A 1RTLA 3Q76A 3MU4A 1DXPA 1Q3XA 3RMNH 4JK6A 4IC5A 2O8TA 1BBRE 1QL8A 3RXBA 2BVXH 2W5EA 4UFGH 1K1JA 2BDBA 5CHAB 5LPRA 1IQHA 1NRRH 3P17H 2WPMS 4U01A 1D3TB 1EP6A 1UTMA 4YT7H 1PYTD 1PPGE 3SZNA 1QGFA 4X2VA 2AMDA 2ZI2H 4NG9H 1S82A 1GBJA 1Z71A 2Z94A 4LZ4B 3A8AA 3A80A 5E0GA 3A88A 3TNTA 3UWIA 1GI8B 2AMQA 4D9RA 1V2OT 1GCTC 2R3YA 3H09A 3QN7A 3BTTE 2ZTZA 1YCPH 5C3NA 1WSSH 3LDXH 1DPOA 1GBIA 3PLPA 2F9OA 3LGVA 4INHA 1UCYE 2FOGA 1XUKA 2V3MA 2G00A 1E35B 4LK4A 3VG8A 3GY7A 3H7OA 1HJAB 4X6MA 5E0HA 3VEQB 3K9XB 4TY7A 1KXDA 4X1NU 5A8YA 1IQMA 2CF8H 1CHOG 4QT8C 3RM2H 1LQDB 4INKA 3U8RH 4RT1A 1RIWB 2BDHA 2ASUB 5HM9A 5C0TA 5A0AE 2BLQA 2ZPRA 4KGAA 1FNIA 4BAMB 1LHGH 1NBMD 5GPIB 2QXJA 5HM2A 4TWWA 3ZVEA 1C1UH 2GCHF 1P0SH 2BYAX 2XC4A 1O3OA 2YMSC 3RM0H 1ELTA 4AFSA 2G5NA 2J38A 2ALPA 1A1RA 4CRGA 8ESTE 4XOJA 1HJ9A 1BTPA 1MCTA 1KTTB 1LHEH 3RXIA 1C5OH 1NU7B 4MNYA 1MKXK 3ZVBA 1OHHD 3E0NB 4AG1A 3SO3A 2JJ2D 1AWFH 3OEHD 2W7SA 5HGGA 2QF3A 4Y7AA 4GSOA 3SUDA 2BDIA 2SGAA 3I77A 5K0HA 3BN9A 1Y59T 2KCAA 3UNQA 1LHDH 2Z9KA 1O3GA 4IN2A 2ANMH 2CMYA 3ATLA 1EAXA 1EJNA 2LNCA 3KEEA 3KF2A 1F92A 3MH7A 4JK5A 4FUEA 1VITH 1J14A 1QR3E 3GY6A 3RUOA 3SV6A 3VGCB 3SU6A 2H9HA 3TK9A 4Y0ZE 4CRDA 3F68H 4RKOB 3R3GB 3TK5A 1ANCA 3UAIC 3E8LA 2WUBA 1CT2E 3RXHA 1O2XA 3NRLA 1D9IA 1OWHA 2CN0H 1HAGE 4NA8A 4AX9H 1PQ7A 1LMWB 4ZHLU 1NRQH 1A2CH 2H5DA 2ZDVH 3KQCA 4B75A 4GCHG 2EI6A 1EJMA 3PRDA 1N8OC 3MTYA 3M5LA 4DVAU 1TABE 1TRMA 2BTCE 2F9PA 1WBGB 1LDTT 2CHAC 1K1MA 1S83A 3HK3B 1TOCB 2C3SA 3SORA 4NGAH 1GHWH 1DWEH 3RC6A 5E0JA 3VXEH 1GG6C 3EA9A 8GCHF 5JBCS 5A0CA 3S9AA 3TK6A 1OWJA 4X1RU 2FTLE 1W7XH 2H9EH 4GHQA 1ACBE 1Z6EA 1O39A 2THFB 1RIWC 3BEUA 3UNRA 4IS5A 3URDA 2ZEBA 1BZXE 4MNWA 3SU4A 1LO6A 4ABIA 4ISHH 1TNHA 1A61H 1O3KA 1ESBA 2G4UA 1D4PB 3SNAA 4I8JA 3TGIE 3H7TA 2ZTYA 2WSSD 1BITA 5DP7A 4J1YA 1T8NA 3MI4A 1MZAA 3EE7A 3VB7A 1EZUC 1GMDG 2PUXB 4ASHA 4XBBA 1NC6A 4BAHB 1MTWA 3UTUH 1DITH 1P09A 1GHAG 2CGAA 1AQ7A 2FM2A 3N7DA 2QCYA 1BMAA 2AFQB 3LGUA 3A7XA 3A81A 1OP2A 2UUKB 3R0FA 3NXPA 3RXFA 3RXLA 4Y11E 1FIWA 4CBNA 1NRSH 3E1XB 4I31A 3ZVGA 2BM2A 1MH0A 3T26A 4Y76A 1GJCB 2ZFTA 1DXWA 1YLDA 1RS0A 1QBVH 3SGQE 2ZU5A 2R0LA 1ESAA 3AASA 3DSOA 3O8CA 1D3PB 1DLEA 1TX7A 1ZRKA 3QZRA 2BVSH 2ZDNA 1SG8B 2ZP0H 1A46H 1AUJA 2M5TA 1IQFA 2DUCA 1OYTH 1QCPA 1TPOA 4BOHA 2BY8X 2IJD1 2TRMA 1SR5C 1YKTA 2F83A 1K21H 5FX5A 1DANH 3ZZAA 3A84A 2PKSB 2F3CE 4MVNA 2BDCA 1XUGA 3W94A 5EJ1A 4D7FA 3GDUA 1B7XB 1G3EA 1V2NT 3M37A 1GDUA 3KIDU 4ABDA 2AGGX 4ISIH 1THSH 1NFXA 2TIOA 1UVSH 1FY4A 1TAWA 2PR3A 1QZ8A 2QF5A 3ZZ8A 4CH2B 2FOMB 4R0IA 1UVUH 2BOHB 3BTHE 5DP8A 1COWD 3CP7A 2BD9A 1N1LA 2R2WU 1UTPA 2ZFSA 1O2YA 1O32A 4Z1MD 8GCHG 5JBBS 1BTWA 2FOCA 5C2ZA 1TA6A 3K65B 1ZHMA 3E0PB 5CHBA 1LKBA 3BG4C 3AW1A 3U69H 1LTOA 1SQTA 2XOKD 2GTBA 3TLOA 1BTZA 3C1KA 1WQVH 1RGQA 3MQKC 1V2RT 4GVUA 1Y3XA 1O2QA 1SC8U 9LPRA 3SJ9A 5DG6A 4Z6AH 2ZGJA 1UCYK 4AG2A 1ELCA 1FN8A 4A92A 1TPAE 1G2LA 4UONA 1DY8A 4CRFA 2J9NA 2BY7X 3SOSA 5G4BA 1NFUA 1O3AA 1Z8IB 3GDSA 3ESTA 1G3DA 1GHZA 1DM4B 1CVWH 1W0KD 2ZU4A 2ZDAH 3GCTF 1YCPK 4MDSA 4O3TA 1A3BH 1EOLA 1KXCA 3P8OA 1HXEH 1MBQA 4U2WA 4ZKRU 1L0ZA 4Q7ZA 1Z7KA 1MMJN 1P57B 1HYLA 1YPJH 1GDNA 1V3XA 1C2LA 3URCA 2FI3E 1EPTC 1YPMH 1WTGH 4Y10E 4YM9A 6CHAC 2QC2A 3GCNA 3M61U 3PMJA 2BLWA 1AKSA 4LZ1H 2ZU1A 1YGCH 1K1OA 2D8WA 2AEIH 1SVPA 4CH8B 1L1JA 2ZKSA 1CHGA 2RDLA 1SPJA 1XVMA 4E7NA 1BHXB 1O2IA 1J17T 1THRH 2VVUA 1V2VT 4Y71A 4OS2A 2A4QA 2GVFA 1JOUB 4BTIB 3M3TA 1O3JA 3A83A 2SGDE 4YTAA 4FUBA 3UFAA 1GI7B 5IDKA 1DUEA 4H42U 2GZ7A 2KZ4A 4I8KA 7GCHF 1FY3A 1P05A 1FIZA 2A0QB 2GCHG 3RXVA 1JWTA 1V2WT 4ZH8A 1GJ7B 1O36A 1SL3A 4ZROA 3AK5A 1MU6B 1TNKA 1XXDA 3TPIZ 1O5CB 3GOVB 3SI3H 1WCZA 1TBQH 2ZDLA 4ABJA 3EA8A 3MNXA 1PYTC 5GCHF 1MCVA 5I46H 3ZYDA 3RXPA 1LKAA 4WMFA 4JZEH 2FEQH 1K22H 3RMOH 5J4SA 4Z0KA 4X6NA 1SQAA 2VVVA 2HLCA 3KN2A 1P10A 4D9QA 5JB8S 2P59A 3C27B 2A5KA 1VGCB 3P8NA 5ETXA 1UTJA 5HYOA 2Y82A 1NT1A 1EZSC 3F9GA 3U8OH 3T27A 1FY5A 5LH8A 1TYNA 3F1SB 1ZTKA 1L2EA 4E05H 3ZZ9A 3A8CA 2BQ7B 2B5TB 1CO7E 1ZHPA 3RXOA 1FJSA 3JZ1B 3PTBA 4JYTA 3OTJE 1P8VC 2HLDD 1PPHE 2VGCB 4IMZA 3RXGA 2PWXA 1JRSA 3GY3A 1P01A 3SNCA 5EG4A 1TONA 3P70B 3A82A 3OY5U 1WYKA 3KCGH 3ZZDA 5F8TA 2Z3CA 4FU9A 5C1XA 1MAYA 3FAOA 1NPMA 3RXUA 1BTYA 1Z1IA 1L4DA 1LPZB 4X8SH 3RLYH 3ENSB 1GBBA 4ABGA 4ZKOU 1S85A 1TA2A 1ETRH 5C17A 3E90B 2SNWA 2VB0A 3FO8D 2GV6A 4DG4A 1MUEB 4TPYA 4AB8A 1Z1JA 4AZ2B 2VINA 3RU4D 1K0HA 1KXBA 2BHGA 4E7RG 4X1QU 4X1PU
chains in the Genus database with same CATH topology
4ABHA 5A8XA 3A89A 2VU8E 1V2PT 2JH0D 1C2JA 1XX9A 1SGRE 2VH0A 1NO9H 1U6QA 3Q3XA 3TH2H 1N6XA 1NRNH 2A2QH 2F9UA 5EOKA 1UK2A 2UUJB 3CS7A 2ULLA 3EAJA 1P04A 3GY5A 4B73A 2B9LA 1FPCH 4F49A 1UMAH 2ZFPH 3SI4H 3F9EA 5E8EH 2P3UB 3D62A 3RC4A 1O3HA 1IQLA 1P9SA 1KXFA 4X1SU 1AMHA 1BRUP 5ABWA 1HLTH 3SQEE 5B6OA 5GIBA 1BRBE 1ANBA 1HIAA 1P2NA 1SGFA 3GCOA 3BG8A 4NWLA 1B0EA 4X6OA 5C67A 7GCHG 3RXKA 1W12U 4DT7B 1C2FA 5CHAC 3NZIA 3V3MA 1QB9A 1HUTH 1X7AC 2AH4X 3SQHE 2D26C 3M36A 2A5IA 2D2DA 4A7IB 1C1RA 1YC0A 2ZA5A 1QA0A 3BEIB 4K8BA 1RXPA 1WU1A 1TB6H 2G4TA 1AU8A 3GCHB 1YM0A 1C1MA 4KTUA 1HPGA 5C20A 2VIQA 3E3TA 4ZXYH 2Y7ZA 3SV7A 1HAIH 2OC1A 2BD2A 4ZUHA 1W14U 2XBYA 4BAQB 1RFNA 2ZFQH 2ZTXA 5FCKA 2Z6BD 3V12A 1GMCF 2P3FH 2V6NA 2P8OB 2XWAA 1ID5H 3OX7U 1FY8E 3OU0A 5EPYA 2OBQA 1ABJH 5IYTA 4I32A 1V2UT 1QRZA 2GX4A 4IBLH 4BTUB 3D65E 1SQOA 3GY4A 4AFUA 1C5YB 1C1TA 1OP0A 5C1YA 5FAHA 4D8NA 4D76A 1GI6A 1XUIA 1OWKA 3SU3A 1NESE 1JMOH 4Y6DA 2Z9GA 3U98H 1NN6A 3BSQA 2V3OH 1MKWK 1TQ0B 1OWDA 5GDSH 1AUTC 4Y8ZA 3MU5A 2XC5A 2IJOB 1LPKB 5EXNA 2C8WB 1MTNB 4FUHA 1SGFG 1BMMH 5L6NH 5LPFA 1QURH 1V2KT 2BX3A 1AN1E 1CHOF 3BTQE 3O8BA 2XCNA 4FUJA 2FMJA 1C5MD 4BXWA 5DJ7A 3A87A 2G5VA 2QGRA 1T4VH 1GCDA 1C4Y2 1PQ5A 3ZVFA 1EPTA 3ZVCA 2B7DH 4XSKU 1TMUH 3PROA 3RC5A 1HRTH 2BVRH 3B23B 3PM3A 2UWPA 1GBAA 1LPGB 1OS8A 2BD3A 2C93B 2ZWLH 4DIIH 1KXAA 1A5HA 1QQUA 5EQSA 1P2JA 1O5DH 3RXCA 2R3UA 2Z3DA 3DT0H 3E6PH 3UPEA 2TGDA 1FAXA 1THPB 3MO9A 3TJUA 2OC0A 2JH5D 1O2HA 5E2OA 2O9QA 2VWNA 2BQ6B 2LIZA 3UY9A 1EPTB 1AVGH 1DFPA 4BAOB 1P3CA 1XVOA 2G8TA 2A4RA 4DOQA 1O3DA 1BBRH 2GKVE 3RP2A 4Y0YE 1DX5M 1EQ9A 2QAAA 4KTCA 4AB9A 1H8IH 4WMDA 3V0XA 2C8ZB 3HGPA 2ZGBH 1PJPA 1C2EA 5ESBA 1B0FA 1A0LA 1AVWA 4DURA 1HGTH 1SI5H 2Y80A 3TU7H 4SGAE 1AZZA 4X2WA 3UREA 2QY0B 1S81A 4NWKA 4I8GA 4AORA 3Q77A 3VB6A 3MHWU 2JETB 5GXPA 1ZRBA 2PW8H 2Q6GA 2NU1E 1B5GH 4MPUA 6GCHF 3OSYA 1P2MA 1AKSB 1LCYA 2FOHA 2HNTE 2VIPA 4ISNA 1ZGIA 4JZIA 1XKBC 4DY7B 3F6UH 1AHTH 4FU8A 2OBOA 1F5RA 3RMMH 5F8XA 1Q31A 2QF0A 1C5LH 4X6PA 1PPZA 1HAOH 4ZKNU 1LQEA 1DS2E 1OKXA 1TALA 2ZFFH 2J34A 1GL1A 2NU4E 1D6WA 3AAUA 3W95A 3I78A 3RXEA 2V0BA 3CENA 1EASA 1IQIA 4X8TH 1QTFA 2FS9A 1TIOA 2GCTC 1NTPA 3UR6A 1AD8H 2FZZA 2UUFB 1HIAB 3SGAE 2ZQ2A 2V3HH 1A4WH 3SV2H 3HKJB 1P03A 1VCQA 3QK1A 3O8DA 1DICA 4E06H 2P16A 2GV7A 2XRCA 3KL6A 4NIVA 1UHBB 2WYGA 1G3CA 4CHAB 3MH6A 4WF8A 3BF6H 4AFQA 4YOIA 2FI5E 1C5QA 2FLRH 4OS7A 3GY8A 4LOYH 4WJG2 2BY5X 4IN1A 2Y5GA 1O30A 1Y3WA 3A7WA 1YCPM 2PSXA 4Y8YA 4K69A 3VXFH 1FXYA 1SOTA 1Z8RA 1AGJA 5FPYA 1UVPA 1PQAA 3BV9B 3BTKE 1ELBA 1XUHA 3HKIB 1ETTH 1A7SA 4X8UH 3M5MA 1YYY1 2K7XA 2R9PA 2TPIZ 2SGFE 1C5NH 2SGPE 4NA9H 3TITA 1GHXH 1SB1H 1WUNH 1ZGVA 3HGNA 4ISOA 2H9TH 1HXFH 2G52A 2WV4A 3ZZBA 1C2DA 1C5PA 2A7JA 2FDAA 1AFQC 3SUGA 4K8YA 3STIA 1JRTA 3AAVA 2ZGHA 4I8HA 2ZHWH 1O2GH 5AFZH 2Y5FA 1EAUA 1GVKB 1O3EA 2OC8A 2V35A 4A5TS 5K7RA 1WAYB 1BMNH 1FI8A 1BCUH 3G01A 4AN7A 2J92A 5EQQA 1OYQA 4XBDA 1OPHB 1RJXB 1QBOA 2NU2E 5FPSA 1HAHH 4YOJA 2VVCA 4GAWA 2ZF0H 2BX4A 1PPFE 2WYJA 3L6PA 2XWBI 4BTTB 1K28D 4HFPB 4YLUA 3LH3A 3DHKH 1T8LA 2R2MB 1GI4A 2PGQB 4AGKA 1F5LA 2ILNA 1OWEA 1F0RA 3K6YA 5F03A 3FP7E 1C9TA 7ESTE 4M7GA 1SGCA 4CR5A 4DIHH 6LPRA 5FX6A 4DJZB 1T32A 2GT8A 1SGQE 1XXFA 5L30H 1QJ6B 1AFEH 1AVXA 1O38A 2GZ9A 2OQUA 1BTXA 1G32B 1KIGH 2A32A 2GMTB 1GMHF 4MG3A 2FOFA 1XM1A 2IOTA 2BD4A 3SHAH 3EGKH 5F6MA 1C1QA 5DKMA 1UTNA 2OLGA 4YZUA 1EAIA 2EEKA 7KMEH 1TX6A 1NU9A 1BA8B 1C4V2 1VITF 3K6ZA 2YOLA 1VCPA 1AO5A 4FVDA 2HVXA 2FOAA 4FUFA 3QTVH 3MNSA 2OCVB 3LGYA 4O9VA 2VIDA 2I6QA 1ZMJA 3RXJA 1YLCA 2GMTC 3D23A 1P02A 1GG6B 1MBMA 1D3QB 1BRAA 1EX3A 1FN6A 1QRWA 2ANKH 5T6GA 3LH1A 2A4GA 2XC0A 4B2BA 2FESH 4NFFA 1F0UA 1HB0B 2QN5T 3SUFA 2G81E 1KDQA 2BXTH 1O5GH 3S7HB 1ZPZA 5BPEA 3SU1A 3RXSA 2DE8A 3NK8A 5LGOA 1O2SA 3RU4E 3T28A 2ZU3A 3MO3A 1TGTA 5E2PA 3ZZ6A 4Q7XA 2OD3B 3QLPH 2AIQA 1AZ8A 1K1LA 4I33A 1A0JA 4OS4A 3SW2B 1IQEA 4JMYA 1SGEE 3VPKA 2CXVA 1ELEE 1SHHB 2PKAA 1MZDA 1D6RA 3P8FA 2C90B 4WY3A 1QIXB 3LC3A 3KQEA 2BLVA 4OGYA 2PV9B 1HFDA 5EW2H 1N6YA 5CMXH 2VGCC 4MLFB 2BD8A 2Y6TA 2HALA 1ARCA 3STJA 1WQSA 1AFQB 4O3UA 4XBCA 1J8AA 1QHRB 4XFQA 1NFWA 1T31A 1Z8JB 3TGJE 2XBVA 3SBKA 4VGCC 5A09A 1GGDC 5C1UA 2PSYA 3RDZA 1A5IA 4ZMAH 5DGJA 4HI3A 4RSPA 1SLXB 3BIUH 1FY1A 1EAWA 2QV1A 4B2CA 2PUQH 2W7UA 2DE9A 5FXLA 3LGIA 3P8GA 2SGQE 1E36B 1S84A 1FAKH 2A2XH 3BTDE 2BOKA 3A86A 1H9IE 3N7OA 2TGPZ 3KGPA 4OS6A 1LVOA 1ZSLA 5FCRA 2AIPA 5T6FA 2ZU2A 4ABAA 1GWAA 3ODFA 1C2HA 1GJAB 3V13A 3QUMP 4FVBA 1G30B 1AE5A 3LIWA 1JXPA 3T2NA 1C2KA 1TGCA 3LPRA 3GY2A 3ZZCA 1CGHA 1P06A 4ISLA 2G51A 3EQ0H 1ELDE 5T3HA 1HAZB 3MMGA 5GWZA 3FFGA 1FQ3A 4B1TA 3MH5A 1AI8H 1EB2A 1N8OB 1E0FD 2FYQA 3NUMA 1QJ7B 1O3NA 6CHAB 6GCHG 2XCFA 4ZAEA 4ZHMU 2ODYB 5AFYH 1ETSH 1Y5AT 4K1SA 1TNIA 4ABBA 1DLKB 3BTWE 4CREA 2RA3A 4NCYA 4MPWA 2O8UA 1TMTH 2OUAA 2PLXA 1VZQH 2SGEE 4GHTA 8KME2 3HPTB 3SJ8A 4A1TA 1SLUB 3UNSA 1CGIE 4CRAA 4MQAA 4RN6A 4FUIA 2QXIA 2ZG0H 5C5OA 5L2YH 1ZYOA 4UFEH 1QJ1B 1PPEE 3KHVA 5L2ZH 1O35A 1P3EA 1DWCH 1CT4E 1UHBA 1ELFA 2ZFRH 1UTOA 1F5KU 3S69A 1ZSJA 4NSYA 2ZHEH 4GPGA 1VR1H 4FU7A 5DPAA 1E38B 2QXHA 1BHXF 2A45B 1QQ4A 1ZSKA 1GMDF 2JETC 1GPZA 3TH3H 1AIXH 4DGJA 1HAVB 3U1JB 1FDPA 5EU8A 2XTTB 3AVZA 2FI4E 1YPKH 2TGTA 1GHBG 1O2VA 4B74A 1AY6H 5JB9S 3PO1C 2Y7XA 2EA3A 3H5CB 2ANYA 1VJ9U 1HAPH 3F9FA 4K60A 1ZPBA 5A0BA 3S9BA 2RCEA 1KSNA 2HWLB 2VIWA 4H4FA 2HNTC 2JH6D 4Q80A 1O3IA 3TJNA 4KP0A 4ZXXH 1QL9A 3EA7A 2B0FA 1SGPE 3GYLB 2H2ZA 1HAVA 2FIRH 2GZ8A 1MQ5A 1NM6A 4U30A 5JYIA 1PFXC 1V2TT 4ESTE 2BD5A 4DCDA 3NPSA 2XBXA 1INCA 1LVBA 1ANDA 3TH4H 4PROA 3MU8A 4A1VA 4TY6A 1C1VH 4KELA 1TNLA 3IG6B 2BB4A 2VWLA 1DY9A 1O3MA 2ZGCA 2P95A 3PLBA 1V2QT 1HV7A 3LJOA 2J94A 1W0YH 2HNTF 1K1NA 1MAXA 1BJVA 1G37A 4GCHF 3SJIA 2PKAB 2ZGXH 1FLEE 1QRXA 1UTKA 3DUXH 1J9CH 1GI9B 5J4QA 3LONA 3DFLA 1K9OE 1ORFA 2C8XB 1PPCE 1YPHC 3A7YA 4JYUH 1FUJA 1TGNA 1C5XB 2PTCE 4AFZA 4K1EA 3ZVAA 4WMEA 2J4IA 1P2OA 2R0KA 5TCAA 2EC9H 3UWJH 1RTFB 5JBTA 1KTSB 1L1GA 4IC6A 5F8ZA 3DA9B 3M7QA 1ZMLA 1O3PB 1RRKA 3WY8A 5FBEA 1NS3A 1G2MA 3B9FH 1P2QA 1O2OA 4OS5A 4KKDA 5JBAS 2I6SA 1J16A 1V2MT 1GMHG 4KTSA 3A7ZA 3IITA 1RTKA 3E16B 5T6DA 4UEHH 3QGNB 2KAIB 5EXLA 2O8WA 2BY9X 3QZQA 1H9LB 1ELAA 3PO1B 5JDUB 2A5AA 1DVAH 1VCWA 1GJ8B 2Z9JA 2J95A 1UTQA 3SHCH 3PMHB 4GUXA 2VIOA 3SV9A 1CSOE 1TPPA 3A8DA 1SGNE 1HAYB 1YPGH 1GBCA 1SFQB 3HK6B 3MYWA 3ZZ7A 2GD4B 1IQKA 1S0RA 1MKXH 2FOBA 3VFEA 1UVTH 2BZ6H 1O2ZA 2QIQA 1EZXC 2QXGA 2BXUH 2TBSA 2W3IA 2HGTH 3KQDA 3KNXA 4BXSA 4DW2U 3L33A 1GGDB 3CS0A 4Y8XA 2WV5A 1GBTA 1O5FH 1KXEA 5A2MH 1W13U 2H5CA 3VGCC 2ZCLP 3P6ZB 1DWDH 2J2UA 2STAE 2WPIS 1G36A 3MU1A 4NZLA 1OX1A 1TE0A 1KY9A 1JIMA 1QFKH 3UIRA 1ZMNA 3SN8A 2BY6X 2OTVA 3SU0A 2FLBH 1C5TA 3RXRA 3HATH 1HCGA 1BTHH 2FP7B 1KDQB 4K5ZA 1UK3A 3FANA 1TPSA 1CT0E 2EI8A 4H6SB 4INLA 2VWOA 1ZTLA 1GJ5H 2JKHA 2ZHQH 2WINI 4YT6H 3SGBE 2PTNA 3SJKA 3MNCA 1FMGA 3ATKA 2OQ5A 3P92A 4D7GA 5EQRA 1TX8A 1S0QA 1QNJA 2STBE 1O2TA 1ZOMA 4F4OC 1AB9B 2YNBA 2Y81A 4Y7BA 1CQQA 1F2SE 1G3BA 2IPHA 1NZQH 5FPTA 4YOGA 3ZZ3A 2VWMA 1SGIB 1H4WA 1ZTJA 4YESB 5DP5A 2FPZA 3BIVH 4J2YB 3KQBA 4MPVA 5TJXA 1C2GA 2EI7A 3K2UA 3DD2H 1QBNA 4FUCA 4K3JA 1W11U 1HJ8A 2QA9E 3SU5A 3SNDA 2WPKS 2ZZUH 4UFDH 5EPNA 1TBZH 2PHBA 4B71A 6ESTA 1GHVH 1Z8GA 2AMPA 4I8LA 1NY22 2BZAA 4THNH 3ZYEA 2F9VA 1C1PA 2ZCKP 3RXAA 9ESTA 1P11E 3GYMA 1TFXA 3T29A 5DK1A 2ZCHP 1CE5A 1O5EH 1ZZZA 4K1TA 4AOQA 5A8ZA 1S6FA 1AE8H 1ZHRA 3U1IB 3QDZB 3MFJA 3UOPA 1OOKB 1YPLH 1E34B 1Y5UT 5GJ4B 1OP8A 1C2MA 1JIRA 4B2AA 1YP9A 1C5RA 1FZZA 2W3KA 1MU8B 5EW1H 1GHYH 4OS1A 5I25A 1P2IA 2AS9A 2GGVB 1BOQA 2BDGA 2ZHDA 4FUGA 2Z9IA 4WXVA 1T8MA 2NWNA 3ZV8A 3LGTA 4AYYB 1HNEE 2BDAA 3ODDA 4TPIZ 1SMFE 1LVYA 2WUCA 3L3TA 8LPRA 1T7CA 3RU4T 3UUZA 3LT3A 1CA0C 1ANEA 1NRPH 2FODA 2XXLA 3M7UA 4IGDA 3ZZ5A 2HRVA 3PYHA 5AVDA 1DDJA 1HDTH 1IHSH 2A31A 1O2LA 2Z7FE 3BEFB 3VB4A 1Y8TA 3LKWA 3RXDA 2G55A 5PTPA 2Q6DA 1Y3UA 2ANWA 1O2UA 3MH4