4WMFA

Crystal structure of catalytically inactive mers-cov 3cl protease (c148a) in spacegroup p212121
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
305
structure length
304
Chain Sequence
b'SGLVKMSHPSDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MERS-CoV 3CL protease
publication title Structures of the Middle East respiratory syndrome coronavirus 3C-like protease reveal insights into substrate specificity.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Hydrolase
total genus 85
structure length 304
sequence length 305
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4wmfA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wmfA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wmfA02
5C1YA 1IQMA 5A8ZA 2BX4A 1BCUH 1WCZA 1AUJA 2H2ZA 5JB9S 3ZYEA 2AIPA 1UTNA 3SU6A 1EASA 1EZXC 2Q6FA 2ODQA 4GLYA 3IWMA 3IITA 4ABBA 4ABHA 2IPHA 4IGDA 1QJ6B 1TBZH 1GBJA 5C1UA 1TA2A 1C5VA 1THRH 4FUIA 3M37A 4Y0ZE 4ASHA 3RXPA 1A61H 2A4GA 3Q3KA 5CHAB 2VIPA 1OWJA 1S85A 2SGPE 1F5LA 3BTHE 1FUJA 4HFPB 3RU4D 2XCNA 1VZQH 2BLWA 5DK1A 1W7GH 3HKIB 3PWBA 5L2YH 1UTMA 2ODPA 2HGTH 1O2OA 3FP8E 3BTDE 4AB8A 2BXTH 5AFYH 1QTFA 3A87A 2FI3E 3BV9B 1YKTA 1ZLRA 3BTTE 3I77A 2SGEE 4I8GA 2ZCHP 2OQ5A 3S0NA 2VVVA 3GCTG 4A1TA 4DW2U 1SGFA 3VXFH 2I6SA 1FIZA 5A0AE 2V6NA 5HGGA 2BY9X 1GHBF 1KY9A 2H9HA 3D49H 1TRMA 1C2DA 1SGFG 1KLTA 1NRSH 1GMCF 3DFLA 2C90B 3JZ1B 2B0FA 3LH3A 1EP6A 3BG4B 1ARCA 3SJOA 3SJ8A 1ETRH 1P3CA 5FXLA 5B6OA 3E0NB 2HWLB 3NZIA 1JBUH 1ZGVA 4LZ4B 1SLVB 3ZVDA 2J2UA 5E2OA 1PPFE 1XUIA 2B7DH 4MNXA 3RXUA 1LDTT 2EEKA 1P12E 3M3SA 3RXQA 3UQOA 4AZ2B 4IC6A 3SHCH 4NIXA 2FS9A 1XX9A 2XTTB 1ELCA 1N1LA 3P17H 3SJ9A 2OC0A 2TGDA 5C5OA 4ZKSU 4TYDA 4JZEH 2THFB 4TY7A 3GY6A 5A0BA 3A8DA 8GCHG 5HM9A 2HNTC 4A1VA 2FOFA 1JRSA 1C4V2 1FY5A 1TGTA 2P3FH 3VGCB 1ZSJA 2VIOA 2J38A 2QXGA 3L33A 1YPHE 3UR9A 2A4QA 4MPUA 1DS2E 3LDXH 4OGYA 1TGSZ 1AKSA 2OLGA 1AUTC 4BAOB 4NIVA 1SFQB 5GWZA 5A09A 5GJ4B 1TQ7B 2BY8X 4M7GA 3TGKE 3GOVB 5F6MA 2A5KA 1SL3A 2F83A 2FOCA 1C5NH 1O3JA 1NRQH 1UHBA 2A2XH 2YNAA 1AI8H 3KGPA 4ZXYH 3UQVA 4BXWA 2NWNA 1SGIB 1BA8B 1KLIH 1OYQA 1C5LH 1QBVH 2Z7FE 4OGXA 5HM2A 3DD2H 5C20A 1GJ4H 3LT3A 1EPTC 5TCAA 3H7TA 4MPWA 2BQWB 1MUEB 3FP6E 1ZHRA 4ZROA 1SPJA 2BLOA 2CJIA 2GV6A 5DP8A 1O2WA 3ATLA 2VH0A 3UIRA 3I29A 1EX3A 3BTFE 2FM2A 2GCTB 4FU8A 1K28D 1IQIA 1EB1H 2CF8H 2VIQA 1EZQA 2FDAA 3U98H 3GICB 2C8WB 1WSSH 1GHBG 3AASA 3RXVA 2EI7A 4MDSA 1SVPA 1K1IA 1GMCG 1RJXB 4OS7A 3KL6A 1TNKA 3BIVH 3T5FH 1V2UT 3DFJA 3CS7A 4D9RA 1P9SA 1NO9H 5FPSA 3P70B 1EOLA 2AEIH 1PQ7A 3VPKA 1O2HA 2BLVA 4XFQA 1C2LA 4HZHA 3LGIA 3RXGA 1TX6A 4JK5A 1A1RA 2ZNKH 4OS5A 2G4UA 1B0EA 4U32A 3UUZA 1CT0E 1YPHC 2GZ8A 1YLCA 5C3NA 3TIUA 4CRGA 3TLOA 1RGQA 1E34B 2A1DB 2UWLA 3SQHE 1H9LB 2QC2A 4I31A 4RN6A 3KF2A 1ELEE 1DWEH 3AAVA 2H9TH 2R0LA 2WV5A 1QBNA 3E1XB 1QQ4A 4BAQB 1MD8A 1M9UA 1PFXC 1SBWA 5I25A 1HXFH 2UUFB 3RXOA 1O3KA 1FXYA 2PLXA 1L4DA 2ZI2H 1SR5C 1SGDE 1MKWH 5F8ZA 5ABWA 1D6RA 1CA0C 3GCOA 4K3JA 5DGJA 1GMHG 1HJAB 3BTQE 3UREA 3UY9A 1CGJE 3GYLB 1O2VA 2A7JA 1DSTA 1J15A 3RMNH 1W13U 3CP7A 2GDDA 1OX1A 1C2MA 4CH2B 1P9UA 3A7WA 3ZZ4A 4HI3A 4FU7A 3STJA 5EPNA 4X6NA 3SV6A 3O8BA 1G2LA 3LJOA 2VWLA 1QB9A 2FOHA 3P92A 3TJOA 4AFZA 4GAWA 2OUAA 3MO6A 3MFJA 3P8GA 4Y8ZA 4DG4A 1CGHA 1C5WB 2GKVE 3P95A 2VVUA 4BTUB 1UTKA 3JZ2B 4X2YA 1L2EA 1BHXB 2Y6TA 3RM2H 3U8TH 4CHAB 3PLPA 1AMHA 2BDAA 2FX4A 1DDJA 1C1SA 1CT2E 3SUGA 4K5ZA 2STAE 1P2KA 1H8IH 4UEHH 3RXCA 3EDXB 2BY6X 4ABFA 1ZSKA 4H42U 1SGEE 3A7VA 1GHWH 4AFQA 2RG3A 4I8LA 1ACBE 2JETC 1AZ8A 4IN2A 3E91A 1MH0A 1UVSH 2BVSH 4J2YB 3F9FA 1E35B 3ATWA 2J95A 2ZG0H 1C5UA 1GJAB 2ZZUH 3SN8A 4GHQA 4X0WU 1L1GA 8ESTE 2BOHB 2PSYA 3BEUA 1O3BA 1NC6A 2O8MA 2BDHA 3F9HA 2FPZA 4LXBH 1ZTLA 2FYQA 4TY6A 4X2XA 4O97A 3UWJH 3TNTA 4ZKNU 2M5TA 3LGYA 3A7TA 3D65E 1DICA 1P8VC 2K1QA 1AWFH 2OCVB 3E8LA 4A1XA 2WPIS 1QFKH 4MQAA 1PQ5A 1TOMH 1IQLA 1TNLA 1L0ZA 1FQ3A 2R2MB 1BBRH 1Y5AT 2ZFPH 2HALA 3SI4H 1HNEE 3SZNA 1OWEA 1D3QB 1H9HE 5E8EH 1NT1A 1SLWB 4D8NA 4DIHH 4VGCB 1AHTH 1FPCH 1GBEA 1AE8H 4SGAE 5SGAE 1ETTH 4I8HA 4FUHA 4Y6DA 3SGQE 4NSYA 1GI1A 1MZAA 2VU8E 1WBGB 2PUXB 1BRCE 2OC8A 1EAWA 2H5DA 3SOSA 4ISHH 2NU3E 1J8AA 2TRMA 2VIWA 1IQKA 5ETXA 4B76A 1AKSB 1TFXA 1ARBA 1UVOA 1GVKB 5F8TA 4E06H 2GX4A 3LOXA 1SB1H 2R3UA 1HV7A 1VJAU 3ZVBA 3GCHB 2ZU5A 1TNGA 3PMJA 1Q31A 1S0QA 1BUIA 3E3TA 5FPTA 1BTPA 1K21H 1O2QA 1O33A 2QN5T 1YPGH 4Y11E 1YBWA 1H4WA 1LKAA 3H5CB 2P8OC 4FVDA 2D2DA 1SGPE 5FX6A 4OS4A 1WOFA 3EBNA 1SHHB 1MU6B 3ZVEA 1O5BB 4MLFB 1MKWK 2A2QH 5A2MH 1A5HA 1HGTH 4ABGA 1X7AC 2XC0A 4OS1A 1V2VT 1C4U2 1KLJH 4NWKA 4FVBA 1PPBH 2DUCA 2F9NA 1SQTA 1YYY1 4NWLA 3SU5A 1GI5A 1S6HA 1THSH 4NZLA 1F92A 3TH2H 3KEEA 3RP2A 3TPIZ 3S9BA 3MNXA 1T4VH 2FMJA 1C5MD 4GPGA 3HK6B 3MHWU 1ANDA 3ZZ6A 1C1MA 1ZRBA 3ELAH 3LONA 1KXDA 3PMHB 1AFQB 4ABEA 3O8CA 4YO9A 4YZUA 4U2WA 1T8NA 2ZHFH 4KTCA 3TJVA 1UMAH 1D3DB 3QLPH 5L2ZH 2ZHWH 3TJNA 4MVNA 1H8DH 1C9TA 2GZ9A 1TAWA 1BBRE 1EKBB 3DHKH 1GGDC 3FAOA 2P94A 3MNCA 1LPGB 2BD7A 1RIWB 1BTUA 1DT2A 3BF6H 3RXMA 2OTVA 5EXNA 3SBKA 2HNTF 3UNQA 5ESBA 1DANH 3M5OA 1SGRE 2GMTB 1AY6H 4Y7AA 2ZFRH 1Z8GA 2QIQA 3NWUA 2FOGA 1P57B 3GDSA 1BRAA 3F9EA 1C5YB 3MH4A 1DY8A 4NIYA 1NFYA 3DUXH 4AX9H 1NS3A 2V0BA 3LH1A 2BQ6B 2VWNA 2ZGHA 1QB6A 9LPRA 2BDCA 2FEQH 1G37A 1C5RA 3P8FA 3T28A 4WF8A 1O38A 3V3MA 1KTSB 4ABDA 1MAYA 1OP8A 3QX5H 2Y7ZA 1O3PB 1BBRK 1S82A 4WXVA 2ODYB 2PFEA 1EUFA 2V3OH 1WQVH 1LPZB 1GI4A 1RD3B 1VGCC 4AYYB 5IDKA 1C4Y2 4AFUA 5FCKA 1QIXB 3E0PB 1ZTJA 5FPYA 1O36A 1GCDA 1O3EA 1F0RA 2IJOB 1V2OT 4MNWA 4JMYA 1CVWH 1GBKA 3EYDA 4INKA 1IQJA 3M36A 4IBLH 3ATKA 1ZOMA 3PO1C 1GBCA 1UK2A 5DKMA 1RTFB 2OBQA 3U1IB 3TNSA 4OS6A 2DE8A 5FAHA 1UK3A 1DXPA 2FI5E 1CHOF 2NU0E 4U30A 1HB0B 3QDZB 3G01A 3NPSA 1V2LT 1WTGH 1F2SE 1BJVA 3QZRA 1G32B 1Z71A 1TALA 2PV9B 5C1XA 3LKWA 4NCYA 4AGKA 2PTNA 4K60A 3A8BA 2K7XA 1GJ5H 1CA8B 1TGCA 4DURA 1ELBA 1GL0E 3VB3A 1HIAA 1ESAA 1O37A 4IS5A 5E0GA 2TGPZ 1V2TT 2XBWA 2ZCLP 4DY7B 1AIXH 2LNCA 2ANYA 4JZDH 2F9UA 1V2KT 4KTUA 1OYTH 5EG4A 4YLUA 1ZJDA 6GCHF 4E7RG 4ZHAA 1ZMLA 1G2MA 1C1NA 1D3PB 1ELGA 1JIRA 1GVZA 1O35A 1O3HA 4K8BA 1KDQB 5C5NA 1V2JT 4K69A 3S7KB 1WV7H 3RLWH 1N6YA 3SUDA 1O2YA 4JZ1A 2XBYA 2BB4A 4MNVA 1O34A 3ITIA 1FV9A 1RS0A 4MPXA 1C1UH 2WPLS 1OPHB 1G3DA 3ZZCA 1HAPH 3MYWA 6LPRA 1LHEH 4X6MA 2XYAA 2W3KA 3DA9B 3BG4C 1D4PB 2HNTE 1A3BH 1CU1A 1SGCA 5CE1A 2A4OA 3QN7A 2D8WA 2R9PA 3PMBB 1BZXE 3VFEA 1ZHPA 3UTUH 3S7HB 5EW1H 1INCA 2BD8A 3UR6A 3H7OA 3OYPA 2O8UA 4WH6A 3ZZAA 1DE7H 1HCGA 1ELTA 1GHYH 1UVPA 2Z9GA 2JH5D 3ZYDA 3ZZ3A 1T7CA 3B9FH 5EODA 5E2PA 3ODFA 1XUJA 4YT7H 4U01A 3E90B 4D76A 2AGGX 5DO4H 2OP9A 3SJIA 4X1NU 3A8CA 4DVAU 3MO3A 2G5VA 7GCHF 2WPMS 5J4QA 3VGCC 3ZZ5A 1ZRKA 4YESB 1AQ7A 2P3UB 2HVXA 2ZFFH 4WMDA 1IQGA 1TWXB 2BQ7B 1A3EH 3LU9B 2OXSA 3UWIA 2G81E 1WU1A 3MH6A 3M5NA 2YNBA 4K8YA 3RUOA 1W8BH 2ESTE 1GHXH 1MTUA 4KGAA 1FJSA 1JOUB 4D7GA 5LPEA 2FOMB 1LPKB 4CRBA 1S6FA 1W14U 1AWHB 2BD2A 1TMUH 2XXLA 2FI4E 5AFZH 3A8AA 1GBIA 4JZFH 5BPEA 1P03A 2QF0A 1KTTB 3HGNA 1AZZA 1P2NA 2FOBA 2GCTC 1P04A 3WY8A 1IAUA 1YLDA 3UPEA 3BEFB 2C8XB 3UNSA 1EJMA 4NZQA 1MU8B 1FNIA 4NA9H 4ZMAH 1QJ1B 1EJNA 5DP5A 1YGCH 3KQBA 4D7FA 1MMJN 4FXGH 1EB2A 1VR1H 1C1QA 1O3NA 1XUKA 5LH8A 1QRZA 2TIOA 4FUFA 1AVGH 3IG6B 2OC7A 1LVOA 1NRNH 1QRWA 3V7TA 4HGCA 4LZ1H 1AB9C 6CHAB 1DVAH 1HDTH 1BTHH 1Y3VA 3SV8A 1F0TA 1LHCH 4I8KA 3O8RA 3LGWA 1HAYB 4YM9A 1FMGA 1QRXA 2ZQ2A 4ZAEA 2J34A 3LGVA 1GCTC 3BSQA 2RCEA 1GL1A 4TPIZ 2PKAA 2ANKH 2F9BH 1RTKA 3RU4T 2EC9H 2VWOA 1OWKA 4IC5A 1LVYA 2FWWA 4B2BA 4ZKRU 2XW9A 1P2MA 1O3GA 1O2KA 2ZHEH 2XBXA 3A7XA 2V3HH 3A89A 3QZQA 3R0FA 3RXAA 4Y71A 3ATMA 1SOTA 3A83A 3V13A 3SQEE 3SGAE 3VB4A 1HJAC 4A92A 5EQRA 1QNJA 4JYTA 3RXTA 2B8OH 2AYWA 1NROH 1AB9B 2SFAA 3RM0H 2OD3B 1GJ8B 4LK4A 3N7OA 4AB9A 1HLTH 2J92A 2C3SA 4UONA 2EI6A 1O2RA 2BZ6H 2HPQH 1V2ST 1GJBB 1SLXB 2PWXA 2Q6GA 1AGJA 1TLDA 2OC1A 2Z9IA 1FLEE 4GSOA 2ZHDA 5EOKA 2GDEH 3UOUA 2XNIA 4X1QU 1HIAB 1GCTB 1TYNA 4B2CA 3VXEH 4JYUH 4ABIA 4ISIH 4ESTE 1TONA 5JBAS 3EA8A 3FZDA 2DE9A 3PV4A 3ZVCA 5HYOA 1G3BA 2Y5FA 2VB0A 2PSXA 1ZR0A 4ABJA 1XXFA 5DP9A 1TMTH 2UUJB 4Y7BA 3Q00A 4CHAC 1LTOA 1W10U 2QGRA 1S5SA 3SNCA 2F3CE 2WUBA 1V2QT 2WPHS 3A80A 2FX6A 3A88A 3K6ZA 2FTLE 1VCPA 2G8TA 4FUCA 1OOKB 1ABJH 1TIOA 2B5TB 2ZGXH 2ASUB 1E38B 3RXEA 3GY5A 2ZIQH 1Y3UA 2B9LA 1HAZB 2AS9A 2A5IA 4Z0KA 1C2FA 1EATA 4BNRA 4CRAA 3MU8A 1BT7A 1LVMA 1GI8B 2FZZA 1J17T 4CR9A 3V12A 4SGBE 1VCQA 1N6XA 1JXPA 2HOBA 3K65B 3F68H 4MTBA 2TPIZ 4FUBA 1A0HB 5T6FA 1ANBA 1QGFA 1TMBH 3GY3A 2BLQA 1A0JA 3ATIA 1SLUB 4D9QA 1F7ZA 2OBOA 2HLCA 3KQEA 4DCDA 1CQQA 1CHGA 2Z94A 2QCYA 3SU0A 2BMGB 4VGCC 5A0CA 2ZTXA 4OS2A 1T8OA 3K2UA 3RC5A 1C5XB 4CREA 4JYVH 1RRKA 5L6NH 1H9IE 1OSSA 1MTVA 3FP7E 1AD8H 2NU2E 1DWBH 1A2CH 3STIA 1SGTA 1Y3YA 4O3UA 1GI3A 1B0FA 3A7YA 4X1SU 1FY1A 1K2I1 3MU4A 3SW2B 1GHVH 1UCYE 1TE0A 2UUYA 2BVRH 3ODDA 3GCHC 1T31A 1GBBA 3GY4A 1O2ZA 4IMZA 3ZZDA 1GJDB 1W0YH 1HUTH 3ZVFA 1G3CA 3SORA 4B75A 1HAVA 2GP9B 9ESTA 5EQQA 1NU7B 4IN1A 1EP5A 3SO3A 2BYAX 2P3TB 1IHTH 4RKJB 1VCWA 3ZZ7A 2VGCB 5DPAA 1FPHH 2ZHQH 4X6OA 3HK3B 3EA7A 1BMAA 1IQNA 1EAUA 1TRNA 2ZDKA 1MTWA 4AFSA 3S9AA 1T8LA 8LPRA 4JZIA 1TNIA 1K1LA 5JYIA 1MTNB 1O32A 2ZO3H 5C67A 4DIIH 2C4FH 1Q2WA 3A84A 2TGAA 4UFEH 2VINA 1UHBB 1P0SH 1AN1E 1DFPA 2BOKA 1S81A 2ZDLA 3SNBA 1O2TA 1P2QA 1QL7A 2FODA 3U8OH 3LJJA 3D62A 4GCHF 1TPOA 1K9OE 3PB1E 4THNH 4AN7A 1O5DH 3MOCA 2ZDAH 3A85A 1AFQC 3GYMA 3V0XA 2VWMA 4A7IB 3F1SB 1EQ9A 3Q3YA 1C2IA 3U9AH 4DGJA 4XSKU 1KYNA 1EZSC 1GMDF 1CBWB 2ZPQA 3GY7A 1JWTA 1A5IA 2GGVB 1O3AA 2PGBB 1PPHE 1SI5H 2PUQH 3ENSB 2UWPA 2PKAB 1RIWC 3I78A 1ESBA 3Q3XA 1NFWA 1YM0A 2W26A 3KCGH 2WINI 2XWAA 1B7XB 3Q76A 1O5CB 1S84A 3UFAA 3FFGA 1PYTC 4GHTA 1WAYB 2FP7B 1EAXA 3KN2A 2GMTC 1P06A 2WYGA 1EOJA 1TPSA 1LVBA 4WMEA 1GBAA 3OSYA 4WWYA 1FAKH 2CGAA 1BTWA 1BTZA 3PLKA 3T62A 4YOIA 2J9NA 2WYJA 4YOGA 4GUXA 5T6GA 1GBDA 5AHGH 2O8TA 2Y80A 1B5GH 1CGIE 1LHFH 2Y82A 3RMLH 4BXSA 3TVJB 1NFXA 3K9XB 4LOYH 4YLQH 2Z9JA 3BTKE 4ABAA 3P8OA 3BEIB 5LGOA 1KXAA 5DP4A 3QUMP 1DUEA 1FY8E 2F9OA 4Z6AH 1P05A 2GCHF 1O3LA 1FY3A 4H6SB 1DX5M 3LIWA 1YF4A 4B73A 3HATH 4B2AA 1O2LA 2ZF0H 3SU2A 1KIGH 2H6MA 3KQDA 1K1OA 1TNJA 1GG6C 5FHTA 1QBOA 1TBRH 1TNHA 2FLRH 3QK1A 4NSVA 1GBTA 1DLKB 3TH3H 1YPLH 1L4ZA 2CMYA 4UDWH 4Q80A 1O2UA 2GVFA 3EGKH 1ZPCA 4BAMB 3EA9A 4UFFH 1NZQH 1S0RA 2Y5GA 5GCHF 2PKSC 2GZ7A 2ZECA 3BTME 1HFDA 3FZZA 1N8OB 1P10A 1D3TB 1DLEA 2CHAB 1GBMA 5F03A 1PPGE 3RXKA 1Y8TA 5I46H 1HPGA 1NTPA 5GXPA 4K1SA 4ZHLU 3M7TA 1AVWA 2GD4B 1LHDH 1PPCE 3D23A 1BITA 2Z9LA 1C2GA 1GJ6A 2XWBI 5DJ7A 1W0ZU 4AGJA 4GVUA 4AYVB 8KME2 4Y8YA 2BD9A 1XUGA 1Z6JH 1TBQH 2XCFA 1HJ9A 4F49A 2A4RA 2LPRA 1GG6B 1TOCB 1O3FA 2BDGA 2FXRA 2QV1A 1Q3XA 3E6PH 3PMAB 2AIQA 2V35A 2WV4A 4CBNA 4Y8XA 1GDQA 1UTPA 2PKSB 1NPMA 2ZU4A 4NIWA 5JBTA 2BX3A 2BY5X 5DP7A 3C27B 2Y5HA 1GJCB 1TX8A 2AMPA 3RC4A 2J94A 3MU0A 1SQOA 1J9CH 3KHVA 3NKKA 3VB6A 3BN9A 4UD9H 3R3GB 1ZPZA 1UJ1A 1FAXA 3FANA 2QXHA 1BOQA 1HRTH 3KNXA 1Z7KA 2GTBA 3MMGA 2P16A 5F8XA 3NCLA 1KXCA 1TGNA 3QTOH 3GCTF 1W2KH 3FVFB 3P8NA 2Y7XA 3TJUA 1HAVB 3RMOH 2G51A 1CO7E 2ULLA 1ELDE 2CF9H 1C5TA 1HXEH 1O2NA 2Z6BD 1UTLM 2EA3A 1O5EH 4XE4A 1K1JA 1BHXF 1VITF 1A7SA 3LPRA 5TCCA 1EPTA 3F6UH 4MG3A 1LO6A 1IQEA 1AFEH 1HAIH 1O2MA 1LHGH 2G55A 1HAOH 2Z3CA 4K2YA 3HPTB 4Q7ZA 1O31A 4WVPE 2QA9E 2A31A 1GI0A 1BQYA 2ALPA 3RXSA 1ZTKA 2P59A 1OKXA 2LIZA 1SMFE 1MQ5A 4UFGH 1A46H 1BIOA 1YPJH 4CBOA 2JKHA 2XBVA 4MPVA 3SV7A 2FOAA 3RXDA 1NM6A 2W7SA 1QJ7B 3KIDU 3O8DA 1EAIA 3B8JA 5JBBS 1HAXB 1LMWB 3LGUA 2Q6DA 2ZWLH 4JK6A 1XKBC 3BIUH 1BRBE 2CXVA 3TU7H 8GCHF 2J4IA 2ANMH 1ELFA 1VITH 3RLYH 1ZSLA 1HBTH 3SJKA 5L30H 1SGYE 4X8VH 4E7NA 3MU1A 2G4TA 1K1NA 4ZXXH 3SUEA 3U8RH 1UVUH 1C1OA 1C1TA 3QGJA 1A0LA 1LQEA 1CHOG 4WXIA 4WJG2 3EAJA 1MKXH 1Y5UT 1ESTA 1P02A 1YCPH 1WUNH 5A8YA 3LC3A 2XC4A 3ZVAA 1A4WH 3SU4A 1DSUA 1Z1IA 1GPZA 2ZU2A 2G5NA 3SNAA 4R0IA 1O2IA 4NG9H 1O5GH 3SUFA 2W7UA 3M3TA 1FIWA 2YOLA 2G00A 1O2GH 3URCA 1MCTA 3W94A 2Q1JA 3A7ZA 4KP0A 1VITG 2QXJA 4WMFA 1O0DH 1P01A 3RXFA 1GJ7B 1XVOA 2NU4E 4TPYA 5IYTA 3MNBA 1TRYA 3C1KA 3A82A 4F4OC 4O03A 6CHAC 4ZH8A 1C5QA 1W3CA 1CT4E 5HMAA 1SG8B 2A0QB 2BHGA 6GCHG 3HGPA 1GI2A 2AH4X 4XBBA 2I6QA 4AG2A 1GBFA 2BY7X 4YTAA 3ZZBA 4ISOA 3M5MA 1FZZA 1BMNH 1Y5BT 1YP9A 1YCPM 3ZZ8A 1ID5H 3VB5A 4KTSA 2F91A 1Y3WA 1C5OH 1P09A 2Z3EA 1TGBA 3GY8A 1NRPH 4FU9A 1O2XA 3TGIE 1GHZA 1UTJA 3L3TA 1TPPA 4WH8A 3ESTA 3CS0A 1MBMA 2A7HA 2ZGBH 2F9VA 2KAIA 3TGJE 1UK4A 3MU5A 2FO9A 1IQFA 6ESTA 4INLA 2AMQA 2ZCKP 3SU3A 1ELAA 1NESE 3BTGE 2JH0D 1THPB 2AGIX 1KXFA 1SQAA 1DITH 2SGFE 1GI9B 4JCNA 3MO9A 1TABE 1CSOE 1QURH 3PLBA 2HPPH 1SGQE 1XXDA 1SSXA 1GMHF 1F5KU 3T29A 2ILNA 2ZPRA 5G4BA 3RU4E 1E0FD 1L1JA 3W95A 4CR5A 4AORA 1QQUA 2ZKSA 3BTEE 1WQSA 1DY9A 4RKOB 7GCHG 4X2VA 2BXUH 2GV7A 2ZDMA 4O9VA 2RDLA 3SV2H 3M61U 3VB7A 3DT0H 1P2JA 4X2WA 5DP3A 4X6PA 1W12U 1W11U 3MH5A 1HAHH 1P2IA 1YPEH 4XDEA 1V2RT 2ZFSA 3MWIU 1V6DA 2QY0B 1JIMA 5CMXH 2QYIA 4TWWA 4UE7H 4X8SH 3RXIA 4H4FA 2TBSA 5T3HA 3QGNB 1UCYH 5GDSH 2VIDA 1MCVA 1V2NT 2A7CA 1WTHD 5FBIA 1A5GH 3SNDA 1DWCH 1W7XH 2C8YB 5FCRA 3RMMH 1GJ9B 1AE5A 3RXLA 3U1JB 4INHA 3RXRA 1EPTB 1JMOH 4DOQA 3ZV9A 1MD7A 1UTOA 2H5CA 2SGDE 5E0HA 1MKXK 1PYTD 4KKDA 4Y76A 1GDNA 1EXFA 1GVLA 1C9PA 1DPOA 1YCPK 2WPKS 1O5AB 2R2WU 1FY4A 4CRFA 1O30A 3SNEA 2ZDNA 4WY3A 2ZQ1A 1RXPA 1O39A 4BTTB 4A6LA 4UFDH 2W3IA 1T32A 1Z6EA 4O3TA 3OY6U 5BRRE 1ZZZA 1FONA 1KSNA 2ZTZA 1PPZA 4I7YH 1OP2A 1SGNE 3UOPA 1FN8A 1C2KA 2BVXH 2FS8A 4Q7XA 5EGMA 5JPMH 1C1VH 2WUCA 5EW2H 3P6ZB 1DXWA 1XUHA 7LPRA 1YC0A 2CN0H 1QL9A 3PYHA 1ZJKA 1OXGA 1NRRH 2CV3A 1GWAA 2FYRA 1F0SA 1BRUP 2ZGCA 4Q2KA 3QWCH 1C5SA 2VVCA 3RXBA 1BMMH 1T8MA 1AU8A 3SGBE 2BD3A 4AOQA 2VGCC 2VIVA 1O3CA 2EI8A 4B74A 4NA8A 2ZPSA 1G9IE 2JH6D 2WPJS 1Z8RA 4X8TH 3SHAH 2BM2A 1CA0B 2ZDVH 3M35A 1ETSH 3A86A 2ZFQH 4X8UH 4FUJA 5K7RA 5LPRA 3K6YA 1DWDH 4B1TA 1SFIA 4BAKB 1LCYA 1MTNC 1K22H 2TGTA 1J14A 4ISNA 2R3YA 3NXPA 1UO6A 2BTCE 5JDUB 1DM4B 1OWIA 2H9EH 1QA7A 1UVTH 3MH7A 4YT6H 2FTMA 1Z8JB 1L1NA 4ZKOU 3B23B 1O3DA 3QTVH 4XOJA 5GIBA 5TJXA 1LKBA 2RA0A 1PQ8A 1PPEE 3TITA 1O2SA 2NU1E 3GDVA 5EQSA 1CBWC 2W5EA 1XVMA 2C8ZB 1ABIH 1UTQA 3T27A 3T2NA 2A32A 1Z8IB 4FUEA 1BTXA 3M7QA 3GY2A 3PTNA 1GI6A 5JB8S 3MNSA 2G52A 4ZUHA 1AVXA 4Y79A 1TPAE 2OINA 3NUMA 1F0UA 2IN2A 2ANWA 4ISLA 1MAXA 1SC8U 1ANEA 1G3EA 1DOJA 1QL8A 1UCYK 2JETB 2KAIB 1ZPBA 1E36B 1V2PT 3MI4A 3T25A 1NU9A 5H4IB 2R0KA 4BANB 5AF9H 4HTCH 1XMNB 1C5ZB 1BDAA 2GT7A 3LC5A 4DT7B 5EXLA 2Y81A 1WYKA 1C2JA 1VJ9U 3M7UA 1KDQA 3E16B 3RXJA 1HAGE 4X1PU 2SGQE 1EZUC 3OU0A 1GHAF 1FN6A 5E0JA 2PHBA 7KMEH 2IOTA 1NFUA 1AO5A 2QAAA 3A81A 2F9PA 1MTSA 2RA3A 1P11E 2ZGJA 1BMLA 4NA7A 3OTJE 3TK9A 1OS8A 2PGQB 3MTYA 1P2OA 4X1RU 4A5TS 1TQ0B 7ESTE 5EU8A 4J1YA 3URDA 2SGAA 1GI7B 3OX7U 1LQDB 1KXBA 1ZMNA 1V2WT 3M3VA 1S83A 2AFQB 2AMDA 1NN6A 1QY6A 1C2HA 2O8LA 4BAHB 1G30B 1DUAA 4ZHMU 1P3EA 1GBHA 5LPFA 1O3IA 1C2EA 1HJ8A 2SNVA 1N8OC 3PWCA 1ELVA 2ZU3A 2CHAC 1ORFA 1ZMJA 5GPIB 3GISB 4K1TA 2BDIA 2XRCA 5A8XA 2Z9KA 1IOEA 2ZA5A 4TWYA 2PW8H 2P95A 3S9CA 4FUGA 2P8OB 3KQCA 1OWHA 3U69H 3CENA 4B71A 1QA0A 4E05H 1O2JA 4QT8C 3RDZA 1FI8A 3BTWE 4IMQA 2HRVA 1MBQA 2C93B 3HKJB 4NFEA 3GDUA 2ZC9H 4Q7YA 2O8WA 2A5AA 5J4SA 3EE0B 5PTPA 2BDYA 4KELA 4DJZB 4NGAH 4H6TA 3LGTA 3ZVGA 2BD4A 2UUKB 3S69A 2QXIA 1JRTA 1PJPA 2BD5A 2VNTA 1J16A 3EQ0H 4GCHG 3TK5A 1C5PA 2XC5A 3TK6A 5DG6A 4CRCA 3F9GA 1V2MT 1OWDA 1SOZA 2UWOA 2VJ1A 1GBLA 1XKAC 1GHAG 1ZGIA 2ZEBA 1GMDG 2P93A 5T6DA 1ANCA 5C2ZA 3M5LA 2FESH 3SU1A 1F5RA 1XM1A 1EJAA 5ESTE 4XBDA 3AAUA 1U6QA 1BJUA 3AW1A 3NK8A 2FOEA 1GGDB 3BG8A 1RFNA 2OQUA 1GDUA 1BB0B 3AVZA 1G36A 4I32A 3ZV8A 4R8TB 4PROA 5FX5A 2SNWA 3QO6A 2FLBH 1C1RA 3T26A 1CE5A 1MZDA 1PQAA 3ZZ9A 3PTBA 1YPKH 5FBEA 1TA6A 1RTLA 2BDBA 2STBE 2ZP0H 1IHSH 1QR3E 1BTYA 1D9IA 3TH4H 2ZFTA 1Z1JA 2PTCE 4XBCA 3SV9A 1H1BA 1T4UH 1Y59T 2AGEX 2D1JA 1FDPA 2BZAA 3AW0A 3Q77A 3GCNA 2ALVA 3UNRA 3RC6A 5HXFA 1MQ6A 2PR3A 4FUDA 2GCHG 2O9QA 2D26C 4YOJA 5JBCS 4K1EA 1C1PA 1D6WA 1O3OA 1V3XA 1C1WH 4CRDA 2ZTYA 2ZU1A 5DP6A 1ZYOA 4AG1A 1TB6H 3PM3A 5EPYA 1KXEA 2FIRH 5K0HA 2Z3DA 1O5FH 1K1MA 2QF3A 1XUFA 2H1UA 1VGCB 1OP0A 2AERH 4I33A 4BTIB 3OY5U 5GCHG 4MNYA 2A45B 1E37B 1QCPA 5CHAC 4RSPA 1SHYA 2VH6A 1ZHMA 1YPMH 4CH8B 3PROA 3SI3H 2GT8A 5AVDA 1IQHA 4Y0YE 3PO1B 5EXMA 1TX7A 3L6PA 1O2PA 4I8JA 3VEQB 1QHRB 4Y10E 1Y3XA 1HYLA 4NFFA 1O3MA 3RXHA 1QB1A 4BOHA 4IW4E 1NY22 1K1PA
chains in the Genus database with same CATH superfamily
5C1YA 1IQMA 5A8ZA 2BX4A 1BCUH 1WCZA 1AUJA 2H2ZA 5JB9S 3ZYEA 2AIPA 1UTNA 3SU6A 1EASA 1EZXC 2Q6FA 2ODQA 1EFRD 4GLYA 3IWMA 3IITA 4ABBA 4ABHA 2IPHA 4IGDA 1QJ6B 1TBZH 1GBJA 5C1UA 1TA2A 1C5VA 1THRH 4FUIA 3M37A 4Y0ZE 4ASHA 3RXPA 1A61H 2A4GA 3Q3KA 5CHAB 2VIPA 1OWJA 1S85A 2SGPE 1F5LA 3BTHE 1FUJA 4HFPB 3RU4D 2XCNA 1VZQH 2BLWA 5DK1A 1W7GH 3HKIB 3PWBA 5L2YH 1UTMA 2ODPA 2HGTH 1O2OA 3FP8E 3BTDE 4AB8A 2BXTH 5AFYH 1QTFA 3A87A 2FI3E 3BV9B 1YKTA 1ZLRA 3BTTE 3I77A 2SGEE 4I8GA 2ZCHP 2OQ5A 3S0NA 3VG8A 2VVVA 3GCTG 4A1TA 4DW2U 1SGFA 3VXFH 2I6SA 1FIZA 5A0AE 2V6NA 5HGGA 2BY9X 1GHBF 1KY9A 2H9HA 3D49H 1TRMA 1C2DA 1SGFG 1KLTA 1NRSH 2WHXA 1GMCF 3DFLA 5DSFA 2C90B 3JZ1B 2B0FA 3LH3A 1EP6A 3BG4B 1ARCA 3PV5A 3SJOA 3SJ8A 1ETRH 1P3CA 5FXLA 5B6OA 3E0NB 2HWLB 3NZIA 1JBUH 1ZGVA 4LZ4B 1SLVB 3ZVDA 2J2UA 5E2OA 1PPFE 1XUIA 2B7DH 4MNXA 3RXUA 1LDTT 2EEKA 1P12E 3M3SA 2PP6A 3RXQA 3N7EA 3UQOA 4AZ2B 4IC6A 3PRBA 4NIXA 3SHCH 2FS9A 1XX9A 2XTTB 1ELCA 1N1LA 3P17H 3SJ9A 2OC0A 2TGDA 5C5OA 4ZKSU 4TYDA 4JZEH 2THFB 3FN8A 3GY6A 4TY7A 3A8DA 5A0BA 8GCHG 2HNTC 4A1VA 5HM9A 2FOFA 1JRSA 1C4V2 1FY5A 1TGTA 2P3FH 3VGCB 1ZSJA 4ASUD 2VIOA 2J38A 2QXGA 3L33A 1YPHE 3UR9A 2A4QA 4MPUA 1DS2E 3LDXH 4OGYA 1TGSZ 1AKSA 2OLGA 1AUTC 4BAOB 4NIVA 1SFQB 5GWZA 5A09A 5GJ4B 4AC9A 1TQ7B 2BY8X 4M7GA 3TGKE 3GOVB 5F6MA 1E79D 2A5KA 1SL3A 2F83A 2FOCA 1C5NH 1O3JA 3PV2A 1NRQH 1UHBA 2A2XH 2YNAA 2AHME 1AI8H 3KGPA 4ZXYH 3UQVA 4BXWA 2NWNA 1SGIB 1BA8B 1KLIH 1OYQA 1C5LH 1QBVH 2Z7FE 4OGXA 5HM2A 3DD2H 5C20A 1GJ4H 3LT3A 1EPTC 5TCAA 3H7TA 4MPWA 2BQWB 1MUEB 3FP6E 1ZHRA 4ZROA 1SPJA 2BLOA 2CJIA 2GV6A 2WPDD 1O2WA 2WSSD 5DP8A 3ATLA 2VH0A 3OEED 3UIRA 3I29A 1EX3A 5F53A 3BTFE 2FM2A 2GCTB 4FU8A 1K28D 1IQIA 1EB1H 2CF8H 2VIQA 3UAIC 4M9FA 1EZQA 2FDAA 3U98H 3GICB 2C8WB 1WSSH 1GHBG 3AASA 3RXVA 2EI7A 4MDSA 1SVPA 1K1IA 3OE7D 1GMCG 1RJXB 4OS7A 3KL6A 1TNKA 3BIVH 3T5FH 1V2UT 3DFJA 3CS7A 4D9RA 1P9SA 1NO9H 5EJ1A 5FPSA 3P70B 1EOLA 2AEIH 1PQ7A 3VPKA 1O2HA 2BLVA 4XFQA 1C2LA 4HZHA 3LGIA 3RXGA 1TX6A 4JK5A 1A1RA 2ZNKH 4OS5A 1K0HA 2G4UA 1B0EA 4U32A 3UUZA 1CT0E 3W1EA 1YPHC 2GZ8A 1YLCA 5FL7D 5C3NA 3TIUA 4CRGA 3TLOA 1RGQA 1E34B 2A1DB 2UWLA 3SQHE 1H9LB 2QC2A 4I31A 4RN6A 3KF2A 1ELEE 1DWEH 3AAVA 2H9TH 2R0LA 2WV5A 1QBNA 3E1XB 1QQ4A 4BAQB 1MD8A 1M9UA 1PFXC 1SBWA 5I25A 1HXFH 2UUFB 3RXOA 1O3KA 1FXYA 2PLXA 1L4DA 2ZI2H 1SR5C 1SGDE 3F2FA 1MKWH 5F8ZA 5ABWA 1D6RA 1CA0C 3GCOA 4K3JA 5DGJA 1GMHG 1HJAB 3BTQE 3UREA 3UY9A 4B6EA 2IPQX 1CGJE 3GYLB 1O2VA 2A7JA 5HIZA 1DSTA 1J15A 3RMNH 1W13U 3CP7A 2GDDA 1OX1A 1C2MA 4CH2B 1P9UA 3A7WA 3ZZ4A 4HI3A 4FU7A 3STJA 5EPNA 4X6NA 3SV6A 3O8BA 1G2LA 3LJOA 2VWLA 1QB9A 2FOHA 3P92A 3TJOA 4AFZA 4GAWA 2OUAA 3MO6A 1WXRA 3MFJA 3P8GA 4Y8ZA 4DG4A 1CGHA 1C5WB 2GKVE 3P95A 2W6ID 2VVUA 4BTUB 1UTKA 3JZ2B 2RDEA 4X2YA 1L2EA 3SYJA 1BHXB 2Y6TA 3RM2H 3U8TH 4CHAB 3PLPA 1AMHA 2BDAA 2QF4A 2FX4A 1DDJA 1C1SA 1CT2E 3SUGA 4K5ZA 2STAE 1P2KA 1H8IH 3DSGA 4UEHH 5EJZA 3RXCA 3EDXB 2BY6X 4ABFA 1ZSKA 4H42U 1SGEE 3A7VA 1GHWH 4AFQA 2RG3A 4I8LA 1ACBE 2JETC 1AZ8A 4IN2A 3E91A 1MH0A 1UVSH 2BVSH 4J2YB 3F9FA 1E35B 3ATWA 2J95A 2ZG0H 1C5UA 1GJAB 2ZZUH 3N7DA 3SN8A 4GHQA 2XNDD 4X0WU 1L1GA 8ESTE 2BOHB 2PSYA 3BEUA 1O3BA 1NC6A 2O8MA 2BDHA 3F9HA 2FPZA 4LXBH 1ZTLA 2FYQA 4TY6A 3F2HA 4O97A 4X2XA 3UWJH 3TNTA 4ZKNU 2M5TA 3LGYA 3A7TA 3D65E 1DICA 1WDIA 1P8VC 2K1QA 1AWFH 2OCVB 3E8LA 4A1XA 2WPIS 1QFKH 4MQAA 1PQ5A 1TOMH 1IQLA 1TNLA 1L0ZA 1FQ3A 2R2MB 1BBRH 1Y5AT 2ZFPH 2HALA 3SI4H 1HNEE 3SZNA 1OWEA 1D3QB 1H9HE 5E8EH 1NT1A 1SLWB 3FO8D 4D8NA 4DIHH 4VGCB 1AHTH 1FPCH 1GBEA 1AE8H 4SGAE 5SGAE 1ETTH 4I8HA 4FUHA 4Y6DA 3SGQE 4NSYA 1GI1A 1MZAA 2VU8E 1WBGB 2PUXB 1BRCE 2OC8A 1EAWA 2H5DA 3SOSA 4ISHH 2NU3E 1J8AA 2TRMA 5C17A 2VIWA 1IQKA 5ETXA 4B76A 1AKSB 1TFXA 1ARBA 1UVOA 1GVKB 5F8TA 4E06H 2GX4A 3LOXA 1SB1H 2R3UA 1HV7A 1VJAU 3ZVBA 3GCHB 2ZU5A 1TNGA 3PMJA 2GJGA 1Q31A 1S0QA 1BUIA 3E3TA 5FPTA 1BTPA 1K21H 1O2QA 1O33A 2QN5T 1YPGH 4Y11E 1YBWA 1H4WA 1LKAA 3H5CB 2P8OC 2WV9A 4FVDA 2D2DA 1SGPE 5FX6A 4OS4A 1WOFA 3EBNA 1SHHB 1SKYE 1MU6B 3ZVEA 1O5BB 4MLFB 1MKWK 2A2QH 5A2MH 1A5HA 1HGTH 4ABGA 3U28C 3NRLA 1X7AC 2XC0A 4OS1A 1V2VT 1C4U2 1KLJH 4NWKA 4FVBA 5HKKD 1PPBH 2DUCA 2F9NA 1SQTA 1YYY1 4NWLA 3SU5A 1GI5A 1S6HA 1THSH 4NZLA 1F92A 3TH2H 3KEEA 3RP2A 4B6FA 3TPIZ 3S9BA 3MNXA 1T4VH 2FMJA 1C5MD 4GPGA 3HK6B 3MHWU 1ANDA 3ZZ6A 1C1MA 1ZRBA 3ELAH 3LONA 1KXDA 3PMHB 1AFQB 4ABEA 3O8CA 4YO9A 4YZUA 4U2WA 1T8NA 2ZHFH 1VKYA 4KTCA 3TJVA 1UMAH 1D3DB 3QLPH 5L2ZH 2ZHWH 3TJNA 4MVNA 1H8DH 1C9TA 2GZ9A 1TAWA 1BBRE 1EKBB 3DHKH 1GGDC 3FAOA 2P94A 3MNCA 1LPGB 2BD7A 1RIWB 1BTUA 1DT2A 3BF6H 3RXMA 2OTVA 5EXNA 3SBKA 2HNTF 3UNQA 5ESBA 1DANH 3M5OA 1SGRE 2GMTB 1AY6H 4Y7AA 2ZFRH 1Z8GA 1E1RD 2QIQA 3NWUA 2FOGA 1P57B 3GDSA 1BRAA 3F9EA 1C5YB 3MH4A 1DY8A 4NIYA 1NFYA 3DUXH 4AX9H 1NS3A 2V0BA 3LH1A 2BQ6B 2VWNA 2ZGHA 1QB6A 9LPRA 2BDCA 2FEQH 1G37A 1C5RA 3P8FA 3T28A 4WF8A 1O38A 1NBME 3V3MA 1KTSB 4ABDA 1MAYA 1OP8A 3QX5H 2Y7ZA 1O3PB 1BBRK 1S82A 4WXVA 2ODYB 2XOKD 2LELA 2PFEA 1EUFA 2V3OH 5C0UA 1WQVH 1LPZB 1GI4A 1RD3B 1VGCC 4AYYB 5IDKA 1C4Y2 4AFUA 5FCKA 1QIXB 3E0PB 1ZTJA 5FPYA 2YMSC 1O36A 1GCDA 1O3EA 1F0RA 2IJOB 1V2OT 4MNWA 4JMYA 1CVWH 1GBKA 3EYDA 4INKA 1IQJA 3M36A 4IBLH 3ATKA 1ZOMA 3PO1C 1GBCA 1UK2A 5DKMA 1RTFB 2OBQA 3U1IB 3TNSA 4OS6A 2DE8A 2JIZD 5FAHA 1UK3A 1DXPA 2FI5E 1CHOF 2NU0E 4U30A 1HB0B 3QDZB 2M2AA 3G01A 3NPSA 1V2LT 1WTGH 1F2SE 1BJVA 3QZRA 1G32B 1Z71A 1TALA 2PV9B 5C1XA 3LKWA 4NCYA 4ACBA 4AGKA 1W0JD 3F0PA 2PTNA 5HIYA 4K60A 3A8BA 2K7XA 1GJ5H 1CA8B 1TGCA 2YMSB 4DURA 1ELBA 1GL0E 3VB3A 1HIAA 1ESAA 1O37A 4YXWD 4IS5A 5E0GA 2TGPZ 1V2TT 2XBWA 2ZCLP 4DY7B 1AIXH 2LNCA 2ANYA 4JZDH 5GNDA 2F9UA 1V2KT 4KTUA 1OYTH 5EG4A 4YLUA 1ZJDA 2CK3D 6GCHF 4E7RG 4ZHAA 1ZMLA 4Q4LA 1G2MA 1C1NA 1D3PB 1ELGA 1JIRA 1GVZA 1O35A 1O3HA 4K8BA 1KDQB 5C5NA 1V2JT 4K69A 2KCAA 3S7KB 1WV7H 3RLWH 3H09A 1N6YA 3SUDA 1O2YA 4JZ1A 2XBYA 2BB4A 4MNVA 1O34A 3ITIA 4P00A 1FV9A 1RS0A 4MPXA 5KGOA 1C1UH 2WPLS 1OPHB 1G3DA 3ZZCA 1HAPH 3MYWA 6LPRA 1LHEH 4X6MA 2XYAA 2W3KA 3DA9B 3BG4C 1D4PB 2HNTE 1A3BH 1CU1A 1SGCA 5CE1A 5EJLA 2A4OA 3QN7A 2D8WA 2R9PA 3PMBB 1BZXE 3VFEA 1ZHPA 3UTUH 3S7HB 5EW1H 1INCA 2BD8A 3UR6A 3H7OA 3OYPA 2O8UA 4WH6A 3ZZAA 1DE7H 1HCGA 1ELTA 1GHYH 1UVPA 2Z9GA 2JH5D 3ZYDA 5KECA 3ZZ3A 4RI0A 1T7CA 3B9FH 5EODA 5E2PA 3ODFA 1XUJA 4YT7H 1H8HD 1W0KD 4U01A 3E90B 4D76A 2AGGX 3SZEA 5DO4H 2OP9A 3SJIA 4X1NU 2F43B 3A8CA 4DVAU 3MO3A 2G5VA 7GCHF 2WPMS 5J4QA 3VGCC 3ZZ5A 1ZRKA 4YESB 1AQ7A 2P3UB 2HVXA 2ZFFH 4WMDA 1IQGA 5KEDA 1TWXB 2BQ7B 1A3EH 3DSOA 3LU9B 2OXSA 3UWIA 2G81E 1WU1A 3MH6A 3M5NA 2YNBA 4K8YA 3RUOA 1W8BH 2ESTE 1GHXH 1MTUA 4KGAA 1FJSA 1JOUB 4Z1MD 4D7GA 5LPEA 2FOMB 1LPKB 4CRBA 1S6FA 1W14U 1AWHB 2BD2A 1TMUH 2XXLA 2FI4E 5AFZH 3A8AA 2L74A 1GBIA 4JZFH 5BPEA 1P03A 2QF0A 1KTTB 3HGNA 1AZZA 1P2NA 2FOBA 2GCTC 1P04A 3WY8A 1IAUA 1YLDA 3UPEA 3BEFB 2C8XB 2KR7A 4TT3D 3UNSA 1EJMA 4NZQA 2V7QD 1MU8B 1FNIA 4NA9H 4ZMAH 1QJ1B 1EJNA 5DP5A 1YGCH 3KQBA 2VBCA 4D7FA 1MMJN 4FXGH 1EB2A 1VR1H 1C1QA 1O3NA 1XUKA 5LH8A 1QRZA 2TIOA 4FUFA 1AVGH 3IG6B 2OC7A 1LVOA 1NRNH 1QRWA 3V7TA 4HGCA 4LZ1H 1AB9C 6CHAB 1DVAH 1HDTH 1BTHH 1Y3VA 3SV8A 1F0TA 1LHCH 4I8KA 3O8RA 3LGWA 1HAYB 4YM9A 1FMGA 1QRXA 2J98A 2ZQ2A 4ZAEA 2J34A 3LGVA 1GCTC 3BSQA 2RCEA 1GL1A 4TPIZ 2PKAA 2ANKH 2F9BH 1RTKA 3RU4T 2EC9H 2VWOA 1OWKA 4IC5A 1LVYA 2FWWA 4B2BA 4ZKRU 2QE7D 2XW9A 1P2MA 1O3GA 1O2KA 2ZHEH 2XBXA 3A7XA 4ZCNA 2V3HH 3A89A 3QZQA 3R0FA 3RXAA 4Y71A 3ATMA 1SOTA 3A83A 3V13A 3SQEE 3SGAE 3VB4A 1HJAC 4A92A 2JDID 5EQRA 1QNJA 4JYTA 3RXTA 2B8OH 2AYWA 1NROH 1AB9B 2SFAA 3RM0H 2OD3B 1GJ8B 4LK4A 3N7OA 4AB9A 4F55A 3FKSD 1HLTH 2J92A 2C3SA 4UONA 2EI6A 1O2RA 2BZ6H 2HPQH 1V2ST 1GJBB 1SLXB 1BMFD 2PWXA 2Q6GA 1AGJA 1TLDA 2OC1A 2Z9IA 1FLEE 4GSOA 2ZHDA 5EOKA 2GDEH 3UOUA 2XNIA 4X1QU 1HIAB 1GCTB 1TYNA 4B2CA 3VXEH 4JYUH 4ABIA 4ISIH 4ESTE 1TONA 5JBAS 3EA8A 3FZDA 5CDFE 2DE9A 3PV4A 3ZVCA 5IK2D 5HYOA 1G3BA 2Y5FA 2VB0A 2JJ1D 2PSXA 1ZR0A 1QZ8A 4ABJA 1XXFA 5DP9A 1TMTH 2UUJB 4Y7BA 3Q00A 4CHAC 1LTOA 1W10U 2QGRA 1S5SA 3SNCA 2F3CE 2WUBA 1V2QT 2WPHS 3A80A 2FX6A 3A88A 1SQRA 3K6ZA 2FTLE 3F0OA 4ACAA 1VCPA 2G8TA 4FUCA 1OOKB 1ABJH 1TIOA 2B5TB 2ZGXH 2ASUB 1E38B 4RT1A 3RXEA 3GY5A 2ZIQH 1Y3UA 2B9LA 1HAZB 2AS9A 2A5IA 2W6JD 4Z0KA 1C2FA 1EATA 4BNRA 4CRAA 3MU8A 1BT7A 1LVMA 1GI8B 2FZZA 1J17T 4CR9A 3V12A 2LP6A 4SGBE 1VCQA 1N6XA 1JXPA 2HOBA 3K65B 3F68H 4MTBA 2TPIZ 4FUBA 1A0HB 5T6FA 1ANBA 1QGFA 1TMBH 2QF5A 3GY3A 2BLQA 1A0JA 3ATIA 1SLUB 4D9QA 1F7ZA 2OBOA 2HLCA 3KQEA 4DCDA 1CQQA 1CHGA 2Z94A 2QCYA 3SU0A 2BMGB 4VGCC 5A0CA 2ZTXA 4OS2A 1T8OA 3K2UA 3KQ5A 1C5XB 3RC5A 4CREA 4JYVH 5EIYA 1RRKA 5L6NH 1H9IE 1OSSA 1MTVA 3FP7E 1AD8H 2NU2E 1DWBH 1A2CH 3STIA 1SGTA 1Y3YA 4O3UA 1GI3A 1B0FA 3A7YA 4X1SU 5T1VA 1FY1A 1K2I1 3MU4A 3SW2B 1GHVH 1UCYE 1TE0A 2UUYA 2BVRH 3ODDA 3GCHC 1T31A 1GBBA 3GY4A 1O2ZA 4IMZA 3ZZDA 1GJDB 1W0YH 1HUTH 3ZVFA 1G3CA 3SORA 4B75A 1HAVA 2GP9B 4Q63A 9ESTA 5EQQA 1NU7B 4IN1A 1EP5A 3SO3A 2BYAX 2P3TB 1IHTH 4RKJB 1VCWA 3ZZ7A 2VGCB 5DPAA 1FPHH 2ZHQH 4X6OA 3HK3B 4XD7D 3EA7A 1BMAA 1IQNA 3PRDA 1EAUA 1TRNA 2ZDKA 3KYFA 1MTWA 4AFSA 3S9AA 1T8LA 8LPRA 4JZIA 1TNIA 1K1LA 5JYIA 1MTNB 1O32A 2ZO3H 5C67A 4DIIH 2C4FH 1Q2WA 3A84A 2TGAA 4UFEH 2VINA 1UHBB 1P0SH 1AN1E 1DFPA 2BOKA 1S81A 2ZDLA 3SNBA 1O2TA 1P2QA 1QL7A 2FODA 3U8OH 3LJJA 3D62A 4GCHF 1TPOA 1K9OE 3PB1E 4THNH 4AN7A 1O5DH 3MOCA 2ZDAH 3A85A 1AFQC 3GYMA 3V0XA 2VWMA 4A7IB 3F1SB 1NBMD 1EQ9A 3Q3YA 2KCYA 1C2IA 3U9AH 4DGJA 4XSKU 1KYNA 1EZSC 1GMDF 2J98B 1CBWB 2ZPQA 2J5UA 3GY7A 1JWTA 1A5IA 2GGVB 1O3AA 2PGBB 1PPHE 1SI5H 2PUQH 3ENSB 2UWPA 2PKAB 1RIWC 3I78A 1ESBA 1KMHB 1NFWA 3Q3XA 1YM0A 2W26A 3KCGH 2WINI 2XWAA 1B7XB 3Q76A 1O5CB 1S84A 3UFAA 3FFGA 1PYTC 4GHTA 1WAYB 2FP7B 1EAXA 3KN2A 2GMTC 1P06A 2WYGA 1EOJA 1TPSA 1LVBA 4WMEA 1GBAA 3OSYA 4WWYA 1FAKH 1OHHD 2CGAA 1BTWA 1BTZA 3PLKA 3T62A 4YOIA 2J9NA 2WYJA 4YOGA 4GUXA 2KZ4A 5T6GA 1GBDA 5AHGH 2O8TA 2Y80A 1B5GH 1CGIE 1LHFH 1UW7A 2Y82A 3RMLH 3WW7A 4BXSA 3TVJB 1NFXA 3K9XB 4LOYH 4YLQH 4XRNA 2Z9JA 3BTKE 4ABAA 3P8OA 3BEIB 5LGOA 1KXAA 5DP4A 3GS9A 3QUMP 1DUEA 1FY8E 2F9OA 4Z6AH 2JJ2D 1P05A 2GCHF 3WWFA 1O3LA 1FY3A 4H6SB 1DX5M 3LIWA 1YF4A 4B73A 3HATH 4B2AA 4I86A 1O2LA 2ZF0H 3SU2A 1KIGH 2H6MA 3KQDA 1K1OA 1TNJA 1GG6C 3FOAA 5FHTA 1QBOA 1TBRH 1TNHA 2FLRH 3QK1A 4NSVA 1GBTA 1DLKB 3TH3H 1YPLH 1L4ZA 2OK5A 2CMYA 4UDWH 4Q80A 1O2UA 2GVFA 3EGKH 1ZPCA 4BAMB 3EA9A 4UFFH 1NZQH 1S0RA 2Y5GA 3F3BA 5GCHF 2PKSC 2GZ7A 2ZECA 3BTME 1HFDA 3FZZA 1N8OB 1P10A 1D3TB 1DLEA 2CHAB 1GBMA 5F03A 1PPGE 3RXKA 1Y8TA 5I46H 1HPGA 1NTPA 5GXPA 4K1SA 4ZHLU 3M7TA 1AVWA 2GD4B 1LHDH 1PPCE 3D23A 1BITA 2Z9LA 1C2GA 1GJ6A 2XWBI 5DJ7A 1W0ZU 4AGJA 4GVUA 4AYVB 8KME2 4Y8YA 2BD9A 1XUGA 1Z6JH 1TBQH 2XCFA 1HJ9A 4F49A 2A4RA 2LPRA 1GG6B 1TOCB 1O3FA 2BDGA 2FXRA 3OTPA 2QV1A 1Q3XA 3E6PH 3PMAB 2AIQA 2V35A 2WV4A 3CNRA 4CBNA 4Y8XA 4RT0A 1GDQA 1UTPA 2PKSB 1NPMA 2ZU4A 4NIWA 5JBTA 2BX3A 2BY5X 5DP7A 3C27B 2Y5HA 1GJCB 1TX8A 2AMPA 3RC4A 2J94A 3MU0A 1SQOA 1J9CH 3KHVA 3NKKA 3VB6A 3BN9A 4UD9H 3R3GB 1ZPZA 3UB0A 1UJ1A 1FAXA 3FANA 2QXHA 1BOQA 1HRTH 3KNXA 1S6LA 1Z7KA 2GTBA 3MMGA 2P16A 5F8XA 3NCLA 1KXCA 1TGNA 3QTOH 3GCTF 1W2KH 3FVFB 3P8NA 2Y7XA 3TJUA 1HAVB 4TSFD 3RMOH 2G51A 1CO7E 2ULLA 1ELDE 2CF9H 1C5TA 1HXEH 1O2NA 2Z6BD 1UTLM 2EA3A 1O5EH 4XE4A 1K1JA 1BHXF 1VITF 1A7SA 3LPRA 5TCCA 1EPTA 3F6UH 4MG3A 1LO6A 1IQEA 1AFEH 1HAIH 1O2MA 1LHGH 2G55A 1HAOH 3ZIAD 2Z3CA 4K2YA 3HPTB 4Q7ZA 1O31A 3WWBA 4WVPE 2QA9E 2A31A 1GI0A 1E1QD 1BQYA 2ALPA 3RXSA 1ZTKA 2P59A 1OKXA 2LIZA 1SMFE 1MQ5A 4UFGH 1A46H 1BIOA 1YPJH 4CBOA 2JKHA 2XBVA 4MPVA 3SV7A 2FOAA 3RXDA 1NM6A 2W7SA 3DCLA 1QJ7B 3KIDU 3O8DA 1EAIA 3B8JA 5JBBS 1HAXB 1LMWB 3LGUA 2Q6DA 2ZWLH 4JK6A 1XKBC 3BIUH 1BRBE 1YY3A 2CXVA 3TU7H 8GCHF 2J4IA 2ANMH 1ELFA 1VITH 3RLYH 1ZSLA 1HBTH 2HVYB 3SJKA 5L30H 1SGYE 4X8VH 4E7NA 3MU1A 2G4TA 1K1NA 4ZXXH 3SUEA 3U8RH 1UVUH 1C1OA 1C1TA 3QGJA 1A0LA 1LQEA 1CHOG 4FETA 4WXIA 4WJG2 3EAJA 1MKXH 1Y5UT 1ESTA 1P02A 1YCPH 1WUNH 5A8YA 3LC3A 2XC4A 3ZVAA 1A4WH 3SU4A 1DSUA 1Z1IA 1GPZA 2ZU2A 2G5NA 3SNAA 4R0IA 1O2IA 2HLDD 2EY4C 4NG9H 1FX0B 1O5GH 3SUFA 2W7UA 3M3TA 1FIWA 2YOLA 2G00A 1O2GH 3URCA 1MCTA 3W94A 2Q1JA 3A7ZA 4KP0A 1VITG 2QXJA 4WMFA 1O0DH 1P01A 3EE7A 3RXFA 1GJ7B 1XVOA 2NU4E 4TPYA 5IYTA 3MNBA 1TRYA 3C1KA 3A82A 4F4OC 4O03A 6CHAC 4ZH8A 1C5QA 1W3CA 1CT4E 5HMAA 1SG8B 2A0QB 2BHGA 6GCHG 3HGPA 1GI2A 2AH4X 2WZQA 4XBBA 2I6QA 4AG2A 1GBFA 5C0TA 2BY7X 4YTAA 3ZZBA 4ISOA 3M5MA 1FZZA 4FOUC 1BMNH 1Y5BT 1YP9A 1YCPM 3ZZ8A 1ID5H 3VB5A 4KTSA 2F91A 1Y3WA 1C5OH 1P09A 2Z3EA 1TGBA 2L6OA 3GY8A 1NRPH 4FU9A 1O2XA 3TGIE 1GHZA 1UTJA 3L3TA 1TPPA 4WH8A 3ESTA 3CS0A 3OFND 1MBMA 2A7HA 2ZGBH 2F9VA 2KAIA 3TGJE 3OEHD 1UK4A 3MU5A 2FO9A 1IQFA 6ESTA 4INLA 2AMQA 2ZCKP 3SU3A 1ELAA 1NESE 3BTGE 2JH0D 1THPB 2AGIX 1KXFA 1SQAA 1DITH 2SGFE 1GI9B 4JCNA 3MO9A 1TABE 1CSOE 1QURH 3PLBA 2HPPH 1SGQE 1XXDA 1SSXA 1GMHF 1F5KU 3T29A 2ILNA 2ZPRA 5G4BA 3RU4E 1E0FD 1L1JA 3W95A 4CR5A 4AORA 1QQUA 2KX4A 2ZKSA 3BTEE 1WQSA 1DY9A 4RKOB 7GCHG 4X2VA 2BXUH 2GV7A 2ZDMA 4O9VA 2RDLA 3SV2H 3M61U 3VB7A 3DT0H 1P2JA 4X2WA 5DP3A 4X6PA 1W12U 1W11U 3MH5A 1HAHH 1P2IA 2IJD1 1YPEH 4XDEA 1V2RT 2ZFSA 3MWIU 1V6DA 2QY0B 1JIMA 5CMXH 2QYIA 4TWWA 4UE7H 4X8SH 3RXIA 4H4FA 2TBSA 5T3HA 3QGNB 1UCYH 5GDSH 2VIDA 1MCVA 1V2NT 2A7CA 1WTHD 5FBIA 1A5GH 3SNDA 1DWCH 1W7XH 2C8YB 5FCRA 3RMMH 1GJ9B 1AE5A 3RXLA 3U1JB 4INHA 3RXRA 1EPTB 1JMOH 4DOQA 3ZV9A 1MD7A 1UTOA 2H5CA 2SGDE 5E0HA 2RFKC 1MKXK 1PYTD 4KKDA 4Y76A 1GDNA 1EXFA 1GVLA 1C9PA 5DN6D 1DPOA 1YCPK 2WPKS 1MABB 1O5AB 2R2WU 1FY4A 4CRFA 1O30A 3SNEA 2ZDNA 4WY3A 2ZQ1A 1RXPA 1O39A 4BTTB 4A6LA 4UFDH 2W3IA 1T32A 1Z6EA 4O3TA 3OY6U 5BRRE 1ZZZA 1FONA 1KSNA 4P02A 2ZTZA 1PPZA 4I7YH 1OP2A 1SGNE 3UOPA 1FN8A 1C2KA 2BVXH 2FS8A 4Q7XA 5EGMA 5JPMH 1C1VH 2WUCA 5EW2H 3P6ZB 1DXWA 1XUHA 7LPRA 1YC0A 2CN0H 1QL9A 3PYHA 1ZJKA 1OXGA 1NRRH 2CV3A 1GWAA 2FYRA 1F0SA 1BRUP 2ZGCA 4Q2KA 3QWCH 1C5SA 2VVCA 3RXBA 1BMMH 1T8MA 1AU8A 2K8IA 3SGBE 2BD3A 4AOQA 2VGCC 2VIVA 1O3CA 2EI8A 4B74A 4NA8A 2ZPSA 1G9IE 2JH6D 2WPJS 1Z8RA 4X8TH 3SHAH 2BM2A 1CA0B 2ZDVH 3M35A 1ETSH 3A86A 2ZFQH 2EQNA 4X8UH 4FUJA 5K7RA 5LPRA 3K6YA 1DWDH 4B1TA 1SFIA 4BAKB 1LCYA 1MTNC 1K22H 2TGTA 1J14A 4ISNA 2R3YA 3NXPA 1UO6A 2BTCE 5JDUB 1DM4B 1OWIA 2YMSD 2H9EH 1QA7A 1UVTH 3MH7A 4YT6H 2FTMA 1Z8JB 1L1NA 4ZKOU 3B23B 1O3DA 3QTVH 4XOJA 5GIBA 5TJXA 1LKBA 2RA0A 1PQ8A 1PPEE 3TITA 1O2SA 2NU1E 3GDVA 5EQSA 1CBWC 2W5EA 1XVMA 2C8ZB 1ABIH 1UTQA 3T27A 3T2NA 2A32A 1Z8IB 4FUEA 1BTXA 3M7QA 3GY2A 3PTNA 1GI6A 5CHBA 5JB8S 3MNSA 2G52A 4ZUHA 1AVXA 4Y79A 1TPAE 2OINA 2F4LA 3NUMA 1F0UA 2IN2A 2ANWA 4ISLA 1MAXA 1SC8U 1ANEA 1G3EA 2KCPA 1DOJA 1QL8A 1UCYK 2JETB 2KAIB 1ZPBA 1E36B 1V2PT 3MI4A 3T25A 1NU9A 5H4IB 2R0KA 4BANB 5AF9H 4HTCH 1XMNB 2K0QA 1C5ZB 1BDAA 2GT7A 3LC5A 4DT4A 4DT7B 5EXLA 2Y81A 1WYKA 1C2JA 1VJ9U 3M7UA 1KDQA 3E16B 3RXJA 1HAGE 4X1PU 2SGQE 1EZUC 3OU0A 1GHAF 1FN6A 5E0JA 2PHBA 7KMEH 2IOTA 1NFUA 1AO5A 2QAAA 3A81A 2F9PA 1MTSA 2RA3A 1P11E 2ZGJA 1BMLA 4NA7A 2V3MA 3OTJE 3TK9A 1OS8A 2PGQB 3MTYA 1P2OA 4X1RU 4A5TS 1TQ0B 7ESTE 5EU8A 4J1YA 3URDA 2SGAA 1GI7B 3OX7U 1LQDB 1KXBA 1ZMNA 1V2WT 3M3VA 1S83A 2AFQB 2AMDA 1NN6A 1COWD 1QY6A 1C2HA 2O8LA 4BAHB 1G30B 1DUAA 4ZHMU 1P3EA 1GBHA 5LPFA 1O3IA 1C2EA 1HJ8A 2SNVA 1N8OC 3PWCA 1ELVA 2ZU3A 2CHAC 1ORFA 1ZMJA 5GPIB 2KFWA 3GISB 4K1TA 2BDIA 2XRCA 5A8XA 2Z9KA 1IOEA 2ZA5A 3MQKC 4TWYA 1YWUA 2PW8H 2P95A 3S9CA 2J97A 4FUGA 2P8OB 3KQCA 1OWHA 3DSPA 3U69H 3CENA 4B71A 1QA0A 4E05H 1O2JA 4QT8C 3RDZA 1FI8A 3BTWE 4IMQA 2HRVA 1MBQA 2C93B 3HKJB 4NFEA 3GDUA 2ZC9H 4Q7YA 2O8WA 2A5AA 5J4SA 3EE0B 5PTPA 2BDYA 4KELA 4DJZB 4NGAH 1YLNA 4H6TA 3LGTA 3ZVGA 2BD4A 2UUKB 3S69A 2QXIA 1JRTA 1PJPA 2BD5A 2VNTA 1J16A 3EQ0H 4GCHG 3TK5A 1C5PA 2XC5A 3TK6A 5DG6A 4CRCA 3F9GA 1V2MT 1OWDA 1SOZA 2UWOA 2VJ1A 1GBLA 1XKAC 3N99A 1GHAG 2KCOA 1ZGIA 2ZEBA 1GMDG 2P93A 5T6DA 3AK5A 1ANCA 5C2ZA 3M5LA 2FESH 3SU1A 1F5RA 1XM1A 1EJAA 5ESTE 2KM0A 4XBDA 3AAUA 1U6QA 1BJUA 3AW1A 3NK8A 2FOEA 1GGDB 3BG8A 1RFNA 2OQUA 1GDUA 1BB0B 3AVZA 1G36A 4I32A 3ZV8A 4R8TB 4PROA 5FX5A 2SNWA 3QO6A 2FLBH 1C1RA 3T26A 1CE5A 1MZDA 1PQAA 3ZZ9A 3PTBA 1YPKH 5FBEA 1TA6A 1RTLA 2BDBA 2STBE 2ZP0H 1IHSH 1QR3E 4HG6A 1BTYA 1D9IA 3TH4H 2ZFTA 1Z1JA 2PTCE 4XBCA 3SV9A 1H1BA 1T4UH 3F2GA 1Y59T 2AGEX 2D1JA 1FDPA 2BZAA 3AW0A 3Q77A 3GCNA 2ALVA 4F48B 3UNRA 1H8ED 3RC6A 5HXFA 1MQ6A 2PR3A 4FUDA 2GCHG 2O9QA 2D26C 4YOJA 5JBCS 4K1EA 1C1PA 1D6WA 1O3OA 1V3XA 1C1WH 4CRDA 2ZTYA 3OAAD 2ZU1A 5DP6A 1ZYOA 4AG1A 5C94A 1TB6H 3PM3A 3KYGA 5B6LA 5EPYA 1KXEA 2FIRH 5K0HA 2Z3DA 1O5FH 1K1MA 2QF3A 1XUFA 2H1UA 1VGCB 1OP0A 2AERH 4I33A 4BTIB 3OY5U 5GCHG 4MNYA 4OM9A 2A45B 1E37B 1QCPA 5CHAC 4RSPA 1SHYA 2VH6A 1ZHMA 1YPMH 4CH8B 3PROA 3SI3H 2GT8A 5AVDA 1IQHA 4Y0YE 3PO1B 5EXMA 1TX7A 3L6PA 1O2PA 4I8JA 3VEQB 1QHRB 4Y10E 1Y3XA 1HYLA 4NFFA 1O3MA 3RXHA 1QB1A 4BOHA 4IW4E 1NY22 1K1PA
chains in the Genus database with same CATH topology
5C1YA 1IQMA 5A8ZA 2BX4A 1BCUH 1WCZA 1AUJA 2H2ZA 5JB9S 3ZYEA 2AIPA 1UTNA 3SU6A 1EASA 1EZXC 2Q6FA 2ODQA 4GLYA 3IWMA 3IITA 4ABBA 4ABHA 2IPHA 4IGDA 1QJ6B 1TBZH 1GBJA 5C1UA 1TA2A 1C5VA 1THRH 4FUIA 3M37A 4Y0ZE 4ASHA 3RXPA 1A61H 2A4GA 3Q3KA 5CHAB 2VIPA 1OWJA 1S85A 2SGPE 1F5LA 3BTHE 1FUJA 4HFPB 3RU4D 2XCNA 1VZQH 2BLWA 5DK1A 1W7GH 3HKIB 3PWBA 5L2YH 1UTMA 2ODPA 2HGTH 1O2OA 3FP8E 3BTDE 4AB8A 2BXTH 5AFYH 1QTFA 3A87A 2FI3E 3BV9B 1YKTA 1ZLRA 3BTTE 3I77A 2SGEE 4I8GA 2ZCHP 2OQ5A 3S0NA 2VVVA 3GCTG 4A1TA 4DW2U 1SGFA 3VXFH 2I6SA 1FIZA 5A0AE 2V6NA 5HGGA 2BY9X 1GHBF 1KY9A 2H9HA 3D49H 1TRMA 1C2DA 1SGFG 1KLTA 1NRSH 1GMCF 3DFLA 2C90B 3JZ1B 2B0FA 3LH3A 1EP6A 3BG4B 1ARCA 3SJOA 3SJ8A 1ETRH 1P3CA 5FXLA 5B6OA 3E0NB 2HWLB 3NZIA 1JBUH 1ZGVA 4LZ4B 1SLVB 3ZVDA 2J2UA 5E2OA 1PPFE 1XUIA 2B7DH 4MNXA 3RXUA 1LDTT 2EEKA 1P12E 3M3SA 3RXQA 3UQOA 4AZ2B 4IC6A 3SHCH 4NIXA 2FS9A 1XX9A 2XTTB 1ELCA 1N1LA 3P17H 3SJ9A 2OC0A 2TGDA 5C5OA 4ZKSU 4TYDA 4JZEH 2THFB 4TY7A 3GY6A 5A0BA 3A8DA 8GCHG 5HM9A 2HNTC 4A1VA 2FOFA 1JRSA 1C4V2 1FY5A 1TGTA 2P3FH 3VGCB 1ZSJA 2VIOA 2J38A 2QXGA 3L33A 1YPHE 3UR9A 2A4QA 4MPUA 1DS2E 3LDXH 4OGYA 1TGSZ 1AKSA 2OLGA 1AUTC 4BAOB 4NIVA 1SFQB 5GWZA 5A09A 5GJ4B 1TQ7B 2BY8X 4M7GA 3TGKE 3GOVB 5F6MA 2A5KA 1SL3A 2F83A 2FOCA 1C5NH 1O3JA 1NRQH 1UHBA 2A2XH 2YNAA 1AI8H 3KGPA 4ZXYH 3UQVA 4BXWA 2NWNA 1SGIB 1BA8B 1KLIH 1OYQA 1C5LH 1QBVH 2Z7FE 4OGXA 5HM2A 3DD2H 5C20A 1GJ4H 3LT3A 1EPTC 5TCAA 3H7TA 4MPWA 2BQWB 1MUEB 3FP6E 1ZHRA 4ZROA 1SPJA 2BLOA 2CJIA 2GV6A 5DP8A 1O2WA 3ATLA 2VH0A 3UIRA 3I29A 1EX3A 3BTFE 2FM2A 2GCTB 4FU8A 1K28D 1IQIA 1EB1H 2CF8H 2VIQA 1EZQA 2FDAA 3U98H 3GICB 2C8WB 1WSSH 1GHBG 3AASA 3RXVA 2EI7A 4MDSA 1SVPA 1K1IA 1GMCG 1RJXB 4OS7A 3KL6A 1TNKA 3BIVH 3T5FH 1V2UT 3DFJA 3CS7A 4D9RA 1P9SA 1NO9H 5FPSA 3P70B 1EOLA 2AEIH 1PQ7A 3VPKA 1O2HA 2BLVA 4XFQA 1C2LA 4HZHA 3LGIA 3RXGA 1TX6A 4JK5A 1A1RA 2ZNKH 4OS5A 2G4UA 1B0EA 4U32A 3UUZA 1CT0E 1YPHC 2GZ8A 1YLCA 5C3NA 3TIUA 4CRGA 3TLOA 1RGQA 1E34B 2A1DB 2UWLA 3SQHE 1H9LB 2QC2A 4I31A 4RN6A 3KF2A 1ELEE 1DWEH 3AAVA 2H9TH 2R0LA 2WV5A 1QBNA 3E1XB 1QQ4A 4BAQB 1MD8A 1M9UA 1PFXC 1SBWA 5I25A 1HXFH 2UUFB 3RXOA 1O3KA 1FXYA 2PLXA 1L4DA 2ZI2H 1SR5C 1SGDE 1MKWH 5F8ZA 5ABWA 1D6RA 1CA0C 3GCOA 4K3JA 5DGJA 1GMHG 1HJAB 3BTQE 3UREA 3UY9A 1CGJE 3GYLB 1O2VA 2A7JA 1DSTA 1J15A 3RMNH 1W13U 3CP7A 2GDDA 1OX1A 1C2MA 4CH2B 1P9UA 3A7WA 3ZZ4A 4HI3A 4FU7A 3STJA 5EPNA 4X6NA 3SV6A 3O8BA 1G2LA 3LJOA 2VWLA 1QB9A 2FOHA 3P92A 3TJOA 4AFZA 4GAWA 2OUAA 3MO6A 3MFJA 3P8GA 4Y8ZA 4DG4A 1CGHA 1C5WB 2GKVE 3P95A 2VVUA 4BTUB 1UTKA 3JZ2B 4X2YA 1L2EA 1BHXB 2Y6TA 3RM2H 3U8TH 4CHAB 3PLPA 1AMHA 2BDAA 2FX4A 1DDJA 1C1SA 1CT2E 3SUGA 4K5ZA 2STAE 1P2KA 1H8IH 4UEHH 3RXCA 3EDXB 2BY6X 4ABFA 1ZSKA 4H42U 1SGEE 3A7VA 1GHWH 4AFQA 2RG3A 4I8LA 1ACBE 2JETC 1AZ8A 4IN2A 3E91A 1MH0A 1UVSH 2BVSH 4J2YB 3F9FA 1E35B 3ATWA 2J95A 2ZG0H 1C5UA 1GJAB 2ZZUH 3SN8A 4GHQA 4X0WU 1L1GA 8ESTE 2BOHB 2PSYA 3BEUA 1O3BA 1NC6A 2O8MA 2BDHA 3F9HA 2FPZA 4LXBH 1ZTLA 2FYQA 4TY6A 4X2XA 4O97A 3UWJH 3TNTA 4ZKNU 2M5TA 3LGYA 3A7TA 3D65E 1DICA 1P8VC 2K1QA 1AWFH 2OCVB 3E8LA 4A1XA 2WPIS 1QFKH 4MQAA 1PQ5A 1TOMH 1IQLA 1TNLA 1L0ZA 1FQ3A 2R2MB 1BBRH 1Y5AT 2ZFPH 2HALA 3SI4H 1HNEE 3SZNA 1OWEA 1D3QB 1H9HE 5E8EH 1NT1A 1SLWB 4D8NA 4DIHH 4VGCB 1AHTH 1FPCH 1GBEA 1AE8H 4SGAE 5SGAE 1ETTH 4I8HA 4FUHA 4Y6DA 3SGQE 4NSYA 1GI1A 1MZAA 2VU8E 1WBGB 2PUXB 1BRCE 2OC8A 1EAWA 2H5DA 3SOSA 4ISHH 2NU3E 1J8AA 2TRMA 2VIWA 1IQKA 5ETXA 4B76A 1AKSB 1TFXA 1ARBA 1UVOA 1GVKB 5F8TA 4E06H 2GX4A 3LOXA 1SB1H 2R3UA 1HV7A 1VJAU 3ZVBA 3GCHB 2ZU5A 1TNGA 3PMJA 1Q31A 1S0QA 1BUIA 3E3TA 5FPTA 1BTPA 1K21H 1O2QA 1O33A 2QN5T 1YPGH 4Y11E 1YBWA 1H4WA 1LKAA 3H5CB 2P8OC 4FVDA 2D2DA 1SGPE 5FX6A 4OS4A 1WOFA 3EBNA 1SHHB 1MU6B 3ZVEA 1O5BB 4MLFB 1MKWK 2A2QH 5A2MH 1A5HA 1HGTH 4ABGA 1X7AC 2XC0A 4OS1A 1V2VT 1C4U2 1KLJH 4NWKA 4FVBA 1PPBH 2DUCA 2F9NA 1SQTA 1YYY1 4NWLA 3SU5A 1GI5A 1S6HA 1THSH 4NZLA 1F92A 3TH2H 3KEEA 3RP2A 3TPIZ 3S9BA 3MNXA 1T4VH 2FMJA 1C5MD 4GPGA 3HK6B 3MHWU 1ANDA 3ZZ6A 1C1MA 1ZRBA 3ELAH 3LONA 1KXDA 3PMHB 1AFQB 4ABEA 3O8CA 4YO9A 4YZUA 4U2WA 1T8NA 2ZHFH 4KTCA 3TJVA 1UMAH 1D3DB 3QLPH 5L2ZH 2ZHWH 3TJNA 4MVNA 1H8DH 1C9TA 2GZ9A 1TAWA 1BBRE 1EKBB 3DHKH 1GGDC 3FAOA 2P94A 3MNCA 1LPGB 2BD7A 1RIWB 1BTUA 1DT2A 3BF6H 3RXMA 2OTVA 5EXNA 3SBKA 2HNTF 3UNQA 5ESBA 1DANH 3M5OA 1SGRE 2GMTB 1AY6H 4Y7AA 2ZFRH 1Z8GA 2QIQA 3NWUA 2FOGA 1P57B 3GDSA 1BRAA 3F9EA 1C5YB 3MH4A 1DY8A 4NIYA 1NFYA 3DUXH 4AX9H 1NS3A 2V0BA 3LH1A 2BQ6B 2VWNA 2ZGHA 1QB6A 9LPRA 2BDCA 2FEQH 1G37A 1C5RA 3P8FA 3T28A 4WF8A 1O38A 3V3MA 1KTSB 4ABDA 1MAYA 1OP8A 3QX5H 2Y7ZA 1O3PB 1BBRK 1S82A 4WXVA 2ODYB 2PFEA 1EUFA 2V3OH 1WQVH 1LPZB 1GI4A 1RD3B 1VGCC 4AYYB 5IDKA 1C4Y2 4AFUA 5FCKA 1QIXB 3E0PB 1ZTJA 5FPYA 1O36A 1GCDA 1O3EA 1F0RA 2IJOB 1V2OT 4MNWA 4JMYA 1CVWH 1GBKA 3EYDA 4INKA 1IQJA 3M36A 4IBLH 3ATKA 1ZOMA 3PO1C 1GBCA 1UK2A 5DKMA 1RTFB 2OBQA 3U1IB 3TNSA 4OS6A 2DE8A 5FAHA 1UK3A 1DXPA 2FI5E 1CHOF 2NU0E 4U30A 1HB0B 3QDZB 3G01A 3NPSA 1V2LT 1WTGH 1F2SE 1BJVA 3QZRA 1G32B 1Z71A 1TALA 2PV9B 5C1XA 3LKWA 4NCYA 4AGKA 2PTNA 4K60A 3A8BA 2K7XA 1GJ5H 1CA8B 1TGCA 4DURA 1ELBA 1GL0E 3VB3A 1HIAA 1ESAA 1O37A 4IS5A 5E0GA 2TGPZ 1V2TT 2XBWA 2ZCLP 4DY7B 1AIXH 2LNCA 2ANYA 4JZDH 2F9UA 1V2KT 4KTUA 1OYTH 5EG4A 4YLUA 1ZJDA 6GCHF 4E7RG 4ZHAA 1ZMLA 1G2MA 1C1NA 1D3PB 1ELGA 1JIRA 1GVZA 1O35A 1O3HA 4K8BA 1KDQB 5C5NA 1V2JT 4K69A 3S7KB 1WV7H 3RLWH 1N6YA 3SUDA 1O2YA 4JZ1A 2XBYA 2BB4A 4MNVA 1O34A 3ITIA 1FV9A 1RS0A 4MPXA 1C1UH 2WPLS 1OPHB 1G3DA 3ZZCA 1HAPH 3MYWA 6LPRA 1LHEH 4X6MA 2XYAA 2W3KA 3DA9B 3BG4C 1D4PB 2HNTE 1A3BH 1CU1A 1SGCA 5CE1A 2A4OA 3QN7A 2D8WA 2R9PA 3PMBB 1BZXE 3VFEA 1ZHPA 3UTUH 3S7HB 5EW1H 1INCA 2BD8A 3UR6A 3H7OA 3OYPA 2O8UA 4WH6A 3ZZAA 1DE7H 1HCGA 1ELTA 1GHYH 1UVPA 2Z9GA 2JH5D 3ZYDA 3ZZ3A 1T7CA 3B9FH 5EODA 5E2PA 3ODFA 1XUJA 4YT7H 4U01A 3E90B 4D76A 2AGGX 5DO4H 2OP9A 3SJIA 4X1NU 3A8CA 4DVAU 3MO3A 2G5VA 7GCHF 2WPMS 5J4QA 3VGCC 3ZZ5A 1ZRKA 4YESB 1AQ7A 2P3UB 2HVXA 2ZFFH 4WMDA 1IQGA 1TWXB 2BQ7B 1A3EH 3LU9B 2OXSA 3UWIA 2G81E 1WU1A 3MH6A 3M5NA 2YNBA 4K8YA 3RUOA 1W8BH 2ESTE 1GHXH 1MTUA 4KGAA 1FJSA 1JOUB 4D7GA 5LPEA 2FOMB 1LPKB 4CRBA 1S6FA 1W14U 1AWHB 2BD2A 1TMUH 2XXLA 2FI4E 5AFZH 3A8AA 1GBIA 4JZFH 5BPEA 1P03A 2QF0A 1KTTB 3HGNA 1AZZA 1P2NA 2FOBA 2GCTC 1P04A 3WY8A 1IAUA 1YLDA 3UPEA 3BEFB 2C8XB 3UNSA 1EJMA 4NZQA 1MU8B 1FNIA 4NA9H 4ZMAH 1QJ1B 1EJNA 5DP5A 1YGCH 3KQBA 4D7FA 1MMJN 4FXGH 1EB2A 1VR1H 1C1QA 1O3NA 1XUKA 5LH8A 1QRZA 2TIOA 4FUFA 1AVGH 3IG6B 2OC7A 1LVOA 1NRNH 1QRWA 3V7TA 4HGCA 4LZ1H 1AB9C 6CHAB 1DVAH 1HDTH 1BTHH 1Y3VA 3SV8A 1F0TA 1LHCH 4I8KA 3O8RA 3LGWA 1HAYB 4YM9A 1FMGA 1QRXA 2ZQ2A 4ZAEA 2J34A 3LGVA 1GCTC 3BSQA 2RCEA 1GL1A 4TPIZ 2PKAA 2ANKH 2F9BH 1RTKA 3RU4T 2EC9H 2VWOA 1OWKA 4IC5A 1LVYA 2FWWA 4B2BA 4ZKRU 2XW9A 1P2MA 1O3GA 1O2KA 2ZHEH 2XBXA 3A7XA 2V3HH 3A89A 3QZQA 3R0FA 3RXAA 4Y71A 3ATMA 1SOTA 3A83A 3V13A 3SQEE 3SGAE 3VB4A 1HJAC 4A92A 5EQRA 1QNJA 4JYTA 3RXTA 2B8OH 2AYWA 1NROH 1AB9B 2SFAA 3RM0H 2OD3B 1GJ8B 4LK4A 3N7OA 4AB9A 1HLTH 2J92A 2C3SA 4UONA 2EI6A 1O2RA 2BZ6H 2HPQH 1V2ST 1GJBB 1SLXB 2PWXA 2Q6GA 1AGJA 1TLDA 2OC1A 2Z9IA 1FLEE 4GSOA 2ZHDA 5EOKA 2GDEH 3UOUA 2XNIA 4X1QU 1HIAB 1GCTB 1TYNA 4B2CA 3VXEH 4JYUH 4ABIA 4ISIH 4ESTE 1TONA 5JBAS 3EA8A 3FZDA 2DE9A 3PV4A 3ZVCA 5HYOA 1G3BA 2Y5FA 2VB0A 2PSXA 1ZR0A 4ABJA 1XXFA 5DP9A 1TMTH 2UUJB 4Y7BA 3Q00A 4CHAC 1LTOA 1W10U 2QGRA 1S5SA 3SNCA 2F3CE 2WUBA 1V2QT 2WPHS 3A80A 2FX6A 3A88A 3K6ZA 2FTLE 1VCPA 2G8TA 4FUCA 1OOKB 1ABJH 1TIOA 2B5TB 2ZGXH 2ASUB 1E38B 3RXEA 3GY5A 2ZIQH 1Y3UA 2B9LA 1HAZB 2AS9A 2A5IA 4Z0KA 1C2FA 1EATA 4BNRA 4CRAA 3MU8A 1BT7A 1LVMA 1GI8B 2FZZA 1J17T 4CR9A 3V12A 4SGBE 1VCQA 1N6XA 1JXPA 2HOBA 3K65B 3F68H 4MTBA 2TPIZ 4FUBA 1A0HB 5T6FA 1ANBA 1QGFA 1TMBH 3GY3A 2BLQA 1A0JA 3ATIA 1SLUB 4D9QA 1F7ZA 2OBOA 2HLCA 3KQEA 4DCDA 1CQQA 1CHGA 2Z94A 2QCYA 3SU0A 2BMGB 4VGCC 5A0CA 2ZTXA 4OS2A 1T8OA 3K2UA 3RC5A 1C5XB 4CREA 4JYV