4WNLA

The x-ray structure of a rna-binding protein complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
233
structure length
227
Chain Sequence
DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFINEPGADSFDKVILPIASMFVKCVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDGTNIGETDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLGALDEEFDVVATKWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SWI5-dependent HO expression protein 2
publication title Hooking She3p onto She2p for myosin-mediated cytoplasmic mRNA transport.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 89
structure length 227
sequence length 233
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11435 She2p RNA binding protein She2p
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.20 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 She2 domain 4wnlA00
1XLYA 5M0IA 4WNLA 5M0JA
chains in the Genus database with same CATH superfamily
1FURA 3RRPA 3KDYA 1JSWA 1B8FA 2O7EA 4FFXA 1XWOA 5F91A 2PFMA 2PTSA 4ADMA 2O7FA 4C5UA 5F92A 4ADLA 5D6BA 4WNLA 3R6YA 4V2QA 2QVEA 3BHGA 3NO9A 2FELA 1U15A 2E9FA 1EB4A 1TJWA 3TV2A 3RD8A 2RJRA 4BAAA 1K7WA 1RE5A 1HY0A 1U16A 4EFCA 3KDZA 3UNVA 1TJUA 2QGAB 1DCNA 2O7DA 4BABA 3R6QA 1HY1A 1KQ7A 1FUOA 2OHYA 4MX2A 1YISA 5EYTA 1YFEA 3NZ4A 2NYFA 3GZHA 4HGVA 2J91A 1AUWA 1FUPA 4NLEA 1DOFA 4APAA 4V2RA 1FUQA 2NYNA 4CQ5A 1TJ7A 1J3UA 2FENA 1Q5NA 1XLYA 2O6YA 3QBPA 2PTQA 2HVGA 1TJVA 3R6VA 1C3UA 2O7BA 1GK3A 2RJSA 2X75A 4C5SA 1GKJA 5EYVA 1Y2MA 1W27A 2VD6A 5HW2A 3CZOA 1I0AA 4APBA 2O78A 2FUSA 1VDKA 1GK2A 1GKMA 3C8TA 3OCFA 4FLCA 4EEIA 5M0IA 1C3CA 1K62A 2YIIA 4C6GA 3E04A 3GTDA 3OCEA 1T6JA 1T6PA 2PTRA 4NSLA 4C5RA 1YFMA 5M0JA
chains in the Genus database with same CATH topology
1XLYA 5M0IA 4WNLA 5M0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLY A;  5M0I A;  4WNL A;  5M0J A; 
#chains in the Genus database with same CATH topology
 1FUR A;  3RRP A;  3KDY A;  1JSW A;  1B8F A;  2O7E A;  4FFX A;  1XWO A;  5F91 A;  2PFM A;  2PTS A;  4ADM A;  2O7F A;  4C5U A;  5F92 A;  4ADL A;  5D6B A;  4WNL A;  3R6Y A;  4V2Q A;  2QVE A;  3BHG A;  3NO9 A;  2FEL A;  1U15 A;  2E9F A;  1EB4 A;  1TJW A;  3TV2 A;  3RD8 A;  2RJR A;  4BAA A;  1K7W A;  1RE5 A;  1HY0 A;  1U16 A;  4EFC A;  3KDZ A;  3UNV A;  1TJU A;  2QGA B;  1DCN A;  2O7D A;  4BAB A;  3R6Q A;  1HY1 A;  1KQ7 A;  1FUO A;  2OHY A;  4MX2 A;  1YIS A;  5EYT A;  1YFE A;  3NZ4 A;  2NYF A;  3GZH A;  4HGV A;  2J91 A;  1AUW A;  1FUP A;  4NLE A;  1DOF A;  4APA A;  4V2R A;  1FUQ A;  2NYN A;  4CQ5 A;  1TJ7 A;  1J3U A;  2FEN A;  1Q5N A;  1XLY A;  2O6Y A;  3QBP A;  2PTQ A;  2HVG A;  1TJV A;  3R6V A;  1C3U A;  2O7B A;  1GK3 A;  2RJS A;  2X75 A;  4C5S A;  1GKJ A;  5EYV A;  1Y2M A;  1W27 A;  2VD6 A;  5HW2 A;  3CZO A;  1I0A A;  4APB A;  2O78 A;  2FUS A;  1VDK A;  1GK2 A;  1GKM A;  3C8T A;  3OCF A;  4FLC A;  4EEI A;  5M0I A;  1C3C A;  1K62 A;  2YII A;  4C6G A;  3E04 A;  3GTD A;  3OCE A;  1T6J A;  1T6P A;  2PTR A;  4NSL A;  4C5R A;  1YFM A;  5M0J A; 
#chains in the Genus database with same CATH homology
 1XLY A;  5M0I A;  4WNL A;  5M0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...