4WNLA

The x-ray structure of a rna-binding protein complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
233
structure length
227
Chain Sequence
DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFINEPGADSFDKVILPIASMFVKCVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDGTNIGETDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLGALDEEFDVVATKWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hooking She3p onto She2p for myosin-mediated cytoplasmic mRNA transport.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords SWI5-dependent HO expression protein 2
total genus 89
structure length 227
sequence length 233
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11435 She2p RNA binding protein She2p
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.20 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 She2 domain 4wnlA00
4WNLA 5M0IA 5M0JA 1XLYA
chains in the Genus database with same CATH superfamily
4ADMA 3UNVA 4NLEA 2QGAB 5F92A 2O78A 2E9FA 2RJSA 2PFMA 1K7WA 1U16A 1DOFA 2O7DA 3R6QA 3QBPA 1GKJA 4C5UA 4HGVA 1YISA 4EFCA 2FENA 2NYNA 1T6JA 1T6PA 3E04A 4FLCA 1FURA 1B8FA 1DCNA 1K62A 2NYFA 1GK3A 1FUPA 4MX2A 2PTRA 5F91A 1AUWA 1TJWA 3R6VA 1GK2A 4EEIA 1YFMA 3TV2A 4WNLA 1KQ7A 4ADLA 1GKMA 4C5RA 4APAA 3KDZA 3BHGA 2O7EA 2VD6A 5HW2A 3RRPA 1C3UA 1HY0A 4V2QA 3CZOA 1TJ7A 3GTDA 1TJVA 4APBA 2OHYA 3KDYA 2HVGA 4BAAA 2X75A 1Q5NA 1J3UA 2YIIA 2FELA 2PTSA 3OCFA 1FUOA 3RD8A 2O7FA 4C6GA 5M0IA 1TJUA 1VDKA 2O7BA 3OCEA 2FUSA 3NO9A 2RJRA 3NZ4A 1EB4A 1FUQA 1HY1A 3R6YA 5D6BA 1U15A 4C5SA 4V2RA 4FFXA 5M0JA 5EYTA 2PTQA 1YFEA 3C8TA 1XWOA 2J91A 1Y2MA 4NSLA 4BABA 4CQ5A 1RE5A 1W27A 1XLYA 2O6YA 5EYVA 2QVEA 1I0AA 1JSWA 3GZHA 1C3CA
chains in the Genus database with same CATH topology
4WNLA 5M0IA 5M0JA 1XLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNL A;  5M0I A;  5M0J A;  1XLY A; 
#chains in the Genus database with same CATH topology
 4ADM A;  3UNV A;  4NLE A;  2QGA B;  5F92 A;  2O78 A;  2E9F A;  2RJS A;  2PFM A;  1K7W A;  1U16 A;  1DOF A;  2O7D A;  3R6Q A;  3QBP A;  1GKJ A;  4C5U A;  4HGV A;  1YIS A;  4EFC A;  2FEN A;  2NYN A;  1T6J A;  1T6P A;  3E04 A;  4FLC A;  1FUR A;  1B8F A;  1DCN A;  1K62 A;  2NYF A;  1GK3 A;  1FUP A;  4MX2 A;  2PTR A;  5F91 A;  1AUW A;  1TJW A;  3R6V A;  1GK2 A;  4EEI A;  1YFM A;  3TV2 A;  4WNL A;  1KQ7 A;  4ADL A;  1GKM A;  4C5R A;  4APA A;  3KDZ A;  3BHG A;  2O7E A;  2VD6 A;  5HW2 A;  3RRP A;  1C3U A;  1HY0 A;  4V2Q A;  3CZO A;  1TJ7 A;  3GTD A;  1TJV A;  4APB A;  2OHY A;  3KDY A;  2HVG A;  4BAA A;  2X75 A;  1Q5N A;  1J3U A;  2YII A;  2FEL A;  2PTS A;  3OCF A;  1FUO A;  3RD8 A;  2O7F A;  4C6G A;  5M0I A;  1TJU A;  1VDK A;  2O7B A;  3OCE A;  2FUS A;  3NO9 A;  2RJR A;  3NZ4 A;  1EB4 A;  1FUQ A;  1HY1 A;  3R6Y A;  5D6B A;  1U15 A;  4C5S A;  4V2R A;  4FFX A;  5M0J A;  5EYT A;  2PTQ A;  1YFE A;  3C8T A;  1XWO A;  2J91 A;  1Y2M A;  4NSL A;  4BAB A;  4CQ5 A;  1RE5 A;  1W27 A;  1XLY A;  2O6Y A;  5EYV A;  2QVE A;  1I0A A;  1JSW A;  3GZH A;  1C3C A; 
#chains in the Genus database with same CATH homology
 4WNL A;  5M0I A;  5M0J A;  1XLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...