4WNLA

The x-ray structure of a rna-binding protein complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
233
structure length
227
Chain Sequence
DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFINEPGADSFDKVILPIASMFVKCVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDGTNIGETDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLGALDEEFDVVATKWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hooking She3p onto She2p for myosin-mediated cytoplasmic mRNA transport.
pubmed doi rcsb
molecule keywords SWI5-dependent HO expression protein 2
molecule tags Rna binding protein
source organism Saccharomyces cerevisiae
total genus 89
structure length 227
sequence length 233
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11435 She2p RNA binding protein She2p
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.20 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 She2 domain 4wnlA00
4WNLA 1XLYA 5M0JA 5M0IA
chains in the Genus database with same CATH superfamily
1K62A 1B8FA 2O78A 3OCFA 4FFXA 5HW2A 1U15A 3KDYA 1FUPA 1TJVA 1YFEA 4C5RA 3C8TA 3BHGA 3CZOA 3OCEA 1FUOA 1C3CA 4CQ5A 2QVEA 1KQ7A 3NO9A 3R6VA 1JSWA 1I0AA 2FENA 3GZHA 1HY0A 5EYVA 1U16A 2QGAB 2VD6A 3GTDA 5D6BA 1DOFA 2HVGA 2O6YA 2RJRA 1VDKA 2NYFA 1GKMA 4V2RA 1GK3A 1YISA 3E04A 1TJUA 2YIIA 1HY1A 2PTSA 1K7WA 4NLEA 2J91A 4APAA 2OHYA 3R6QA 2PTRA 3RD8A 1T6JA 2PFMA 3R6YA 1GK2A 4V2QA 1TJWA 4ADMA 3RRPA 1AUWA 4EEIA 4HGVA 1GKJA 3KDZA 1C3UA 1J3UA 4APBA 1Y2MA 1T6PA 2NYNA 3TV2A 5F91A 1XWOA 1XLYA 5M0IA 2FUSA 4C6GA 1Q5NA 1DCNA 2O7FA 1FURA 1W27A 1EB4A 4ADLA 4BABA 1TJ7A 1RE5A 5M0JA 4EFCA 2RJSA 1FUQA 2PTQA 4MX2A 4FLCA 3QBPA 3NZ4A 4C5SA 5EYTA 2O7EA 1YFMA 2O7DA 4BAAA 4NSLA 3UNVA 5F92A 4C5UA 4WNLA 2E9FA 2FELA 2O7BA 2X75A
chains in the Genus database with same CATH topology
4WNLA 1XLYA 5M0JA 5M0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNL A;  1XLY A;  5M0J A;  5M0I A; 
#chains in the Genus database with same CATH topology
 1K62 A;  1B8F A;  2O78 A;  3OCF A;  4FFX A;  5HW2 A;  1U15 A;  3KDY A;  1FUP A;  1TJV A;  1YFE A;  4C5R A;  3C8T A;  3BHG A;  3CZO A;  3OCE A;  1FUO A;  1C3C A;  4CQ5 A;  2QVE A;  1KQ7 A;  3NO9 A;  3R6V A;  1JSW A;  1I0A A;  2FEN A;  3GZH A;  1HY0 A;  5EYV A;  1U16 A;  2QGA B;  2VD6 A;  3GTD A;  5D6B A;  1DOF A;  2HVG A;  2O6Y A;  2RJR A;  1VDK A;  2NYF A;  1GKM A;  4V2R A;  1GK3 A;  1YIS A;  3E04 A;  1TJU A;  2YII A;  1HY1 A;  2PTS A;  1K7W A;  4NLE A;  2J91 A;  4APA A;  2OHY A;  3R6Q A;  2PTR A;  3RD8 A;  1T6J A;  2PFM A;  3R6Y A;  1GK2 A;  4V2Q A;  1TJW A;  4ADM A;  3RRP A;  1AUW A;  4EEI A;  4HGV A;  1GKJ A;  3KDZ A;  1C3U A;  1J3U A;  4APB A;  1Y2M A;  1T6P A;  2NYN A;  3TV2 A;  5F91 A;  1XWO A;  1XLY A;  5M0I A;  2FUS A;  4C6G A;  1Q5N A;  1DCN A;  2O7F A;  1FUR A;  1W27 A;  1EB4 A;  4ADL A;  4BAB A;  1TJ7 A;  1RE5 A;  5M0J A;  4EFC A;  2RJS A;  1FUQ A;  2PTQ A;  4MX2 A;  4FLC A;  3QBP A;  3NZ4 A;  4C5S A;  5EYT A;  2O7E A;  1YFM A;  2O7D A;  4BAA A;  4NSL A;  3UNV A;  5F92 A;  4C5U A;  4WNL A;  2E9F A;  2FEL A;  2O7B A;  2X75 A; 
#chains in the Genus database with same CATH homology
 4WNL A;  1XLY A;  5M0J A;  5M0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...