4WNQB

The molecular bases of delta/alpha-beta t-cell mediated antigen recognition
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
241
structure length
241
Chain Sequence
VVSQHPSRVISKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSAPGGVGAFFGQGTRLTVVEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR Variable Delta 1 chain and TCR constant Alpha chain
publication title The molecular bases of delta / alpha beta T cell-mediated antigen recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 241
sequence length 241
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wnqB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wnqB02
3GSRA 5D7JA 1CG9A 2W07A 2WWMC 5DRWA 1MQ8A 5TE4H 4LLDB 4HUUA 3CVHL 4M1DL 3Q6FB 5EZOL 1QFHA 5IVXB 1GPOL 1LILA 3L95B 4CW1B 5AYUH 5J7CC 3CFKB 3G04B 3G6JB 1U8KB 5E4EC 4UTBL 1VFMA 4HPYH 4HCRH 5EBMA 3EYVA 1QBMH 3VFTA 2BSRA 4PB9L 4U6TA 1AJ7H 1CL7H 2AXJA 4PRHA 4R6UA 5HHXH 4WUUE 1MCPH 4OCMC 4CDGC 3LN5A 5GISL 4Y4KC 4LPYA 1I1AC 1W72B 4NBXB 3P9WB 1T89C 3TZVA 2ARJA 4UB0H 5BV7H 4Y2DC 1D6VL 2JIXD 3DMMB 3BQUD 3HR6A 3LB6D 3PV6A 1NPUA 3ZHLA 4FXKB 1KT2A 4PJBF 1TZHA 1JGEB 2R15A 2DD8H 3ARPA 2WBKA 1PG7H 4QRPA 2ED9A 1PVHA 2A6DB 2FD6H 4XBEH 1MVFA 4M48H 4KI5E 3IDXH 4NC2B 3BVNB 5EH1A 2VR5A 1LO4L 3EFDL 3AXLA 3E3QC 4WUKH 1XR8A 1P2CA 2BSED 1OTSC 1F4WH 5DK0B 4P99A 1A3RL 1E4KA 1AGFB 3DLQR 4XHQA 4GKZA 4P9MH 3FQTB 1CGUA 1MI5A 3BP5B 2JJUA 2QQQA 3N1GC 5I66A 1QSEA 5FAAA 4ZFOB 1S7RB 3GHEL 4UDTA 4XT1C 1NAML 4MAYB 5K9KB 1S3KL 2XTJC 4K8RD 4M61B 4OGZA 4PJDF 1S9YA 1OAYH 3HRZB 4Y19A 1HK6A 1U91A 3PWLB 4URTB 1U3ZA 2FHCA 1G7LA 3BZDA 1UB5A 2R23A 2W0FA 3MRMB 2PO6D 1B6UA 1JHTB 2JB6A 3LEVH 2OLDA 2VWEE 4I18C 3PABB 4WFGD 2W9EL 4G8EA 3UTQA 1E27A 3RL2A 5JOFB 4L8SA 2GUOA 4ZFFB 2XWJA 3QIWA 4MNHB 5FM5O 4XH2B 4JFED 5DEFB 3QXWA 3TPKA 2ED7A 5FM4A 3P4MA 3WUZA 3EDEA 1F42A 1KCVH 5TF1H 6FABL 1DBAH 3HPJB 4NQVA 3V6OE 4BFBD 1MCKA 1XT5A 4H1LH 3QEUA 1A21A 1S7SA 1AGBB 1EAPA 2K1MA 2OI9C 3O9WD 4X6EA 1T5XB 4YHNA 4ODSH 1OB1A 4RQQA 2BVOB 2WP3O 1FVEA 1K8IA 2UVFA 2A9ML 1CBVH 5EA0H 3SDAD 1YEJH 2DYPB 1U95A 1KB5A 2CSPA 4KMTL 4G9FB 2I60L 1J11A 9CGTA 4MXVF 2EDOA 3IYLW 5EIIA 1S7XB 2AGJL 4NFBA 4JY4A 2MCPL 1Q9LA 1YEGL 3RGHA 1S7UB 1IAKB 1KB5L 2B8OT 3TBSA 5DUBA 4U1MA 3WLWD 5B39G 2E8ZA 2GIYA 3PDOB 2XIDA 3MA7B 1X5XA 2ADFL 2O5XH 3CUPA 1DVFB 1CVSC 3SPVB 2VITA 4KTEH 2HFFA 1A1MB 1KJ2B 5ERWA 4PJBA 4F9LA 3KYNB 1NMCC 3P4NA 4HUNB 4Y5YC 3SE9H 3H0TA 3ROOB 1I85A 5GGTH 5DT1H 2NY0C 1A6UH 4NRXB 3TJHC 3BKJL 3M8OL 4NN6B 3T3MF 4KH2A 3FQNA 2H9GB 3VGBA 5CUSL 5ACLA 1A7RL 3CU1A 4NO3B 1F02I 3WNPA 5HHOA 1WIPA 5HYQA 2VXQL 1WBZA 1E6JL 5DRZA 5I73B 2HFGH 2XXCB 4WWKD 4ZXBC 4YFLI 3MUGA 3QIBA 4TVPD 5KSVA 2BX5A 1XIWA 2CD0A 2IQ9H 3RGVA 1GYAA 1AFVH 4PJDA 2D7OA 4KKBC 2AJYH 2P8MA 5C92A 5IWLC 1AO7B 1N26A 2EDJA 2PXYC 1P7QA 4HXAL 3WS3A 2O61B 3WSQH 4JPVH 2C3WA 4OD3L 1CR9L 3HI1A 1JZ7A 5IT2H 2W91A 4BUHA 4N68A 1IAOA 1MLBA 5HDQH 1HSAB 2GFBB 3GFUA 1BF2A 4PTTA 2VN4A 3ZHDA 2DLFL 4RCAA 4L8CA 4Z77B 4JB9H 2YPLD 3ECBA 1KTKE 2X1OA 5FYKD 5FUZL 1YJDC 4KC3B 1IGJA 3EYFA 3EBAA 3EOAA 4XPFL 4F7MA 2F74B 4LLUA 2VXUL 4HUXB 1FPTH 3ARGB 1OM3L 4YXHL 4M7ZB 4S2SA 1OWWA 5FUCC 5I1EH 4JCLA 2ZCKL 1ZA6A 3UXFA 1A47A 2OL3L 4R3SA 5GRJL 5C86A 1UCBH 1NUDA 2BC4A 5FYJL 3JWDH 4F7PB 3H6JA 5ACZB 5F9AC 2DTMH 4DCQA 4OZFG 3WXWL 5F1NA 4DN3H 2AK1L 4LSRL 5I1JH 2QSQA 1AD9B 1I7ZA 1JYWA 3VWKC 2VISA 3QCVL 1R3KA 3IAPA 2X1XR 2OR9H 5D1ZB 1K4CA 3ULUD 3UJTH 3UX9B 5I8CA 2EDNA 3RJDA 5I16A 5C0DA 1A9EA 2H2SD 4UIKH 3S34H 3OR7A 1OAQL 3LKPA 4EUPH 1OPGH 3KDMA 2PYFB 3CDGB 1QVOA 1U8JB 5E7FA 2COQA 1URLA 1FBIH 2ADIA 4M6AA 3DXAD 1LO0H 2YC1A 3BMVA 3HC4H 2QADB 4NJ9L 5LAXB 3VFVB 2C1PA 4X9HA 3W11D 3WS6C 4NC0B 5GGVL 1EH9A 5EO1B 4P59H 1WBYB 5L6YL 3BN3B 2Y25A 1G7QA 1MF2L 4OV5A 4RRPG 5GRYA 2R0KH 2XFXB 3GSUA 3CPLB 3DROA 4WV1B 4LLVA 2ZSVB 3GHBL 2YPKA 4I9WD 2W92A 3HG1B 3ULVE 1Q9OA 1MWAB 3BIBX 3OKDB 4Z18A 3O2DL 3IDGB 1MCLA 4XZUA 3DI2B 4PJFE 2F53A 3NA9H 4Y8DC 1H15A 2EE6A 5FYKE 4EI5C 2N4IA 4NRZA 5DRNA 5LXGL 4H88H 1K5NA 1WVZA 5IHBA 2H26A 2YBRB 4O2FB 2DLTA 5EZOH 4YC2B 5AWNH 3F58H 1I8KA 2IH1B 1P7HL 4Q2ZA 1I75A 3U9PL 4DQOL 4YZFE 2MTPA 4EBQH 4RIRB 3BDBA 2XY2A 5D8JH 4PG2A 3MLZL 1PEZA 4NNXA 3KHQA 1SYVB 1XCQB 2G9HB 3OB0K 4AEHH 3VRJA 3WXVL 2Z8WC 4BELD 4JAMA 1J0IA 1F58L 4LCCA 4IM8A 3MV9A 2O5ZL 3QPQD 4MSWA 5E5UB 3DO7B 4P2OD 3QH3B 1MHPL 2UWEA 4AG4H 3ULUE 3QI9C 3VXQB 5FECB 1UB6A 4FQ2H 5C07D 4JZJC 5H2BA 1I8MB 2ILLA 4QXTB 1PFCA 2AJVL 5DMKA 1TCRB 2Z31A 4W68A 2C3VA 1OGTA 4RA3A 1KC5H 3K4ZA 1DSFL 3VRLE 3MLVH 1IBGL 3DXAE 5E5RB 4MWFA 3W9DA 5EC1B 5CBAB 2NZ9C 1JV5A 4TPRH 1LO4H 1VGKA 3EFDH 3JV6B 4JGUA 3LOWA 2OP4H 3KPRE 5LQBH 1F4XL 3OG6B 1JHLL 1NGZA 1OTUC 1A3RH 3QQ9C 3DSFH 1CIDA 2IGFL 4U7MA 3WFDH 5FO9B 1NCDL 2AV1B 5DVLA 1RIVH 3BP7B 4F9PA 1F3JB 4EVNA 1I1RA 1OCWH 1BZ7A 1SJEB 1FNHA 4QCIA 4P5TC 1MFNA 5ANMA 4ZS7L 3O4LD 5GRUL 5IMMA 2D7TL 3SJVA 2Q7NA 1KENH 3VXSB 3QFJD 1GC1L 1NCUA 3ARFC 2A73A 5HHVL 2W9EH 5JXEA 4M4RA 1MCCA 2FHBA 2X5PA 4WI2A 3L3OB 3TH3T 1JHKL 4IJ3B 3VFWB 3KPLA 5IV2B 1KUMA 4P9HL 3UTSD 2EYRB 3KWWA 3D18B 5F7FA 1W72L 1W0VA 4M6NH 3ARDC 3WN5A 3VGAB 5DJ8A 2OXHA 1XGTA 4QRTB 5SWSD 3BXNB 3EJZD 3HE6D 4HEPG 3SKUD 3D2UB 3WFEH 3MRCB 4MS8D 1HHIA 2XZQL 4NWUH 2FRGP 2ZOLA 2FX9L 3BSZH 4IS6A 4TUJA 5BRZA 4U1JA 4U31A 3P0YH 2I9TA 4O5LL 3UBXB 4LDEB 4NQCB 2YEZB 1I9IH 1JZ5A 4RSVA 4JRXD 4N90D 4ZFOA 1JPGB 1DLFL 1OLZA 3RX5A 3E6FB 5DJXB 3H9SD 3UYPA 5BVJB 4TUKH 1UKTA 4GBXD 1KB5H 2WUCH 4P48A 5IW3A 1YNKL 5HI3D 1CGWA 1ORQB 5M94B 4EEEA 4ZFOL 4NKMA 5CJQL 3CFCL 1U8NB 1J1PH 1D6EB 3MRMA 4Y4HD 4OFYD 5DQDL 4WI4A 1EAJA 2BCKA 3C5JA 5FGSA 4JRYA 4OIBA 4KMQA 1KYOJ 5JOFA 3KYOA 1PG7W 1I3GH 3O4LE 4MJ4A 1FFNB 3MRRA 5EOCJ 4MNHA 4P46D 4GMSH 4CNIB 2R9HC 1JCKA 2NY6C 5EZLB 3T0EA 1YPZB 5MP6L 35C8L 4TRPL 2R0ZL 4GLRH 2G75B 3FB8B 4JFDE 1AY1L 1FAKT 2BVTA 2HMIC 1CICC 4L29B 1Q8MA 1A7OL 3FFCB 3HZYB 4YUEH 1A7RH 5FGBC 5D1XC 1IAIL 4XBPA 1HDMA 4JKLA 2HRLA 2APVA 1WZMA 5GJSH 1R5WA 3WFCH 2ICWI 3WUWG 3UTSE 3QUMB 1O0VA 4DVBB 3GI8L 5DGRA 3QUYC 3ZL4L 1BWWA 3QIUC 4LASL 5B4MC 1V5JA 3NN8B 5GGUB 3BH9B 5GJTL 3Q3GA 1T03H 3QUZD 2FO4B 1MH5B 1M7IA 2X89D 3HN3A 2Q87A 5IEKB 1S7UA 3CAFA 3UROR 1ZWIA 4NIKB 32C2A 3I02A 5BOZG 3X17A 3UJIH 4Y8AA 1CQYA 1TZIA 1WAAF 5DD6B 3WKMH 4JRXE 1JNHA 1CF8L 4YLQT 3OX8B 2CLRA 3NCJL 1LO5A 1NBZA 1DQTA 4TN9A 3VFMA 1KFAH 4QHUB 3MJGX 3VCLB 5HHNA 1JGUL 5FUZH 2X4OB 2GK0A 1RU9L 2E9WA 3QDGB 1ZEAH 4HFUL 3WDJA 3IKCA 4NDMA 4N0CD 4OKVB 5DZNA 2ICEB 3C6LD 1A6AA 4OD2B 3FB6A 1H9VA 1H0DA 1FYTB 1HXYA 1KJ2L 2GT9B 2ERJC 3AMLA 1AE6H 4EIGB 4K94H 3VD9A 1EMTH 4EKXA 2F19L 4GXUN 2ZSWA 2WBJC 4NWTH 3S36X 2LVEA 3LHPH 1RUAH 3QQNA 4NN7C 4UAOC 5FB8B 3MXWL 1YDPB 2FB4L 3QCVH 2KZ1B 1TTUA 1SJVA 4NZUH 1X5ZA 2AV7A 4WGVB 5DJ0B 3QWRD 1C16B 5EIVA 4ZYKA 5DYOA 3FRUB 5B3NA 2A6IB 3TN0B 3UDWA 3OR6B 3LEXA 2MMXA 2F54B 3MRLB 4OFKA 4YX2L 3VG0H 1CI5A 1UVQA 3MBEC 3OAYH 2V7NA 3LMJL 3RIFK 3LV3B 1KXQE 4LLMB 3OKLB 3J7HA 4QHKI 4JPKH 1G1CA 3A0OA 4EN3B 5EU6D 4KPHH 5DTFB 4OTXH 1UM4L 1FFQA 1X7QA 4LCYB 1HSAA 4WHCA 4LARH 1JTOA 1UWXK 1MEXH 3CFBB 4AQOA 3SKOA 4K55A 1ZLUH 1ZVYA 1F90H 5L6YH 2K7QA 4YGAB 5J57B 5IHLB 3MRJA 4JQXC 1ZGLA 1C1EH 2Z91A 4JN2A 5JA8B 5KSBB 2VH5L 1A6ZB 4YPGB 2HRPL 3UPAA 3ARGA 2YD1A 4F58L 5I8OH 1ZS8B 4G6JH 4RDQG 1JF1B 1U2HA 2IBZX 5TE7H 4XCCL 3MRKB 3RKPA 4Z7WB 5IHUL 4JM4H 1N0XH 2N7AA 1J8KA 1UWEL 4L5FH 2V5MA 3O8XD 3PL6D 1DTUA 4R4NC 5CD5C 5DEGA 4XP6L 4WI5A 5F89A 1U8MB 1UC6A 5D7LB 2NNAB 1EPFA 5F88A 1PSKH 1A02N 5E08L 3W0WD 2APFA 5HPMA 1W8OA 5F7MC 3U4EA 4BSJA 1NCNA 1WAAA 3PGDA 1N3NA 3GK8L 4GW4A 3GIVB 2BNRE 3CDGA 1ZHBB 1UACH 4GRLD 1MHPH 3JWOH 5F7UA 1HHJA 3PWPD 3GEWB 1FZMA 1IC7H 1R3LA 4ZAKB 3HKFA 4TQEL 2P49B 4HKBA 3RAJL 4PD4J 1NDGB 1JWUA 5E8EB 3T0WA 5EUKB 1U8HB 3CC5B 1FV1A 3BQUC 4AIZA 3TBVB 3K7UA 4WV1A 5IESL 5EU6E 3OKOA 4BQBA 1S9VA 5CP7A 2YD9A 3ZTNL 1WCBB 5C0BD 4PUBH 4Q9BA 3GIZL 3MOQA 2WUBL 5D1QD 4EQ2A 2WLYA 5DHVA 1V3LA 1A6WH 3JWNC 4NC1E 5CGTA 5AAWA 3CH1B 1RZFL 3DBXA 3RVXD 4FG6D 3CNKA 1GVIA 1T66D 3RIAK 2NY1D 4P4RB 2O26U 5EU7C 3TYFA 3HFMH 1MWAL 5EO9B 1CZ8L 3F7YB 5CAYB 3HNVL 2ATPB 3D85B 4NYLA 4JO4H 5T1DH 5D7KE 2ORBH 4MAUH 5KS9E 2R2HA 1XF1A 4WNQB 4GXVL 3HI5L 4PBXA 3DV4A 4ALAL 4XVTL 3ARVA 1XCQA 2ZKHH 1OGAB 3A67H 4E41E 2ZUQC 5HHVH 3Q1SL 1OTTD 2FR4A 1G7PB 2ADJA 4C56B 2DWEB 3MRGA 3UEZA 4WU5B 2ZG2A 5GS1B 3DO7A 5B21A 3TJEL 1PAMA 1JTTA 3OKEB 2EDWA 4O2CA 4WEBH 3FQXA 3W0WE 1A14L 5CP3A 3WD5L 3RY6C 5FECA 2MQCA 4BSVB 5HYJB 1GCFA 1Y18B 2WIIA 4GFTB 2A6JA 4HC1A 4DKFL 1YPZF 4FMKA 3AMKA 4R0LB 4HWBL 4KJYB 2H6PB 5CILH 3QZWG 1U93B 4PGBB 2BRRL 5GGQL 4PJHB 2B1AL 2W0PA 5CZXD 1B2WH 3D48R 4XPAH 4PJ8D 4MQXD 3BWUC 3O4OB 4RGND 3QPXL 3UZEA 4DGYL 4HBCH 2OS7A 4MNGB 3SDAC 1I4FA 2F5BH 4RFOL 5FYKU 4C83A 1VFAA 4YDJA 3ZKNC 3HCVA 1YNKH 5F7LB 2EDEA 1B4JL 4ZTOH 5FFLA 1K4DB 3SDDD 4MDJB 4OQTA 2EYSA 1ED3B 1UENA 1AXSA 4PYHA 4UINL 4HS3B 3QCUH 2ZUUA 1IGCH 5KSAA 2CDGA 4ACPA 3SCMD 3V4UH 3WJJC 3QEQD 4OQTL 5E8DL 3H3KA 4UT7L 1TDQA 1WCQA 4WW1B 4I8DA 2BY1A 4TRPH 2R0ZH 1AC6A 1FFRA 1FZOA 1FLTX 3RDTD 1A1NA 3SO3B 2AI0L 1Q38A 1J05B 4WO4B 1SEQH 4JO2H 4Y89A 1LDPH 1ADQA 1GZQB 1J10A 3DX9A 4AJ0A 4ZUTB 5ACMA 4I0KA 1YQVH 2YZ1A 4PTUA 1F2QA 4WTZA 2I27N 1S9XB 4NRYB 4AEFA 1JTPA 1ZT1B 1MIMH 1FNEB 4Q6IC 2XRAH 5D2NA 4YHML 3EOTH 1CFVL 2BNQB 5A3ID 4G43A 3KG5A 4WHYG 5M7QA 1SBBA 1DN2A 1FZJA 3S5LG 4DOHB 1NEZG 3HUJE 4TTGA 2M8XA 4LVNC 4PJ5A 5C6WH 3S36H 3QXAA 1TQBC 1I9JL 2FCBA 4PJIB 4XC1H 3WLBB 3MYJB 3F7PC 3SEPA 3MJ8A 4ZSOE 5DMYA 1DQQA 2P42B 1YEFH 1IE5A 4Z76B 3C60C 5F7DB 3BFOA 5DJCA 1G9NC 5BO1H 1TXKA 2APWA 2CUMA 3K3QA 3SKNB 2CLZA 4OZIB 5FKPB 4RGNE 1WBXB 3TT3L 1CF8H 3RWHB 2B5IB 3S98A 1H5BC 4NO0B 1BZ9A 4E9LA 4PJ7E 4XNQA 1QLEL 2QQLH 4EQ3A 2MKWA 3S8WA 5IOPB 1XR9A 4PRPB 1HWGB 1TETH 3S4SB 1J1XL 1FFNA 1FZKB 3LQAL 5DC9B 1Z9SA 5IFAL 1MRDL 1YPZA 1YMMB 1F8TL 4BQ6A 3E0GA 2NTFA 4L4VE 1A22B 5INDB 3O6FA 4JANA 4YDIH 5E8PA 4ODUA 3GMLA 1AQKH 1PZ5B 5BJTB 4QF1A 2H41A 1E28B 5A43C 3FMGH 2DF3A 1T1ZB 1J0KA 2R69H 3TVMC 1AKJD 3WIFA 3QEQE 4X98B 1XF5B 4V1DA 2CMRL 3F12A 3MNZA 5FUOH 3MV8D 5HYSB 1BIHA 4FFYH 2MPAH 1G7IB 5CGYD 4MZ2A 2GJZA 4RISL 4G5ZH 1T1XA 2QKIA 5T1KD 3E8UL 4WFFD 4U0QB 2YWZA 3UO1L 3LMJH 4X7SL 1ZVSA 5IMLB 3QUML 2VYRE 2IBGA 4BKLB 4D9LH 2NW2A 4XCFH 2BVYA 5I2IB 3SE8L 2MCG1 5T3ZH 2AXHA 4NN5C 2EE2A 4ELKB 3ARBB 1UWGH 1RIUH 2Q86A 1NGWA 5CZVH 2Q8BL 1JBJA 3OHXB 2AAVA 2J6EA 5CKGA 5D5MB 1Q9KA 3VCLA 4QRSA 2NXZB 2VLLB 2R56H 5MENE 4K71B 4XNUL 2X4OA 4YO0B 1IAII 3W9EB 2WWKO 1R3JB 4O4YH 5EU3B 2HRPH 2VXTH 4YDVB 3TA3A 2X09A 4TTDD 1I7UB 5HY9A 3TPUB 2GT9A 3T4YB 5FA4B 1TPXB 3B2UD 1J5OH 3UYRL 3QULB 3SDCD 1DBBL 4JG1L 2DQTL 4ZUSB 2NW3B 3R1GL 2E7MA 5GS3A 3FO9B 2XWBA 1AR1D 3LRHA 5HGAB 5FB8A 3HE7C 1YDPA 3D39A 1CFNA 1UQSB 4LOUD 4EIZC 1INDL 1Q94B 2CRYA 3D0LA 4JHAH 1NFDB 2FLBT 1DQJB 3KGRA 4XXCC 5IR1B 3X11B 5AD0B 1SHMA 4JFOB 3MPCA 5DD3L 1MY7A 5E8NA 4QTIH 1JWMB 3MV8E 3GK8H 3TEUA 5EC2A 4ZFGL 2V5YA 3H42H 3S88L 1JGLH 4KK6D 1U0QA 2NPLX 1DCLA 3AUVA 4JREC 4IBLT 2BOCA 5C09A 3WNKA 2FJFB 1HHKB 3U46B 3RAJH 5I76B 4OLWH 3AREA 3LZFL 1NCWH 2EKSB 1ORSB 4YQXL 2E7CA 1EEQA 4O58L 4JFHD 5DA4A 1RURL 3GDBA 4UIMA 4ZDHA 2AXGA 2YXMA 1OP5H 1PKQB 2EO9A 2CIKB 2A38A 4LHUG 1N5AB 3H7BB 4K9EC 1ZLUK 3RVWC 2VUYA 4GO6B 4ZQKA 3ZSSA 1BJ1H 2HKFL 2W65A 1WWCA 4I2XB 2VUOA 3MRKA 3OTTA 3C9NA 4GMTH 1CU4H 1ZK9A 4LCWD 1JVKA 4LKXA 2VE6A 12E8H 5DHVH 5EU5A 3NA4A 2A9NH 4L3CA 3T0DA 1LEIA 2R0LH 4L8BB 1LEGA 2KKQA 1TNMA 3OG4B 3ZYOA 4HFWA 1WTGT 3VWJB 3BO8A 2V2WB 3RWIB 1S7TA 5L8KB 3SY0B 4M4PA 1G9EA 1CXIA 2AK4D 4GOSA 2ZUWA 1B0WA 5C0JB 5DJ6A 4XVTH 2N56A 4U1LB 1XGPA 2XQYK 3NPZB 3UZVB 3V7AE 2WNGA 5C08A 3K2UH 1CDUA 2VLRE 2ZJSL 2H45A 3KPPA 4PLJC 2YA0A 3KPNB 3PHQB 3BKCL 25C8L 1R3IH 3IU3A 1QO3B 4ELMB 4QYOB 3TJEH 1OW0C 1OL0A 3BKML 5SWZD 5K9JL 2LTQB 2N7BA 4ZAKA 1KB9K 2P44B 3BMWA 4G8GA 1U3HD 4F7TB 1PLGL 3K0WA 5FYJD 3MCG1 1YEHH 1YNLL 2VAJA 4J3XA 4R7NA 4UBDC 3WO4C 1T7YA 2D7PA 2Q3AA 4XPBH 5CSZA 1GGCH 5CP3H 2CKBB 2D3VA 2ITCB 5MERB 3DWTA 1REIA 2VC2H 1KBGH 1WCBA 3AY4C 2VNCA 2WINB 3MGAA 4M8VA 2B1AH 3HE6C 4X9IA 1IGTA 4MS8C 1QSFA 4HC1H 2RFXB 1CD0A 5MI0B 3CU7A 3S37X 1BX2A 4DGYH 3GSVA 4RBPK 1M05A 4PJAE 1MCEA 5EO9A 3JBG7 7FABH 1SVCP 4N8VG 2IAMD 4FXGB 2P5ED 4OZ4B 4LSPL 5FDYA 3O6KL 5I71C 4NGHL 3SGJC 4PB0L 5T5NF 2E27L 2YK1L 2VQTA 4HBQA 1R0AH 2X40A 4YBHA 4G9DB 3QHFL 4DN4L 4WFHD 5FCSH 1MCQA 4GW1A 5GIRB 1SQ2N 4OQ1A 1IQWH 4KUCD 1XZ0A 3I3BA 5L2KA 2DOCA 4D3CL 2DQEH 1F3DH 1J8HB 1NC4A 4OQTH 4XC3L 5E8DH 5I9QC 2AK4E 2FX8L 2PF6A 3V2AR 4XHJC 2EDLA 3ULSA 3VXPA 4BSVA 2AI0H 1YY8B 4JDVA 1XGQA 2IANE 3SBWA 3G6AA 1KLUA 4NHCH 5TDOA 1PBYA 5E00B 3LH2H 3LKSB 2MQ3A 4X5WB 4X0KB 1N5YH 2YUVA 2FJHA 3R06B 4H8WC 5K33A 3VXRE 2OTWA 5SWZE 1BM3L 1U6AH 2P24A 3ILPA 4J1UA 1ADQH 4CMHB 4F7CA 2B4CL 3LS5L 1W2KT 4FQCL 2EDTA 4P2QE 1PEWA 5BZWB 1FNSL 1I9JH 3T3PE 1GIGH 2QR0B 1MJ7L 2XA3A 1HH9B 1ONQA 2YD7A 4HKZB 1J0HA 5HVHC 3K8MA 2RHEA 5BV7C 2DS4A 1MFEL 1U8LA 2ZCHL 3MCLH 2D31A 1A7BA 2CKNA 1LK3L 5A2IH 5E7BA 1JPSH 5E1AB 3LD8B 2LQRA 1A6VH 2HTLC 2VZUA 4ZNEA 3RWJB 1VESA 1S9KC 2GEEA 4XMLH 1OAUL 1T1YA 4OGYH 2UZIL 3MJ7A 5IFHH 1J1XH 5IFAH 4AIOA 4DGIL 1N8ZA 4WW1A 3RTQB 4G7YH 3B3IA 1F8TH 1MHHB 3SGKC 4WUUB 3RZCD 3RL1A 2J7LA 3QDME 4WO4A 1IFHL 4IOIA 2AJXH 2X1WL 2HN7B 2FNBA 1YY9D 4ZUTA 4HAGA 1MFBH 5F7HA 1H3XA 4S10A 5T3XH 4LVOC 5E9DE 4R9HA 2AJ3B 4KRNA 1HCFX 2BNQA 3ARYA 3BPCB 1X5JA 3RU8L 4CVZB 3DVIA 4XRCA 2BVQB 4RMQA 1MFCL 5D2LE 2C3XA 2Y9RT 3ARQA 1Q0YL 5FYLE 1MCDA 3PJSA 4FRWA 4GT7A 3WLBA 1X9QA 4ZD3L 4M7LL 3DECA 1ZHKA 4YHKL 2LU7A 1T2QH 2F8XC 1A5FL 1BQSA 5TH2B 2DTSA 1WQVT 4XP9H 3BPNC 5HGBA 1LDSA 3FZUD 1C5DA 1WBXA 1Y0LB 3DMMD 4JPWL 2ITDA 1VA9A 3BAEL 4OFIA 2Q8BH 1BQLH 1X4ZA 3SE4A 1J0JA 2VSDA 5C0ND 4NO0A 3VI3E 5E6ID 4K07A 5KAQG 1MSPA 4ZS6C 1NL0H 5JUEL 1F5WA 3FTGB 2GTZA 4LSDA 5IP4A 1FL3A 3PP4L 1PYWB 3CK0H 2ZUSA 1BD2A 3PP3H 3VWKA 4X6CA 4D0CA 2J6EH 2R1WB 3SE3A 1BREA 2J88L 2NYYD 4Y4FA 3TBTB 4DEPB 2L7JA 4PJEF 4Q0XH 4HIJB 4LRIC 2GSIA 4GG8B 3NCEB 3VE0A 5CBEB 4P2RA 5BJTA 5D7SL 1WT5A 5BMFL 1T1ZA 5AZ2L 3KXFA 1FFOA 1I3RB 1KN2L 3NCYP 3QDJA 4I0PC 4I5BB 4MAYD 3GSXA 3PWUB 3UBXI 2AABL 4LGRB 4C57C 1A7PL 4P23B 4LK4A 2VN7A 5CJBA 3WS6A 1F6AB 1RJLB 1HYSD 2DKUA 4I4WB 5D93B 4K2UH 2FWOA 1MCWM 5CHNB 5F7EL 4JG0H 5CS7A 3MXVH 1OP3K 3ZKMD 1II4E 4X99B 3F7QA 5I1KH 1IKFL 3ISWA 2C4FU 4X9BA 4HXBH 4F80A 3S35L 4M5YH 5ISZE 3F5WB 2MSPA 5IG7B 5E2JA 1CYGA 3MLXL 4L3EA 5F3BA 1QA9B 4EI5A 3V6ZA 4YQXH 3DETD 3WEXA 4ELMF 2K3TA 1I8LC 1RURH 3MQIA 1BAFH 1D5XA 1A1OB 1GOHA 1HH6B 3OXRA 1R3JA 1AD0A 1M7XA 3Q6GL 3ZE0F 4K7FB 4JFYA 1H3GA 1MFDL 2X4UB 4HMCA 3MRFA 1I8IB 1IM3B 2VABB 3P9LB 5D1QC 1X6NA 1FVDB 3MV11 3DV6B 5HDOA 4NUJB 5CWSA 4ZUSA 3TNNA 1EHAA 3F65A 4TNVF 4NPYA 5C70A 1AIFB 2VDMH 4Y5XC 2DMKA 3UC0H 2PO6B 5J11B 4HIEB 1B4RA 1NGXB 1OSZA 4OT1L 1UQSA 4TNWF 3S37H 4XB8A 5DDHB 1L7IH 3DPBA 4I3SL 3UJJL 4QGTA 5B38B 1S9WA 4Z7NF 2NY3B 1DVFD 2ZCLH 3S35X 4JFOA 4YBLB 2VQ1B 2ZJSH 1ZVHA 4HV8A 1M71B 1BLNB 4PD4K 4N0UE 5FV2A 3BKCH 2CDEB 5BXFB 3VXNA 3MLSH 3GI9L 4Z0BH 1D9KC 5ICZA 2FJFA 4QY8B 3ZTJH 5K9JH 3K1DA 1PLGH 5EORH 5E99H 1OWRM 5E8OA 4C4KT 4JJ5A 4E0RA 3RNQA 4JHWL 1MREL 3TCXA 3OMZA 4PJEA 1JZ6A 3JWDC 4X7DC 1QFUL 2FGZA 4JDZA 1ACYL 1PKQA 4P5TA 5TQ0H 3RP1A 3V52L 3QUXB 4FQLH 1KIUA 2FEEI 4MA3A 4H5SA 3Q5OA 2Z92B 4DWHA 5I1IL 3WV0A 1GZPA 3GKWL 4YJZL 4R4FL 3VI4E 1AO7D 1FDLL 5GS0D 2X05A 4R7DB 1RHHB 4HQQL 3MUJA 1S78D 2ZPKL 1Z3GL 3L9RA 5C0RL 4P2YA 4Y16C 3GUTA 4LSPH 3VXME 4XI5D 3PXJA 2H1PH 4OZGF 1FC1A 2VDLH 8FABA 4IRJC 3G5XB 1RJYB 2IMNA 2W60A 2E27H 4LVHC 4HUVB 4HK0B 3S6CA 4KK5C 5FM8A 5JLZA 4X4MA 4P4KC 5EOCL 4CGTA 4DN4H 4ODXA 3ARDA 3BGFB 4W6XB 2LU4A 2PTUA 2RCSL 5C0CD 1NUNB 4NCDA 5T1MA 1BBJA 5HI5D 4YHIA 1JGVL 3D1MC 3MLWL 2ZNXA 3T2NH 3LRSA 4PFEA 2NR6D 4HDIA 4J8RA 3HNTH 2BDNL 3L7FB 2BMKA 4WWKB 4X7CC 3DVNB 4H1LG 2CRMA 3M17A 1BVKB 4JKWA 1MUJA 1U8IA 4MNQA 1ZLVK 4LP5A 3IFNH 1F4AA 1WGOA 3B9KB 1LNUA 5BCAA 3QO1B 5D7JC 2HT4C 3LKQB 4IIQC 1I9EA 1KIQB 2PW2A 3VFGH 3LS5H 2IALB 2CKBL 3AAZA 5D1ZD 2IH3A 2CGRH 3OXSB 4JGMA 4LLAA 2GJ6E 1KJ3L 2XQBL 1FNSH 5C0AE 4RWYL 2EH8H 3G08B 5ETUA 5FO8B 2AEQL 2HJKB 5JW4M 3L3DB 2MFNA 3UAJD 3MUHL 4PJFB 2ZCHH 4G6KH 3WCYA 3KLAB 2ESVE 5IBTH 2VTFA 2AXFA 4RZCB 1ZTXL 1LK3H 1AO7E 3INUH 3SDXF 1CICA 3VFUB 2O5YH 3CMOH 1HILB 3RHWK 5GRZA 3TZVC 5HDBE 5EO0A 3PNWA 3EYOA 4HLZH 5J9PA 4S1RL 3C5ZA 3K80A 4EDXB 2LE9A 2VDOL 2WM0A 2UZIH 1X5LA 4R2GB 1Z6JT 4GW5B 4LF3A 3QQ4B 3PWVB 2PCPA 3HRPA 4MDIA 3MCKB 1T22B 4FFZL 4RAVA 2VR9A 1RI8A 2DQHH 3DX7B 4OLZH 3RNKA 5HYEA 3PIQB 3UYOD 3QUYA 2DQIL 3QIUA 4XXDA 3BUTA 4QWWC 3U36B 1ZSDB 5C0CE 1EFQA 4ONFL 4EDWH 1MHCB 1A2YA 1E4KC 2CR6A 1P9MA 1WITA 2AQ3A 4XWGH 1EHLH 3HR5A 3TBWB 2DIAA 5B39B 1DBML 2YD6A 1HINL 2BVPA 3NAAL 4R8WH 3QNYA 1MFCH 5TDNA 2CQVA 4OZGA 1W0WB 1Q0YH 4QHMA 1QTYT 5LBSL 5I8KL 3ES6A 3QQ3A 3OF6D 3TO4A 5TQ2L 2QR0A 4FQXB 1AC0A 3KPRB 4PJ9B 4NKIH 5E1HB 4FZ8H 4HJ0D 4XTRD 4OCXH 4HULB 4HUMB 1DFBL 5LCVL 3QZWA 5ECJE 4OGAC 3T09A 4JPWH 1ZANH 4L8SC 4M7KH 4OCSL 3QIWC 3WE6A 4GUPA 4KWUA 5K59E 3BX7C 1WISA 1MAML 3IT8D 3X14B 3KJ6L 1JMZA 3OKNB 1EEYA 3L5WB 1RFDH 2WBJA 2AEIT 3DSNA 4WDIA 3B6SB 2QJDA 3ME0A 1J88A 2X41A 4LPXA 3MTRA 5C0GA 5GHWL 2J88H 4JFQA 3VH8A 1PDKA 1RVFL 1YN7B 4QOKE 1DQML 4F3FA 5LGJB 4QHLB 5JR1H 5D7SH 1EVUA 3DX6B 2X4PA 2OTUB 5BW7A 5JDJA 4WI7A 4NFDA 2WP3T 5GGRB 1IEAB 4XPTL 5BZDA 2AABH 3VG9B 2ICWJ 5KSUB 4HH9A 5E4EB 2B2XH 4MGXA 2CR3A 3D5OF 5IJKA 2BVQA 4N1EA 4ODVL 4K3DL 2R2EB 4Z7QF 3FQUA 3KYKH 4LOUC 5FYJU 4NZTH 4Y5VB 4EUPG 4Y4KB 5ITBH 3NGBB 1I1AB 3SDXA 4HZLA 4Y2DB 2HA1A 3W82A 4MD0A 4N9OB 1GGBH 5TH2A 3SOBL 4X4YA 3FJTA 1QQDB 5I17B 1CLYL 5HTSA 3GSNB 2EIEA 2HVJB 1TENA 4F9LC 1A64A 2NLJB 2OZ4A 4I77L 3BYYA 3SQOL 1H3PL 1IGML 2HLAB 3V0WL 4Y88A 2NXYC 3S3PA 4M93C 4X8XA 5J6GB 5JHDD 1T0MA 4HG4K 3U6RA 3JV4A 5DMGD 3IGAB 1GOFA 4OZFB 1AHWB 3D2UD 1G7HA 5KW9H 2XKNA 3LKRA 3L3JA 5DR5L 2K7PA 4O02H 4HIJA 4NQDE 2D9CA 2A1WL 5I1LA 2ZP0T 5H8DA 4S1SL 3O4LB 4NQCD 5CGMA 2MQ0A 5EIQA 1NBYA 5DUMH 1AXTL 4C58B 2P48B 4Z7VE 3QIBC 3TCLB 1XIWC 3P30L 3EOBA 3RGVC 4HS8L 1EEZB 4LLWB 4JFDB 3A6BL 3MRIB 3O45B 3KLDA 3P73A 4KHXH 3O2WL 4OT1H 3VXTB 1T7WA 3V6OA 4LRNH 3KPSE 2PTTA 4RA0C 3P0VL 3VXUE 3LIZL 2HWZH 5ESQB 2V7HA 3SDYH 3T4AA 4I18B 1MOEA 4APQD 3PWNB 3PWJA 1KCLA 3QWOB 1U8QA 2JIXA 1FNFA 2RIKA 3BQUA 3SGDH 3RPIB 2DL9A 4FNLL 4F7EA 1FHGA 3EZJB 3D25B 4QHKJ 2BRQA 1J7VR 2XNAB 3UTSB 4Z7OE 1WZKA 2I9LA 2OQJB 3I2CH 5CMAB 2D4FA 4YHZH 5ITFB 3QJHA 3RVTD 5DVOA 1JJUA 4JO1H 4G8FA 4K94C 3CLFL 2DLIA 4ORZC 1MREH 4YAQA 2X7LB 5HHMD 3FFCD 5D6CB 2FATL 5IMKB 2OI9B 4KY1H 5F8RC 3I75B 1A1OA 1A4KA 5I0DA 3GJFA 3G9AB 3FB5B 1D7FA 2Y5TB 3CX2A 5F97E 1T4KA 2C7UB 5GRXG 3H2WA 1FLRL 3BPLC 2F58H 1EFXB 4GBXB 1IM3A 4HUWA 5JHDE 4NO5A 1KCUH 5JZ7C 2VAAB 1E4WL 2DAVA 2DQJH 2R0WH 2GI7A 3BP6B 2BHYA 3AU1A 4Y4HB 2PO6A 4BFGA 3EKCA 2MOVA 1I7RA 1NGXA 3TM6A 2VLJB 4IMLB 4U1HA 5J3HC 3ESVF 1NCAL 4PJXE 1RUQL 2D03H 1UH3A 4MQ7B 3RWFB 2R1YA 2ED8A 3ULVF 2XY1A 1KPRB 1DN0B 1BQHA 4P46B 2BFVH 1PW3A 3PGCB 4JFEA 1QEWB 1P4BH 2KQNA 1KN4H 4ZUUA 2DBLH 5LWYL 5E24E 1R5IA 1D5MB 4PJFF 4YHOL 4Y5YB 2X4RB 2VQ1A 1F6FB 5EN2A 2Z93A 2A74B 5KVGL 1G7JB 1BLNA 4M9OA 3LPWA 2NY0B 1NC2B 3MBXL 2WMPA 2HJFA 3RRQA 1JGVH 1AGDA 5HJ3A 3RBGA 3NFPA 2EIZB 1FYTD 3O9WA 3L3GA 1Z5LA 2BDNH 5DJYA 2APBA 4YZFF 4HMDA 5FV1L 4PG9A 1JWSB 3GNMH 4TSBH 2JK5A 3BKYH 3SDAA 5FCUH 3QG7H 1R3HA 4TSAH 4ZXBB 1VFBB 5E56A 4POZD 4G42B 1MLCB 1YNTB 3B9EA 3DX8A 4OJFL 4EXPX 1NKRA 5E2UH 3F7VB 2FZ3A 2D0FA 2CDFB 1T7ZA 2PXYB 3ULUF 5HHME 5A16B 5F9JA 1HEZB 4NO2B 4R7DA 4OUUB 5SWQA 3TN0D 2UV3A 1MCSA 2F54D 2QTEA 4YEFA 1KG0B 3FO2B 3MLYL 3E2HC 1CLOL 4FQQB 1BEYL 2AEQH 5DQ9A 2YD8A 4PG2C 1WC7A 3O3BB 3JWOC 4RNRB 2UZXB 4PRAB 3G5XA 3VRLF 2XN9E 4EN3D 4LHUA 2HJLA 2DLHA 1PY4A 3U2SA 1FFPB 3L5JA 1ZTXH 3P77B 4JCMA 5MEPB 3ZE1F 4LCCC 3GMPB 1MY5A 4NJAH 3C6LB 3U4AA 1QKZL 1AI1H 3WFHB 3CGTA 1S7VA 5IGXH 3U9UB 2NY5L 5JXAL 1GAFH 4M3KB 2Z31C 4KRPB 4OI8A 1NLBL 3OKYA 2X70B 3MRDA 1NANH 1PD6A 2BNRB 4WWKA 1D5ZA 2DQIH 1UCTA 5JMRA 4KKCD 1M6OB 3ILQD 4PRNA 1DE4A 4R96A 4AENA 4MA7L 3FAWA 4JFPA 1L9MA 3U82B 2OM5A 3ZT5A 4LU5H 1UXWA 4ETYA 1TVBB 3G5VA 1DBMH 3GSQB 1HINH 3HHRB 3STBA 4K7PL 1KIQA 4F9PC 1JUFA 5D7LD 4BH7A 1JPST 4NNPH 1NAKL 1ND0A 4LSVL 1GC1C 4JLRA 4FQHA 3OXSA 4U6VL 5EU6B 3FQWA 2YPVL 5JOPD 1QP1A 3BUYA 4HGMA 3HPLA 4ORGB 3KPTA 2BNUB 4L9LA 3FO0H 5AUMB 3MNVA 4LKCA 2P7TB 3V6FB 1FCCA 2YPLA 2I07B 4HPOL 3MOBL 1YECL 4PJFA 4WHTA 3GRWA 4JJHA 4YNYA 1DFBH 4M62H 5F7NC 3HAEA 2F5AH 5JXEC 3ULVL 4G6FB 2GTWB 3C2AL 1MJJB 2VL5A 3VFUA 2L7UA 1WFTA 4FTVA 5J4MA 1MAMH 3CSYB 5FYKL 1DANU 3V5DA 1EGJA 1FNGB 3M1BB 1RV6X 2G5RA 3I6KB 4XGZB 3GMRA 2L4OA 2HT2C 1KIRB 5KS9B 1NDMA 2HFEB 4PRDB 3ROLA 5FA3B 2BSSA 5TDPA 3MCKA 3WN5C 5L9DL 3WUWB 3OGOE 3MMEB 2UYLA 5GHWH 2YHGA 4MB5A 4E41B 4PRHE 5ICYA 4O9HL 3OL2A 4XMPH 4JQVA 4JKMA 4E42B 4K7PX 3UCRA 3U36A 3BE1H 5F1OB 2N1KA 2IFFL 2R4SH 2DN7A 2NY7H 5C0EB 5KSBE 3N85H 4GG6F 5C8JA 3TP4A 2FBJL 1VB9A 3D85D 3DVFA 4OI7A 3FO1B 4P5KB 4ZUWB 3MODH 4ZPVA 3VFPB 3IF1A 3ULUL 4B7LA 3C5SB 5I1HL 5HI4D 4ODVH 4K3DH 4Z7WE 2JCCF 2V9QA 3DXAA 1IQDA 3QP3A 1UJ3A 3BN9D 4PRID 1PKOA 3FCTA 3X3FH 1OGAD 3KNBB 1S7WB 1JGDB 3ZO0A 3C09B 4YWGH 4C56D 3QI9B 1NMBL 4NQXA 4NKOB 3QHZL 3B2VL 2X4NA 1MI5E 3GBNH 1X3DA 1QSEE 5F7YC 3PE9A 5JIPA 4UV7H 3VA2C 5E70A 1H3PH 1KEMH 2DJ4A 5INCB 5TPWL 4MD4A 3V0WH 5HYJD 4XNXH 43CAA 5DSCB 4LFHG 2X4SB 3VDCA 5IK3A 4OM0H 1P5VA 3N1FC 3HC0A 4MX7A 5IW1B 4M43L 4TVSa 1XMWA 4CN6A 2NY1B 2OZ4H 1PQZB 4LAQL 1BJ8A 4PV9B 1HZHL 4P3DB 1MNUL 1EUUA 3RWDB 4NP4H 1K6QL 4JDTL 1P7KB 2IJ0C 1AXTH 5CSGA 3KYMB 1KTDA 3A6BH 4OLUL 1MCNA 5A2KH 4U3CA 3BZEA 2HVKA 4XWOC 1X44A 1MQKL 1X5AA 3ALWA 3ARFB 2HG5B 4P2OA 1S7QB 1IT9H 4C59B 1XFPA 1ZE3C 4FNLH 5IB4A 5JO5A 1PZUB 2DM7A 3AS3A 1C12B 5C07A 4OSUL 3EO0B 3TIEA 4U1NB 1CGVA 1T5WB 4I48A 1QQDA 3HUJB 3ET9F 1A6PA 3IXTB 3BZFB 2GITA 4PRIE 4ZSOB 2QHLA 3D9AL 4OAWA 1LWRA 1BBDH 3OZ9H 4B50A 3GSNL 2OJZH 5K9QG 4XNYH 2YMXH 4UU9A 4YBQC 3X3GH 3DVGA 2CJUH 2NY2C 3LY6A 4UT9L 2WQ8A 3RFZC 4UI2A 4LBEA 5C0FB 4QNPF 1DL7L 3X13A 4PJ7B 4DKDC 1S8DA 4GG6A 1QRNA 1VEMA 4AL8L 3IFPA 3VXOB 4YDLB 5HYJE 5H94B 3O4LA 3MO1A 3GJFH 3MACL 1IAIM 2E3VA 5DJAB 1E4WH 2G2RB 4HWEL 4ONHB 4GAJL 2JCCA 3GSWA 3QFJA 4L4VB 4K8RH 3MRIA 1DBJL 5DRXB 4BFIB 1CGSL 1H8NA 4P5MB 2RQ8A 3I9GL 5F6HJ 3UDWC 5IEHB 1S78C 4F33A 1RUQH 5JORA 2P8PB 4KHTL 1E4XH 3SCMB 3PWNA 5HHOE 3QEQB 4JY5L 4V2CB 4E5XB 1KNOA 1IC5L 3ABZA 4MNGE 3LEYL 3U48A 4AM0B 2OX5A 5LWYH 5IQ7L 4I13B 3MR9A 1CGTA 4JZOB 1GSMA 3ALXA 5DHYB 3UTSA 1QLRB 2NY6B 5KVGH 2CIIB 2B0SL 4KK9C 4PRPD 1VFUA 4PJDE 3MROB 4KJWC 5SWSA 3IETA 3HE6A 1GGYA 5ITFA 1YMMD 3U4BL 1FG9C 4MCYA 1CVRA 1CFTB 1EXUA 2RGSA 4XPGL 2K9UA 3QEHB 5D1XB 3KLHC 3ARGC 4YFLF 1CD1B 4FZEH 1I1FB 2BSTA 4M7ZC 1RMFL 5IB3B 1OAXH 3WIIH 2ICCA 2X4TB 4DK3A 3FB5A 4JRXA 1YEEH 4MMZC 5JIHA 2C7UA 5ESAB 5KJRH 3WO3B 3H9SA 4LEXL 4JZNA 4GBXA 2ADGB 5MENB 3U7AA 5JOEA 1WWBX 2B1HL 1B90A 4GSDL 5K93A 1JNLL 3JTTA 3FL7A 2X1PA 2EXYC 5KVMC 5FM5M 3RWEA 4CVXA 4Q7DA 2DQFA 3MLYH 4Y4HA 4OFYA 2YD3A 2QHRL 1WTLA 2SEBA 5F8QC 1Z9MA 2CLVA 1U92B 1LD9A 5KN5A 1KLGB 1FRGL 3ARBD 4ONOA 4KQ3H 5I1GL 3WNNA 4A6YB 4KKLD 1XGYH 5I1DA 3FFDB 2QADC 4X80H 5F96H 2ARWA 2X4RA 43C9A 2A74A 2NXZD 4Z5RA 4JFZH 1HIML 4HKJB 3T8XA 4DKEL 2R4RL 4KZDL 2M26A 5HPOA 3WHXA 3HS0B 4WU7B 5GSVB 4KKAD 4OZIE 3MRNA 1RIHH 1FORL 3V4VH 4WV1C 1U8OB 3Q2CA 3NIGE 3ELAT 3VRIB 2EICA 3MV8B 2EIZA 2CO7B 1F97A 2HT3C 3ZLQC 4MA1C 1EJOL 5TGBA 3IDIA 4PJGF 4KUZL 3AC0A 5KS9F 5LGHH 2GY7B 4MA7H 3RKDD 4NN7B 4ODWB 3BWAB 3EJJX 1IC1A 3QNXB 1C5CH 1VFBA 3UPRA 1PJ9A 4G42A 3D3VA 3PDDA 4LLYA 2VERN 3QUZA 4TVPH 4YHYC 4K7PH 5T5FH 4ZTPH 2X89A 5AG9A 5BOPA 1V7NL 1NAKH 4HIHA 4U6VH 3BT2L 3O41B 1G9NH 2YPVH 3TV3H 1NQBA 1BVLA 1KG0A 5CCKL 5FK9B 3QJFA 3LKOB 4OIIH 4TUOB 4NKDB 3CJJA 1JRHL 3KYAA 5FHAL 1L9NA 1KCSL 2F53E 2YRZA 4HKXB 5DI8A 3IU4L 3MRQA 3OQ3B 4LLQB 5D9SB 3NTCL 2XA8L 1F11B 3O3EB 4FS0A 2Y06L 2W59A 1KCRL 1I1YB 3TNMB 2OJEA 3GRWH 2E7LA 1NGPL 4JVUA 1C7TA 4UV4L 1LEKA 3HAEH 1G9ML 4KDVA 3SDCB 5I30L 2Q6WB 3RI5K 2JJVA 4JRWA 3BJLA 1NSNL 1QOKA 2EXWC 4Z95H 3KPMB 5A1AA 3S5LB 3FB7A 3M07A 1EGJH 2VLRB 5CINH 2Z35A 1NEZB 4L8DA 4XCYB 1WFOA 4LSQH 1GH7A 5J8OA 3S96A 3QWRA 2YD5A 2G5BB 3HMWL 5BVPL 1ETZB 3EFFB 2UWEE 1ZLSL 1AXIB 4HT1L 1Q9WB 3HZVB 1E0OB 3EJYD 5IB5B 5BRZD 3VWJD 5C6PB 2FBJH 2EDYA 2GY5A 3JSSA 3OJ2C 5DFVD 5EUOF 3U1SH 4NNYA 4HX1A 3QWQB 4LL9A 2GAZB 4S1DC 3ULUH 5EU6A 1P1ZB 1FVCA 1BIIB 4H0HB 4BFEA 2AJSL 5KZCD 4AZ8A 3QFDB 3C08H 4XVJL 4FP8L 4GXUM 4X7TB 1V7ML 1NLDH 4LNRB 4WJ5B 4LPTA 3QHZH 1KSRA 3AB0B 4MCZB 4QXGL 4YE4H 1XH3B 4PJAB 2DI9A 3KPQB 1T0NA 3IJHB 4ODTL 1RZ7H 5LGKA 7CGTA 1N6QL 4F57L 4LCIL 3O0RH 1MHEA 1BVZA 4XPHL 1FAIL 5ANME 1HOCB 3V0VB 1J0ZA 4XGZA 1KIRA 4M43H 4PJGA 5IVOA 5KS9A 3T0ED 3ZKQD 3SJVE 4LAQH 3O8XA 3U0TB 3PL6A 5TFSL 5DMGC 4G8IB 5JW4Q 1MNUH 1T21B 3W39B 1JI1A 2FHFA 2R2BB 3FONA 2H8PB 2WW8A 5D2NC 2A83B 3W0WA 3LSOA 2AK4B 1TJHH 2R1XB 3TH4T 3REWB 4PJ7F 3HC3L 3VGDA 4X6DA 2A6KA 4ERSL 1IL1A 2APTA 3MJ9A 2IANB 4DGVH 4IDLA 5C7XL 5ENWB 3JV5A 1S5HB 1C5BL 4EI6B 1FO0A 2IF7A 2RBLA 4GRLA 4ZFZB 2ZUQB 3QA3A 4J23A 3DIFB 3VXRB 3PWPA 5SWZB 4DZ8A 3MJ9L 4M1CD 1S7WA 4OSUH 2YSSB 2GK2A 4N8PA 5BRZE 1RUPH 3EZ8A 3LQAC 4N0YL 1JPTH 4Z0XA 4U6HB 4CADA 1G0YR 4P2QB 2Q7YB 1J8HD 1UM6L 3O6ML 1XF4A 2YN5A 3L3KA 5IQ9B 1FG2B 5F70A 5C0BA 4F15C 3BOVA 5D1QA 4FFVC 1F2XK 3T77A 3OJMB 5JQ6L 1XF2A 4J3SA 3MFFA 3A6CH 3W2DH 4KJQC 4MJIB 1NGQH 3O6FC 4QHNA 1IGYB 5C71A 3CSBA 1KCKA 5SV3A 1YMHA 4UOW0 2IAMB 3EYQC 3OKMA 4XX1G 5CLWA 3FOLA 3U0PB 2P8LB 5EUOA 1S5IH 3IDMB 4ONGL 4TSCH 3CFDB 4JFXA 4PPTA 4WEUD 5I8EA 5JW3L 4Z6AT 5CIPA 3T0EE 2GSGA 4AMKH 3MLUH 1DLHB 1N64L 2CUIA 2EE9A 4PP2A 1UA6H 5F7KC 3V79C 3QDMB 1T20B 3BYTA 3CCHB 3NZ8B 2NX5D 5I15H 3TBYA 2DDQH 2H32A 3QUKA 2IPTH 4HHAB 2WAHA 3OAUH 3MNWA 1CDJA 3L3IB 4DAGL 2FO1A 1HI6A 3N1MC 4KHTH 1X4YA 1F00I 2G60H 1INEH 1NFIB 1XGRB 2CRIA 5E9DB 3PHOB 3JTSA 3VFOA 1T2JA 1OLLA 5EWIL 1IGIH 2B20A 3E6HA 3STLA 4NZJA 4QLRA 5D2LB 3ARTA 3EYSH 2IQAB 4G6AC 2NTSP 4FQIH 4I3RL 5SX5K 3GBLA 1B0GA 1CT8A 5HHQA 4ZSOA 1EBPA 4GQ9L 2H3NB 3MX0A 4WUUD 5EG6C 5J56B 2YKLH 4MA8L 3TA3C 4PJ8A 1OAZH 4M6OH 3OAZH 2GCYB 4GAGL 4OFPA 2JJSA 3OJDA 1QR1A 4M5ZL 3WHE0 4Q6IB 3N06B 4PREB 5T33L 1LO3L 4KXZI 3RQ3A 4XCEA 1HXMB 4WCYL 4Y7MA 1L0YA 4PJ7A 3LQMA 4HF5H 4LEXH 4LVNB 3VFNA 4QRUB 1TQBB 5CJ5A 4UUJA 4G80B 4YDKL 2JJTA 4KI5D 3C60B 5AG8A 2G2RA 3T65B 3SDDA 3DRTB 4BFIA 5DRXA 3GBML 3KPOB 3B43A 3IJSB 5BQ7B 1BOGB 4KJPC 2YUZA 5JPNA 3HZMA 4ZPTB 4RMWA 1AGEB 1H5BB 4DW2L 4HS6B 3RUGF 3SCMA 2JB5H 5I1GH 2J2ZA 5JMOC 1SJHA 5CEXA 4GRWH 4EN3C 3T0XA 4FQ1L 1FC2D 3KR3L 2P47B 3RDTA 2R29L 3C8KA 5DHYA 5IF0A 2VB5A 4OD1H 4S11A 2NX5E 3CVHA 2DQCL 2CIIA 3AREC 1SYSA 3L7EB 3KHOA 4POUB 3V5KA 5IMOB 3MROA 5T3ZE 4CMMB 4IIQA 3G6DL 4S1QL 2GHWB 2HKHL 3BIKA 2ATKA 3BH8B 5TE6H 1UGNA 2EH7L 2PTVA 1MRFH 3RA7H 5FKAA 3IJYB 4GAFB 5ADOH 5IJVB 4H8WH 1EJOH 3TVMB 1FJ1A 3EYUL 2KL6A 4QO1A 1D5IL 3UTZA 5ISZB 2PUQT 4L4TB 4OLYH 3BEWA 2BHUA 1EV2E 1MCIA 4WTZG 3P40A 4P23D 4KMLB 1NCCL 3FKUS 3L1OH 2VRAA 2Z4QB 4HAFA 2ZOKB 4IMKA 4P2CG 4NZRH 3O2VH 2F9BT 5DQJB 4LCUB 3LQZA 3BEVB 4Y1AB 5F9OL 5I19L 5DD5L 1ZKAA 3VFSA 1TFHA 3QAZC 1CGXA 5E6IB 1P53A 1EHXA 1U58A 1UKSA 1KCSH 4OCYH 3IU4H 4OF0A 3NTCH 5DHXB 2PYEB 4U6XA 1G6RB 1DUYB 5GSRB 1H3VA 3EGSB 4A6YA 1K8DB 2P1YA 1KCRH 2R8SH 4AEIL 3P4OA 4J4PC 4H20H 4ZAKC 4UV4H 1NAMA 3B5HA 1A0QL 2AJUL 4KTYA 5E6ZA 3THML 3MA9L 4PJAF 3H3BC 4A6YL 5GSVA 2ICWA 1VEOA 3IVKB 1T83A 3L5XH 3RVVC 1AKJA 2QQKL 3AS2A 3R8BB 4MXWL 3MV8A 1WAAE 2EC9U 4KVNL 4TOYL 1YYML 4U1SA 1VGEL 1MJ8H 5D6DC 4N0UB 1BFOA 3ZHKA 1B88A 5HHPA 2XXMB 3P11L 3LPGA 4ZMAT 3HMWH 4PLKD 4WW2F 1YEIL 3QNXA 3HE7B 4MHHG 5J12C 4P57A 1NBVL 4DZBB 1WZLA 2VDQL 5T1KA 3QBTB 4OLEA 3G5ZA 1EO8H 2OK0L 1D5BB 3HA0A 1ZT4A 2C5DC 2ZNWA 3V6BR 3TO2A 3GMOB 4K3GA 4PY8J 3T1FB 2NY3D 3FT4B 5A40E 3FOMA 4O2EA 4K23L 3RUGA 4XX1E 4P3CH 3CX5J 2EZ0D 4JREB 2XZCL 4NQEA 1XCTA 1FGNL 4FP8H 4JQIL 3FT2A 2X4QB 4H0IA 2QQNL 1ES0A 2FL5B 3U30B 4QXGH 4PP1D 1FP5A 3N9GL 3IDJB 5CJOL 1ULVA 2D9QB 2OMNA 3VXMB 1KIPB 4RGOL 5HBBA 5KSAD 3QG6B 3TFKD 1PY9A 5B8CB 3T3PF 4Z7UE 1G1YA 1YYLH 2W9DL 2VJXA 4CU7A 1YEDB 3QUXD 1I7TA 3SBWC 2AERT 5L7XL 5TFSH 3WL9B 4PRBA 5GGSA 5EBWB 1BECA 2B4CC 4WY7H 3P2TA 4MJ6A 3BP4B 4QRQA 5C2BH 3I6GA 1KACB 1CDBA 5C0IA 2MHAB 4QXUL 4FQJL 3K8KA 4LEOB 4KK8D 3QRGL 4PGEA 5C9JB 4IDJH 4BQ9A 3EO1B 3MGTB 5I1AA 4NUGH 5E95B 3QCTH 3HC3H 5IB5A 3BHBA 1CTNA 2FGWL 3D69B 1JRHI 5DLML 1IGFH 3GB7A 1YUHA 2GAZA 5FF6B 1DBKL 1C5BH 1MAKA 3FRPA 4H25A 4BSWB 1ZA3B 4Q97A 3QO0A 1IZJA 1IARB 3CXDH 1WUNT 1WEJL 3MJ9H 1YEKH 2PW1B 2AJZA 4KUCF 2J8UB 4IRZL 3HI6L 5JQHC 2FSEB 1ITBB 1FO0H 4N0YH 3GJEA 3NFNB 4KQ4L 1UM6H 2GJ6B 1AQDA 4OZHF 4PJAA 5C0AB 5L88L 3OPZH 2XOTA 3FN0L 4UQ3A 3EW3B 1JYVA 5D2LF 4NM4L 4X4XA 5DWUH 3VFRB 2L0DA 5E2WH 2IADA 4QTHB 1WZ1L 3V0VA 2ESVB 3SO3C 1IM9B 1RULH 4XCNB 3RX8A 3B9KD 1MVUB 4WO4C 5I75C 1L0XA 4LCWA 4NSKA 5EOQH 4WW2A 5FDWA 2V6HA 1T21A 3JXAA 4OBRA 3GMQA 3IFLL 5IKCB 4J12A 2WV3A 5DJZB 5IB2B 1T1WB 3HMXL 1LE5B 3ORJA 4L3AA 2AKRA 4ZNCD 1LE9A 5EBLB 3VI3F 3ULVD 2IFGA 5I71B 3HB3D 2UUDK 4LDOB 4PGCA 1A3LL 1AP2B 4PYGA 4BUGA 5I18H 5J1AB 1JK8A 1RK1B 5C0CB 4RAUA 4U6YB 3PQYD 5CIPH 1A4JB 3RVUC 4ZFZA 4BH8A 4LMQE 3QRFM 1ZLWK 2OL3A 3RWGB 2A77H 1U3HA 1H3TA 2H32H 2FDBP 5EWIH 5J13B 2JELL 4Q9RL 2YSSA 3AS1A 5D2NE 2V2TB 1RZJL 5I9QB 3IDYB 1MJUL 3U0WL 2B5IC 5E2TL 3SE4C 3ZTJG 4R2GD 3GGWA 5MEQB 5C6TL 3FT3A 3CZJA 3MRHB 4GKNA 4PJ5E 5IHZB 1BFSA 3MGOA 1FSKB 4WTXA 3NABH 3WNMA 5CD3B 4J6RH 4MA8H 3SE3C 3OGCA 4Y4FC 4XVUD 4PS4L 5DMIL 4B41A 2XWTB 5KG9B 4H26B 3C6SB 5HGDA 4XNMB 3L6FA 2DIBA 5EOTB 5IVXF 1LO3H 1NJ9B 2NY4D 3D0VB 2PR4H 4PLNC 2IAMA 1WT5C 2P5EA 3Q5YA 4JKKA 1U8PA 4UQ2A 2C4XA 1RK0A 5MEOB 2Q76B 3U0PA 5E94A 1OSPL 1RZKL 3G6JF 2VDRH 4M9PA 1RAMA 1CE6B 2LABA 4U1IB 4N8CL 4CUCA 1J86A 5HVHB 4JR9L 5EFIA 4CU8A 1Q1JH 4N5EC 4FQXD 1UXSB 3D39D 3KPRD 4PJ9D 5T3XE 1XAUA 1KJVA 3QXDB 1NMAL 4M8QA 4OLVH 4QOKB 5D96C 1QBLL 2Q3ZA 5F1SA 1UYWL 4HJGA 1GHFH 3O2DA 5CKAA 4DW2H 1NFIA 1G7MA 4JM2B 4V1DE 3BW9B 3O3AA 4OZHA 3KR3H 1FIGL 3AFLA 5L2JA 1WIOA 3F6LA 1N7ML 1MFAH 2IPKA 3CDFA 1CE1L 3GSOA 1JN6A 3VJ6B 1LK2A 2V2XB 3BZ4B 3MRPA 2EEBA 1EZVY 3CLEL 3PQYE 4L1DA 4S1QH 3G6DH 4FOMA 5K9OA 4IHOA 4K71C 2EH7H 3LN4A 1RZGA 4PJCB 1VEPA 3CVHH 3G5YB 4M1DH 5EPMB 1IEHA 1GPOH 3S97C 5IM7A 1GGIL 4FABL 5FYLL 4LVOB 1MIEL 2GCYA 5F3HB 1B0RB 4D8PA 3DUSB 4R4BB 4F2MA 4UTBH 1N2RA 4D0DB 2P45B 5L0QC 2JF1A 1Q72L 1HXMA 4PB9H 1VERA 4PGDA 4RGMB 3BGMA 3LAFA 5GISH 1QLFB 4HIIB 5E5MA 4GH7B 1A6TB 3ZDXF 1D6VH 3V5HA 3ZDYE 3DTXB 4Y4KD 4QRRD 5F9OH 3DRTA 5ILTL 1I1AD 1R5VA 4NQDB 4Y2DD 2Y7QB 1JPFA 3QT2A 4D94A 4G7VL 4O51A 1KB9J 3MLPA 4Z7VB 1TVHA 2ID5A 4JO3L 3IDNB 4OLXL 5IVZA 4GKSA 5A2JH 4H1LB 4JPIA 2MWCA 4HLZG 5EZJB 5I74C 1HQRB 3FQRA 1KPUB 3NPSC 1MELA 2AP2A 5E03A 3D39E 3KPSB 3RZCA 3VI4F 1A0QH 4CN1A 3VXUB 1BJMA 3ZYJA 4HH8A 4A6YH 1OTSD 4ODBD 1NUGA 1DUZB 4XP4L 1UZ8B 5CSBA 4FFWC 2JKXA 4RFEB 3GHEH 1NAMH 2EKJA 4TOYH 1S3KH 4LLDA 5IVXA 1V05A 3MYZA 3Q6FA 4M6ML 5DK2B 3L95A 4CW1A 1FL5B 1UM5L 5DJDB 5M95B 1YEIH 3CFKA 5DVNA 5C09E 4F37K 3G04A 3G6JA 1U8KA 4JFDD 5AZEL 4YH6A 1AGCB 3JZ7A 4UTAL 1T3FB 3U7WL 4XAKE 3MOAL 3OBAA 3V4PL 4Z78B 2C26A 5T1LB 5J89A 1W72A 3OKKB 5ESVB 3DMMA 1OP9A 1A7NL 5IVNA 4JVPA 4JQIH 4FXKA 6FABH 2MNUA 5T5NG 4DUXA 5E6IA 3DUUB 4Z9KB 5ID1B 1JGEA 1J12A 1UEMA 5JHDB 1ODAA 4ISVB 1P4LB 2A6DA 3QDAA 4GRMB 4UDUB 1AR2A 3LVEA 1MRCL 1U9KA 3BVNA 1KEGL 2BXZA 3HZKB 4QEGA 4QRRE 5L2KD 5GZOC 5B22A 1QPPA 5DK0A 2A9MH 4PJXB 4KVCL 1AGFA 1G6RL 1BQUA 3FQTA 2V5SA 3BP5A 2XPGB 2DQDL 2W9DH 4ETQB 1T0PB 1KLFA 3B5GA 4KMTH 4OB5L 2I60H 1S7RA 5C08E 1TJGL 4MAYA 2AGJH 5DK3A 5K9KA 2MCPH 1NCBL 4M61A 1YEGH 1EFXD 3TT1L 3O3DB 4NHUB 1JNJA 4Y5XB 4N0FB 3NCCB 2CK2A 4NQSB 3HRZA 3E3QE 4HWNA 3PWLA 5MI0C 2ADFH 4APQB 1VPOL 5IIEB 4G8GE 4QT5B 5F1IB 4HW6A 1JHTA 4IRSB 2VLJD 3BDXA 3NH7L 3PABA 1D5BA 1X6LA 4JY6B 2JTDA 1ZT7B 4ZFFA 1MCBA 1WV7T 2AEPL 4OBSA 1OVZA 4XH2A 5EU4B 2XTJE 1WEJH 2EYTB 3NACL 5DEFA 1CDCA 1ZAGA 5ALBL 1D9KB 3RPKA 3PXHA 1QSFE 4AH2B 3HPJA 5GXBB 3BKJH 1QD0A 3M8OH 5HHMB 1CFSB 1YC8A 5CUSH 3U79A 1VADB 1DP0A 1NC2D 2NY0D 4KQ4H 3RWCB 4HJJL 4N9GB 3C5ZC 1L0QA 3SKMB 4Z8FL 4CAGA 2VXQH 1E6JH 1AGBA 1LO2L 1T5XA 4NM4H 1KIPA 1DEEB 2BVOA 3QG6A 2XN9B 4MVBC 5EZIL 4ZUVB 4WVRA 3EHBD 2DYPA 2X42A 2H2PD 2DI7A 2Q8AL 5DZLA 4ZXBD 4LHQB 2BY2A 4MB4A 4G9FA 4HXAH 1S7XA 1KTLB 2C3GA 2P5WB 4KKBD 3EDJA 4OD3H 1CR9H 4K9EL 4X5XB 2PXYD 3SO5A 1P9MC 1QSZA 1P84J 5L2KE 1IAKA 4EUPB 1R24B 4Y16B 1FE8L 3PDOA 4CMHC 3MA7A 5K59F 2FYYB 3CVIL 4POYA 1T6WA 1DVFA 5HGHB 5JNYB 4LVEA 1CFQB 3SPVA 3D69A 2DLFH 4LVHB 3GKZA 5MHSD 5FGRA 1QFOA 1A1MA 3TO4C 1QG3A 4P4KB 1KJ2A 3KYNA 1HSBB 4XPFH 4DK6A 5J6HB 5C3TA 2VXUH 1QACA 1OF2B 1OM3H 3ROOA 1MCOL 4YXHH 4NFCA 2FJGB 1ZV5A 4NRXA 3T1WA 3MZTA 2VLJE 4JN1L 2ZCKH 4P3WA 3TIDB 3LKNB 2H9GA 4JM2F 4LDLB 5C6TH 2OL3H 3P9MB 4NO3A 5GRJH 2A0LC 5FYJH 4Q9QL 5ADPL 4KRPD 4J3UA 3WXWH 1QBAA 2AK1H 4LSRH 2BNRD 3ZDZE 1CS6A 3RTQC 5IB1B 2WBWB 3GSRB 4PS4H 2Z0BA 5D7JB 5D70L 5DMIH 1BD2D 1QNZL 1AO7A 3VWKD 5DRWB 4HUUB 2O61A 1CK0L 5A2LH 2VO5A 2F8OA 5BW7C 1OAQH 1OSPH 2IMMA 5DJZA 5GS0L 4W4OA 3KXFD 4ENED 1YA5A 2J3SA 5F9WC 3WIHA 2GFBA 4NJ9H 5EBLA 5IJKC 3QDJD 2AS5M 5EBMB 3EYVB 5JTWA 5GGVH 3VFTB 2BSRB 3STZB 1JFQL 5CJ8A 4PRHB 4Z77A 2BZDA 1NMAH 1MF2H 5ALCL 1QBLH 3LN5B 3QISA 3EO9L 4M7JL 3WIHL 4XNZC 3TZVB 2ARJB 3LCYA 2EDDA 4G6FD 2HTKC 2F74A 3GHBH 3PV6B 3NFSL 4HUXA 3DGCR 1VENA 1HWHB 2D4DA 1KT2B 4K7PY 2QSCL 1TZHB 1IAMA 3O2DH 5D7KD 4Z7VF 5MHSE 5LXGH 2P43B 4L3ED 4F7PA 1MPAL 3AXLB 2Y23A 1XR8B 4E41D 4EI5D 5ACZA 1P2CB 5J1SC 3GZKA 4KAQL 4UILL 3FN9A 1AD9A 2Y36L 4FABH 5I66B 1MI5B 2VWEC 3U9PH 4DQOH 4UOW1 1QSEB 5D1ZA 2XWTA 5FUCE 4L9DA 4XNMA 5EOTA 3MLZH 5TE4L 4PIRF 4ESKA 3L5HA 4Z7OF 4JE4B 3WXVH 5AYUL 2X1QA 4DUVA 1S9YB 2PYFA 1F58H 3VGFA 1U8JA 2O5ZH 2DKMA 4X9GA 3V6OC 1G7LB 1UB5B 1BD2E 2R23B 2W0FB 3K4AA 3VMOA 4CJ0A 4HPYL 4HCRL 5LAXA 3VFVA 4X6CE 4YHLL 1QBML 2JB6B 1DJSA 5EO1A 1AJ7L 1CL7L 5HHXL 1WBYA 4NT6B 3UTQB 1MCPL 3QI9D 1E27B 3RL2B 2AJVH 2GUOB 3LB6C 5IW6B 2XFXA 2XWJB 1HNGA 3SGEI 3CPLA 3QIWB 3QR2A 4UB0L 1RHFA 1DSFH 3KXFE 1IBGH 1F13A 2ZSVA 3RJQB 3P4MB 3BW9A 3TESA 3QDJE 3HG1A 1MWAA 3OKDA 1F4XH 1JHLH 1NKOA 3IDGA 4NQVB 2Y6SD 3CH8A 1PG7L 2IGFH 3QEUB 1HYRC 1NCDH 4XBEL 3DYOA 3QQ9D 1S7SB 4M48L 1EBAA 1EAPB 3NCMA 3IDXL 2VZ3A 2YD4A 3RIFF 4WUKL 4X6EB 4YHNB 2YBRA 3G9VA 1OB1B 4O2FA 4RQQB 4A2LA 2YR3A 4PJXF 1FVEB 5F21B 5F44A 1K8IB 3WHE1 4ZS7H 2IH1A 4J3TA 4XMKL 5GRUH 1U95B 4P9ML 1UM5H 1KB5B 2D7TH 4K8RC 4LPCA 1B0RA 4RIRA 4D0BB 2JLLA 1BJ1J 3QEGL 5EIIB 1GC1H 4PRIB 5AZEH 3OF6A 3PG2A 4L3EE 1SYVA 2G9HA 4H0GA 4JY4B 1Q9LB 4YFDB 4FQPA 5KOVC 3KAAA 3TBSB 2PO6C 1WF5A 5DUBB 4U1MB 1OAYL 5J11C 3ARFD 3QH3A 3CUPB 1JHKH 4PLOB 3VXQA 2VITB 3LEVL 2XICA 4P9HH 2HFFB 4HWBA 4J2XA 1I8MA 4QXTA 1W72H 5ERWB 1TCRA 5D72L 2EZ0C 1MCFA 4YBLC 3ARWA 1PG7X 3H0TB 2NXYB 2WLZA 1QFPA 4MLIA 5EC1A 5CBAA 1HQRA 2XZQH 1KPUA 1KEGH 1QFWI 3JV6A 3D6GA 2FX9H 5TF1L 1DBAL 3B9VA 3FQNB 4O5LH 1YN6B 1CLZL 4W81A 3O9WC 5FO9A 5HHOB 5HYQB 4OIAA 2AV1A 1WBZB 3TFKC 3BP7A 1I3VA 1F3JA 1DLFH 1SJEA 1RJCA 1TJGH 4ODSL 5DMJB 4U49A 3MUGB 1NCBH 3QIBB 4X4ZA 1CBVL 1XIWB 1CWVA 5EA0L 3RGVB 4HLJA 4PJDB 3VH8G 2P8MB 5CJQH 3REVB 3CFCH 3CFJB 3VXSA 5DQDH 4L4VD 3WLWC 3HI1B 4YPJA 1IAOB 2UY6A 3CX5K 5DA0B 1MLBB 4PJEE 2DRUA 3T2OA 2AEPH 2O5XL 3F62A 3OKKA 3EDKA 5MP6H 3L3OA 2VKWA 35C8H 4PTTB 3VFWA 4B7IA 5ALBH 4M3JA 5IV2A 4L8CB 1LHZA 3ECBB 1AY1H 2R9HD 2EYRA 2NY6D 3D18A 5DUPL 2NY5C 5JHDA 1A7OH 1IGJB 3RIAF 4QRTA 2CRZA 1TQCB 3EOAB 3BXNA 4F7MB 4LLUB 3SE9L 3D2UA 4Z8FH 3MRCA 2HMID 1IAIH 1LO2H 5DT1L 4S2SB 1A6UL 1F3DJ 5D1XD 3KVQA 1ZA6B 3UBXA 1OQXA 3GI8H 4NQCA 2YEZA 4R3SB 4YK4C 3BPLB 4WWKC 3ZL4H 4LASH 2BC4B 5GJTH 4X4ME 3JUZA 4DCQB 1JPGA 5F1NB 2HFGL 5JW5B 3E6FA 1I7ZB 4NOBA 5DJXA 5B4MD 2VISB 5BVJA 4YGVB 1R3KB 5DO2D 2EEAA 2IQ9L 5MEND 1AFVL 3O3DA 3PF2A 1K4CB 5JW4R 2AJYL 1ORQA 5I8CB 2IEPA 5I16B 5C0DB 1U8NA 1A9EB 1D6EA 1O5DT 3NCJH 3MRBB 3WSQL 4JPVL 3OR7B 4PY7B 3LKPB 5IT2L 3KDMB 3ULVC 4JY6A 1QVOB 4L9LC 1JGUH 2ADIB 2YC1B 5HDQL 1RU9H 4MNQE 5KANG 4HFUH 2HP4A 2C1PB 5EU4A 4CNIA 5EZLA 2G75A 3FB8A 4JB9L 1G7QB 4OV5B 2DL2A 1KJ2H 4C4KO 4JN1H 4L29A 3GSUB 3DROB 5KSBF 4LLVB 3FFCA 3HZYA 3BRDA 2DWDB 3SKMA 2F19H 1JE6A 5DFWH 4YR6B 1FPTL 1Q9OB 4Z7NE 3WDIA 5FO7B 3MXWH 2FB4H 5I1EL 2MJWA 4Z7WF 1KXVC 1SMOA 3QNZB 4XZUB 4OCNC 2WBJD 2F53B 3K8LA 3QUMA 1H15B 4DVBA 2EO1A 2GYSA 4NRZB 1UCBL 5DRNB 4JQVC 5A2FA 4MMXC 1K5NB 3NN8A 5GGUA 3BH9A 4IEFB 2H26B 4YX2H 2BXYA 2DTML 1CK0H 2FO4A 4DN3L 5I1JL 3ULUC 1I8KB 1MH5A 5LVEA 4Q2ZB 5IEKA 4DKAA 3MREB 2H2SC 3MBED 2OR9L 5GS0H 3S3JA 1R24A 1UM4H 3WNOA 4D2NA 4NNXB 5DD6A 1SJXA 3ARSA 3OX8A 5JNYA 4UIKL 3VRJB 3S34L 1UJ3C 1JF6A 4JAMB 1OPGL 3W11C 4QHUA 4LCCB 3MV9B 4MSWB 1FBIL 3WIHH 3ARUA 1LO0L 3QDGA 2UWEB 3HC4L 2HH0L 1LP9E 3ZYIA 2VH5H 3W81A 2ZUYA 1UB6B 4OKVA 2ICEA 2C4FT 4P59L 4F58H 4OD2A 5H2BB 4HG4J 1BQHG 1A9BB 1FYTA 5DMKB 1IVLA 4LPVA 2R0KL 4XCCH 2Z31B 5IHUH 1EX0A 1OGTB 2C3VB 4OZGE 1UWEH 3W9DB 4MWFB 2E6QA 1JV5B 1U2CA 1MPAH 1VGKB 4XP6H 2LAAA 2VLRD 2KDGA 8CGTA 5SX4I 1NGZB 1XGUB 4UILH 2FEEL 4CU6A 4R4ND 5CD5D 5F6HI 3X12B 4U1GC 3CIQA 3NA9L 5E08H 5DJ0A 3MV7D 1C16A 5HDLA 4HMEA 4H88L 3FRUA 3AGVA 2A6IA 4EVNB 3TN0A 5DD0L 1BZ7B 1RZIB 3OR6A 2F54A 1MCJA 3MRLA 4QCIB 2KPNA 5AWNL 3LV3A 2D7MA 3F58L 2XT1B 4LLMA 5ANMB 3OKLA 5I6XC 2FIKB 3MZGB 5IBUG 3WKNA 5IMMB 4LP4A 5JA9A 2DI8A 4EN3A 5DTFA 3VG9C 3SJVB 4EBQL 1YZZA 3WDHA 4LCYA 4MQTB 5D8JL 3CFBA 4TQEH 3DOSA 4YHLH 5GZND 4AEHL 2A73B 3STZA 3QPQC 3OAYK 4P2OC 3JVGA 1DZBA 4Y5VC 1VKXB 1KXTB 3NGBC 1QBBA 4CL7A 5IESH 5E2VL 1CD8A 4AG4L 5KSBA 3ZTNH 1A6ZA 4YPGA 3VMPA 3KPLB 3DURB 3GIZH 4FQ2L 2WUBH 3R0NA 1ZS8A 3KWWB 1JF1A 1W0VB 1RZFH 3WN5B 5HGGS 3IS0X 5DJ8B 1YQ2A 1XGTB 4NQUA 4Z7WA 1KC5L 1V3JA 3MLVL 2VR4A 3MLTB 4PJHF 1HHIB 1VHPA 1MWAH 4TPRL 1CZ8H 1AHWC 2ZOLB 4IS6B 2OP4L 3HNVH 4TUJB 3SDXE 5BRZB 4U1JB 4HEME 5LQBL 1U8MA 1FH5L 2I9TB 3DSFL 4XMKH 5D7LA 3TH2T 2NNAA 3VGHA 1X5HA 5I1CL 3WFDL 1OAKL 4BQCA 1RIVL 2ENSA 3QEGH 4GXVH 3HI5H 1OCWL 4ALAH 1FN4B 5KZCB 3H8NA 3V95A 2IAND 3Q1SH 3GIVA 2OR8A 1IKNC 1FNAA 1ZHBA 4NKMB 3TWCL 3MV7E 4J4PA 2FECL 1KENL 3VXRD 1A14H 3WD5H 3WFBL 2BCKB 3C5JB 1NDGA 1K3IA 5E8EA 1JYXA 4JRYB 5EUKA 4NT6A 5JIIA 1U8HA 3CC5A 3KYOB 5D72H 5IW6A 3TBVA 4P2QD 3MRRB 2YA2A 4DKFH 5HVGB 4LPWA 3T0EB 1QHPA 3LDBB 4HWBH 5D6DA 4KDWA 1ZGLP 5GGQH 2BRRH 3HAEG 3EJZC 1OOAA 3CH1A 4M6NL 2WANA 4KROB 1CLZH 4MJID 2FH6A 2V5TA 3I85A 3WFEL 3QPXH 4P4RA 5J06A 4XBPB 1HDMB 3MLRL 1CXLA 4NWUL 3F7YA 3BSZL 1R5WB 4RFOH 1CGYA 2ATPA 3D85A 3P0YL 5DEZA 1QRKA 1I9IL 1X5KA 1B4JH 4D9QD 4PJIF 4D0BA 4WNQA 4GBXC 3Q3GB 3ZKND 3AROA 4PRIA 1CL7I 4PBVC 4HUKB 5HI3C 4AK1A 1M7IB 3QDMD 1OGAA 4TUKL 4UINH 2C9AA 1ZWIB 2WUCL 1G7PA 32C2B 4C56A 3I02B 4Y4HC 1N59B 2DWEA 5GRVK 4OZIF 5EU7E 4WU5A 3LN9A 5GS1A 3NIGF 3OKEA 1TZIB 4UT7H 1J1PL 5E9DD 1JNHB 4U05A 2CLRB 1LO5B 1NBZB 2OXGA 3DRQB 3VFMB 2BY0A 2V5RA 4P46C 5HYJA 4X8JB 5HHNB 4LHUD 1Y18A 5DUPH 1I3GL 2GK0B 3AS0A 5FYLD 4GMSL 3IKCB 4NDMB 4R0LA 4KJYA 1A6AB 2H6PA 4Z7QE 3FB6B 1U93A 4PGBA 1H0DB 4PJHA 1HXYB 4YHMH 1CFVH 2NY2B 4WFGE 3WNLA 2YXFA 1YN6A 3B9AA 4YUEL 5F93C 2ZSWB 4JFEE 4MNGA 4KZEL 3EHBC 2H2PC 5GJSL 1J9CT 3WFCL 2AV7B 2NX5B 3QUZC 3SKJL 4ZYKB 4JEGB 5DYOB 4MJIE 3ZKXB 3C60D 3BISA 1UWXH 3REVA 2PNDA 3CFJA 3LEXB 1K4DA 3TT3H 1T03L 1UVQB 2V7NB 4MDJA 1RQ5A 1ED3A 2QV2A 3BGAA 4HS3A 1QLEH 3ESUF 3AM8A 4BK5A 1NEUA 3DHJA 1X7QB 4UNTA 3UJIL 5BS0D 3LQAH 4ODHL 1MRDH 3L5IA 3WKML 4D9QE 3SKOB 1HHGB 3HLAB 4C54A 1KJMB 2IPUG 5D5MF 3ZE2F 4N5UA 1G9MC 1KFAL 3MRJB 1ZGLB 1J05A 4N0CC 2UWEF 1IILE 3C6LC 4KTDL 1GZQA 1ZEAL 2Z91B 4JN2B 4OCWL 2E7LC 4CVUA 2X9YA 2CMRH 1S9XA 4NRYA 4FTVD 2YD2A 1I3UA 1E6OL 1ZT1A 1FNEA 3WJLA 3TVMD 1AE6L 4KDTA 4K94L 4KRPC 3PV7A 1EMTL 4RISH 5HYIA 4HWZB 1P84K 5ISZD 3E8UH 4L4TD 4PJIA 5DEGB 4NWTL 3MYJA 3LHPL 5F89B 3UO1H 4X7SH 1RUAL 5JW5A 3QUMH 1TZGL 4Z76A 4NZUL 4YGVA 5F7DA 1JNNL 1NFDF 5F88B 3SE8H 1WSST 5HPMB 3SKNA 3ZMRA 2P4AB 3QXUA 5ABDE 4OZIA 5FKPA 3U4EB 3VG0L 4Y1AD 1RUKL 4Y2OA 3RWHA 3PGDB 3MRBA 1N3NB 4PY7A 4DFHA 4ENEC 4GW4B 4JPKL 2VXSL 2FBOJ 3VDAA 4TVPE 4KPHL 5IOPA 4PRPA 4NC1C 4OTXL 1SEBB 4XNUH 2PYED 4OF8A 3S4SA 1FZKA 1HHJB 2HH0H 3KS0H 3M45A 1FZMB 1R3LB 2CO6B 2HYMA 4LARL 4LHJB 1MEXL 4HKBB 3RBSA 1YMMA 2ZZUT 1JWUB 1F90L 4X6FB 4AT6B 5INDA 3W5MA 1FV1B 4U4BA 4YIQB 4AIZB 5KVDL 5GS2D 4G6ML 2YA1A 1C1EL 3UYRH 1PZ5A 1DBBH 3SN6N 3OKOB 4JG1H 1S9VB 3C8DA 1E28A 2DQTH 4UOJA 5CP7B 5FGCE 2DWDA 2WK2A 5BS0E 2XI9A 4MA1B 4X98A 3R1GH 1XF5A 2DM3A 4YR6A 5DHVB 1ZHLB 1CTOA 5F6IC 2W0KA 5HYSA 5I8OL 4G6JL 1HQ4B 5FO7A 3O8XC 3DBXB 3PL6C 2YPLE 5TE7L 3QNZA 1INDH 4JM4L 4QGYA 1N0XL 1G7IA 3HE7D 4L5FL 4YHYB 4WGWB 3TYFB 5DD0H 2EECA 5DD3H 3IS1X 5IMLA 4FTVE 4NYLB 4BKLA 2FLRT 4ZFGH 3S88H 1PSKL 5I2IA 3MREA 1BP3B 1TLKA 4Z7UB 2R2HB 2JE8A 4ELKA 3ARBA 1UT9A 2EIDA 3DV4B 4WIQA 1KGCD 4L4TE 3LZFH 4GRLC 3H7LA 4JHZA 2FR4B 3OHXA 2ADJB 5D5MA 4J3WA 3MRGB 5GQBA 4M02A 4O58H 2VLLA 1UACL 5E2VH 4YO0A 3JWOL 5KVEL 3LPFA 3C09C 4O2CB 3W9EA 3FQXB 1IC7L 5AEAA 5EU3A 4YDVA 5I0ZA 4Y1AE 3VXMD 1I7UA 3TPUA 2WIIB 1A9BA 4LSSL 2HKFH 2A6JB 3T4YA 5FA4A 3QULA 3RVWD 3DGGB 4OUOA 1TTFA 2PYEE 4RAHA 4XB7A 4X5LA 3S7GA 2UZYB 4PUBL 4GS7B 3RVXC 4FG6C 1NFKA 2Y6SC 2NW3A 3FO9A 1A6WL