4WO4C

The molecular bases of delta/alpha beta t cell-mediated antigen recognition.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
200
structure length
200
Chain Sequence
QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGVTGKLTFGQGTILTVHPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d
publication title The molecular bases of delta / alpha beta T cell-mediated antigen recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2014-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wo4C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wo4C01
4XVJL 4KRPC 2X10A 3CFEB 5F7KC 3ULVE 1IC1A 3TNNA 1EVUA 3WS6A 3OKDA 4XNMA 4O58H 5EO9B 4LLWA 4HT1H 2FO4A 5E8NA 3K46A 3VXTA 5ITBL 3U36B 3V2AR 4X8JA 3NACH 3GB7A 1OT1A 2IH1A 2Y36L 2A6JB 4KUCF 5I1LA 1TETL 1ZGLM 2BOCB 5EC2B 5DD1L 2HWZL 1FBIH 2EEBA 1L6XA 2D0FA 4WI4A 1KB9J 3N50A 3FFCA 4LARL 4YHZH 1T5WB 5D7JC 3LN5A 2RQ8A 1F90H 2UUDK 3HHRB 4HC1H 4M7JH 2A2QT 4F7TB 1UJ3B 4X4ME 2IG2H 2EE6A 1FIEA 3UTQB 4EN3B 1TZHA 1KPUB 3N0PB 3PP3K 1N6QL 1DLHA 1Y18B 5SWSB 3VWKD 3INUL 4XP6H 3JV4B 3BDYH 3UJIL 1CFTA 3D69B 1ZLVK 1TVDA 3BPOB 3RY6C 4DUXA 1X5JA 1ADQL 3VXUA 4PLOB 5CSZA 5GQBA 1FZJA 2NX5A 3P4MB 1CCZA 4FA8A 2GSGA 3BISA 3ARFC 4MA7H 5HVHB 3TF7C 3TJHD 3AREA 1PYWB 2FIKB 4NM8H 5IJKC 4OTXL 4RGND 3GSXB 4MX7B 3UTTB 2OL3H 1MCOH 2KBGA 4GBXB 2DQJL 3TZVB 3QO1A 5EPMA 2OLDA 5ESVB 2COQA 5CEXB 4JFHE 2ZOLB 1NL0H 5D2LE 2PUQT 3C60C 5EU6B 3RX5A 2FX7L 3SKUD 4ONFL 5B38A 1GZPB 5LAXA 3OZ9H 4YBHA 2DWEB 3ARDD 4OCYL 2VIRA 5FGBA 1YEHH 3P73A 2R0ZH 5TE7L 4MD0B 3IDXH 4MLSA 4JR9L 4D9RE 1IBGL 2ZUVA 3MRFA 5IB5A 2W0LA 3ULVC 1ORQA 1CGXA 3SDCC 2HJKA 2EECA 2D7OA 2X4PB 4UV7H 3DJ9A 3WXWL 4NBXB 4AM0B 1KN2H 4WEMB 4NM4L 2DDQH 1U3ZA 5SX5H 4ZFFB 5D72L 2OXGA 2W9DL 4XBPB 1W72H 2EDTA 1TZIB 4JRXB 2BDNH 3NZHL 5F70A 5C08B 4KKCC 2GCYB 5DWUL 1HYSD 3FO2B 2V5MA 3P9LB 4MNGA 3QDAA 3N85H 1PLGL 4NC1E 1JL8A 2N7BA 3BSZH 4FQJH 4PGDA 2APFA 4LEXL 4ETQB 4FTVA 2EH7H 2JIXA 2YPLA 4O58L 4C56A 4X80L 1GPOL 5IHZB 4KGJA 1I9EA 1IQDB 4ZAKA 5IMKA 3QFJA 4HT1L 4RAVA 1MEXL 1R6VA 3W39B 3U9PH 3BMVA 3WKMH 1OTSD 1UQSA 3H3KA 3MREA 2YUVA 1FBIL 1J1PH 4P5TB 3M07A 3QCUH 3FOLB 4HQQL 4N68A 4YHZL 2RBLA 3SDDC 3FT4A 1LEGB 1QEWA 4FOMA 3JV6B 2RCSH 5DC9B 2J6EL 4NQEB 3TJEH 2X9XA 4RRPG 2NXZB 1G7PA 2N1KA 5I74B 1J88A 1CE6B 4W4OC 2R0WL 5EWIL 4Z78B 3VFMB 1IE5A 4ZFGH 4DZ8A 5C2BH 4EXPX 5GRUL 5HDLA 4L8SB 3BDYL 1C1EL 2Z8VC 1DEEA 1UA6H 4KKNA 4R96B 3DURB 1TZGH 1BFSA 1U2CA 3MJ9H 5L9DH 3D18A 1JIBA 5KANI 3VU2A 3FQUB 1N0LA 4MA7L 1UM6H 5I75B 1D6VH 4PPTA 5GZOC 2LAAA 1G9NC 1HIMH 5IM7A 2HVJB 1BQHA 5FECA 3RWFA 1KLFA 3SGDI 4G8GE 1NMBH 1JE6A 1NL0L 4U1MA 4X0KA 2BNUA 1DSFH 4ZFZA 3UDWA 4ODXB 5C8JB 2UZIH 3OZ9L 5HGAA 5DK3A 5I8EA 3ZLQC 5I2IA 2PO6C 5IBLC 5DYOA 2R1YA 3DMMD 1GH7A 4JZNA 1T1ZB 3PL6D 4YIQA 4AJ0A 2E9WA 1GRWA 4POZC 3T2OA 1XF5B 3CC5B 4M4RA 1AGFA 2HKHH 4EDWH 5F9DC 3QDMA 4K7PL 1I9RH 1OF2A 1JTPA 3P30L 4NC1C 2W92A 4QOKA 4X6BA 5EORH 4Z0XB 5DHYA 5FYKL 3HZVA 2P5WA 1DQQA 2AXGA 4Q9QH 4YZFE 1QLFA 5J3HC 5GZNC 1R24B 3MLWL 4FQPA 4ELMF 3K2UL 4PJCF 2O61A 5M94B 1CGWA 2IPKB 5IMLB 4KK5C 5KJRH 3BSZL 3V8OA 4KVNL 4ZS7H 1MCEA 1HEZB 3G9AB 3PV7A 3UTZB 2GJ6A 5GGVH 1T6VN 2CQVA 2ARWA 1JI1A 1ZHNB 3WHE0 1JHLL 4JG1H 4GKSA 2UYLA 5C7XL 4KU1A 2JB6B 1QOKA 4N90D 3B83A 4DVBA 5TH2B 4N9OB 4JFQB 4Y4KD 5E2WH 3MBXH 3SGEH 3BP5B 2NY2C 4Q9CA 5J13C 5E08H 3CVHB 3QWRD 4M6AA 2APVA 3AB0B 2RCSL 3O6FC 3MJ7A 3DV6B 1N5AA 3CVHL 3CK0H 1LO2L 3U6RA 4LCIH 2IBZX 5C09B 3RVWD 2V5TA 4ZFGL 1CF8L 4X6CB 3B9KA 2BFVL 1KB9K 3PWJA 2VQTA 3KPLB 2XNAA 4MNQB 4KDVA 1NLDH 2QHRL 1NC2B 4Z7NF 2DQTH 5F1OB 4YXLH 2CKNA 2A6DB 2E3VA 5DVKA 4K7FA 2HRPH 1CGSH 2IAMB 4V1DD 4HFUH 2EICA 3L3OA 1I7ZB 2EYTB 4OT1L 3QRGH 3L7FB 4Y7MA 3HMWH 4NO3A 2FGWH 4ZUVB 3P77A 1LEIA 1NMBL 5A16A 32C2B 1D5BA 1J5OL 5IWLA 2D2OA 4MGXA 5DHVB 3ZE1E 1MIEL 1TXKA 1MRDH 1IILE 2OSLA 2UZIL 2X9WA 1CLYH 4TUOA 5EDXA 4Z77B 5CWSB 3SGKC 1JFQH 1EJOL 1YMMD 5DT1H 2WSKA 3VFTB 4L1HA 2LVEA 5D96C 4F7PA 1BFVH 2LE9A 5HDQH 2CLVB 4HZLA 3GDBA 4GG8A 2R4SH 2H2PD 1XGUA 1IKFH 1P1ZA 3F7VB 4ELMA 3H3PH 5GS1C 5ELIA 4PJCA 4IOSD 3FB8A 2QKIA 4JRWA 3MLVL 5KSAA 3RKDC 2PF6A 4GRWE 4PS4H 4PREB 1MLCB 4OF8A 4P9HC 4DZBA 4Q9QL 2OI9C 1T03H 4XCNB 5HHOA 4A6YB 3I3DA 4GKNB 2HH0L 1I8IB 3I02A 3SEPA 4BSJA 2EO1A 3EGSB 4NQSA 3SE3A 4Y2DA 4Q9RL 4NRZB 4A6YL 1EHAA 5KSUB 3PWPE 1HXMA 1VEOA 4JM2C 1PZ5A 2BRRH 4X9GA 5KJRL 5SWQA 3JTSB 5HYEA 4NP4L 3GSNA 2BNQA 4OGYH 5JDSA 5I16B 5I1IL 4ZS7L 1E28B 4UUJA 4JRYE 3HFML 5IIEA 1FYTD 5GGVL 4CMMA 1FVCA 3MCG1 3KYNB 1H0DA 3GO1H 3VGAC 3VFVB 1FZMA 1GGTA 3DUUA 4FQXB 4JG1L 2UWEF 1H5BA 1JPTL 4JDZA 2HTKD 2D7MA 4TNVK 4WU5A 3QCVH 4ODVL 3HZKA 1ZT1B 1GC1H 3FRPG 3MLZH 1DBKL 1IAOA 3ARYA 5DJDA 2YD4A 3KPRE 3ULVF 1ZLWK 1KACB 2FYYB 1IC7L 4I5BA 3HMXA 4OB5L 2BC4B 5IBUG 4X4YB 4LMQI 4N9GB 4PJXB 3MRIB 3CCHB 5C0AA 3ZE0E 1VGKB 4LSUH 4U7MA 3TT3L 3V79C 1IT9L 3LRGA 4KJWC 3TNNB 1J0JA 4XNMB 3AFLA 3MA7A 4FNLL 2K7QA 5E6ZA 1JV5B 4PIRF 3SDAC 2DQTL 1V3JA 2FO4B 5E8NB 4Y2OA 5HGHA 2RAMA 5DJZB 1FLRL 1Q9KA 4Z7UE 3VRLE 4CN6A 4GOSA 4X8JB 3VI3E 3MODH 3GB7B 1P4BL 1DR9A 5TDOA 5I1LB 5D7JA 3DX8A 4LCWA 2FO1A 2MKLC 4CRPA 1CDCA 4F33A 2M2DA 3H6JA 3LN5B 3MV01 1BOYA 5KVMC 1Z2KA 5EO0A 2WBJD 1MRDL 1CQKA 4AL8H 5I1AA 3O3BA 4TSAL 2DQDH 5JXEC 3DHJA 1TZHB 1BREA 2KKQA 1JFQL 3RY6A 3RIAF 5T1DL 1DLHB 5C07E 1H8SA 1X4ZA 5KAQF 5HDQL 1CFTB 1LO4H 3N06B 2DMCA 5J12C 3ARFA 5HYSA 5JORA 4DGIL 5CSZB 2JB5H 2NX5B 4WIQA 5IJKA 2CPCA 4JFFE 1VSCA 5C0EB 2Y07H 2H32A 3AXLB 1DQTA 3L5XH 1A6UH 4OBRA 1DFBH 1M7DA 3AREB 3RL1A 1XGRA 1SJVA 4IDJL 3RWGA 1YY9D 5HHXH 2Q6WB 3C60A 4M7KL 3QO1B 5EPMB 3JSSA 2BVOA 4R7NB 5SX4I 4WGVB 3F62A 5JA9A 4KROD 1G1YA 1CDUA 2UWEA 1VFOA 1U8PA 4R4ND 5B38B 6FABL 5LAXB 3BYYA 4WI2A 4OGYL 3CFCH 3H9SA 3SCMC 2VIRB 1RUQH 3DO7B 2EDOA 4I48A 3P73B 3EYQC 5HYQA 3MJ6A 3SDCA 4HSQA 5AUMB 3S4SA 3ME0A 1X5XA 4E41B 3FL7A 4OZFB 4PJIB 3MRFB 2VN4A 5IB5B 5T1MA 2AJYH 4BK4A 2R1WA 1GC1L 4X5WA 3D25B 3E8UH 4JFYA 4DKDC 4ZS6C 3DPBA 1RZ7H 1SYVA 4ISVB 4WFEE 5I18H 2VL5B 4LHJB 4ZOEA 3DROB 1MQ8A 3PDOB 2VLRB 4JZOA 4ODTH 1OB1A 1U58B 1MH5A 3IU4H 3RWCA 3WN5C 1F45A 5GRXG 2VLKE 5E2VL 4X4MA 5T1KB 3VRJA 4PGDB 4FTVB 2JIXB 3UEZA 4C56B 5DRWA 1A6ZA 4ZAKB 3RFZC 1WT5C 2XKNB 4FQIH 2X4TA 4MD4A 1EMTL 3MODL 4RIRB 3PP4H 2MQ0A 1UH4A 2XZAH 1MCCA 3VFRA 1UQSB 3MREB 3SDDA 4LQ1A 2R56H 3V6BR 1DBMH 1U8NB 3IETA 1P53A 1U8MA 1JZ6A 4XBEH 1Q1JL 3CDGA 4W4OA 3FT4B 1MJJA 1O7VA 1QEWB 1BM3H 3AS3A 1MCKA 3O4LD 4EN3D 1S7VA 1FNFA 1T22A 1CGVA 5JQ6H 1G7PB 4N5EC 1MHHB 2DQDL 3JZ7A 1FJ1A 2AK4E 5I76A 5KN5A 3L5IA 5SWSD 1MI5E 1CDHA 4DZ8B 5DVMA 5D2LA 3G5VA 2K9UA 5HHQA 1MREH 4HLZG 4YX2H 2EXWD 1DEEB 4LP5A 3EW3B 4NNXB 2AERT 4QWWC 2CIIA 3LKNA 3D18B 4PRNA 4DN4L 2AEIT 2VJXA 2Y07L 1MCPL 1J10A 3L5XL 3HI6H 2AKRA 1S7XA 3FN3A 3UTTD 4GBXD 3U2SB 3TZVD 5IM7B 1AGDA 1BQHB 5FECB 3RWFB 3RGVC 1CICC 4KKBD 4G8EB 1HHJA 2XT1B 4WI5A 5EU6D 5I1EH 1RJLA 3RNKA 1OPGH 2PO6A 1HZHH 2BNUB 3WL9A 4ZFZB 3BHBB 3QUZD 4TVPE 5HGAB 4LSQL 3IDUA 3SE9H 4WFGD 4RSVA 3T4YA 5I8EB 5I2IB 1QD0A 2XG4A 4P5MA 5DYOB 2R1YB 1KGCD 4OCSL 3QEHA 4PJ9C 4YIQB 1KCUL 2CD0A 3MNZA 3HC0B 4J4PC 1AGFB 3QG7H 3QDMB 4HS3B 1NCWH 1XF2A 3LS4H 1OF2B 4QOKB 4WV1B 4LVEA 5IFAL 2Q20A 4U1JB 4RA3A 2EE2A 5ALBH 5DHYB 5HGGS 3HZVB 2R23A 4WW2F 5MI0B 2AXGB 4TQEL 1FAIH 5DFVD 3C8KB 4JRXD 2FSEA 2IQ9L 5C08D 5JOEA 1HWGB 1YNKH 3LKPA 4ODTL 3SO5A 4G43B 3T2PA 1HOCA 5JW4Q 2FJFA 4NCDA 5JOFB 2OCFD 4WEBL 5HDBE 5B3JF 2ZUUA 2XQBL 2GJ6B 2R39A 3MLTA 4KV5F 3IKCA 4NYLA 4PJ5E 1ZAGA 4JFEE 1AGBA 4GKSB 2UYLB 4P5TD 4J3TA 3GMPA 3H9YA 4DVBB 4W81A 3LEVL 1F58H 4J8RA 2UZXB 4Y5XC 1D5IL 3O6FA 1ED3A 4AENA 1YEFH 4K7PY 2CXKA 4NQED 2PKDA 3A6BL 4HUXA 4LVNC 3KG5A 4FZEL 4HK0A 3TWCL 1T7WA 5KS9E 3K2MC 1N5AB 4KHXH 4FZ8H 3ROOA 4OFVA 4G8GA 3U6RB 4JN2A 1T1XA 3LOWA 3NPZB 2Q7YA 3B9KB 3PWJB 5CZVH 1MREL 4Y5VC 1NFIA 2X4SA 3BE1H 2R69L 3W9DA 5DMGC 4XP1H 3QXVA 3OAYH 4L9LC 4JPIB 2DI7A 4MAYC 3T8XA 1LP9E 3ZE1F 3WIFA 1KB5A 2YD8A 1RUPH 5MEPA 1L7TL 3OKLA 2B5IB 2EDDA 2YD3A 4NO3B 4DKEH 2E9BA 2CDGA 3QISA 3P77B 3VGDA 3GSQA 4E9LA 1LEIB 4HGWA 3TM6A 2O5XL 5A16B 1D5BB 1T5XA 3L3GA 1HZHL 3SGKA 3THML 2OSLB 4TUOB 4C4KT 2WWMD 4M1DH 1UWGH 4POYA 1V3LA 2YN5A 3WLBA 4LIQE 5CEZH 2VZ1A 4JHAL 4F3FA 4YHLL 1EFQA 4GRWF 3EO9L 4F7PB 5GS1A 1XGTA 2YUWA 4HZLB 5FYKD 1X5LA 2C4XA 4HMEA 1S7WA 5DJ6A 4GG8B 3QG7L 1XGUB 2H1PH 1P1ZB 3LS4L 1TMCB 4PJCB 4OGAC 3VG9B 4NPYA 5JA8B 1ZANH 2EKSA 5ALBL 4MXQD 1LO0L 3MNVA 4DZBB 4MXVE 1FAIL 5HHOB 2H32H 3QEQE 4JM2A 2WP3O 4YDJA 1GZQA 3I02B 4H5SA 4NQSB 2H6PA 4R2GB 1HXMB 2XRAH 4OQTH 3REVA 1MFBH 4NRXA 1PZ5B 3QDGB 4Y8DC 1DLFH 5SWQB 4EUPH 4MDJA 1MAML 4WWKD 4QRTA 3GSNB 2BNQB 5FA4A 5GS2D 5BVJB 2B4CL 4WTWA 1G6RH 4Q97A 4UUJB 5IIEB 4CMMB 3G6DL 3GSNL 1FVCB 1OQOA 2DMKA 1H0DB 1MRFL 2NYYC 3DUUB 1LGVA 1SYSA 4Y19E 1G9ML 5E2JA 3WIHA 3ULVH 2E7BA 2VZVA 2ZUQC 3BUYB 4WU5B 3RJDA 2A83A 2CRIA 4KPHH 1C08A 3GK8L 4PRBA 3LZFL 3UXFA 1IAOB 1JVKA 5DJDB 5I30H 5L6YH 3WNNA 1FNHA 2HFFA 5F72S 5I1DB 1A7RL 1U8QB 1FIGH 1J86A 5TFSH 4XNUH 5FGCE 3HMXL 5C0AB 4OUUA 4QGYA 4Z7UF 3VRLF 1IGIH 3SDAA 4MNQD 3VI3F 4M7LT 4WI6A 5CZVL 2XXMB 1NC2D 3FKUS 3MA7B 2ICWB 5CEYA 2VDRH 2AEWA 4OJFL 1TJIH 5HGHB 1NCAH 3FN0H 4XP1L 1Q9KB 2IAMD 1DANT 2BP3A 4RZCB 1HCFX 4LAQH 4QGTA 1WCQA 4X9BA 4M1GL 1RUPL 4JFOA 5D7JB 1I3RB 4LCWB 1CGUA 4DKEL 4XAWH 4F33B 3NGBC 2NY5C 2MJWA 3OF6A 4M93C 5JXEA 1CIDA 2QSVA 1AJ7L 1YEJL 4D0CB 3ZSSA 4AEEA 5EO0B 4QXUH 2I9LA 4TTDC 1MRCL 2EDXA 1N5YH 3MRMB 5F97E 1K3IA 4QTIL 3BO8A 3JWDC 2ZUTA 2E7MA 3MV8E 2DTML 1BWWA 3DV4A 2FJGA 4U1LA 1P2CA 7CGTA 3PWPA 3CD4A 1F3DH 5LWYL 1P5UA 4LBEA 4E0RA 2IANB 2FD6L 3ARFB 1LVEA 5JORB 1S7QA 4JRYA 4P2QE 1EBAA 4O9HL 4QRRD 4MQXD 1CLCA 2H32B 4LPYA 2DQHL 4YHYC 4HUUA 1DEDA 1BJ8A 1M7DB 3U7AA 3RL1B 1XGRB 4Y4FC 3RWGB 3C5ZC 1CFQA 2AJUL 1IAMA 1QA9A 1GJIA 3GI9H 5E4IA 3K4DA 1NEUA 5F1NA 4PYHA 2BVOB 3CDFA 3E0GA 3KPRA 4Z7VE 3SCMA 5EU5A 2UWEB 4P57A 2XRAL 1U8PB 4H26B 1ZLUH 1BPVA 5K59E 1DLFL 1U42A 4J3SA 3CZJA 2ESVE 5HHPA 3H9SB 4I77H 2NLJB 1RULL 4I48B 1U36A 2P8PB 3I6KA 4FQXD 4PD4J 2HT4D 5HYQB 4CU7A 2YMXH 1MCIA 3K74B 5H37H 5I19H 1SJXA 4JO3H 4LGRB 1FAKT 3W0WE 1G0XA 4F8QA 5I6XC 3EZ8A 1TJGH 3HNVL 5T1MB 3ULVL 1KFAH 4EDXB 4LSSL 1ITBB 2R1WB 4YDIH 4X5WB 3WMSA 2DQCH 4Z7UA 4JFYB 5L6YL 5KSVA 4WHTA 1SYVB 3QIBB 5IV2A 1WISA 5DVNA 5IESL 3H7LA 4KK8D 4ODUB 2I5YL 3WN5A 1FIGL 5DMIL 4M61A 1AR1D 3RA7L 1B4JL 3D0VA 3S34H 5EZIH 1NGQL 4JZOB 1OB1B 3RI5F 1MH5B 2ID5A 3RWCB 1WT5A 4XHJC 3Q0HA 4YJZL 2AV7A 3VRJB 1KJMA 5DRWB 1A6ZB 2ILLA 3IRZA 1EHNA 2ZCLL 4WFFE 4XMPH 2KQNA 5F9JA 2OQJA 2P5EE 2X4TB 4Q9BA 4MD4B 3I6LD 5C07A 1HKLH 3LD8C 2YSSB 4TNVF 2F19H 4PR5B 2BXZA 1YNTA 3VFRB 3SDDB 5FOJA 3VXSE 5D7KD 4HEME 3IETB 1U8MB 4G7YL 4FMKA 4JFFA 3RVXD 4KRMB 3QA3A 4GAFB 3CDGB 5ERWB 4X8XA 2VN7A 3QHZL 1MJJB 1IAKB 1PX3A 4LFHD 3C2AH 1IQWH 1T22B 1I7TB 1QYGL 1MHEA 2DQFA 4PJEE 1A6TA 5KN5B 1FJ1B 3RU8H 1C5DA 4PY7A 1LDSA 2D7PA 4BZ1L 2DIAA 5D2LB 4KY1H 3ZTNH 1NUGA 4JO1H 2OZ4A 4QY8A 2NY6B 3MV7E 2LFGA 2BSSA 2CIIB 1ZEAL 4PRNB 1YN7A 2SEBA 2UUDH 3ARED 3RGVA 1CICA 3V0WH 4JEGB 2AKRB 1G9NL 3RWDA 3QIUC 1AIFB 4WCYH 5F8RC 3BW9B 5HVGB 4MJIB 1AGDB 4S1SH 5C86A 1BOGB 1KB5H 4Z5RA 4OF0A 4BKLA 1HHJB 3HCVB 3PP3H 1RJLB 4P0DA 3RNKB 2PO6B 1FC2D 3WL9B 1KCVH 1ZLVH 4OLXH 5HHVH 3HAEA 4PJ9A 5C71A 3T4YB 4PFEA 3NABL 4P5MB 3G08A 2FX8L 2XTLA 4J4PA 1JP5A 4E41D 3QEHB 2VLKA 2W1NA 3O3DA 5FDYA 5FA3A 3ZDYF 2NQCA 5L2KE 1PX4A 1A6WH 1KFAL 1XF2B 3HB3C 3MA9L 5IK3A 1D5MB 2XPGA 1WWBX 2Y5TA 4HBCH 4P9HH 5FKPB 4MVBD 4J12A 4RNRB 5C0FA 3BEVA 2FSEB 2VLRD 4FQ2L 1YPZB 4D9LH 5HDBF 4OM1L 3LKPB 1NFDE 1FYHB 5T1KD 5LBSH 4HJJH 3P0GB 4FTVD 2JIXD 3EDKA 4C56D 5F1SA 5DDHA 4ZAKD 1S5HA 1HOCB 3N1FC 5IB1A 2VQUA 1BBJA 1P7QA 2EYSA 2YPKB 3ARUA 2FJFB 2W9LA 2HTLC 2AK4A 4XCCH 4JFPA 1MI5A 4CGTA 3MLTB 1J7VR 2NZ9C 1HKLL 2R8SL 1EHLH 1UZ6E 5DJCB 3DVNB 3O6KH 1AGBB 4K9EC 4Y5XA 4EOWL 2ZP0T 3GMPB 4G80B 5J13B 2D7NA 2V2TA 1KV3A 1W2KT 4NKIL 1WSST 2DJUA 2MSPA 4J8RB 4JDTH 3U30C 3O6FB 3EDDA 1ED3B 4HKZA 3S5LG 5GJTL 3T0EE 3WIHH 5L0QB 2C3XA 2O5YH 3MZGB 4M6OL 3F5WA 4HUXB 1LK3L 4HK0B 1KIPA 2XZQH 3C2AL 5CAYB 3QNYB 3BP6A 5H35A 1YYLL 2JELH 2B2XL 3W2DH 3ROOB 4WO4B 4XP5H 1A5FL 1NAMH 3B2UD 4Y5VA 4JN2B 1T1XB 2CJUH 4DN3H 2Q7YB 2NNAA 1LP9F 4URTB 3IDYC 2YA1A 2F5AL 2WM0A 4L9LA 4X5LA 2X4SB 4MAYA 4AG4H 4U1IA 3OBAA 1EZVX 4JFXB 3W9DB 2VAAB 1QFHA 5I17A 4YGVA 1UC6A 3V7MA 4G3YH 3MYZA 4JO2L 3V0WL 3T8XB 3EJYD 1CXFA 3K4ZA 3WIFB 1EV2E 5MEPB 5T3XH 2P7TA 2J8UE 3OKLB 5KOMC 2CDGB 3GSQB 2HP4A 2FHCA 1T5XB 3L3GB 2ZG3A 4JKKA 4HV8B 5FOBA 3FTGA 1Z3GH 2XZCL 3KYKL 4GRWH 2VITA 3WLWD 5D96B 3NBNA 4OKDA 3D2UD 4F3FB 3PE9A 5GS1B 4CVUA 2CIKA 2MKWA 2X40A 3EJJX 5DJ6B 4QOKD 1KELL 1A6WL 4CVXB 3GI8H 4I2XB 1G7QA 5GJSL 2QQNL 4NCC1 2OI9B 1CG9B 2EKSB 4PJ5A 4RBPK 4JFEA 2VZOA 3CNKA 1VFUA 2HT3D 1K6QH 4W70A 5F6IC 3MRQB 4UV4L 3NCYP 5IVOA 1ZV5A 5F21B 1QHPA 3RDTC 2FX9L 3U7WH 4MAUH 4JM2B 4KK9C 2Q86B 2Q8AL 3VFPA 4YDJB 1GZQB 3MNWA 4H5SB 5D1QC 5ID1B 4DQOL 4U1GC 4I3RL 3MLSH 2H6PB 2Y9RT 4CNIA 3UMTA 3REVB 4NRXB 3E6HA 2CMRH 3U82B 4MDJB 5KS9A 3T0EC 5HI3D 4QRTB 4G6JL 5FA4B 1RI8A 2GJ6D 4LSRH 1TCRA 3R8BB 1EO8H 3GJEA 2HMID 1QSEE 4JHWL 3O6KL 1SYSB 1OQXA 4ZTPH 3VXQB 3JV5A 1QLEH 5DK0A 2A83B 4JDTL 3CXHJ 1C08B 3A6OA 3VGEA 3EYUH 4PRBB 4KRLB 2C5DC 3WIHL 2DTSA 4B0MM 1LP9A 5EBMA 2HFFB 2NY7L 2XZQL 4YWGH 3VH8A 5JOPD 2NXYC 2QEJA 5EZJA 4J23A 4L9DA 4FABL 2JELL 4RAUB 4XP5L 3MLXL 1RIHH 3W5NA 2Y72A 4OUUB 2MOVA 3VG0L 5HYJE 4NN6C 1A7BA 2WWKT 1X5AA 3S3SA 1ZA3A 2DQUH 5CEYB 4NGHL 2FH8A 5I1CH 2CO6B 3ZTJG 2Y4SA 3I6GA 1PSKL 3KYAA 4U33A 4G3YL 4JLRA 4ZYKA 3H42L 4NJAL 3V8CA 4JFOB 1RD6A 1FVDA 4GRWB 5J57B 5E8PA 2I9LB 3GSUA 1CE1L 4Z8FL 3QEQA 4XNZC 2BK8A 1MIML 3BO8B 1KBGL 3ARDC 5ISZE 3DV4B 4L4VE 1H9VA 2FJGB 4U1LB 5J12B 1P2CB 3EHBD 2P44B 5FDWA 2RJMA 2DJSA 3PWPB 4A2LA 2YZ1A 4LBEB 4PUBL 4WY7L 5CHNA 4E0RB 4WWID 4NIKB 3EUUA 2OZ4H 3C5SB 4Y4FA 4FQQA 5DTFA 3C5ZA 4OLUH 2OJEB 2AGJL 4Z7VF 5F8QC 4HUUB 5HHOD 4Y19A 2Y5EA 5K59F 4DTGH 3REWA 1UWXK 3I75A 1JPFA 3T3PE 4FG6D 1CFQB 3U7WL 4MAUL 1F4XH 1IEBA 4XP4L 4LF3B 3VDAA 1QA9B 4R2GD 1BAFH 4LGPB 1UXWB 2VB5A 3SE4C 3QDGD 3MOQA 4P5KA 5CZKA 3SCMB 5EU5B 3MLSL 3BP4A 1QNZH 4P57B 2BNQD 3GFUA 5DFTA 3C08H 3GEWB 4KQ4H 3OKKA 2E27L 2VDQH 3NIGE 1G7JA 1T04A 4JVWA 5HHPB 5EIIA 1NEZB 1B6UA 2O5ZL 4NT6A 3FHAA 4D0BA 3I6KB 1QFWH 5I1HL 1I1RA 4NJ9L 3O6LL 4NN7C 3TYGH 1ZHLA 3QQ4A 2NZIA 4LSVH 1RZFH 3T2NH 4ZTPL 2DYPB 5CS7A 3QG6A 2CGRL 1GGCL 1OTSC 4BZYA 2FBOJ 1GAFH 1JNLH 2ZKHL 3ET9F 1U8HA 4MZ2A 3EYUL 4Z0BH 2V7NA 1DBBL 1JNNH 5I1KL 4WHTB 1WIOA 5KSVB 5IV2B 1KPVA 3QZWG 3FFDB 4FRWA 5EA0H 4YWGL 1JZ2A 1KG0A 1OAQH 1Z6JT 4M61B 1BJ1J 1FRGH 3D0VB 1OAKH 4PBVC 4GW5A 3MJGX 5LCVL 5C0DA 2FZ3A 4EIZC 2D3VA 2AV7B 1KJMB 4LSTH 1B4RA 4EXKA 1R3IL 3PWNA 3KJ6L 3MV8A 1P4LA 4XB8A 5I1CL 2OQJB 1UEMA 4M5YH 1BLNA 1KNOB 5C07B 4QNPE 4BK5A 1I9IH 5D7JD 5IVXA 2FEEL 4Z7WE 4LCWD 1IFHH 1BX2A 4OLYH 4PJBE 4PJEF 1MY7A 1KN4H 4P2QA 2MMXA 2P1YA 2LQRA 2YC1B 4PJAE 5FYJL 4WVRA 3SJVE 2QL1A 2OMBA 4OZFG 4APQC 1J9CT 2VE6A 3FT2B 2DQFB 5GGRA 2BCKB 1IGML 1BHGA 1C5DB 4RRPA 4Z7VA 3DMMC 2IAND 3PL6C 4QRSA 4HCRA 2C3WA 4NSKA 3ARFD 4FQLL 4LCUA 3OR6A 2ESVA 4YHOH 3LPWA 5GRZA 1VPOL 4F57H 3TBWA 1YN7B 3IKKA 3QIUA 4TVPH 2SEBB 2ADJA 2DI8A 4KK6C 3W0WA 4HIHA 5BMFL 3UCRA 3ZO0A 3FO9A 4OIIH 1MJ7H 3OJDA 2E9JA 1YMME 2ZG2A 3Q6FB 3JUZA 4NWUH 4Z5RB 4BKLB 1T66D 2MTPA 4J1UA 3TBTA 3UBXI 1XCTB 1N59B 1QO3A 4JPKH 3C08L 3H9SD 3DETC 4JAMB 2VDQL 5E56A 3HAEB 4XPAL 3M8OH 3PGFH 3ULVD 3G08B 4WGWB 3NCYS 1PG7W 2GJJA 2DM2A 2GY5A 4GQ9L 4HX1A 4JPWH 3TYGL 3O3DB 4UOW1 1K2DA 4LSVL 2FR4A 1RZFL 3RKPA 5H2BA 1X4YA 2P5EA 1NFDF 3QIBD 5IK3B 1KTLA 3OJ2C 5JO5A 2XPGB 2CDFA 2Y5TB 4G5ZH 4KJQC 3MOAL 3P0VH 5C0FB 3BEVB 1FYTE 3VXSA 5HJ3A 1YQVH 4KJYA 5FAAA 1FRGL 1LK2A 3D87B 1VEMA 4JFZL 1KTDA 3BI9X 3IT8D 4HS6A 3RVWC 1UZ6F 2A1WH 5DDHB 1M1SA 1FORL 3X13B 5AG9A 1DQML 1P7QB 2EYSB 1RZJC 4S1RH 4PJEA 2AK4B 2M1KA 5T1LA 4JFPB 1FFPB 3DX6B 3HC4L 1JTTA 2IBBA 4GRMA 5HDOA 1I9IL 1XIWC 3KPSE 3A6CH 4Y5XB 3SDDD 5JW3H 4PP2B 4U31A 3MV7A 4X7FC 2YA0A 2V2TB 4LVNB 2PR4H 2XA8L 3L3KA 3SPVA 4X6FA 5GGSA 4HZAA 4HKZB 3UAJD 3L1OL 1KCLA 3F5WB 4I0KA 1GOHA 3ROLA 1KIPB 3RX7A 1AR2A 4HKJA 4JQVC 5H35B 2WQRA 2MCPL 3V6ZA 1XZ0A 1UM5L 5D2NB 4NZTH 1C5BL 5EOQL 4YAQA 2NNAB 2NY6D 1JZ4A 4IRZL 4L9LB 3C5JB 4BZ2L 4MAYB 2J8UF 2LV4A 4U1IB 5DLMH 4F57L 5C3LD 3O0RH 4ODBD 4TVPL 5LGHH 1SJEA 3F7PC 3KLHD 1KEML 2EDEA 4NRYB 4MJID 3AS1A 4Y0GA 5IGXL 2J5LC 5TE4L 4LIQH 5L2KA 3D3VE 4PJ7E 2P7TB 3T3MF 4FFWD 1T1WA 3WFBL 1QHOA 4NWUL 1SMOA 2NY5H 1BF8A 2PO6D 4FP8H 1NCTA 5F7MC 2ZUXA 5FOBB 3ABZA 4LLUA 5I8OL 4JPKL 3FTGB 3HNSL 2OR9L 1I9JH 2VITB 3JWDH 1MQKL 5FIEA 4QHUA 3M8OL 4CVZB 1NFDA 3PGFL 2MNUA 3L95B 1T21A 4O02H 3S96B 3LQAC 1W8OA 3ZKNC 4G42A 2HRLA 1E4JA 4YH6A 5D8JL 4Z95H 1LE9A 4HKBB 2VABB 3CUPA 5GZND 1A3LH 5K9OA 3DHMA 3DUHA 3RDTA 3WIIH 4XH2A 4JFEB 3WSQL 4A2MA 2C1PA 3NCEB 4WTXA 4G5ZL 5D1QA 1RIVH 4KK5D 1ACZA 4QHLA 3GMMA 1DBAL 3E6FA 1EX0A 1IGJA 3VFPB 5MEOB 4JN1H 3B9DA 3FCTA 3MNWB 1QRKA 3T0EA 4CU6A 5L8LB 2FEDC 3R1GH 3IJSB 5MP6H 2J12B 2PXYC 5D70H 4YHKH 2A1WL 4P59H 3IAQA 3ORJA 5EZLB 5KS9B 3FQRA 4PG2C 4CL7A 1MFAH 4R90L 5BRZB 2FATH 1EGJL 3VXMD 3PNWA 4GXUM 2G60L 4U0RC 2GT9A 3GJEB 3NTCL 5BOZG 1CLZH 2OTUA 1N4XL 4ZO8A 4XAKE 1D3CA 4RQQA 5J4MA 2AQ2A 1ACYH 3CX5K 5CGTA 3IYLW 5E8DH 3O6FD 4OCWL 4UB0H 2QBWA 4N0FB 5DK0B 2OP4L 2VDLH 1J12A 2YBRA 3QUKA 5E0QA 3FRPA 4LKCA 4OCXH 2QV2A 1UXSA 4WO4D 3VH8B 2J8UA 1U95A 3PG2A 3LMJH 1SY6H 4LLDB 4MQTB 4DGVH 3DO3A 5C6TL 2HLAA 5JMRA 3HKFA 1JZ7A 3HUJE 3IDNA 5A3ID 4EQ2A 1CBVH 2XOTA 2VDOL 3MX0A 3NFSL 3F6IA 5IROC 4M03A 4WI8A 2QJDA 1OW0C 3O0RL 2X42A 4N5UA 1QR4A 4MJ6B 3I6GB 4JLRB 3O4LE 1A6AA 3MGOA 5JLZA 4ZYKB 1U9KA 5BVPL 3NGBB 4QTHA 4H0GA 4LIQL 2EDHA 2R0LH 4M93B 1IZJA 4RGOH 3BYTA 1MJUL 2NY5L 3RAJH 2PYEA 4FP8L 4OGXL 5J8OA 1BP3B 5E8PB 3ULUE 3SKMA 2N4IA 4P46B 3ARDA 3OAUL 1S78D 3ZT5A 1F2XK 1DBJH 5KG9A 5CJQL 1QBML 3GSUB 3QEQB 2QTEA 3W11C 3TCXA 1MF2H 3E1F1 1U8IA 1XF1A 5FDWB 4NKMA 1JHKH 4PJHB 4U6YA 2X6MA 4MS8C 3RKDD 4FFZH 4WHYH 3EBAA 5FO7A 5CHNB 3V4VH 2V7HA 3OQ3B 3T3PF 4YHYB 5EU6E 3LN9A 3MJ8A 1VGEH 5EOCH 4Z95L 3IFPB 4Y4FB 1A3LL 4FQQB 1QSEA 3B2VH 2DBLL 5DTFB 3C5ZB 3S36H 1NANI 3NCJL 1UEYA 5E7BA 1MLBA 1I8LC 4Y19B 3GKWH 4WFGE 1JGEA 1NUDA 1V5JA 4JM2D 1RIVL 4QYOB 3REWB 3SE4A 4YNYA 1JPFB 4G7VL 5DJ0B 3VE0A 3IFLH 5CKAA 3GSRA 1IEBB 3PV6B 4TOYH 2AQ1A 3MRKA 2YUXA 4P5KB 2ARJA 1RIUH 3X17A 1YMHA 3IJYB 5CGYD 1G7JB 4GT7A 4NT6B 4D0BB 4O4YH 1JF6A 2DL2A 2VKXA 4F7CA 3FOMA 3SKJH 5HYJA 1ZHLB 5C08E 3QQ4B 1P5VA 5EH1A 2Z35A 1ACYL 4HXBH 1J0HA 3VXRB 4M6NL 3ARPA 5FUOH 3WFDH 4RISL 5DD3L 1IAIH 2D9QB 3DUSB 3DX7A 4GKOA 3TPKA 1UM4L 2OM5A 1U8HB 1F4HA 3RHWF 3CJJA 1P9MC 4KDTC 1KPVB 3LIZL 4ZPVA 4HWEH 4KJWD 2X7LB 1T7VA 5IW3A 4GJTB 1KG0B 4TULL 1PD6A 3OMZA 1RZGA 3WUZA 4GW5B 3QQ9C 2B0SH 2YKLL 4QNPF 3L3IA 4Z7WF 1A22B 3GBML 5FCSH 1OAXH 2EXWC 3LD8B 4M7LH 3RBGA 2GTZA 1CR9H 3ULUC 2H45A 3MV8B 5ISZA 5ADOH 5I15H 3A67L 4L4VA 4PRDA 4I4WA 2A9ML 1BLNB 2P8LA 2W0FA 3QXDA 1N2RA 2CRMA 3ARXA 3ES6A 3RJQB 5IVXB 3S37X 1FDLH 1BX2B 4YXKL 5IG7B 4WDIA 2YZ8A 3OF6D 3QULA 4APQA 5JXED 4KKBC 1Q0YH 4MDIA 5LXGL 3GBNL 1CU4H 1DBJL 1ZLSL 3DMMA 3QUZC 2VE6B 1MF2L 3KNBB 3PL6A 4R8WL 1AXIB 5GGRB 2WW8A 3PWPD 3NAAL 4OLVH 3MLRL 4YHPA 1LNUA 4QRSB 2Z4QA 3O3UN 4NSKB 3CDYA 3DVIA 1MFEL 1XF3A 4DAGL 2BERA 3O2DH 2L7UA 3VGFA 5K9KA 4LCUB 2WLZA 2ESVB 3HNTH 3OR6B 1JYNA 2L7JA 3MV9D 4HCRL 1RJYA 3QIUB 3TBWB 1QFUL 3B2VL 3TO4B 5C0RH 2ADJB 3FO0H 1XH3B 4OAWB 3TH3T 4TSCH 4U1NB 2X4UA 5CJXC 4RWYH 3PWVA 3GKWL 3W0WB 5FYLE 4HIHB 4PJDE 2QR0A 1AQKH 3FO9B 3MLUL 1WFUA 3IFLL 3SCMD 3RIFK 4J1UB 5FYKE 3TBTB 3CSYA 3EYQD 5TF1L 1FSKB 1QO3B 1G84A 5F3HA 9CGTA 2F8VA 4L3EB 1AI1L 3SKJL 2IEPA 4HX1B 5HHME 1GGIH 2DYPD 3DYOA 4ZS6D 1BFOB 2FR4B 1K2DB 2VDKL 4Y16C 4XCFL 2NW3A 2A9NH 2R0KH 4HXBL 3WFDL 1CL7I 2IFFL 1F5WA 2VZUA 1IAIL 5H2BB 2QQLH 3O4OC 1KEGH 1KTLB 5JO5B 2CDFB 2DJ4A 4QF1A 2Q7NA 2GQHA 4GFTB 4Z7WA 1CFBA 1OL0A 5GRVK 2F5BH 3LY6A 3PJSA 4BQ8A 4PJBA 4R0LC 1CTOA 1K8IA 5HJ3B 3O9WB 3TIEA 4KJYB 4XVSH 1SM3H 2HA1A 4PJAA 3WHE1 2QQKH 4YQXH 2WINA 1I3GH 1KTDB 3IF1B 3SJVA 1F2QA 1D6EA 4HS6B 1CVSC 5ITFA 4JKWA 4AEIH 4P48A 1EA9C 5KW9L 3TFKC 1OAXL 1M6OA 1XGPA 1X7QA 3DSFL 3P9MB 4PJEB 4R4FL 4TN9A 1XIWA 5EZOH 2H8PA 1DQLH 2ITCA 5T1LB 1VERA 5C07D 4HJ0D 4GRMB 4K9EL 5TQ2L 5FYJD 1HILB 2Y7QA 3MV7B 3N9GH 2N56A 4X6CE 1F11A 3SPVB 4MNQE 3LRHA 2AVGA 1LDPL 3G5ZA 5GGSB 4CN1A 3X11B 3WXVL 1Q0YL 5M7QA 3LKQA 4JQVA 5BW7C 3NFPA 1OSPH 5A2KH 3ROLB 4NNYB 2VKWA 4R97B 1V7NL 1YMMA 2WIMA 5FHAL 4FQCL 2AI0L 4P49A 1YN6A 1DL7H 3IDYB 8CGTA 1XZ0B 3B8SA 2ADFL 4YAQB 1G7HA 1KXVC 4YHNA 2VR5A 1ZGLB 1LILA 1BIIA 4PJ7F 4G6AD 5CIPA 2PETA 1S9XA 4HBQA 2HJFA 4L8BB 5F7WC 3OKYA 3BQUB 3T65A 1SJEB 4Z76A 3MACL 2A74A 3G04A 3B4NA 4HEPG 2EEAA 4CJ1A 5MEQA 3MFFA 1AY1H 5L2KB 4ZNCD 4CADA 3CFIC 2ORBL 3LB6C 1JWSA 4WFED 4ALAL 3MRPB 3C6LB 1XFPA 3LCYA 3OG4B 4L5FL 1IEAA 3J7HA 1SEBA 4QXGH 3UJTL 4BM7A 2Z9TA 4RMSA 4LLUB 1T89C 4FXLA 4ZD3H 1FYTA 2KZWA 4QRRE 1RUMH 4WWKC 4J4PD 4JDVA 1NCNA 1NFDB 3KHQA 4CKVX 3EDJA 1T21B 1FL3A 1R5VA 4X4XA 3WD5H 2K7PA 4RDQF 4G42B 2AV1A 1NCDL 4XPHH 1FNGA 2D7TH 3UO1H 4JPVH 3ZE2E 1LE9B 1J1XL 4XPFH 2M8XA 4YFLI 1M7IA 2QQLL 1E6OH 2XKSA 5F6IB 1AO7D 2B20A 4H0HB 4F37K 3R06A 4UT6L 5C0BB 1HNFA 3KPSA 3AB0C 2C1PB 4FMFA 5GGTL 5D1QB 3VXNA 4K23H 4PTUB 1UADC 1QKZL 2OJZH 2IC2A 4QHLB 4MCZA 3GMMB 4XRCA 2PXYA 5KVFH 3E6FB 1IGJB 4XVSL 5JZ7D 5FUZH 3FCTB 4PG2A 4M6MH 3T0EB 2P49B 4YQXL 5F71A 3GUTA 2O93L 3EYOA 4N1HB 2IALA 1ERNA 1P7QD 4YO0A 4BUHA 4AEIL 2AK4D 4I8DA 4KC3B 1I1AC 1CN4A 4WUKH 5IQ9A 1UKSA 2GT9B 2VR9A 4MCYA 5T3ZE 1WC7A 3U48A 4KTEH 4RQQB 4MB5A 3N9GL 3CMGA 1A2YB 2Q3AA 3AMKA 3B9AA 2KDGA 4G8FB 3CSPA 2NXYB 1IGTA 3HUJF 3QUKB 2VXVL 4LKCB 2DLFL 3D3VA 4EQ3A 4P3WA 3SKNA 1TCMA 2J8UB 1U95B 3DBXA 1JHTA 4NN6B 4JY4B 2CDEA 2HLAB 2R29L 1B3JA 4YDLB 1OWWA 3OB0K 1IGYA 1PKQE 3IDNB 4I18B 5DMGD 4FFVC 1YNLL 4TVPD 5IROA 4X5XA 4RFNB 1OW0A 4MAYD 4MA8H 5D7KE 1MFNA 1PBYA 1QFOA 4ZQKA 1MUJA 3PF2A 5I1GH 4HS8H 4IM8A 2LVCA 1A6AB 5JLZB 3GHEL 5GRYA 3FB7A 3CMOH 4QTHB 4JZJC 3V6FB 2IBGA 3MLYL 1E4WL 1WTGT 3MR9B 4UILH 5J56B 1HH6A 2Z8RA 2PYEB 1WIUA 4JM4H 4DUWA 4X9FA 4YUEH 3SKMB 4FS0A 2BVQA 5EUKA 3O6MH 4R7DA 5KG9B 3DNKA 1FHGA 4UT9L 5DEGA 3C2SA 3V95A 1U8IB 3BXNA 1ZT4A 4NHUB 4EI6A 1JRHI 4FQXC 4UT7H 4U6YB 2HT4C 1OM3H 3WD5L 4J3VA 4LHUB 5FO7B 4B53A 2IBZY 2V7HB 2D7TL 3K0WA 2VC2H 5F44A 1I8LA 3MJ8B 4JPVL 1Z0NA 3RPIB 5JHDE 2AABL 1QSEB 1N6UA 4JFED 5CJOH 2X70B 4XX1G 4IMLA 5E2TH 2FECI 1N64L 1KJ2H 1OLLA 3ESUF 4O51A 1JGEB 1F00I 2C1OA 1EFXA 4W6WB 4YNYB 5FV1L 2ENYA 5K9QI 4U6VL 3VE0B 1NUNB 1YEIL 5KVFL 4E41E 4TUKH 4PJIE 4M8QA 1F4YH 3MRKB 2R2CA 3QDJE 1DQDH 3AVEA 2ARJB 5DQDH 5BRZD 3PHSA 1KENH 1HI6A 3O2WL 5DJ8A 3V4UH 2IJ0C 4NN7B 4ZO7A 1DJSA 4I3SH 2FL5A 3QEGH 2BOCA 4M3JA 4WUKL 1IJ9A 3HUJA 4F7CB 3FOMB 2IMMA 4D0DA 2V5YA 5HYJB 1BZ7A 2VLRE 1PG7H 5J89A 3FQTB 1YJDC 2VXSL 4HGMA 2Z35B 2D9CA 1HHIB 1P9MA 4KDTA 4F7TA 3DX7B 1A7QH 4XXCC 2LU7A 3SDXE 3QXAA 3O4LA 1W0WA 5GIRA 2X5PA 4GXVL 4XMKL 1OTTC 4ZPVB 2VSCA 5I73C 3WFHA 1ADQA 3IDJA 3PWUA 4ZG1A 2DD8L 2J3SA 1K4DB 3D69A 3RVTC 1RZGB 1IGFH 3CFJB 2AJVH 2ZCKH 3MROB 4WHDA 3IS0X 2J1KA 3FONA 4MA8L 5TPWH 5IB2B 3GM8A 1TIUA 2ZNWA 1CTNA 3MXVH 1CXLA 5EBWA 1PYWA 2GTZB 1VADA 5ISZB 5I1GL 5D5ME 4L4VB 4HS8L 3KXFB 4JB9L 4MX7A 4I4WB 4P3CH 2P8LB 4X6EB 3EKCA 2W0FB 3QXDB 5HYFA 3ES6B 5E6IC 5JHLH 5ESVA 1A1MA 4U4BA 1NEZG 5EU6A 1T20A 4ONOA 2BJMH 4TTDD 4UILL 4XC1L 2C3VA 2BRQA 4NHCL 2P45B 5AD0A 3QULB 4APQB 1OAZH 1I7UA 4P46D 3VD3A 4CU8A 5GXBB 4JM4L 3QUZA 4MDIB 4ODHL 1F8TL 3MOBL 3QEQD 4UDUA 2X1QA 5EBLA 4WJ5A 1LD9B 1T0MA 2XFXA 1WZLA 2VXQH 3U7YH 2QSCH 3UPCA 1JBJA 3EJZC 4Z7QF 4LLQB 5LGKA 2C3HA 1LO3L 3BVNA 4UT7L 2H3NB 3TV3H 1XF3B 4NUGH 5K9KB 2DQIL 5IW6B 2CK2A 4Y4FD 1DE4B 3OHXB 5CJXA 4ZFFA 3C5ZD 2ZZUT 1ZHBA 2FH6A 1RJYB 1FNEA 4J2XA 5AZEL 2A77L 1SVCP 1A14L 1TZIA 4LL9A 1QPPA 5E2TL 4OD3L 5C08A 2X4UB 2E7HA 1H3PH 5LJYH 1X5ZA 1XAUA 2QR0B 3MGTA 4RCAA 3SO3C 4XWGH 2XKUA 4ETQA 1H8OA 4TUKL 2X1OA 4KVCH 4KZDL 2YRPA 3V5DA 3CSYB 3W39A 3SKOB 1RU9H 2AJ3B 5F3HB 1U8KA 1F4WL 3LHPL 1CQYA 3ALPA 15C8H 4OGZA 4U05A 4Y16A 2ADGB 5BZWA 3VXPA 3LQAH 2NY0B 2C7UA 5K9JL 3FOLA 3VXRD 1INDH 1JNHA 1E4XH 4YBQD 1EUTA 1Q72L 1UWXH 1LEGA 2Y06L 5EULV 1YC8A 3KJ4C 4ERSH 5JW5A 1NGXB 4QF1B 4R0LA 4M43L 3AM8C 4Z78A 4C58B 2EH8H 1SBSL 4XHJD 3WKNA 3BRDA 1X5KA 4PJBB 5DUBA 1F42A 1FH5H 1K8IB 2EIEA 4R96A 3AAZB 4JG0H 4OF7A 4ZDHA 3TIEB 1KC5H 4PJAB 1IGFL 2WINB 2AJVL 5JIHA 3SJVB 5ITFB 1INQA 3MV8D 3JUYA 1RZJL 3X3FL 4X6CF 1M6OB 1XGPB 3MXVL 1XIWB 4QHMA 5C92A 1HN1A 4G6KH 4NQTA 4K3EH 3F58L 1VACB 3CFDA 4DW2H 2VXTH 2DKUA 1JGLL 5JHLL 1FCCA 2Y7QB 3HAEG 1RHHA 3MRHB 1IC5L 1PJ9A 1Z9SA 2X44D 4LLAA 2QADC 1BEYH 5BW7A 5CKGA 2W38A 5IKCA 1F11B 1RUKH 3VW3L 3U4AA 3G5ZB 1OAZL 3LKQB 3T08A 4PJDA 3S5LA 2VQ1B 4F7EA 5DD6A 4GMSL 1YMMB 2VXQL 3G6AA 2QSCL 1XF5A 4YDKL 3WLWC 1YN6B 4L29A 3IJHB 3N1GC 4AYFA 1J87A 4LDOB 1OAUL 1CXIA 2XI9A 2ESVD 1MFCH 4Z0XA 1G7HB 4YHNB 5E94B 4NUGL 3QIUD 2YOCA 5CIPB 3TO4D 5T33L 4WV1C 3CH1A 3QSKB 4MZ3A 2XA3A 3EO0B 2M26A 4Z76B 3HE6C 1R24A 3C87A 3TA3B 3W0WD 1X5YA 2A74B 3G04B 5KBNC 3FJTA 5MEQB 3MFFB 2WUCH 4CADB 2NTFA 4XWGL 1MCWM 1T89A 3OKEA 4KVCL 5ALCH 4WWKA 3MRLA 3UTZA 1IEAB 1EDQA 1QPXA 3BN9C 1FYTB 4JGMA 4L3ED 4JDVB 5D7SL 3AU1A 1J0YA 3ZE2F 3KPTA 3BRFA 4L8CA 3HB3D 1AP2A 3BT2H 4JFQA 1FL3B 1R5VB 3HC3L 3LQAL 4X4XB 1AFVL 3IFOB 1E4XL 2AV1B 1S7UA 3QCTL 2AXJA 3BN3B 1FNGB 5DQ9A 2XTJB 3QDGE 3EOTH 5D7LE 3QHFL 3UYPA 4XCYA 3R06B 1ZXQA 3KPSB 2P8MA 4XVJH 2EH8L 2MQ3A 4U6HB 5F96H 3VXNB 3O9WD 4X6CA 4GXUN 4MCZB 4XRCB 3TGXA 2PXYB 3ARTA 3S9DB 3KLSA 3LS5L 4KMLB 1X5GA 1NC2A 3T09A 4PJXF 1I1AA 2HG5A 2IALB 2A6DA 2NZ9D 5ITBH 4JANB 2X4QA 4J6RH 1VENA 5T1LD 4BFIA 2Y36H 4OD1H 1TETH 1I7ZA 4UNVA 4OZHB 4K3EL 5IQ9B 5DD1H 2HWZH 4DW2L 3SGEI 1KLUA 3MV7D 4LARH 4PJGE 4BQ9A 3BX7C 4I3GA 4LLYA 4PRHD 1RUKL 4ESKA 1P6AB 3MRBB 1IGTB 2ERJB 4Z77A 1I8MB 5MEND 1N6QH 2YRLA 1MCHA 3D3VB 3INUH 3SKNB 3UJIH 5ICYB 1SJHA 1JHTB 2CLVA 1P69B 2CDEB 3VFNA 1ADQH 1C7SA 1IC4H 2VLJA 1UKTA 3EHBC 4G9FE 2DICA 4X5XB 1RK1B 4QRRA 1NBYA 4Y4HC 1MLCA 3FHQA 3BQUD 4TNWK 3UZEA 4ZQKB 4OTXH 1MUJB 4XCNA 4JZJA 3EYFA 4A6YA 4JO4L 3U0WL 3P3YA 4GKNA 1ZA6A 2DQJH 2YHGA 4LSPH 5L2KD 3EGSA 3FB7B 3ZDXE 3ZKMC 1MAKA 4ZUWB 3STZB 2FX7H 4ONFH 3C6LD 1K3ZA 2IANE 1OP5K 1PY9A 1E28A 4R2GC 3NIDF 2B4CC 3DOSA 2A0LD 4EIGB 2BVQB 5EUKB 4QHNA 5ABDE 5DEGB 1N8ZA 3KYNA 3VFVA 4FQXA 5L88L 1OP3K 4JR9H 1IBGH 2KQMA 1OGTB 4XNXH 1ZT4B 1S3KL 2CO7B 2EO9A 5FF6B 5AYUL 3BT2L 1ZT1A 3QQ3A 1KT2A 3WXWH 1HSAA 1JYVA 2Y25A 4NM4H 4Z9KB 2FYYA 2HKFL 3NFNA 4S1DD 4GW1A 5DUPL 2EIZA 2BC4A 3EOTL 4KK9D 5C0BD 4PJIF 5JR1L 3CCHA 3ISWA 5D1QD 4IMLB 4NBYB 4KKLC 3NZHH 1V7MH 1RZIA 4O51B 4X7SL 5F96L 2C1OB 1GCFA 1EFXB 1PLGH 2GI7A 3T0ED 4LEXH 1H3UA 1A7OL 4X80H 1GPOH 4M8QB 1JV5A 4YPGA 5KANG 1DN0B 1WV7T 1JK8B 1MEXH 4MB4A 5DJZA 5E9DA 1FE8L 1HI6B 4J6RL 5DJ8B 2QLVB 4OD1L 4K71B 2FL5B 1AQDA 4DGYL 3SDXF 3HUJB 1PKQA 3OX8A 4D0DB 4HQQH 3P0YL 4XXCA 1BZ7B 1G7MB 3DECA 1Q38A 3MFGB 1I3UA 4F37F 2NXYD 2J6EH 1ES0A 3CLFL 3FAXA 3QXAB 3O4LB 1LE5B 1W0WB 2R0WH 5EWIH 5GIRB 1NQBA 1U92A 3WFHB 3EOBB 5GRUH 3IDJB 3PWUB 1OCWL 3GZKA 1C1EH 1HHHB 4YE4L 5IHLB 3QZWA 1LQSR 2CXGA 3WV0A 5CJ8A 3X12B 1DN2A 1RAMA 1IC4L 1IARB 5C0EA 3SOBL 1MCJA 3FONB 3AXLA 3RUGA 4H1LG 3ULUL 5EBWB 5E6IA 4UAOC 1VADB 2Q6WA 5JIIA 4LLVA 1ONQA 1NGPL 1U41A 4UNTA 1NC4D 4LSPL 2BVTA 1A1MB 2DKSA 2VLLA 2YA2A 4R7NA 5DMJB 1NBVL 1T20B 4RMTA 2ZCHL 2PYED 2C3VB 3W81A 5AD0B 5JHDA 3HTLX 4XPTL 1I7UB 5EIVA 3MQIA 1T66C 1U8OA 3QUZB 4HWBA 3DO7A 2G2RA 1VESA 4UDUB 5EBLB 1MCRA 4WJ5B 1T0MB 2XFXB 4L3AA 5AUMA 2E5EA 1GYAA 4E41A 1TTGA 5FYLH 1AD9A 4OZFA 4PJIA 4XNXL 4MJIE 3UC0L 3QDJA 4K7PH 2FIRT 4LHUD 3P30H 3D25A 3BVNB 4NQDA 1RVFH 4FQ1H 4ISVA 5FYKH 3DYMA 2VL5A 1QSED 2LAGB 3MUJA 1ZHBB 5DWUH 2ZPKH 1FNEB 3DROA 3QDHA 3PDOA 3MLWH 3QIBC 4KDWA 3K2UH 2VLRA 4ZNEE 1V7ML 1U58A 2WLYA 3MGTB 3I2CL 5T1KA 2EE3A 5SV4A 3SDXA 4KVNH 4LU5L 2XKNA 3IDMA 5TF0A 4LKXA 2RR3A 3V5DB 1UYWL 3MO1A 1DANU 3RVVC 5GISH 4XXDA 4RIRA 1TTFA 1JHLH 1CFVL 2I07B 5C7XH 3EOAA 1U8KB 5GS2H 4Y16B 5BZWB 3VXPB 5HYJD 1CD1B 1U8NA 1YPZE 2C7UB 3T0DA 2GAZB 2XY1A 5DS8A 3O4OB 1JNHB 3I84A 3AM8A 2F53E 4O2CA 4BUGA 3Q2CA 1FV1B 5D5MA 3KYOB 5JW5B 3CVHH 4OD2A 5CMAA 1MHHA 4R0LB 1LO2H 4KTYA 3UAJC 3NA9H 5IVNA 3VXME 1JCKA 1CF8H 1QR1A 1R5WA 2BFVH 1NMAL 5DUBB 3LDBB 3S6CA 4ZDHB 2QHRH 1W0VB 2Z8SA 4NNXA 1TVHB 2VOTA 4ZOAA 5BXFB 3QXUA 1INQB 1LO5A 2NY6C 2WBWB 5ISZD 4L4VD 1E27B 3AGVA 3KXFD 4QHMB 4K8RL 5DK2A 3U2SA 4OT1H 3CFDB 4B5EA 4G8EA 3KLHC 2VO5A 1I85C 1INEH 4M48L 3SHSA 1J5OH 1QSFA 2ZSWA 5EB9A 1RHHB 5IKCB 4APQD 1MIEH 1F6AA 2VSDA 3BHBA 2NY1C 4FFWC 1K4CA 5EO1B 1NBZA 5DHVH 2BHUA 5BS0B 1EJOH 4BJLA 1GXEA 4ZUTA 4PJDB 4OLZL 3G6JA 3S5LB 3TC9A 1WBXB 3DGCR 3D2UA 5DD6B 3ZKXC 4F7EB 1CVRA 1OT2A 3G6AB 3HC0A 5FYLL 4L29B 5JDJA 4HS3A 4MYWB 2R1XA 1QRNE 4WV1A 3VMOA 1RVFL 3BUTA 4KK6D 3MLVH 4U1JA 1G0DA 3I3EA 4FQ1L 3HE6A 1D9KD 4P2YA 3C8KA 2D4DA 3CH1B 2ZPKL 2YPVL 2BY2A 5HHMB 5DF0A 2HH0H 3DRQB 1OARL 3VFGL 3MRNB 3WS3A 4NQXA 4OCRL 4Q9RH 4EUPG 3D0LA 4A6YH 5DD5L 4LQFH 1MWAA 4G43A 1P7KA 3RBSA 3VGGA 3B5HA 3DETD 4FN0A 3PQYE 2NTFB 5FKAA 4NP4H 5HHNA 4YK4C 4JJHA 5JOFA 5I1IH 3OKEB 4H88H 4WWKB 4I2XE 3MRLB 1OGAB 3ARZA 5J6HB 3HFMH 4BSWA 1JZ3A 4HMCA 3GMQB 4HUVA 3E3QE 5GISL 3AS0A 3MXWL 5E8EA 1ZSDB 3VRIA 1JPTH 3AU1B 3LEXA 4QLRA 2NY0D 5EFIB 5GGUA 4L8CB 4ODVH 1AP2B 1DBKH 2NW2B 5IT2L 1S7UB 4Z6AT 4P3DA 1YEDA 4KJQD 1IC7H 5DQ9B 3OJVC 1YEGH 4OB5H 3HA0A 5L0QC 5C1MB 1LMKA 2ED9A 2VUYA 3ZT6A 3FO1A 4XCYB 5FK9A 2HFTA 4MNHA 3FT3A 2P8MB 3NA9L 3TT3H 1IT9H 2WBKA 4OFKA 1PDKA 4WO4C 1MCDA 3ZDZE 3H8NA 3HPLA 3IGAA 3SJVD 3C9NA 1VFAA 1TPXB 4FNLH 1WICA 4P2RE 1I1AB 4NKOA 2HG5B 1FLRH 5A3IC 2JF1A 3HR5A 4JPIA 1XIWD 2X4QB 2IGFL 1YEEL 1P4BH 4BFIB 3J8F7 3H0TA 1ITCA 4MJ5B 4XBGA 3ZSTA 4HXAL 2AJZB 4LHQB 1KLUB 5HI4D 5FM8A 1G0YR 1INEL 4CAGA 1N0XL 4S2SA 3U4BH 4LLYB 4XX1E 1M05A 1MFDL 1C12B 4TSAH 3AMLA 5T5FL 1ZK9A 1B0GA 5T1DH 1S78C 3FQXA 5IB4A 1BQUA 3H3BC 1SJHB 1A1NA 4NOBA 4RMWA 2OYPA 2B1AL 3VFNB 4F2MA 4DGIH 4Y4HA 1RZ8A 5A2LH 2VLJB 2NTSP 5E8OB 2VXUH 3D85A 2YS4A 3LV3A 2OTWA 1NBYB 4QRRB 1T1YB 4IDJH 3D5OF 4MWFA 3TA3D 4JZJB 3EYFB 3TLRA 1FPTL 3E3QC 1G1CA 4M7KH 1ZA6B 4HWNA 2B39A 1UFUA 3ARGB 4LQFL 4RMUA 4DOHE 5TE6L 3QDGA 1GL4B 3CFBA 5D7LA 6FABH 3V6OE 1A8JH 1MCLA 3BGFC 3BKJL 5BVJA 4H88L 4W6YB 1B0RA 3OXRA 2VDNL 4QHNB 3MUHL 3ARBB 3MV9E 3OV6A 4RWHA 3QWOA 1AE6L 1N8ZB 4BQ6A 1E4KC 5CGYC 1OVZA 2EDBA 1WFTA 3ARVA 3BUYA 1JJUA 4ACPA 3GMRA 3QQ3B 1KT2B 2V9RA 5F7DB 1UB6A 4IEFB 4OZFH 2XTJD 4I13B 3EFFA 3GSVA 2DI9A 3CXDH 1HSAB 3NFNB 5I1DA 2OK0L 4GW1B 1U8QA 1YEGL 2EIZB 3UROR 4HFWB 4XVUC 3FQWB 3O3EA 3KPSD 5DEZA 2ZUYA 3GGWA 2FEDD 4PJGA 1RZIB 1EZVY 2PXYD 1ZT7A 1PZUB 2G5RA 4JGUA 1RURL 1U3HD 4KAQL 5E2VH 5IFHL 2W91A 3RZWA 2ICWA 4YPGB 1WF5A 4Z7OE 4OSUL 4XZUA 5E9DB 4YHML 4HIJB 3D39D 1EMTH 4RZCA 5DFWH 4G9DB 1AQDB 1I3RA 4HMDA 4WHCA 4DVRL 5B8CC 1PKQB 3B5GA 3OX8B 1CK0H 3D6GA 2HT2D 4G9FA 2VR4A 1EVTC 1S7RA 1YJDL 2F58L 4X98B 1Q1JH 2AXFA 5GRVL 3U4BL 2WQ8A 1HH9B 4D0CA 1J0ZA 4HH8A 1S9WB 1ES0B 5I73B 1MELA 3MRMA 4KI1A 4N8CH 3D3VD 1WFNA 5L8JB 4LHUG 3ELAT 1U92B 3AY4C 1HKFA 4BH8A 4GAYA 1Z9MA 2JJSC 4W4NA 3QZWB 2IANA 5FYJE 4LOUC 4K3JL 5CD5C 4DN4H 4JQIL 3V6OC 4WENB 1Y6KR 1MCPH 2VXUL 3RUGB 3PUCA 1MCQA 3MBEC 5D2LF 2GK2A 2NY3C 5E6IB 4YC2C 3T4AA 3QUYD 4LLVB 2VYRE 1ONQB 5DA4A 2JJWA 4C54A 2VLLB 2CKBB 5ILTL 4JHBA 4H26A 3W11D 5JHDB 1U93B 3NZ8B 1R0AL 4HAGA 4LSQH 2CKBL 1WZ1L 3L3JB 3OB0H 3KAAA 1U8OB 2NLJA 3U0TA 3BJ91 2G2RB 2P8PA 4U1HA 2YRZA 4MS8D 4NFCA 4OCSH 1KCUH 4ONHA 4HWBL 4NQCB 2F54E 1AD9B 3D9AL 4MSWB 4EDXA 3QDJB 3VFOA 4R4BB 4NQDB 1A3RL 4XPBL 1XEDA 4TNWF 5ACMA 1TDQA 3ZKSD 5IFAH 5JNYA 1QFWM 2FLRT 1JTOA 3CXDL 3QIBA 4KTDL 4HHAB 5FEBA 2MWCA 4ODUA 2BNRE 4TQEH 1EUUA 5BQ7A 1QVOB 3EYVA 4BA8A 2QSQA 1EJ6A 2IQ9H 4XAKD 2IMNA 4OKVA 3SO3B 4QKXB 2KL6A 4OF6A 3HI5L 1EFXD 2ATPB 2P24A 1M71B 3OPZL 4X9HA 2ARJQ 5HY9B 3VI4E 3SDXB 2V2WA 5GHWL 5J06A 4WEBH 3IDMB 4LKXB 4MD5B 1YPZF 4HULB 3BZ4A 3MRGB 2XQBH 3GBLA 3MO1B 3NCMA 1FGVL 5IOPA 4XXDB 2YSSA 2FHFA 1L7IL 1AO7E 4PR5A 4FHBD 1KULA 3EOAB 1WZKA 1S8DA 3PHQB 3LEVH 1HWHB 4HJ0C 4X6DB 1CK0L 1HE7A 1D5IH 3KJ4B 2W07A 5DS8B 3T0AA 5ERWA 5J0BA 2V17L 3A6BH 1IAKA 4FZEH 4O2CB 1T7XA 3TWCH 3BGMA 1BQLL 5D5MB 1I7TA 4GMTL 4OD2B 1VHPA 5CMAB 5MHSE 4I9WE 4N8CL 3QQ9D 4NO5A 4PLJD 5IB3A 4Q6YA 3KYMA 1QR1B 4X7DC 1R5WB 2ZUWA 3MRJA 3ULUD 3CU1A 5T3ZH 2R69H 4OI7A 4NO0B 4OZGE 1FGNL 1XGYH 1U2HA 2XACC 1LO5B 1O5DT 3V52L 1QLRA 2D31A 5IF0B 4LK4A 1YQ2A 1I85A 1NGWB 5DK2B 1L7TH 1D5XB 1AIFA 4G6AC 1FCGA 4UU9B 3BW9A 4MJIA 3TYFB 2DAVA 2QADB 1BOGA 3PDDA 2BVYA 4QRQA 3HCVA 2O5XH 5D2NE 1QSFB 2ZSWB 1AC0A 3S37L 3THMH 1F6AB 3PABA 3TH2T 1K4CB 2AEQL 3GJFK 3TVMB 1NBZB 4ZNEA 5CINH 3KLDA 4ZUTB 1NDMA 4JHAH 3G6JB 4YHLH 3EO9H 1I3VA 3D2UB 1F3DJ 1W8NA 1Y0LA 4H8WC 4YZFF 4LPXA 2R1XB 2DMBA 1D5MA 1K8DB 3T0XA 3HE6B 1LO0H 2CLZA 5FKPA 4BH7A 4RNRA 2BVPA 1VDGA 3JXAA 1HHGA 4KZEL 1YPZA 1B9ZA 2VH5L 3WS3B 4QRUA 2VDMH 4NQXB 4JKPL 1J1OL 3D0LB 1T0NB 1MWAB 1P7KB 1NGZB 2F53A 1NUFA 1WEJH 5KTEL 1EH9A 1U8LB 2WUBH 4Q6IC 1MAMH 4WTZG 5FKAB 2YPKA 1P7HL 5HHNB 1MWAL 4M4PA 5JZ7C 3EOYG 4JM2F 2B4CH 1DQJB 4ELKB 4LASL 3VXMA 4BSWB 3G6DH 3GSNH 3HZYB 4HUVB 1MRFH 2XWTB 4Y16D 5DJCA 3DVNA 4K94L 5E8EB 3VRIB 3AC0A 1G9MH 3LEXB 2VZTA 4HWZA 5GGUB 4G80A 5DUMH 1WVZA 1MSPA 3ILQD 4F80A 3WEXA 3SQOL 3GK8H 1B88A 1V05A 3LZFH 3B8YA 4LCYA 3WFEH 4P3DB 1YEDB 3Q5OA 1A7RH 2ICEA 5FO9A 4WFHE 4X83A 1L0YA 1J11A 2J8OA 3C6SB 3QNYA 5BRZE 5ADPH 1GVIA 5LGJB 2W9EL 1OTUC 3FO1B 4WO4A 5FK9B 3NCCB 2DS4A 4MNHB 4U49A 3BKML 3DX9A 1QUNA 3HMXH 3FT3B 2AJSL 1T2JA 3DYPA 1RMFL 3TFKD 3NH7L 3KPNA 3NPSB 3HPLB 4LPCA 3IGAB 3C9NB 1VFAB 1YEKL 2DOCA 5D2NC 5FB8A 1VKXA 4K8RD 4M5ZL 5T3ZL 5IEHB 4OJFH 2YD2A 4JFXA 2VAAA 4NKOB 2DF3A 4XNYL 4CBPA 1XGYL 4LVHC 1NMCC 3HR5B 3L5HA 5TQ0L 2CUMA 3H0TB 1JN6A 4KI5D 4M1GH 4M8VA 4I0PB 4XBGB 4N0YL 1NKRA 3OB8A 3ZYJA 1CD9B 1QRNA 1Y6NR 4D2NA 4S2SB 1A64A 3VGBA 1AJ7H 1YEJH 2FLBT 2R15A 4HV8A 1M05B 5AZ2L 1A3QA 5GS0L 1MRCH 1CD0A 5BS0D 4QTIH 5DR5L 5F89A 4UIMA 5FYLD 5DEFA 5GRJL 2DTMH 1ND0A 5CINL 1B0GB 5TDPA 3TIDB 4Y1AB 3FQXB 5IB4B 5LWYH 2FB4L 1QBBA 2PW2A 3PQYA 4X99B 4MHHI 1A1NB 1WWAX 2FD6H 2GSIA 4Q7DA 4AQOA 4CVXA 4F2MB 4IOIA 3STBA 4Y4HB 1RZ8B 4I2XA 4G6ML 3B5TA 1A4JA 4O9HH 1CG9A 2VNCA 4KGLA 4NKQB 3UYRL 1A7NL 4EKXA 3D85B 2DQHH 3LV3B 2OTWB 1CLOL 1J18A 5HHMD 4MWFB 2YK1L 3MRQA 2KH2B 1FN4A 3EYSH 4NCC2 3LB6D 2RFXB 2Q86A 2AJUH 1UJTA 2VDML 1QBLL 5ID1A 1MVUA 4PTTA 4DK6A 2DQEL 4OFIA 2Q3ZA 1DVFD 4IIQB 4PJHE 5F9WB 5IQ7L 2E6PA 1WEJL 4HH9A 1EXUB 3CFBB 2WUBL 5D7LB 1OGAD 1E4KA 2VDPH 1RULH 3OG6B 1B0RB 3OXRB 3GSOB 3QWOB 1Q9WB 4C55A 1JPSL 2Z31C 1MCBA 2FWOA 1PFCA 3VXQA 1PY4A 1A4KA 3HNVH 5DUML 4P2RA 4LSSH 4LRIC 3GMRB 4PV9B 4L4TB 3ZE0F 4PJFE 1UB6B 3EFFB 3GSVB 4G6FB 5HI5D 3V4PL 2OXHA 3WFEL 3FQNB 5IESH 4HW6A 3F8UB 3I3BA 2I5YH 3GHBH 4M02A 1AD0A 5DMIH 1TNNA 3O3EB 3RA7H 2H9GA 1W72A 4Z7OF 5ADPL 4RAUA 1B4JH 3GGWB 5L2JA 1NGQH 4PJGB 1OLZA 1T7ZA 4MMZC 5AG8A 1ZT7B 4HPOL 3B6SB 3K1KC 5I8KL 1I1AD 3K80A 3VXRE 5DRXA 4OQ1A 4JHZA 2ZCLH 4C4KO 3TBSA 1WJ3A 3UTPE 4XZUB 5B8CA 4PJ8C 3WO4C 1HQRA 3ALWA 1QACA 5E5MB 3U0PA 5FFLA 5ACZA 1CZ8H 2RHEA 3H9HA 4G7YH 2ZUSA 4G9FB 1NDGB 3CLEL 1S7RB 3H2WA 3SQBA 2AXFB 1YA5A 1XGQA 3BIBX 3QHZH 3AY4A 2X2YA 1GSMA 2OBGA 1QYGH 3JVGC 4DUVA 2JJSA 5DI8A 3RWEA 1YYML 4DCQA 2E8ZA 2DLGA 4P46C 4CW1A 3ZL4L 4FFVD 4PRPD 1KIUA 4BH8B 4GAYB 4BZ1H 1EPFA 3BIKA 1PAMA 1YDPA 2DL9A 3UJJL 5IVXE 3B3IB 5E2UL 5AAMA 4JY5L 3V6OA 2J88L 2BX5A 2VLJD 4F15C 1RZKC 2I27N 4P2CG 3MBEA 43C9B 2HFEA 1DUYA 1ZEAH 2P43B 3C5SA 4L3CA 4UAOB 3RIAK 3MV9A 1JWMA 3OSKA 4WI3A 3WNPA 2OJEA 1CYGA 5IW1B 1G9NH 2PTVA 4X7TA 3VFSB 3T4AB 1MCSA 4UDTA 4GG6B 3EYSL 3ZKQD 3HZMA 3ARGD 4LF3A 5CLTA 4JY6A 1UXWA 5BV7B 4TVSa 3GMLA 3KS0H 3TNMA 3ZZ1A 4CUCA 5BV7L 1NEZA 4QT5B 2VL4A 1C16A 3NABH 3ARBD 2VDPL 3U0TB 2FX8H 4GAJL 4OLWL 3OGCA 4U1HB 2IQAA 3G5XA 3Q3GA 3BPNB 3UX9B 5LQBL 4ONHB 3CSBA 2C4FT 3WHXA 2DYPA 4JGJA 5HTSA 3K81A 2EDLA 4OF3A 3VFOB 1UWEL 3MA9H 5GGQL 4U1SB 5JNYB 3VFUA 3PWLA 3QNZB 3DI2B 5IFJA 4P23C 1ZHKA 4YBQC 1R3JA 3OAZK 3FFDA 3KPPA 1MJ8L 5BQ7B 3EYVB 3GHBL 1OP5H 4FQ2H 4GSDL 4OKVB 4NQUA 4UIKH 4NWTH 4OM1H 5SWZE 3V0VA 5J6GA 4L3EE 3LKRA 4MLIA 2P24B 5CEZE 1X5IA 4Q58C 1NAKH 4KJPD 1OP3H 1HDMA 3VD5A 2V2WB 4HWUA 1OY3B 3MRCA 1QFWI 5E9DD 3BZ4B 3QPXL 2GKIA 4XP9L 5BZDA 5E4EC 1KNOA 5E95B 12E8H 5IOPB 1FFQA 2R8SH 5C0GA 4OM0L 5TGBA 2R4RL 4EOWH 2OMNA 4GRLB 4JREB 2VISA 1S8DB 4ONGH 3VD9A 4NKIH 1DDHA 1CZ8L 4NZRL 4BSVA 4LMQE 5IHUL 2YC1A 3JWOL 5GJTH 3MCLL 1OTTD 4M6OH 2GK0A 2I60L 5T5NG 3P2TA 1HCVA 1LK3H 3GNML 4BELD 1WAAE 2VMFA 3BGMB 4JKMA 5CUSL 3RVTD 3FT2A 1YYLH 1QQDB 2B2XH 4OZGF 2BSRB 2BCKA 1XF4B 3RWHA 1A5FH 4PG9B 3WE6A 3P40A 2ZJSL 4NO5B 1R3HA 1FO0A 1T80A 3TP4A 5IB3B 4KHTL 5FYKU 3KYMB 1BVZA 2AJXH 3BZDA 3FB6A 25C8L 3MRJB 2F5AH 4ENEC 4KQ3H 2W65A 5J1SC 4PRHE 4LEOA 5IUSA 4JO2H 5E6ID 1QLRB 2W60A 5C9KA 2D31B 3S3JA 2F54A 2EC9T 4PLKD 4JQXC 3TPUA 1F3JA 3F7QA 3TO4C 5MENE 3LPGA 3QEUA 3Q6FA 4JCLA 2JLLA 4QRQB 3O2VH 2NY1B 2P48B 1ZVHA 5JHDD 1XCTA 2BNRA 1N59A 3NN8B 2XZCH 1IGCL 3KYKH 3PABB 3PGDA 4D3CL 4JAMA 1MOEA 4N0RA 3EJZD 3ZKXB 3WDIA 4HGKC 3QQNA 1FSKC 5F9OL 4NQCD 1AGCA 1NDMB 4F58H 1SMAA 3ARRA 3QDJD 1Y0LB 1GIGL 4S1QH 5FHBL 1KELH 4NQDD 3KPMB 2IPTH 5GJSH 2V5SA 2QQNH 5FCUH 3WJJC 1BBDL 1L0XA 1EO7A 3CZFA 1ZVSA 1AO7A 2CLZB 4BH7B 4UV4H 1JRHL 2BVPB 1HHGB 2FX9H 2OS7A 4N8VG 3W5MA 1O7SA 4UIKL 2Q8AH 2MHAA 4NWTL 5IMOA 4Q6IA 1JWUB 4QRUB 5CP3A 3P9WB 4PB9L 4YK4B 4DQOH 4I3RH 1KJ3L 2F53B 2B1HL 1NAKL 4DJMA 3O9WC 3X13A 2HVKA 3HE7D 4G6JH 4HAFA 1V3MA 3RNQB 2FECL 2WK2A 3SGJC 2EKJA 4KXZH 1FFPA 3CIQA 3DX6A 3VXMB 1E6JL 4JHWH 12E8L 5C0BE 2NY4D 4P4KB 4PP2A 4YR6B 1DTUA 3PGCA 3QI9C 4LPVA 2J4WL 4HWZB 5KS9F 3LQZB 4ONGL 4OZGA 3BKCL 3WEXB 1HHKB 4YGAB 4X7CC 3Q6GL 1CDGA 1WWWX 4LCYB 4ZPTA 4K3DH 4B7LA 1S7TB 2CK0L 2ICEB 2NY7H 3DWTA 5FO9B 2Z91A 4MMXC 3LRSA 4FABH 3LQMA 5HPOA 3IU3A 3MLXH 3DX9B 5D2NA 3KDMA 5F7LB 2XV6B 4R97C 2AJXL 3VG0H 1B2WH 4NO0D 3KPNB 1RJCA 3C5JA 4KQ3L 5FB8B 1VKXB 4ZXBC 4NGHH 1C7TA 1PSKH 1DUZA 5D7IE 5F7EH 2YD1A 2AAVA 4NRYA 3H42H 1HXYA 4NJAH 1OD7A 1G7LA 4NDMA 1M4KA 1JN6B 2QADD 3BQUC 4HIXH 4MA3A 4Q0XH 2JJVA 2KUTA 1C8PA 3NACL 3V9FA 5J1AB 1QRNB 1QSFD 3O2VL 1ZKAA 4J3WA 3KPQA 3TVMD 2R9HD 1CE1H 5E1AA 5IJVA 4Z8FH 3UPRA 3C6LC 4HC1L 1F90L 4M7JL 5F89B 1MIMH 4UIMB 4QXTB 3WUWG 4CVZA 1KBGH 3LKSA 5DEFB 3RY5A 1ND0B 3L95A 2DQGH 2IG2L 4WHYG 2DLHA 4D9QE 5TDPB 1X9QA 3TN0C 2A0LC 3S96A 1NPUA 4F58L 1H8NA 3PQYB 2PW2B 4PUBH 3RWIA 2XN9E 4MXVF 4WY7H 2DIBA 4S1QL 4HF5H 2GSIB 2IPTL 4IOIB 4XB7A 4CN4A 4XP6L 4HKBA 2VABA 1A4JB 5FCUL 3ALXA 3HE6D 3P4LA 3U4EA 2PYEE 2AGJH 3IXAB 1NBQA 4PJHF 2WAHA 4PD4K 2E6QA 4AY0A 4S1DC 5M95B 1FN4B 2OL3B 2ITDA 4XP4H 3HRPA 5MEOA 3VWJD 3DSNA 3N1QC 3BD5A 4NM8L 1MVUB 4PTTB 3IJSA 4QRPE 3BGFB 1EGJA 4MJ2A 2OL3L 1MCOL 5DRNA 3U46A 4HH9B 5CSGA 3BN9D 3IXTA 5EZLA 2E27H 2VUOA 5BRZA 2O5ZH 3M1BB 2Z31A 3RL2A 2VERN 4PJFF 5I1HH 3HG1A 2FHBA 4NJ9H 3O6LH 5AAWA 4LRIA 2C9AA 1JGDA 5I8CB 1YEHL 2R0ZL 2FWOB 2CGRH 1GGCH 1A4KB 1EK3A 2EZ0C 4N0FA 4P2RB 1CFNA 3IDXL 2ZKHH 2ZG1A 1DBBH 5I1KH 4UI2A 4K3DL 1IM9B 3MUZ1 5B22A 3NOIA 4UV7L 2PNDA 1AD0B 1KN2L 2H9GB 1W72B 2DDQL 4LLDA 5T3ZD 5L2JB 1QP1A 2DRUA 5LCVH 1W72L 1B2WL 2BDNL 3RQ3A 4YDLC 5GSVA 1R3IH 2YUZA 4I18C 5DRXB 4PJ8A 3KJ6H 3N85L 3TBSB 3CSGA 4RFNC 1Q9LA 4FQJL 4HDIA 4MJ6A 2EH7L 1BD2B 5B8CB 4XT1C 5F7EL 2ICCA 4ZODA 1K5NA 5E6YA 4I0PD 2FCBA 2ZNXA 1HQRB 5HD8C 5CSBA 3U0PB 3U9PL 4HIXL 4Q0XL 1ORSA 5E5RB 5GS0D 5ACZB 3H9HB 3WKML 4PGZA 2XY2A 3JVGA 5FYJH 3UBXG 4U7KA 1J1PL 1XCQA 1XGQB 4P46A 3QCUL 5IVXF 5B3JE 2AW2A 4KV5E 5L7XH 1UB5A 5F1IA 5DI8B 3RWEB 3H7BA 4DCQB 4Y1AD 4CW1B 1IGMH 2DQGL 3KXFE 3TJEL 2EDWA 2GIYA 3BIKB 4PJHA 4DOHB 1A1OA 1YDPB 1VB9A 4KFZC 4EEEA 4Y4HD 4OZ4A 4FQLH 1FO0H 3RZCD 4HF5L 5C2BL 3MBEB 2HFEB 1DUYB 2NY3B 3DVGA 1VPOH 3IFPA 4L3CB 3D85D 4YC2B 1UA6L 3MV9B 1JWMB 1TZGL 1RFDH 3GJFA 3MJ9L 1JYWA 5L9DL 3OR7A 5BMFH 4X7TB 3ZKMD 4QYOA 1MNUH 2UY7A 4FXKB 4UDTB 5DJ0A 4H1LA 1UM6L 3HZMB 1D6VL 4MA1B 4PJFA 5I71B 4S10A 2Z93B 3PV6A 5K93A 1HIML 4JY6B 5D7LD 1F6LL 3GMLB 3TNMB 1NGYA 3IJYA 2YR3A 5ACLA 5CILH 4XPAH 1F3RB 4O00A 3LSOA 1C16B 1DSFL 3OGCB 5CD3A 3V5HA 2IQAB 3HAEH 4GQ9H 5DVOA 3G5XB 3Q3GB 1NJ9B 1L0QA 3C09C 4H8WH 3WHXB 3VXRA 4P23A 1MCNA 4L4TD 5FM5O 3DUSA 5T3XE 2WWKO 4G6FD 2KZ1B 1ZVYA 5JW4M 4ORZC 1RK0A 4KKLD 3VFUB 3OL2A 1R3LB 2HKHL 3PWLB 4EDWL 5IFJB 1ZHKB 1R3JB 4WW2C 1I9RL 3RVUC 3KPPB 4PRIE 2X7LA 3MOAH 5EORL 1OHQA 4IMKC 4ODWA 1RQ5A 4ZFOA 1JPGA 3V0VB 2Y6SD 4PGBA 3ZYIA 5I0ZA 5J6GB 4JFZH 3LKRB 3VMPA 1TQCB 2VRAA 3OKNB 1J8HE 1HDMB 1FORH 5JIKA 5CP3H 8FABA 1DQMH 3OKMA 4N0UB 3MRCB 3IDIA 3HC4H 3RI5K 3S35X 4LNRA 5BZDB 3PXJA 1BZQK 1ZLWH 5C0GB 5TGBB 4HUWA 5DC0A 1IAII 2YEZA 1WAAF 5IG7A 1U3YA 2VISB 4G9FD 2XA8H 4ZSOB 1DDHB 3X14A 5EC1A 4XI5C 3WFCH 4BSVB 5FM5M 2J8HA 3L1OH 1EEZA 4MQ7A 2R2EA 2GK0B 1PEWA 1HK6A 3U83A 5E2WL 3MBXL 4H0IA 5L7XL 5E08L 3KNBA 2MCPH 3RWHB 3WE6B 4LCCC 4GAGH 1R3HB 1FO0B 1UM5H 1KIRA 1C5BH 5EOQH 3CK0L 3FB6B 3RPKA 4IRZH 4LCIL 1FO0L 4BZ2H 2GW5A 1U6AH 3ILPA 2W65B 5CJBA 4JQXA 3VDCA 4LEOB 1SVZA 4DFHA 3OKDB 3TO4A 1NLDL 2FRGP 3K7UA 4GUPA 4BFEA 5DGQA