4WO4C

The molecular bases of delta/alpha beta t cell-mediated antigen recognition.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
200
structure length
200
Chain Sequence
b'QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGVTGKLTFGQGTILTVHPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d
publication title The molecular bases of delta / alpha beta T cell-mediated antigen recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2014-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wo4C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wo4C01
1YQ2A 3VRIB 2J3SA 1L6XA 4MXWH 3MJ9L 2A6KB 5IK3B 1D5BA 1CL7H 1LE9A 1A9EB 1BP3B 2BRRH 5H8DA 1J7VR 1N64L 1E4JA 5SV4A 5BMFL 1CF8H 3RPKA 2VDQL 1NGYA 3OQ3B 1WBXB 5IVXB 4JM4H 1UCBH 5JXAL 3OZ9L 1A1MB 1GHFH 3NIFE 3RP1A 4WU7A 3T0EE 5FUZH 3W9EB 1MREL 3IFPB 1WIPA 4O2CB 4CL7A 4L3EA 1IZJA 2C3XA 4BQ8A 3NIFF 3PXJA 4DZ8B 1BF2A 2PW2B 1S7QA 2VWEE 2APTA 4X9GA 3F7PC 2CKNA 1M1SA 2IFFL 3IJHB 4P5MB 4K7PY 2Y6SC 4ETQA 2GSIB 2V17L 1FIEA 1U0QA 4JDTH 4WHYH 3W9DB 5EBLA 4GKZB 4XAKD 5I1IH 1BOYA 1UJ3A 4AEHL 5BXFB 1HSAA 3FO2B 1NFIB 3NCJL 3FQRB 3QIUD 1EGJL 2CUMA 5ETUB 1J5OH 1L7IL 2IAMC 3MRNA 3GBNH 2WBWB 3P11L 4XXDB 4PY8J 4LEXH 1TJHL 2ZUUA 4LARH 4XHQA 5EU5A 2J2ZA 2Y23A 2Y1VA 1KN4L 1NMCC 1Z0NA 4ZPVB 5IWLA 5SWZA 2LAAA 5B4MD 4YDJB 4JFDB 3RVUD 5IB1A 3VFUA 4EN3B 1F8TH 1J1PH 1MLBA 1FNGB 2DQHH 1OAKL 3AU1B 3BIKB 6FABL 2AXGA 4UNVA 1VPOL 4X5WA 2ADGB 5GRXG 3OR6A 1DTUA 2DQEL 3RAJL 5C0BB 1J9CT 5DD6A 1M4KA 3RBSA 4TUJA 2HFGL 4N8VB 4F3FB 5KN5B 1FNEA 5DK2A 4XI5C 1WWAX 4WUUB 2G60H 4HAGA 3VE0B 1DVFB 3QIBD 3OBAA 4LVHC 3U7YH 4PJXB 2BP3A 3DTXA 3GDBA 2DYPA 2QADD 5C6TL 4OLZH 2X44D 4DKAA 5A16B 4KTDH 4R0LA 4Z78B 4KK8D 3WUWB 1YN6B 3QEHA 4LNVA 1GRWA 3O6FA 4G5ZL 5C0JB 3RJDA 43C9A 4HIIB 3SBWA 2JELL 3CSBA 2QKIA 3L5IA 4XVTL 3FT4A 3F8UB 5I0ZA 4U1SB 3FQUB 4Y4KC 4I13B 1QRNB 1EEUA 5FUOL 4DN4H 1NUFA 3PNWB 4R26H 2KBGA 3BVNB 2DI8A 4L8SC 5HHQB 4CVXA 3VFSB 4HUWB 5GQBA 3AGVA 3BIAX 4P23D 3UJJH 4QT5B 4R4FL 1F00I 4G3YH 3PWUB 2XTJE 4C58B 1GIGL 4TSAL 2PTVA 3N1QC 2YPLD 4HH9B 3NPSC 3VWJB 2V9QA 3Q6FB 3QDME 4PLOB 4D3CL 2OL3L 2IJ0C 1FZMA 1RZJL 4GRLC 1A7BA 1MFEH 1NGWB 1Q94B 1P4IH 3DXAA 1DBMH 2NW2A 4IJ3C 1OSZB 2OR8A 1OW0C 4MWFB 4HQQH 4Q6YA 3L7EB 5SWQB 1EJOH 1SJEB 1ZT4B 3L1OH 3QO1B 3BP5A 4LSVH 3T0XA 2DM2A 4FQJH 4EUPG 1IKFL 5EWIL 1NBVL 1AGCA 4LSQH 4U7SA 1R3HA 1IKNA 2C3HA 5J89A 1I3RB 2O5YH 2M1KA 4ZS7L 2DQJL 4M7LT 3FOMB 1KTDB 4QEGA 2I60H 2MHAB 5HVGB 1FVDA 5E6IC 3HKFA 1H9VA 1G6RB 3T65B 1TPXB 5DWUH 4POYA 5ITBH 2OZ4L 5LAXB 1J10A 1CGYA 3ARPA 5KW9H 3GJFA 5EO9A 2FRGP 5GGTH 3SDYH 4M3JA 4NO0B 3OMZA 5DEFA 4LCUA 3VWKA 3FZUD 3BKML 1JPGA 4Q58C 2PR4H 2Q76B 2ZPKH 3RNQB 5ALBL 1RV6X 4PRHE 4JPIA 2HJLB 4NKIH 4KQ3H 5D71H 2VLJD 2PF6A 1KPRA 3QB7C 3ZYIA 3DOSA 3U0PA 5IFJA 3TNNA 4OTXL 3DURB 2BVOB 1W72H 2QSVA 3K1KC 4XCEB 4XZUB 4PLNC 3U2SB 3T0ED 3P0VL 3PWPD 4AY0A 4LGPB 2E8YA 4AK1A 4Z7WE 3BGMA 3L3DA 4KQ4L 1OVZA 3B6SA 1QLEL 4QRPA 1JHKH 1FNHA 1M6OA 4LASH 2FATL 5J6GB 4FQIL 4Z7WF 4B7IA 4HZLB 1OSPL 1X5LA 4HLZG 4LLQB 4YR6B 4ZUUB 2NY0C 4MJIE 2YMXH 4EOWH 5E2TH 1LHZA 5KSAD 2DL9A 2OM5A 4OB5L 2VTFA 2APVA 1VESA 2PNDA 4HS3A 2C3GA 2DD8H 1LO5A 2ADJA 3VW3H 4OGXH 3WS6A 2C7UB 2YD1A 5ID1A 4Z5RB 3BKCL 1ADQL 3GBLA 4NBXB 3CVHL 3O9WC 1JF1A 2FYYA 3SKNA 2Y25A 3C5SB 4JAMB 1E28A 2D9QB 3CXHJ 1C1EH 1R3KB 1YEFL 3PWJA 3QAZC 2JIXA 2E9BA 1YYLH 3CUPA 3MOAL 4JM2A 3TH2T 3U7AA 2AJZA 1Q9KB 1P4BL 5JNYA 4MA8H 1JPFA 4ODBD 4WDIB 1JF5A 2J6EL 5CEZE 1TVBA 5HSFA 1B0GA 5CJ5A 2PXYD 3BFOA 1B4JL 3FB6B 3MGOA 1XH3B 2ILLA 2Z91B 3MRFB 4QXGL 3VRIA 2V6HA 4RDQF 1KIQB 1LILA 4ODXB 2A6KA 3EOTH 5IK3A 2Y9RT 3E2HC 5ADOH 1A9EA 5TH2B 4NKDA 1EPFA 3LH2L 4JO3L 4OKVB 1T03H 4XPGL 1RMFL 3BZEB 3S35X 3QRFM 2W38A 3TFKC 4GKNA 3BD5A 1WBXA 4KKBD 4LMQI 2MQ0A 5IVXA 1OPGH 1UACH 1A1MA 1UXSA 4L4JA 3CZJA 4JFOB 4O2CA 1LO4H 1JGUH 5BW7C 1JYWA 1SVZA 2PW2A 4FXLA 1MELA 4NQUA 1IAIM 3MV7B 2C3VB 4JKWA 3HC4L 3UROR 3IJHA 4KRMB 4P5MA 3KLHD 3DGCR 4ZO7A 3EOAB 1UGNA 5GXBB 2GSIA 3Q1SH 3W9DA 5FDWB 2F8VA 1IEBB 2QADB 3TJEH 2J5LC 3GGWB 4LIQH 3VXPB 3FO2A 3KXFB 1NFIA 3NTCL 5EIVA 3GMRB 3FQRA 1KEML 5F89B 5ETUA 1IQWH 3BPOC 5L9DL 1E4KA 2XTJD 5EORL 5T33L 4WV1B 3NFSH 4HXBH 3MRLB 5T1LB 4C57C 5I1KL 5D70L 4XXDA 1G9MC 3ALPA 4Y5VB 3QDMD 3QDAA 4ZUTB 4H88H 2A1WL 1XGRB 4ZPVA 5J1SC 2WSKA 4MZ2A 1PY9A 4YDJA 4JFDA 4KH2A 1IGIL 5HY9A 3ULSB 4EN3A 4YAQB 3QIUC 2FECL 1FNGA 4HAFA 3AU1A 2E27H 4J4PC 2ADGA 5IVNA 1OAYL 3FHQA 4F3FA 4N8VA 5KN5A 1IBGH 4DKEH 3O45A 1U93B 4WUUA 5B4MC 2VSDA 1HHGA 3U48A 1LEGB 1ROWA 3VE0A 4XC3H 1DVFA 1WUNT 1FDLL 4PJXA 5CZXC 4CU8A 1HH6A 5D7IE 3V2AR 3NCBB 4Q9BA 3T3PE 4Z78A 4XMKL 2G2RB 3WUWA 4DN3L 1YN6A 4OI9A 4BK5A 3KVQA 4R90H 4I0PD 3WKML 5D7IF 5C0JA 5ICZB 2ESVB 3T3PF 1QVOB 1VADB 2WAHA 4HIIA 1G6VK 3QIBC 1AHWC 4AENB 1DQLH 3PE9A 3AS1A 1VFAB 1JRHL 4MA1C 3K2UL 4F2MB 1CFVH 4MMXC 3MV11 4U1SA 3FQUA 4Y5YC 4KK8C 1NLDL 1QRNA 2XPGB 4I2XE 4KV5E 1IJ9A 3BEVB 3MCG1 1TQCB 3PNWA 4PRHD 5EB9A 1G7QB 3BVNA 4M62L 5HHQA 3VFSA 5F7FA 1DEDA 1MCLA 4HUWA 5FYKE 4AQOA 5MERB 3K1DA 5GJSL 5E8DH 5FHBL 4NP4H 1OD7A 3TP4A 3O11B 3PWUA 4X8JA 1MCIA 3TVMD 2D03L 5C92A 1HILB 2DDQH 3UJTH 4HH9A 1MWAB 3VWJA 2N1KA 3Q6FA 2ADFL 4HG4J 3O8XB 3W2DH 4X4XB 1J8HB 1PG7L 4WI4A 4P23C 2HN7B 1GH7A 2WIMA 1NGWA 1Q94A 3QXTA 3TEUA 1J86A 1I8KB 5GS1B 1KTLB 2VLJB 1QR4A 4MWFA 1U58A 3L7EA 4MJID 4UU9B 2R23A 5SWQA 1SJEA 1ZT4A 3QO1A 3R8BB 1YEEH 1HSBB 5HTSA 1N59B 1KIPB 3PWPB 4X6CB 3IDYB 1I3RA 1N64H 2W9DL 3U4BH 5BMFH 1T6WA 3DV4A 1KTDA 1VFOA 2IADB 4Y88A 1VKXB 2JK5B 4X6EA 2UYLB 5JXAH 1G6RA 3T65A 5KSAB 1MREH 4PR5B 5LAXA 5IHUL 3OPZL 3WFCH 4LKXB 1AGDA 3VXUE 4JRYE 5BCAA 3CFBA 4NO0A 3DVGB 2CRMA 4GT7A 1FCGA 1JPSH 2QL1A 1A0QH 2IFFH 4JQIL 1L7TL 2Q76A 5AWNH 3EO1B 4OCRL 1FC2D 1OL0A 5EOTA 2APBA 2HJLA 5JXED 2APXA 2WW8A 1U42A 2P46B 3RKPA 4PJ8B 2FSEB 8FABA 4BFGA 5KOVC 3CD4A 3DURA 2BVOA 3RY6A 4PJDB 5FYJL 3U2SA 3BP7B 1EGJH 3HUJB 4NDMB 4HUKB 4PJCB 4WIQA 1QACA 2PXYB 4MVBD 1JTPA 2AP2A 4F7MB 1K4CB 2R4RL 3JWNC 4S1DD 4KI5E 3V7AE 2F8XC 2ZZUT 4WENB 1DLFL 1DDHB 3IAQA 4OI8A 1EFQA 1S7RB 5J6GA 1NJ9B 4HZLA 4ZUUA 4YR6A 4KI5F 4HK3J 3O6KH 4NJ9H 4MS8C 3T0EC 1OAKH 4ONGL 6FABH 2W0PA 1AP2B 4HT1L 4NN5C 2VWEC 2NR6D 3H7BB 1FAIL 4XMPL 5KSBE 2HFGH 2C7UA 4YX2L 3PDOB 1S7XB 1JI2A 4Z5RA 4YIQB 4QRUB 1YJDC 5KSBF 5CBAB 4TULH 2HRPH 1XT5A 5DR5L 3C60B 1TETL 5D1ZC 2A0LD 5C7XL 3C5SA 4JAMA 3PP4L 4EZMA 3N1GC 1MEXL 1R3KA 1Z5LB 5AZ2H 5KS9B 2Y7QB 2DN7A 1Q9KA 4WDIA 1S7UB 4OM0H 4J1UB 2JELH 4HS8L 4FQLL 3FB6A 1XH3A 3MRFA 2Z91A 4Q9QL 4DGYL 1LDSA 4GS7C 2VXTH 1KIQA 3FN0L 4ODXA 3L6FB 4CU6A 3GSVB 5TH2A 3S4SB 5TFSL 1FFPB 4X8XA 1JPST 2F54A 4WWKB 4PTTB 1T2XA 2Q20A 5C9KA 2NW3B 2Z8VC 5F9DC 1KCRL 2Z31D 1XF3B 4OFPA 4F9LA 2EO9A 4JFOA 1GZQB 3RIAK 4TSAH 2VXVH 5KZCD 2E7LC 3MV7A 2C3VA 4N8VG 1Z9OA 1RZJH 2A6IB 4W6XB 1TJGL 4KKBC 1KC5L 4IMKA 5HHXL 3EOAA 1ZHBB 1JNLL 3C6SB 2QJDA 5FDWA 5E8NB 4K94L 4OLUH 2SEBB 1IEBA 1INDL 4N8PA 3GGWA 3VXPA 5H37G 3T8XB 1YUHB 3KXFA 3WUWG 1QR1B 3HCVA 3GMRA 3BDXA 4ZD3H 5F89A 3KLHC 3LB6D 1IKFH 3LQAH 4Y1AE 5EWIH 4PV8B 4OLVL 4WV1A 1DFBL 4IRZH 3MRLA 5T1LA 1ZVHA 4YFDB 5GS0D 4WI3A 2EDDA 4Y5VA 4ZUTA 4PJGF 1XGRA 4RBPK 5I8OH 5TGBB 1FZOB 4XP5H 3ULSA 2FECI 3QJFB 4YAQA 1S9YB 3VRJA 4URTB 4Y8DC 2OZ4H 2WM0A 2XTJC 5JIPA 5C6PB 4Q7DA 4FZEL 1RJYB 5JW5B 2Q86B 3IKKA 4MNHB 5C09D 2R56H 1CK0L 4NKQB 3RGHA 1FORL 3BKMH 4JN2A 4L3CA 1U93A 4ZFGH 5IIEB 1LEGA 4HUUA 4P3WA 4U2ZA 4LAQL 5IESH 3KPQB 3RWDB 2VABA 2RCSL 2KUTA 4OQTA 3VFWB 2NY1D 1U36A 3ARDD 1WZ1H 3NCYS 2G2RA 5DFWH 4GAGL 3EKCA 5EIIB 4PRAB 4OZFA 3QFDA 5L8KB 5ICZA 2AJYL 2ESVA 3VH8A 3P0VH 5ILTL 3MNWB 5MEQA 4LKCB 1AQDA 3O3BB 1BX2B 4LU5H 1E4XL 4JRYD 1G7MB 1MFNA 4AENA 4YHNA 2VLRD 2DM3A 4JY5H 1JRHI 1FGVH 1U41A 2QLVB 1VFAA 4F2MA 4OT1H 2BFVL 4TQEL 4FQIH 5ADPH 5D1QD 2XPGA 3A6BH 3RTQD 3BEVA 4QXWA 1G7QA 5CJXA 2KL6A 3W39B 1MAMH 4OB5H 4M6OH 2Q7NA 2ADIB 1ODAA 3OX8B 3O11A 3WCYA 5JZ7C 3IFOB 1IAOB 1HILA 3BKCH 3DO7B 1MWAA 3K4DA 1I7UA 1EDQA 1R3JA 3O8XA 2YSSB 3ZYOA 4X4XA 1J8HA 4KKLD 5HGDB 1ZHKB 3QHFH 1FL3B 1YEFH 4G8IB 5GS1A 3KHQA 1KTLA 3NBNA 2GJ6B 3TVMC 1T2QH 5GS3A 2J88L 4UU9A 4QKXB 2GHWB 4UT7L 4GXUN 3SGDH 3UTPD 1Y6KR 3PWNB 4IEFB 4QXGH 3S5LB 1N59A 4WRLA 3NMEA 1IRAY 1KIPA 4M1GL 2AKRB 4OGYH 4M7ZC 4X6CA 5DC0A 1WCBB 4OM1L 3ARED 3MV8E 1AD9B 1I1YB 2IADA 3N1PC 4PJ9B 2JK5A 2UYLA 4LLYB 2XRAL 4YXLL 4XPAH 4B41A 3CSYB 4LFHD 4PR5A 1NBYA 2B20A 1KJ2B 5D1XB 1G9NC 4ZSOE 4LKXA 4RSVA 2NY3D 2K1MA 4W4OA 3DVGA 2J7LA 2AEQH 2OLDA 3HC4H 3LRHA 5KVFH 5SX5H 3TH4T 3EO1A 5DVKA 3T08A 4BZ2L 1SMAA 1NANH 3TF7C 2VDNL 4W6WB 3MA7A 4IRJD 4JPVL 4JKKA 3JTTB 1F2XK 4PJ8A 3WDJA 2FSEA 4HKJB 1NDMA 5L0QB 3CFKB 3KG5A 4TVPH 4PJDA 3FB7A 3NTCH 4PJ7E 4U1IB 3BP7A 1KEMH 2AERT 3HUJA 1EJ6A 4KMTL 5EORH 2XXCB 5JXEC 2PXYA 4QXUL 5I1KH 3S37L 1W2KT 1SMOA 3LHPL 4L9LA 4F7MA 5DK3A 3S6CA 1DDHA 4HLZH 4AEFA 1KB9K 1S7RA 2IPKB 4X80H 1NJ9A 2H8PB 1SJVA 3ES6B 3CDGB 1PYWB 2BNUB 4JFEE 4O2EA 5IF0B 1AP2A 3QUYD 3VFOB 1G6RL 4MVBC 1JL8A 4OLXH 1TTFA 4S1DC 3ULUF 3H7BA 3EYUL 2Z31B 3OXRB 1F3DJ 4X6DE 1BEYL 3PDOA 5ITFB 4XBEL 4YIQA 3D0VA 1RPQA 4Y1AD 1HQ4B 4QRUA 2Z4QB 4XP6L 5CBAA 1L0YA 4FQQB 3C60A 5J9PB 4MNGE 3IDNB 2GI7A 1JWUB 4BSWA 3ZT6A 1MCFA 1A7PL 1Z5LA 1NEZB 4LSUL 4UQ2B 4V2BA 5KS9A 1BECA 3HI6H 3QXAB 1LP9F 1S7UA 5IJVA 4J1UA 4XMLH 1BZ7B 3U0TB 2FDBP 5I19L 2AXHA 1A14L 4HJGB 5I1JH 2F74B 2W07A 3K2UH 4WW1A 3U9UB 3L6FA 3QQ3B 2DLIA 3RKDD 4LLUB 1FJ1A 2NYYD 4OD3L 1FFPA 1UKTA 2EIZB 1C5DB 1R3IH 4WWKA 3PQYB 1DQDL 5HI5C 4PTTA 5C0DA 4HKBB 4N0UA 1CLZL 4WVRA 4LLDB 2CDFB 2V2TA 1VENA 3EOYG 5GJSH 5FHBH 1NSNL 3THMH 3I2CH 4X5LA 4WI6A 1TENA 1GZQA 5E99L 4F7CB 4WTXA 2YPVL 1PEWA 2HG5B 5C09B 3OKOB 4YHYC 3I6GB 3QNXB 2A6IA 4R7DB 1A3LH 1JHLL 5SWSA 1RJLA 3QUZB 1CDBA 1ZHBA 3CX2A 3KAAA 4N68A 4JG1L 1EA9C 3C6SA 1OTSD 2QTEA 3KWWB 4KTEL 2SEBA 1A6VH 1MHPL 2XOTA 3T8XA 1NBZA 1YUHA 3QFJB 1QR1A 4PRNB 2R15A 1FHGA 3TBYB 1JE6A 4PV8A 3QUXC 1KB5A 1QFPA 2W9DH 3QWRD 2VLRB 2HT3D 5SV3A 1QHOA 5TGBA 5DJCB 1FZOA 4PJHE 4NIKB 3QJFA 1S9YA 2ZCHH 3TJHD 2FO1A 1YNKH 2X1OA 2DQGL 2AABL 2F58L 4O2FB 4PJHF 4P2OC 1RJYA 1ZLVH 5JW5A 3NIGE 4MNHA 2XQBH 1SY6H 1WV7T 3NIGF 5IIEA 1ZA3A 3D48R 2PTTB 1V05A 1X3DA 4RFEB 5IW6B 3KPQA 2EH8L 1CIDA 3RWDA 3O2DA 4OIAA 3QH3B 1KCSH 2X42A 1AE6L 3V4PL 4I3GA 5FYLE 3MV8D 4OJFH 3VFWA 3HPJB 5E5RB 4K2UL 4PRAA 4S1RL 2QV2A 1TZHB 4U1HB 4FQ2L 4LKCA 3O3BA 3MOQA 5IG7B 4M03A 1G7MA 1H8NA 1V8HA 1W0VB 1IC5L 1CFNB 4FFYL 3ARDC 2YEZB 2XQYK 4I3SL 4NHCH 1P5VA 1A3QA 5TQ0L 3GM0A 4JHBA 5E03A 2ADIA 4JO1L 5F72S 1LEKB 1LGVA 1A1NB 3WIFB 2BSED 1UA6L 1FAIH 4XMPH 4HS6A 4YX2H 3IFOA 4U6VL 2AK4B 3CMOH 1IAOA 1WVZA 3T09A 2Q1EA 3DO7A 5DURB 3MBXH 2BXYA 1RULH 3M17A 5DR5H 3S88L 5D6CB 4NM4L 2A77L 5GS2H 5E1AB 5T1MB 5HGDA 5LCVH 4KZDL 1WT5C 3CFDA 3QPXH 3GMOB 1R24B 4JN1H 5I1AB 5HDLA 1IAKB 2GJ6A 5CD3A 4IRJB 4MQSB 4OQTL 2HTKD 1JF6A 2O93L 5CD5D 4MJ2A 1PBYA 3ULUD 1J11A 4N1HB 4A6YA 4NQCE 3PF2A 3PWNA 4K23H 4Q9QH 4KKLC 2X4UB 1A22B 3S5LA 1YEIH 4AG4L 4KI5C 5E1HB 1GGBL 1RVFL 3RNKB 1GZPA 2Q87A 3LN5B 4FTVD 3RIAF 4YPJA 4EDXB 4HIXL 1I1AD 1WCBA 1OP5H 4V1DE 1DP0A 1AD9A 2R0KL 3RWEB 1I1YA 3GNML 1RZIB 4PJ9A 2BOCB 3MRBA 4LLYA 4LCWE 2B1AL 2YKLL 4KY1H 1KCRH 4LVNC 3CSYA 4HX1B 1ACZA 3QUKB 4I77H 1KJ2A 3IDGA 5D1XA 3QUYB 5CGYC 3T2OA 3AREC 2BERA 3LDBB 1FV1B 2WP3O 3E6FB 4AEIH 1OAQH 2D9CA 5L2KD 1MWAL 4FFWC 4QF1A 5EOCH 3QUMH 3JSSA 2Q8AL 3CJJA 1KENH 4PBVC 4PJGB 5I76B 1E6JL 3JTTA 4XVJH 2NY3C 3HNVL 4HKJA 4WHDA 5IV2B 3BPCB 3CFKA 5CJQL 2H32B 3K4AA 4U1IA 4QRSB 5I17B 3EYFB 1L9MA 5EZOH 4LRIA 4OLVH 3QA3B 4DGIL 4U1GB 5AAWA 2AQ1A 5GHWL 4LSTL 2FGWH 3U82B 5DD0L 5HGHA 3QEQB 4ZAKC 5E2UH 4Q9RL 2IPKA 3HZVB 2H8PA 2FLBT 2XACC 3IT8D 3Q6GH 5IHLB 3ES6A 3S4SG 3IF1B 3LS4L 3CDGA 1PYWA 2BNUA 1GC1L 1BPVA 2YUWA 4GUPA 4TTGA 3VFOA 1RZGA 1EEZB 4Y7MA 3O4OC 3TV3L 3B83A 1PEZA 4BZ1H 4IHOB 4E0RB 5IFHL 5ICYA 3HNTL 2DQCH 4ZDHA 3MO1B 2GT9B 4EI5D 3P77B 4FQQA 4S10A 5J9PA 2RCSH 1AFVL 1EAPB 3IDNA 1YZZA 3TIDB 2JTDA 1JWUA 4P2QE 3X3FL 4OZHA 4KJYB 4KK5C 1NEZA 4UQ2A 4UT6H 1PDKA 4M5YH 1OCWL 3JTSA 1IARB 3QXAA 5JDJA 1KELH 2AJYH 5E6YA 5ILTH 3LD8B 3H8NA 1CFTB 4U3HA 3BH9B 3E3QE 4KJQD 5AYUL 1KT2B 3O3EB 2FNBA 5D2LB 4HJGA 1DL7H 5DS8B 2EDEA 3CU7A 2F74A 3IRPX 1CVRA 12E8H 2J8HA 3U9UA 3QQ3A 2BFVH 2VXQL 1YYMH 2P24B 5FGSA 4LLUA 3DUSA 1KG0B 2QQQA 3PABA 1QOKA 1C5DA 4X7EC 3PQYA 2CIKB 1Q72H 4YXKL 4HKBA 4UNTA 3ZKXC 4LLDA 3LN4B 3IU4L 2CDFA 1CICD 3TN0D 1Q38A 3V5DB 4BQ9A 2Y07L 3SO3C 1TMCB 3RKDC 3AB0C 2OJEB 4NT6B 5GGVL 2NYYC 4F7CA 1JV5B 4H5SA 2HG5A 3OKOA 1H3WM 2R9HD 3I6GA 4K9EH 4D9LL 3QNXA 4L4VE 4R7DA 3SKMB 2OBGA 1GSMA 3QUZA 2XT1B 3TZVD 4HWEL 2CGRL 2NXYC 1B2WL 3KWWA 2W91A 5DEGB 2VL5B 2VERN 4JG0L 3DRQB 5DJ0B 5EOCJ 5T3XE 3QFJA 4PRNA 1VDGA 2ED7A 3LKPB 2AEPL 1Q1JH 5D4QA 3TBYA 2BY3A 1UZ8B 5F6HJ 3MCLL 1NL0L 3GIVB 4OCSL 3KPMA 1JPTL 2J8UF 3WSQL 3D39E 3TBWB 5C0CA 3H2WA 3WE6B 4DVBB 2MQ3A 3TO2B 2YD9A 4QLRA 4NZTL 2XRAH 2R0ZL 3ARGD 1XMWA 4OSUL 4Z7QE 1K6QH 5CJOH 4RGMC 4O2FA 5DK0A 1CGTA 4Y2OA 3W0WB 4JPKH 5KVEH 2HT3C 4Z7QF 4Q0XH 4Z77A 1JVKA 4NQTA 3ZO0A 5BVPH 3DWTA 2PTTA 1C16A 4RFEA 2B4CC 4HMEA 4NM8H 5D7LA 5IW6A 2VDNH 4BZYA 1FP5A 3WD5H 1MCSA 5A40E 3BGAA 4XBGB 4HUXB 3HPJA 2DBLL 2XA8L 3P9MB 5JIHA 3KNBA 4UBDD 1AO7E 1IC7L 1TZHA 3CX5J 4KMTH 1KIUA 4MXQD 1W8NA 3BQUD 4NPYB 4QXUH 3BT2H 5JOFB 2PO6D 5D93B 3MGAA 3LY6A 1INQB 5FF6B 3S5LG 4E5XB 3U9PH 1ZWIB 1KB5L 2PTUA 1CFNA 5DO2D 5FOBB 2YEZA 4FTVB 3BPLC 3IXAB 4NQSB 1I1AB 4F80A 5L88L 2NY5H 3RGVD 4H20H 3O0RH 4UIMA 2QSTA 1QPXA 2D31B 4Y4FC 1LEKA 2RGSA 4M6NL 1Q0XL 1A1NA 5I71C 3WIFA 3EYUH 1LNUA 2BNRE 4RGNE 1BJMA 2G5BA 1BEYH 2HVJB 2AK4A 2FJHA 4M02A 2R1WB 1DANU 4XBEH 1OM3H 3NN8B 4NZRL 1LK2B 3BMWA 4U6HA 1T0NB 5D6CA 5L2KB 6CGTA 2UWEB 5T1MA 3O2DL 5KVGL 3QDGA 4QY8B 3GMOA 1A7PH 1R24A 4LSUH 1CE1L 1IAKA 5EG6C 4IRJA 5I15L 1I9JL 3LSOB 4JLRB 4JKLA 5EUOF 5IBUB 1R5IB 2P43B 3L5JA 4WI5A 3MRDB 1KYOJ 1XCTB 2X4UA 4OIBA 1A14H 4JY6B 2DB8A 1YNTA 3EDFA 3LN5A 3NCEB 4DKDC 3ULVL 4GRMB 1KACB 4OD3H 4EDXA 2HTKC 1Y18B 4YNYB 3UX9B 2HT2C 5EBWB 1CLZH 4EQ3A 2BOCA 4F33B 2YD5A 2OQJB 3H9SD 4PJFB 4MCYB 5HYJB 3ARTA 1LD9B 4HX1A 1NSNH 3QUKA 1T1ZA 2H2PD 1OAUH 2W59A 1AC0A 5IKCA 1IVLA 3QUYA 4WFFE 2YPVH 3TWCL 1IEAB 5D2NB 5DC9B 1FV1A 1I75A 4CADA 4Y16D 1CD0A 1JHLH 4PP1C 5A1AA 4EI5B 2AAVA 5GPRA 1CLYL 2VDMH 4KTEH 5MI0C 1ZLSH 1J1XL 2D7OA 1WEJL 4I18C 1NEZG 1RUAL 5TE6H 2FB4H 4YHZL 4Y4KA 4KHXL 1MFAH 4QRSA 5TE4L 1YPZE 5I17A 1JZ7A 3ARFD 3MRQB 4A6YL 4BUGA 1P1ZB 3HG1D 3HZYB 4L8SA 2Q7YB 4PRBB 3SDDB 2H9GB 1A6AB 1YPZF 1EK3A 1KLGB 5JDSB 1I8LA 3BI9X 5IQ7L 2BVYA 1LO2H 3MV9E 3QEQA 5EZIL 4JO4L 2E8ZA 4Y19E 1ACYL 4L4VD 2OMBA 3HZVA 1CXHA 4YHIB 1CN4A 3KJ6L 3EFDH 4JB9H 3HR6A 4PREB 1T21B 3IF1A 2EO1A 3IJYB 4WW2F 2P8LB 2AABH 1PY4A 3QQ4B 1EEZA 3TN0B 1T1XB 1KJ2L 3OKNB 2EXWD 4OCNC 2X4QB 4E0RA 4RA3A 3KLAB 4FNLH 3S96B 3C87A 4YLQT 4PFEA 4PJ5B 1HNGA 2UZIH 3MO1A 1ZMYA 3P77A 1P7QD 2X5PA 3TBSA 1EAPA 1AE6H 1RZKL 3TIDA 3V4PH 4NQEE 1HHHA 3WN5C 4KJYA 2DWEB 1PSKL 1YY8A 2AQ2A 4K55A 2FX7L 3SJVE 2FR4A 2YS4A 1BFTA 4M61B 1OP3K 3GSNB 4P9HH 2RAMA 2WBJB 3K80A 4JGUA 4FQ2H 2FBOJ 1CFTA 1N0XL 5AEAA 3BH8B 3BH9A 5FM5M 3CFJB 3V0AC 1GL4B 5DZNA 5ABDE 3O3EA 1U8HB 5CHNA 1T0MB 5D2LA 5EDXA 3RX7A 4NO5B 5DS8A 3MCKB 2RB8A 4FFYH 3FQTB 5SX5K 1KG0A 3QZWA 2OI9C 4I3SH 2ARJQ 3P3YA 3VXMD 1VFBB 5TQ0H 1OB1A 5B22A 4XC1H 1NBQA 2JJSC 4IIQB 4G7YL 4NZDA 1BVKB 1VEPA 3V5DA 1UA6H 4EI6B 4J3OC 5BRZD 4U6VH 1WISA 2X4RB 3Q48A 2OJEA 4NT6A 4NRXB 1F45A 5D7SH 3VA6A 2PYFB 1JV5A 3C2SA 4OAWB 3D2UB 3MRPB 3SKJH 4RX4A 2A77H 4M48L 4U0QB 3SKMA 4RZCB 2GTZB 4KZDH 1KUMA 4QO1A 2R69H 4UINL 5CP7B 1QQDB 1E27B 5J3HD 3R06B 5L7XH 5IMOB 1JIBA 3JWDL 5DEGA 2RJMA 4KROD 3UJIH 2VL5A 4MNQD 3DRQA 1ZHNB 5DJ0A 2IPTL 2X9YA 3IKCB 4OZFH 2ERJB 4ONHB 3QCVH 3LKPA 1U3HD 1F13A 3O6LL 4LHJB 4HWBA 2NXZB 1UZ8A 3JWOL 4RGND 4MB5A 3CIQA 3GIVA 3BQUB 4JFYB 4LCCC 4ZMAT 3VFRB 3TBWA 1X5XA 1U8QA 1NKOA 3ARBD 1FFQA 2JLLA 2AV7B 3WE6A 1QEWB 3TO2A 4FZ8H 1BF8A 2B1AH 2YKLH 3CFIC 3TA3D 4BH8B 3RGVB 3CLFH 3EHBD 3UAJC 1FBIL 4QOKB 4XPFL 3W0WA 3D18B 4C56B 1BHGA 4PJAB 3GSQB 1I9RL 1GGUA 4PGDA 4K7PL 2R0WL 1JZ8A 4EIGB 2BNQD 4Z7UE 3ARGC 2A9ML 3CFEB 4ZXBB 5DMKB 4XBGA 5DA4A 4HUXA 3KPLB 3X12B 4X7FC 3P9MA 4XVSL 5D5MA 3WJLA 5HYSB 4HPYL 1PKQB 3INUL 5BV7H 4KGLA 4DGIH 3X17A 9CGTA 1F2QA 4NPYA 5CFHA 4OF7A 5JOFA 5GHWH 4WFFD 4E5XA 5DD0H 4KFZC 3WO3B 5DXWA 3ZE1E 1ZA6B 5FOBA 4I5BB 1BFSA 4FTVA 3AUVA 4UBDC 4NQSA 5BW7A 1I1AA 2QSCH 4CN6A 3ZE1F 4UV4L 3KPRD 3RQ3A 5I74C 5DC4B 4MXQC 4LPYA 4TRPL 4LMQE 2D31A 1F42A 3H9SB 4LLMA 2PO6C 3TV3H 4QTHB 2HFFA 2ZCLH 1B6UA 1INEH 2FHFA 4NWUH 5IFHH 2BCKB 2HVJA 1NAKH 1R5WB 4G6KL 2R1WA 3HNTH 3NN8A 4P46B 1DQQB 4ZO6A 1LK2A 5C0AB 1ZXQA 5MP6H 2PYEB 3RWCB 1T0NA 4HJJL 3ZMRA 4PB0H 2WWMD 2UWEA 1KF9B 5FYJU 3MV9D 5EC2B 5MHSD 4F7EA 4QY8A 4Y19D 2BVEA 5FK9B 1DLHB 4OD1L 4BQBA 2QQNH 4L8BB 3QO0B 3LSOA 3RDTD 3IETB 4JHZA 4JLRA 4H26A 5AYUH 4QRRD 1WZKA 3JV5A 3BPNC 4HUMB 1XCTA 3GHEH 4JY6A 4M1DL 1GPOL 1BD2D 3ARFB 3HG1B 4GRMA 1Y18A 2ZUVA 3HMXH 4YNYA 2DRUA 3B4NA 4XWOD 2X6MA 1F4XH 5MEND 2KH2B 2OQJA 4PJFA 4R7NB 5T3ZE 5HYJA 1X5GA 4L3AA 4K71C 2I5YH 3SJVD 3P30H 4AIOA 3PWLA 2Y07H 1OAZL 4EXKA 5DLMH 2HKHL 5K9JH 1TFHA 1X5HA 5CKGA 1ZK9A 3NH7H 5D2NA 4D9LH 1NCWL 4HWEH 3MLVH 2R29H 5HHPB 7FABH 2CGRH 4XX1E 4Z95L 1P7QB 2H2PC 5E2JA 3LMJH 3DIFB 3KYMA 3KYKH 3MLYL 2ARWA 5FKPB 1ZT7B 3E3QC 4DOHB 4WO4B 4K3EL 4Y16C 2AEPH 3GJFK 1CXFA 3T3MF 3MRQA 1IGYA 1P1ZA 2Q7YA 4KDWA 4PRBA 3SDDA 1A4JB 5JPNB 1NL0H 2H9GA 1A6AA 3FONB 4P57B 2DTSA 3I6KB 5HD8D 1KLGA 4BFBD 1Q0YL 5J0BA 5JDSA 3CXDH 3WSQH 2DQTL 4NQXA 5F3BB 4APQD 3K8KA 1CQYA 4GRWH 4ODVL 4PGEB 4U05A 4HULB 1VGEL 4PREA 1T21A 3QZWG 2ZUQB 3VXMB 1JWMB 3V9FA 3C8DA 2P8LA 1DBBL 3QQ4A 4MA3A 4GSDH 5JHDE 1UWGL 3TN0A 4ODHH 5E4EB 1NUNB 4XP1L 5C2BL 4LPCA 2AK1L 2XZCH 2X4QA 4OKDA 5JOEA 2PN5A 5BRZB 3KLAA 5GJTL 1QPPA 3VXRB 2GYSA 4PJ5A 3EYVB 3D85B 3MC0A 4N90E 1I1FB 3G6JB 4PD4K 5TF1L 3ZHDA 2DWEA 1TZIB 2DBLH 3MR9B 2HMIC 4P4KC 4M61A 1QSFE 1IC7H 4TVSa 5IB5B 2WBJA 4XNMB 4U33A 1JNHB 3VFMB 2X9XA 3BH8A 2CJUL 3CFJA 4GMSL 4M43H 1A6TB 3CZFB 1U8HA 3V0WH 2XY1A 4NO5A 4OFYA 1KB5H 3TO4C 1F4WL 3FQTA 3NFPB 5DRXB 5DZLA 2X4OB 2W92A 4MYWB 5EBGA 1VFBA 2X89A 2QHLA 1UZ6F 2ZUWA 3F58L 2HLAB 3VU2A 3SGKA 5GRWA 1BVKA 5D6DC 1VERA 2DI9A 5FV2A 4MZ3A 4M6NH 2AJSL 4OZGB 4EI6A 5EUOB 4NRXA 5E94B 1MCKA 4NZRH 2PYFA 1W72B 4JJ5B 4OAWA 3D2UA 4KHTL 3T2QA 5KTEH 3I3DA 3P0GB 5IBLD 1QUNA 2GTZA 1HXMB 2BJMH 4RZCA 3U6RA 5F9OL 1ITCA 1YNLL 1MSPA 3BOVA 4WI9A 5KVGH 1RHFA 2BNQB 2HAZA 3BAEH 4KRPC 3L3IB 4JCMA 5CP7A 1A7NL 1E27A 1QQDA 5IMOA 1ZLWK 1RJZA 3FL7A 1X44A 1LK3H 3IKCA 4ONHA 4YWGL 3MYJB 3WDHA 3MRJB 4JFXB 5GGSY 3LPWA 1HOCB 1KCUL 3EFFB 3BQUA 4XP9L 3EYSL 2I07A 5BQ7B 4MJ6B 3VFRA 4KROC 3RZCD 1UM4H 5CWSA 4Q2ZB 5IMMB 4KKNA 2AV7A 3MLWH 1M05A 4BH8A 1U3HC 1N6UA 3RGVA 3KPRB 2VDKH 4RGNC 1DANT 1HXYB 5F88A 4D9RD 5FV1L 2HH0L 5D1ZA 4QOKA 1QSZA 3QNZB 4N0CD 5GZND 3D18A 2KZ1B 4C56A 4PJAA 3CDYA 1RIUH 3GSQA 3ZYZA 4X98B 3ARBC 4N8CL 4PGCB 3FAWA 3ZKSD 2Y4SA 1AQKL 4KU1A 4JDVB 1JYNA 3TA3C 2HTLD 5D7JD 2QR0B 5C0RL 4OF0A 4PJIE 1CLYH 3CFEA 3EHBC 4XNUH 1I9EA 4ZXBA 5DMKA 5L8LB 4NUJB 1SYVB 2ZUXA 3X12A 1QBAA 3GO1L 4WW2B 5H2BB 4YHZH 4KHXH 3SDCC 1PKQA 4X7SL 3C2AH 1NCDH 5DEZA 4A6YH 4NN7C 5IBUG 4YK4B 4XNQB 4QRRB 3BUTA 3B43A 1EZVY 4HWBL 1LE5B 4AT6B 4YJZL 5EZIH 1BD2B 1N5AB 1ZA6A 2F5BH 4CMHB 4I5BA 5FM5O 1EHAA 1CD8A 5DQ9B 4L4TE 5EFIB 3L5HA 2LE9A 2ZG3A 4OF8A 4K8RL 1ZANH 1SVCP 5ESQB 1V3LA 5MENB 1QLRB 2AGJH 3H9SA 3MRKB 1NGXB 3ZKMC 4ELMB 1D9KD 1MRFL 1X4YA 3MFFB 4JZJB 3P73B 1YEGL 5E0QA 2BCKA 3FKUS 1R5WA 2IFGA 4ISVB 1DQQA 2F5AL 4P46A 4WFED 5C0AA 2PYEA 4OQ1A 3RWCA 5IHZB 3OAUL 1IGMH 2X41A 2WQRA 1QO3B 1RZKH 4YC2B 3UPRB 3K3QA 5EC2A 2DKMA 1PSKH 3QJHB 5FK9A 1UWEH 5EA0H 1DLHA 4DZBB 5IM7B 2MMXA 3C5ZC 2J4WH 4L8BA 3UTTD 3IETA 4B5EA 2DKSA 3VGAC 1CS6A 4PS4L 3U79A 1ZVSA 5CMAB 4TN9A 4K3DL 1HZHL 3A67H 2R1XB 2WWMC 3ARFA 1WFTA 3MFGB 3ZDXE 3S35L 2IQAB 1DEEB 1V7ML 2EIBA 1HKLL 2VLKE 4P2OB 2LU4A 3TT1L 1XGTA 1UB5B 3GIZL 3KYOB 4N90D 1RIHL 4G7YH 3WLBB 4MB4A 1N5YH 4CAGA 3GSOA 4XH2B 5H94B 4JCLA 1R3LB 3QHZL 4XB7A 5I1CL 3ROLA 1FZKB 3G5VB 5GGRB 1MCPL 1G7HB 4TPRL 5DRWA 4N5ED 4RAVB 1S7WB 3FAXA 4OGAC 4XWOC 4EBQL 4M48H 5EZJA 5FM4A 5DGRA 1IC1A 3DYOA 1FE8L 4YHML 1MNUH 1P7QA 1S9VB 3GM8A 3JWDH 3KR3L 3DIFA 5FKPA 4OZIB 3EO0B 3SQOL 4WO4A 4FFVD 1G9ML 4NBYB 5TJWK 1WFOA 1OARH 4LOUD 3O6LH 1OGTB 2FO4B 2V7NB 4GQ9H 3UPCA 1F6AB 2I26N 2YD2A 4BSVB 1MCOL 1A4JA 3FONA 5F1KC 2VXSL 2B5IC 5F3BA 5HI4D 5HGAB 2WUCL 4PGEA 4HFWB 1S9XB 4LSSH 3G9AB 1CLOL 5SWZE 1BAFL 3VXMA 5D72H 4R4ND 1JWMA 1V5JA 4WU5A 1FL6B 3I02B 1IM9D 3U0WL 1UM6L 2X4SB 5HD8C 1CXLA 3MLTB 4XNYH 5F96L 3SCMD 4APQC 5BRZA 3VXTB 4UTBH 4K7PH 3LOWA 3N9GH 4GAYB 2JB5H 5E08L 1VB9A 3VXRA 3SY0B 1UJTA 5F1NB 5CSBA 3EYVA 3D85A 2PKDA 4J3WA 1I1FA 3G6JA 2A9MH 3WNLA 1QKZL 7CGTA 3GMPB 1TZIA 3NGBC 4LDOB 3MR9A 4ZFFB 4XVSH 2AJVH 2ITDA 1A7QL 2KZWA 4TUKL 5I18L 3NACL 3MZGB 4HPYH 4XNMA 3SE4C 1S78D 3VFMA 2GK0B 1T66D 3DX7A 2WANA 4WHCA 3E8UH 2FD6L 2Q3AA 3CZFA 4O58H 1MF2L 2LTQC 4RAHA 4Q97A 3IXTB 3LCYA 1N7MH 1J1OL 4LVNB 2ZUTA 3VXSD 2DTML 3FN3A 3NFPA 5DRXA 5BS0D 4WY7H 2JB6B 3KYNB 3OF6A 2E9JA 4UV4H 1I7ZB 2HLAA 4PRPB 3SDXE 3T0DA 4NQDB 3HMWH 2MNUA 3TT3H 2B2XL 2XI9A 2VIRB 4M1CD 4M4PA 1P2CB 3D9AH 4OZGA 1WBYB 5CUSL 1JTTA 5LXGH 3ALXA 3WFEL 5F44A 3IDXL 5ERWB 4G6KH 2YBRB 1L6ZA 5E94A 3U4EB 3I3BA 1JK8B 1W72A 4JJ5A 5I73C 1OLLA 3CLEL 5J12C 1HXMA 5ISZE 4JKPL 1T83C 4X4ZA 3J8F7 3UZEA 5GGQL 4KTYA 2CK0H 3L3IA 1NQBA 4OD1H 5D7JB 2MWCA 3DXAE 4L4TD 3E0GA 4BA8A 4IS6B 2HLFC 3OKDB 4G6ML 3UO1H 1FLRL 5FYJE 1U6AH 3LQZB 3MYJA 4PGBA 2ITCA 5KJRL 3B9VA 3MRJA 1GPOH 4FQXD 4JFXA 4ZS6C 5L2JB 2VISB 3MLUL 1HOCA 3EFFA 3RHWK 5EPMB 5BQ7A 3I85A 4MJ6A 1MJJA 4R97C 1CFBA 4PG9A 5IMMA 2ORBL 4WJ5B 1NFDB 3GKZA 3CFCH 1ULVA 3WFBH 2VMFA 5JW3L 4LVOB 1NPUA 3KPRA 2AJ3B 1HXYA 3H3KA 1ZEAH 3B5TA 3QDJB 4PRIE 3TYGH 4GG6E 3QNZA 4NCDA 3GRWH 3ISWA 3GMLB 3RZCC 4WHYG 2HJKB 4QTIH 4PGCA 1C5BL 3TGXA 3ARQA 1OGAB 4JDVA 4N0RA 4E41D 1NCWH 1RIVL 5IR1B 4Y2DB 1YEKH 1ZLUH 2QR0A 3WFZA 2EDWA 3OKEA 2F53B 4NUJA 3JV6B 4DCQB 4N0CC 1SYVA 1X4ZA 4GAFB 4HPOL 4XGZB 3MLYH 3RVVD 4IOFC 4OCMC 4R8WL 4WEBL 5H2BA 3L7FB 5DHYB 3P4LA 3UTTB 2EXYD 5E8OB 2C3WA 3RVWD 4AL8H 3QEUB 2HTLC 3ZKXB 3FO0L 4QRRA 3IDJB 1LE5A 1CCZA 4L3ED 4G43A 4AT6A 3BWAB 2DQTH 1BD2A 4LDEB 1N5AA 1T1YB 4QRPE 4NZJA 5DQ9A 5EFIA 4FP8L 1PGRB 5ESQA 1DBBH 2YUXA 1MFDL 3MRKA 2ATKB 5DF0A 1NGXA 5C2BH 4HDIB 5EU6D 4ELMA 3MFFA 4JZJA 1RHHB 3P73A 3X14B 2F15A 1KSRA 4LEOB 1M7IB 4ISVA 5C8JB 1I85A 1QD0A 5C0NC 3WXVH 5IHZA 1T89C 4RNRB 3T77B 4Y5XC 2Z8WC 3CSPA 1QO3A 4OLWL 5TF1H 2FHCA 3UPRA 3B8YA 3QJHA 4E42B 4DZBA 1CGSL 5IM7A 4MXWL 3DX8B 1DSFH 3RJQB 5SWZD 1Z3GH 1CL7L 4O4YH 2BRRL 1CF8L 4GMSH 1JFQL 4JM2F 2IANE 1F4YH 4XWGH 3OR7B 4R4BB 1F4WH 5HBBA 1MH5B 3BN9C 4BYHA 5FUZL 2IQAA 2GFBA 5HI3D 4P2OA 4G6AD 1H3GA 2P49B 1BBJB 1UB5A 4MAYC 4AIZB 3KYOA 5E2WH 4JFFB 5INCB 3WLBA 3S9DB 1NCBH 1K85A 1HH9B 5H94A 1R3LA 5IVXE 2DYPD 2FIKA 1FZKA 4O02H 4M93C 1G7HA 4PD4J 4JDTL 1S7WA 3IDUA 5IVXF 3O6FD 2AJXH 3H42H 1NCNA 3SCMB 5TE7H 2NX5B 3CPLA 1Q9OB 4L1DA 1TLKA 5E8EB 1S9VA 3HLAA 1J5OL 5FIEA 3RBGA 3LZFH 3PJSB 3QWOB 1EFXD 2A83B 3KJ4B 5IJKA 4OZIA 1QFWH 4LEXL 3EO0A 5JMRA 5J11B 4AH2B 4YWGH 5E5UB 4GXUM 1OGTA 2P5WD 4PLJD 2FO4A 4LSRL 1F6AA 4JQXC 2F19H 5HVHB 1F8TL 1KCUH 2ICCA 1CXIA 2DQHL 4WHTB 5HDBE 3VXUA 1I3GH 3SGEH 1MCQA 1MY5A 4MCZB 4C83B 1TJIH 1VCAA 3VXSB 1J0HA 2OJZH 3OAYK 5HDBF 4HFWA 5BS0B 4FMKA 5JW4Q 1S9XA 4M7LL 5EH1A 5BO1H 4IOIB 1MI5B 3VI3F 3OKMB 4JFDE 1FL6A 1T20B 3FFCE 5EIQA 3KS0J 3I02A 3DXAD 4EDWH 2HH0H 2X4TB 2X4SA 3BXNB 3V4UL 3MLTA 3MLSL 3U7YL 3G08B 5C0BE 5FYJD 3VXTA 4OLZL 35C8L 2I9TB 3RWFA 4KTDL 3U1SL 4GAYA 4PJ7B 1FYTB 1ZS8B 3SY0A 1CLCA 5F1NA 3WHE0 4WUUE 5DJZA 3F7QA 4JRXB 4GJTB 3OWEA 5E7FA 3GMPA 2FEDC 4ZFFA 4HGWB 4PJXE 3GO1H 1JGLH 5LQBH 4J8RA 3LEVL 1T7WA 3SN6N 4PJXF 2GK0A 3ZT5A 3VD5A 4DN4L 4OD2B 1IGFH 1UWXH 4DEPB 3QI9B 3IXTA 4FQXB 3I9GH 4R96B 4G3YL 1U8NB 4X6DB 2JB6A 3KYNA 3TBVB 1EBPA 1I7ZA 1VACB 15C8H 1QRNE 4K8RH 4PRPA 2MKLC 1T66C 2JE8A 4NQDA 2B8OT 4R2GB 2FBJH 2VIRA 1XCQB 1P2CA 1EXUB 5D96C 4XCYB 1WBYA 1MFEL 5JOPE 3KHOA 3GSRB 5ALCL 1YEGH 2X7LB 5ERWA 4XNZB 1DBML 2YBRA 1K9TA 3U4EA 1JK8A 3FFDB 4NSKB 1DQMH 1XR9B 3SGJC 1WZLA 1F4AA 4I18B 1S5IH 5JORB 3HS0A 4M1CC 4LSVL 5L6YH 3BGFB 4FQJL 2RQ8A 1H8SA 4QRPD 5GRVL 3P0YL 2XA3A 4LSQL 4QGTA 1X7QA 3ZKND 3V7MA 1UC6A 4L8CB 1EO8H 4IS6A 3PP3K 3QQ9C 3OKDA 4Y4HB 1NGYB 4K3DH 3LQZA 2I60L 3OAZH 3CMGA 4D94A 5L2JA 4HZAA 2VISA 4RQQB 4ELKB 5IROC 4X7TA 3OJDA 3ZDYE 5ITBL 5KW9L 1GGYA 25C8H 4JHAL 4L3EB 2WLZA 2EKSB 2EYSA 3AAZB 3AY4C 4WJ5A 3ZDYF 4NYLA 1NFDA 2EC9T 4P9MH 3MYZA 1EEYB 2PR4L 5AD0A 3QHZH 4S0TD 5I1CH 2AJ3A 1CQKA 2CXGA 2JIXD 4NKIL 3QDJA 4JM2D 2C1PA 5D71L 1YEDA 2BSRB 5EBLB 4PLKD 3ARWA 5EU6B 1IGTB 1UJ3B 3LEYH 1BBDH 1RY7B 1MCNA 1W72L 2WWKT 1HSAB 3GMQB 1OGAA 3MJ8A 4OF3A 1PAMA 2COQA 5IR1A 4Y2DA 1FE8H 4YHMH 3AMKA 2IH3A 2F53A 1CU4L 4WTZA 3KR3H 3JV6A 4DCQA 1RZ7H 2W0LA 4H0GA 2HRLA 4XGZA 3DI2B 5GZOC 3SQOH 1OT2A 4FS0A 1JHKL 3L7FA 1DBKH 1G9MH 5EU5B 4W70A 5E8OA 4XNXH 4OCWH 1YC8A 2YMXL 5GSVA 3WUZA 3QDHA 3QEUA 4EOWL 1MCOH 2DWDA 3BWAA 2EDLA 1YN7B 4X83A 3OXSB 1JZ3A 3F6LA 4JFQB 2ICWJ 5EBMA 3RVVC 3VW3L 1T1YA 5F6IC 2LQRA 4ZO9A 1FNEB 1NMAL 2EXYC 1NCUA 2YUZA 4Y0GA 3VMNA 2ZUSA 2L7UA 1IM3A 1T1WA 3NIDE 2YA1A 1ZGLB 4OLYH 4AJ0A 3F62A 2R2BB 4GQPH 4HDIA 1QG3A 3X14A 3NIDF 3DTXB 2DYPB 3HZKA 1YYLL 1M7IA 4LEOA 1DZBA 2CPCA 1WAAA 3RIFK 3ARVA 2V2XB 1GJIA 3O6FB 4MA8L 1FPTL 3T77A 4RNRA 2OCFD 3HE6D 4OCXL 3BRGC 4E42A 2Z93B 3OJ2C 2RBLA 4KVCH 1YMHA 3KPTA 3DX8A 4TUKH 5I18H 3OKLB 1CL7I 3KDMB 5ADOL 4JFDD 1SYSA 4EN3D 1EFXB 4XAKE 1T03L 1X5YA 2GY7B 2Q8BH 4G8GB 3FQWB 3OR7A 3WS3B 2P5WB 4R4BA 1I3UA 1OPGL 1MH5A 1MY7A 2ZOKB 5JQ6L 1JNJA 3GBMH 5IWLC 4HIJA 1BBJA 1LO4L 4WUUD 4FOMA 4AIZA 4JFFA 5INCA 3WXWL 3EAKA 1DVFD 3WKNA 1BFVH 3BSZH 5CUSH 3B9EA 4I9WD 4ODTH 3IDXH 1Z6JT 4KKAD 5I1DB 5HI3C 5LKNA 4M9OA 4XRCA 3CLEH 1AR2A 2EDYA 4KXZH 2NX5A 3FTGB 3MV7E 4NQCB 1Q9OA 1GAFH 4JKPH 4N0YL 5GGQH 3AM8C 5E8EA 3F6IA 3RHWF 1Z9MA 3L3JB 1F3JA 3L3HB 3NFSL 3MACH 4U2YA 4V1DB 4HXBL 3PJSA 3AXLB 1QRND 5F7EH 3QWOA 2A83A 4G6MH 4D0CA 3F12B 4AH2A 4H88L 3SBWC 4UTAH 3KXFE 1TQBB 4B7LA 4GOSA 4WHTA 4Y4FA 3VFVA 1EUTA 4ERSH 2E27L 3CU1A 2R8SH 4O51B 1FIGH 1O7SA 4MCZA 3VWJD 3VGHA 4C83A 3GMNA 1DQJA 1FGNH 1ZT1A 2FX8H 5BS0A 1F3RB 1IBGL 1C5CL 4B50A 4JY4B 2OX5A 5LBSL 4IOIA 1MI5A 3OKMA 5HDQL 1T20A 2LU7A 2WIIB 2QBWA 1A9BB 3WIIH 4JPIB 4F7PB 4EKXA 3BXNA 4NZUH 3JUZA 3GB7B 3G08A 5IFJB 5FGCB 1KOAA 3FRPA 4OZ4B 4PJ7A 3L5WB 1FYTA 3GK8H 1ZS8A 2P4AB 1TIUA 5CILH 4JRXA 4FHBD 4GH7B 2NTSP 1EVTC 1T80A 3VG9C 3HTLX 3BGMB 4ACPA 4HGWA 1DQLL 2MTPA 3HB3C 2IBZX 1CG9B 3BE1H 2V9TA 2VQ1B 4X4ME 4ZTPL 2Z0BA 4OD2A 3HPLB 1RI8A 2IPUG 5C1MB 2ESVE 3FO0H 3UXFA 3DJ9A 1IKNC 4F9PC 3U46B 1CGVA 3QI9A 4X7CC 4LPWA 5E8DL 1AI1H 4NO0D 1LO5B 4G80B 2ADJB 4NP4L 4R96A 5DI8B 4C4KT 1U8NA 4X6DA 5F3HA 5T1KB 4OLEA 4G8FA 3VA2C 3TBVA 2EDNA 1VACA 4UQ3B 3NCFB 2DDQL 3DROB 3S8WA 3QUMB 1XCQA 1MFDH 4Z18A 3W2DL 1EXUA 4XCYA 5JIIA 3GSRA 2X7LA 5FA3B 3VWKC 3FFDA 4NSKA 4F15C 2AJZB 1N3NB 1XR9A 2DS4A 2NMSA 4UB0H 4D0BB 5ID0B 2JJTA 3OG4B 4I18A 4FA8A 2HYMA 1J8HE 1YEEL 3MGOB 4OCYH 1ZOXA 4LPVA 1CGSH 1QLFB 4WTZG 4L8CA 2GQHA 2XXMB 2VLJE 1QBML 4NKDB 3U4BL 4Y4HA 3FT3B 4X0KB 3LKSB 1B9ZA 1JFQH 5E9DB 4H8WC 4GKNB 3ARSA 2M26A 4RQQA 1UXSB 4ELKA 3PWPE 2ARJB 4KDVA 1EHLL 4DKFH 3WFCL 4X6CE 1EHXA 1JHTB 2EKSA 3AAZA 3GSUB 5IEKB 1JPSL 4X6CF 1EEYA 2UUDK 1A0QL 1JZ4A 5AWNL 3LKRB 1UG9A 2DJUA 2NCMA 4Z0XA 3WS6C 5IOPB 2BSRA 5DMGC 1QSEB 3MRGB 1DN2A 5E5MB 5EU6A 1IGTA 5TQ2H 4NNYB 4QHKJ 1KTRL 4UI2A 3GMQA 1MJ8L 4RMWA 1BQUA 3IVKB 4RA0C 2NNAB 4U0RB 3ZHLA 2FL5B 5D7KE 2IBZY 4K94C 1NC4D 4F37F 3HE6B 4JM2C 1MCHA 1IGCH 4HBQA 2NQCA 2F54D 4CVWA 2FEEI 3R0NA 1V7NH 2H2SC 2X70A 4LP5A 5C3TA 2NY6D 3MX0A 4M00A 4PJDE 4LSRH 5HY9B 3O6KL 2JJSA 4NJ9L 1KBGH 3HUJE 4PJCE 4PJDF 1YN7A 3OXSA 3HUJF 4JFQA 2P8MB 3MV7D 1YDPB 2VYRE 4PJCF 2VC2L 4M7LH 4NOBA 3MODH 3O45B 2RHEA 5I1LB 4DWHA 5FAAA 1HHGB 2V5RA 3WNMA 1SJXA 4TULL 2HRPL 3WJJC 3MJ6A 5F21B 1ZGLA 3V4UH 4POUB 2R2BA 3MLSH 4KJWD 1T7ZA 5BZWB 1T7XA 5FHAH 3RUGB 1HH6B 1I7TB 4OFDA 1IQDB 35C8H 1FC1A 3L5XH 5AZ2L 5DGQA 3U1SH 3KXFD 1A7OH 2V2XA 3AFLA 4FQHA 4YDIH 5GIRB 4OM0L 3OB0K 2XN9B 5DVLA 3QQNA 5T1LD 1GOHA 4KK6D 2Z93A 1KGCD 2P47B 2VXTL 3RL1B 3OKLA 5KS9E 3LEVH 3KDMA 3P2TA 4Z7NE 5I6XB 1BZ9B 1EFXA 4G8GA 2H26B 1E4KC 1KJMB 3FQWA 5KS9F 3ZE2E 4HUVB 4Z7NF 3WS3A 2P5WA 2BNRB 3IJSB 4WI7A 4X8JB 3ZE2F 2ZOKA 1SY6A 5CLTA 2VXVL 4WI8A 3TPUB 3OGCA 3UBXB 3VRLE 4I4WB 1CFQB 1VHPA 5ALCH 1MCRA 3VRLF 2MCG1 2DQUH 5I1DA 1U58B 2ESVD 1BM3H 2R23B 3H3BC 4OLUL 2OK0H 3MXWL 4NQCA 3FTGA 4HMDA 1TVDA 4LRNH 3V4VH 1DVFC 5BOZG 3FRPG 2QSQA 2XG4A 4ZD3L 3CC5B 4NN7B 3LQAL 3P0YH 5F7YC 4Q9CA 3BKYH 2QQLH 3L3JA 3L3HA 4IRZL 4V1DA 3AXLA 5FGBA 2W60B 3DV4B 2AXFB 3F12A 2G5RA 4AEEA 3UYOD 5I8OL 4KDTC 5GRYA 4X6EB 4XP5L 3QCTH 3IAPA 4MLIA 1OOAA 3V5HB 3QP3A 3KPNB 4JHAH 4O51A 3OV6A 1AGDB 4DGVL 5DTFB 3CFBB 1G9NH 1UVQB 2R56L 3O8XD 3BESR 4HV8B 1LO3L 1J8HD 3Q5YA 4JY4A 3I50H 4WEUD 4ZFGL 2GAZA 5EOTB 1VGKA 2WIIA 1A9BA 5IESL 4F7PA 4N5UA 1A6WH 2B4CL 1BWWA 5DHXB 3GB7A 3BX7C 4P2CG 8FABB 3VWJC 2CMRL 3D69A 1WZ1L 4OZ4A 5CEZH 3L5WA 1CBVH 3PUCA 2DOCA 1U8PB 4IOSD 3P9LA 4NNPL 1MCWW 4OFKA 1P9MA 1CU4H 1IZKA 3GSXA 4LU5L 1JCKA 4YPGB 4JY5L 4DJMA 1ZV5A 4HHAB 1FGVL 5M94B 2CKBB 4OT1L 2HFTA 4PTUB 4IMLA 1CG9A 5ADPL 5HYQB 2VQ1A 3RWIB 5I30L 3A6BL 3HPLA 1MAML 5CP3H 1SBSL 3U46A 4M6OL 2D7QA 3KPSB 3T0VA 3ULVE 4G80A 5DI8A 1PX4A 4QCIB 5T1KA 2MCPH 3RIFF 1NMAH 1LQSR 3QIWB 4UQ3A 5J6HB 3ULVF 3DROA 2NZ9C 5D7KD 1TPXC 3QUMA 3BKJH 4PJ8D 4HSQA 4Z7OE 1J87A 2UVEA 3QHFL 4KVNH 1XIWB 5FA3A 4XCCH 4JGMA 2ZG2A 3HC3L 4ZFOB 3S36H 1T2QL 5B38B 4Z7OF 1N3NA 1UADC 3NA9H 1HEZB 1FPTH 2R0LL 4D0BA 5ID0A 3TPKA 5GRJL 4A2MA 4OCXH 3MNZB 1QLFA 3EJYD 4UDUB 2B7DT 4OGYL 3RY6C 2GJ6E 1NC4B 5J8OA 1JN6B 3AS3A 1UH2A 4K3GA 2JCCB 4ZOEA 2F54B 3VGEA 1CDIA 3FT3A 4X0KA 3LKSA 5E9DA 3QG7L 2NY6B 3KPPB 1M7DB 3MUY1 4XPAL 3DECA 1A64A 4YQXH 2ARJA 5I1GL 5JQ6H 1X4XA 2XYCA 3SDAB 2N7AA 4JKMA 1JHTA 4FQCH 3WXWH 3BZ4B 3GSUA 5IEKA 2AEQL 3C60D 1HYSD 5GISL 5KVFL 5CGMA 1AIFB 3LKRA 1KLUA 3D6GA 3X13B 5E8PB 2CRIA 1S9KC 4JVPA 3W11D 5IOPA 1QSEA 8CGTA 3MRGA 2LABA 2A9NH 3PL6D 5E5MA 1UWXK 4P4KA 3D0LB 3DMMD 4NNYA 3HC0B 4PJBB 4TVPL 4DUWA 2K9UA 1NCCH 1SJHB 1TVHB 3H9ZA 4N0YH 3M8OL 1K5NA 3HCVB 3MJGX 3IVKA 2NNAA 3MLRH 1Q9LB 2FL5A 2FLRT 5FGRA 1CD9B 1D6EB 3HE6A 4LK4A 4WWKD 2DMCA 3D39A 3DX9A 3GFUA 3TH3T 3TO4A 5M7QA 5J4MA 1P7KB 3PHQB 3NAAL 4X80L 3MLXH 2Z35B 2V5TA 4G9FD 1PZ5B 1GOGA 5FYKH 3VRJB 1HINL 4HH8A 4KUCF 4XHJD 5D6DA 1VFMA 3VD4A 4N1CA 1B3JA 5D9SB 1U3YA 4OLXL 5DJAB 2P8MA 4WGWB 1YDPA 2OTWB 5CIPB 1C5CH 4JN2B 5LBSH 5I1LA 4L3CB 3G5ZB 5SWSD 3TCXA 5HDQH 3RVUC 3TIEA 5LVEA 3T0AA 4HUUB 4F9LC 5J06A 2VABB 5TF0A 5CCKH 5BZWA 1HWGB 3RUGA 1I7TA 4H1LH 1IQDA 3EUUA 4M7KL 3LIZL 2VE6B 2J1KA 1F58H 4JR9L 3HI6L 5IB4B 4RFNB 4BSJA 4OZFB 3QFDB 3O2VH 3VH8B 4IMKC 3X3GL 5HHOD 5MEQB 5GIRA 1AQDB 2ID5A 2XN9A 2YPKB 4XMLL 1YQVH 4YHNB 4KJWC 4G6JH 1CTOA 4NO2A 5I1JL 2ICEB 2BY2A 1JZ2A 3RL1A 2QADC 3SKOB 4O5LL 2L4OA 3DUUA 3RI5K 4GW5A 3K46A 4ZTPH 1BZ9A 1R3IL 3WFDL 4PPTA 2H26A 1KJMA 4OBRA 4WV1C 4J3VA 2JF1A 4HUVA 2EDQA 4KK6C 2BNRA 1FFRA 4Y5VC 3IJSA 5F7WC 2ZG1A 3I2CL 3THML 5JLZB 4Q6IC 1A5FH 2CIIB 4NCC1 1T5XB 2IMNA 4JQVA 2O5XH 1I7UB 3PQYE 4XPTH 3TPUA 1R3JB 1JWSB 3UBXA 4PB9H 4I4WA 1CFQA 4ZNEE 1A3LL 5L8JB 1MIEH 2NY4B 4MMZC 2XZQL 3QG6B 1FZJB 5FYLL 2HA1A 2F8OA 4OF5A 1CDJA 4FQ1L 2DIBA 1JZ5A 1A6VL 1A7RH 3WNOA 5C09E 5LGHH 2VR5A 3SDCA 3PIQB 4KUZL 5BV7B 3QEGH 1UT9A 4AQ1B 3ULVD 2Y72A 4ZODA 3CC5A 5EC1B 1N4XH 1IFHL 4PG2A 2YOCA 1QBMH 3MSPA 3H0TB 4LSDA 3IDIB 3CCHB 2W60A 2AXFA 1BGXL 2QQKH 4YHKH 1J0KA 2OP4L 3QFJE 1EHNA 3BRDA 3OTTA 3VGDA 2ZCHL 1RUPH 3V5HA 1NBYB 1YNKL 3KPNA 1EHLH 4UMGA 1IAMA 5DTFA 4OI7A 1TQCC 1UVQA 2VLRE 2XQBL 4HV8A 3UP1A 1SY6L 1AGBB 4IRSB 1KULA 4U7MA 2I25N 3LKOA 3CDFA 3LS5H 1OY3B 3ZTJH 1P84K 2I24N 2GJ6D 3MA7B 3NZ8A 1KCSL 4XBPB 3LKNB 5KSVB 1XF5B 3C8KB 2R2HB 4OJFL 1NDMB 5HYFA 5CS7A 1MJ8H 3FZUC 2RR3A 3FB7B 1U8PA 1E0OB 4BH7B 5GS1C 3D3VB 4G6FB 3MOBH 1A2YA 3OG6B 1WICA 1NMBL 1H8OA 4YPGA 4L9LB 4P5TB 3PGCA 4NJAL 3O6MH 3BZDA 4HHAA 5BOPA 1ES0A 2CLVB 3WDIA 2CKBA 5HXMA 4QRTA 4ODSH 4PJ9D 4PTUA 5HYQA 3RWIA 1G1YA 1QZ1A 4KKCD 4NHCL 4YBLB 1CDYA 4O2EB 5D1XD 4YXHH 3IDYC 3UTPE 3KPSA 3B9KB 3VXQB 2VJXA 2H41A 2ED9A 4QCIA 2VC2H 3O4LB 4NRZB 3STZB 1GC1C 3CMOL 4JFZL 3QIWA 3DLQR 5J6HA 1C7SA 4UIKH 3V52H 3D0VB 4LQFH 3MBXL 4ESKA 1RULL 5KSAC 1YECH 2LFGA 2Z8RA 3FQXA 4NQEA 4OBSA 2GCYB 5LCVL 4BSWB 5JPMB 1XIWA 3QPXL 4KUCD 4ALAH 4JN1L 4I0KA 5DFTA 1AY1H 4ZFOA 5B38A 5K9KB 2AK4E 2EE2A 3PL6B 1HEZA 4GLRH 2E7CA 3DMMB 1OQXA 5AYQA 3Q0HA 5KANG 5IJVB 3SGDI 1CE6B 5T5NG 1LEIB 2V2WB 3GI8L 2ZJSL 3EOBB 3MNZA 4K23L 4PJ8C 3IFLH 1YEIL 1NLBH 4HMCA 4WW1B 4UDUA 3KPOB 1NC4A 2C4XA 1JN6A 1FJ1B 3RWJB 2JCCA 4ORZC 2KQMA 4GRWB 4MGXA 4UV7H 5C0DB 5IEHB 2C4FU 4N0UB 2PXYC 3KPPA 2V2TB 1M7DA 4G9FB 4KY1L 2CRZA 2P5ED 4I77L 1DBJL 3SDAA 4G42B 4I1NB 5CSGA 1HIMH 3ETBF 4UNUA 4PBXA 4XP4H 3BZ4A 5DJ2B 4AEIL 1OAQL 5EOCL 3UZVB 1HWHB 5SWSB 2GK2A 1AIFA 3QUML 1NANI 1RJLB 3X13A 5E8PA 1KENL 4WNQB 3QPQD 3BW9A 4NC1E 5E95B 1FSKC 4XVJL 4KI1A 4JO2L 3D0LA 4PJBA 1T2JA 3HC0A 4Z0BH 3PWVB 1QSVA 3MXWH 1NBZB 2FH6A 3C60C 5FA4B 1HYSC 1SJHA 1TVHA 3SE4A 2EKJA 1DQTA 1Q9LA 1B88A 5EZOL 5HHOB 2VAAB 1D6EA 4PJGE 3W11C 1KB5B 1BIIB 2GUOB 2FGWL 3PQYD 4NKOB 2HJFB 5HVFB 5E2UL 3C6LB 1P7KA 3PHQA 3SHSA 2Z35A 2HWZH 3Q6GL 1PZ5A 4LVEA 2EEBA 5D9SA 4CMMB 4DGVH 4WWKC 5DJAA 4UDTB 4X6FB 1CDGA 3QEQE 4BZ1L 2OTWA 5CIPA 1LO3H 3B5GA 4BFIB 3T2PA 1JJUA 4CJ1A 3ZSSA 2YD8A 3G5ZA 4D8PB 4Z7UA 2CLZA 2DQCL 3QUZD 1ZA3B 3JVGC 4PJIB 4UILH 3UBXG 3S7GA 2B4CH 1T83A 4RISH 2CMRH 1JP5A 1CYGA 4PGZA 3FN9A 4PJEB 4UT6L 3QFJD 2VE6A 3L3KB 2QEJA 3FO9B 4M5YL 1EEQA 5IB4A 5B3NA 5T3XL 1KELL 3L3OB 4NNPH 2P48B 3GSWB 1EBAA 2YPKA 1LO0L 3DSFH 3P4NB 2VB5A 1K4DA 3GHBL 4UOJA 1DL7L 4M8QB 2ICEA 5C0CD 12E8L 2AJUH 1YYML 3SKOA 3WHE1 5I75B 1F3DH 5F7MC 5I30H 1XF1A 4GXVH 4B0MM 4I0PC 2HVKB 4S11A 1Q72L 1SBSH 1WGOA 3WO4C 4JPWH 2E6PA 4P0DA 5D2LE 5JR1L 1F4HA 3MREB 5JLZA 4HS6B 2CIIA 2BSSB 2XG5A 1RZFH 1T5XA 5D2LF 3T1FB 2EIEA 1T0PB 5D7LD 4UAOB 3M17B 1JWSA 4K9EL 2GJZB 3HE7D 2VUOA 3HFMH 5I16B 2VR4A 4LCIH 2H1PL 3MLPA 4TYUA 3QG6A 1FZJA 2VL4A 3CFDB 3JV0A 5MEPB 3HC3H 5CD3B 4D0DB 1ONQB 4U7KA 3TC9A 2R0LH 3D87B 5C0EB 5GRJH 4A6YB 5I1EH 3PIQA 3AMLA 3RPIB 1Q1JL 3IFNL 1QA9B 5EC1A 2A6DA 1NEUA 1GZPB 1EUUA 5KAQG 3H0TA 3IDIA 3CCHA 3M07A 3R4DA 3QG7H 3PV7A 1K2DB 2GKIA 3MRBB 1G0DA 2Y6SD 1YEHH 4HFUL 1RUQH 3ULVC 2Y36H 1JNNL 5I1GH 1K6QL 2AK4D 3IDGB 5CJOL 3ARXA 4WTWA 1T3FB 5DURD 4JPKL 1PQZB 5KVEL 1NGPL 2OTUB 4Q0XL 3ILQD 1LVEA 3B9DA 5GISH 1AGBA 4IRSA 1NFKA 4QF1B 3UTSB 3V0VB 3PDGA 5BVPL 4GBXB 3QDGD 2ENSA 4NM8L 2LAGB 2X40A 5K59F 2IAMD 3WD5L 3OKYA 4XBPA 4G9DA 3LKNA 3N85H 1XF5A 5KSVA 4DTGH 2W0KA 4FABH 3C8KA 2R2HA 3W0WE 3WHXB 3SE8H 3SQBA 4P2YA 4BKLB 2EECA 4JANB 5B38G 5HHMD 3M8OH 3VXNB 3CXHK 1XR8B 4BH7A 5IW1B 3WIHA 1J05B 3D3VA 2VLLB 1EAJA 3BT2L 1GGCH 3PV6A 4P5TA 2XNAB 3U9PL 5HGHB 3GI9H 2CLVA 4AM0B 3HMXA 4ZTOH 5CINH 3NAAH 4XI5D 2J8OA 2VR9A 1I3VA 1T7VA 2NY5L 1EVUA 4H20L 1HINH 3O0RL 5D5MF 5DVOA 3ULUE 5IUSA 4GUPB 5JHDA 2IC2A 1KCKA 1IEHA 1RZGB 1U95B 5J13B 3B9KA 3FRUA 3GZKA 1CDCA 2P5EB 1U8LB 3VXQA 1XGYH 2AEWA 3O4LA 4NRZA 3STZA 4PJ9C 4FTVE 3FMGL 4XCNA 5ICYB 5GRVK 4KKCC 1OM3L 2K3TA 4ZDHB 2B1HL 2C9AA 3WMSA 5JW4N 5I9QB 5D1XC 5IGXH 2GCYA 4NN6B 1FVCB 3EYQD 4OZHB 3S36X 5JPMA 4EEEA 2NR6C 1LP9E 1QSFA 3RI5F 4M7KH 3LIZH 3W81A 5K9KA 4JR9H 4Y4KD 3JTSB 1A47A 5INDA 3PL6A 3EDDA 3X3GH 3DMMA 3QISA 3N1MC 2XFXA 1T7YA 1CE6A 1LEIA 1WZMA 2V2WA 5L2KE 3EOBA 2UWEE 2A0LC 4M7JH 3QEQD 1FNSL 5L0QC 3KPOA 4O5LH 3W5NA 1RU9H 2UWEF 3DUSB 3PABB 3RWJA 2CKBL 4LPTA 3HA0A 3SPVB 1MAJA 3WFDH 2BY0A 5IEHA 1G7IA 3EGSB 4YDKL 1V3MA 3VGBA 4NFCA 1WWWX 2A2QT 4G9FA 4P2RB 3U30B 1WBZB 2LV4A 1XGUB 2NY2B 1JUFB 1OAUL 3C09B 1M71B 4G42A 4HWZB 4DQOH 3DVIA 4M6MH 4H5SB 5DJ2A 1PZUB 1HKFA 4PJFE 3ROOA 5H35B 5HYJE 4C59B 2XZQH 2QHRH 1CWVA 4WNQA 1UYWH 5FYLH 2Z31C 5F6HI 4PJFF 2VDML 5C07D 4FQ1H 1G7PB 3PWVA 4ZFOL 1ZLSL 5D2NE 5HHVH 4YHOL 1S7TB 3RVXD 1B0RB 5FA4A 3DO3A 4KUZH 5TE6L 2FB4L 5DMJB 1MFAL 4YDLB 2DAVA 4OZFG 3VH8G 5HHOA 1IFHH 3QPQC 2VAAA 1HE7A 1H5BB 4JGJA 1BIIA 2GUOA 4NKOA 2HJFA 3KPMB 1LO2L 4KMLB 5FM8A 3RA7H 4AIXA 1BGXH 3C6LA 5C0CB 2OP4H 2YD4A 3JWOC 3EFDL 4JB9L 4PY7B 4U6XB 5FO8A 5EOQL 3LB6C 2FX9H 3BMVA 5DK0B 4CMMA 2XWJB 5GS0C 2D4DA 4MAUH 4UDTA 4X6FA 4HXAL 4Z77B 5F7DB 1QFUL 4RX4D 4BFIA 3MBEB 4FNLL 3P4MA 4D8PA 1C08B 1XF4A 2BZDA 1C16B 2UZIL 4PJIA 5D7LB 4FN0A 1YMMD 3HE7B 2ZUYA 4TTDD 4HKXB 3EDJA 2VKWA 4RFOL 4HG4K 4PJEA 1K8DA 3L3KA 5KANI 1QBLH 2CRYA 2FIRT 3FO9A 3KNBB 4P9HL 3L3OA 3QUZC 1IILE 4PJ5E 3GSWA 3WLWD 5DQJB 4QWWD 1FN4A 5CEYB 1JYVA 3P4NA 1NMBH 2E6JA 4MX7A 2EDHA 3V6OA 4NJAH 4M8QA 1FNFA 2NY1C 3O2WH 4BM7A 1NC2B 4K8RD 1WIOA 2CUIA 1U8KB 4TNWK 2MPAL 5FO7A 2DLFH 2JJVA 2HVKA 3O9WD 3AY4A 4UIMB 4XC1L 3UEZA 1WTLA 3W0WD 5D8JH 2FH8A 1UM5L 1LNUB 3MREA 4KMQA 4TOYL 1FO0A 2G5BB 2BSSA 4JFZH 5AZEH 2FJHB 3T1FA 5D1QC 5D7SL 3RTQC 2AEIT 4P3DA 3B9AA 3CH1B 4U6HB 3SKJL 2GJZA 2DLTA 3SE3A 1CIUA 5I16A 4RBPH 5E56A 5C08D 4XX1G 3QDGB 2R69L 1BVLB 5MEPA 4LPUA 2IAMB 4D0DA 5L7XL 1MRDL 1ONQA 2E7BA 2V5MA 5T1DL 3UJIL 4RCAA 1SEBB 5C0EA 2HP4A 4MD4B 1NMCB 3GI8H 3RPIA 2YD3A 3QCVL 2ZJSH 5HHMB 4M3KB 1QA9A 1FVEB 4P99A 1YNTB 4G8EB 3QT2A 2VLKA 2W65B 2BK8A 1FRGH 5TDPA 3QULB 1J0JA 2GW5A 1K2DA 4M5ZH 4FRWA 5ANMB 5KVDL 4FZ8L 5DJDB 2VSCA 2NZIA 1XEDA 1T1ZB 4TNVK 3CLFL 5IKCB 1DBJH 1T3FA 4LVHB 1KXQE 1PQZA 2OTUA 1X5FA 1D6VH 1X6LA 4YHLL 1WF5A 4CADB 3UTSA 4JHWL 3UBXI 3V0VA 5K9QG 3EYOB 4GBXA 4YFEA 4ZUSB 2DLHA 5C0FB 4QOKE 5IVZB 4JO2H 3WHXA 5IMLA 4C56E 4PJAE 3ILQC 4BKLA 4JANA 2XZAH 4Y4KB 3VXNA 5SX4I 1XR8A 4HBCH 4PJAF 5IW1A 1J05A 5BV7L 4L8SB 2VLLA 5EZLB 4CKVX 5E24E 4J4PD 4IRJC 1SM3H 3N1FC 2XNAA 2C4FT 5EUKB 4AM0A 3DNKA 3E6HA 2VDPL 4L5FH 4YDVB 3DBXB 3H6JA 4KZEL 2WV3A 5HYJD 2WUBH 4R6UA 5LJYH 1PKQE 2QSCL 3FFCB 3NPSB 5T3ZL 4I3RL 3CK0H 3TM6A 4GRLB 2G9HB 1U95A 4QHNA 2X4NB 5CZXD 2P5EA 5FECB 1U8LA 2ZCLL 1INEL 2UV3A 4NWUL 1SHMA 5KG9B 4IJ3B 4RWYH 1NAKL 2YC1B 2P45B 5MP6L 5FXCH 1U91B 1WK0A 4NC1C 4PB0L 3TBSB 3H9SE 3QUYC 1FVCA 3AM8A 1HHHB 3ZT7A 1YY8B 3LDBC 4NGHL 1K3IA 1G7JB 1YY9D 2FR4B 5F1IB 2QQNL 2VXUH 5C07B 1N2RA 5T3XH 5C0AE 5DHVH 2PYEE 1T04B 2GJJA 1ORQB 3SDDD 5B39B 1LO0H 2IQ9H 3GHBH 1DJSA 5E6IB 3G9VA 5CHNB 4OIIL 3MLZH 3WIHL 3GHEL 4NHUB 3EYQC 3OJVC 5DJXA 1U8IA 3MTRA 1AH1A 1I1CA 3QZWB 3HMXL 2Z92B 2R4SH 3SPVA 3SDXA 2FJFB 1NUGA 1OB1B 2P1YA 3BYTA 3R1GH 1F4XL 3EGSA 4U1GC 4EVNB 2BY1A 4FFZH 4LHUB 3OSKA 5JR1H 4P2RA 3T0BA 1I8LC 2I5YL 1WBZA 5FOJA 3P30L 4BQ6A 1XGUA 1JUFA 3HG1E 5FCUL 1MFCH 5DLML 5E2VL 1M71A 5K9JL 4HWZA 1P4LA 3NH7L 3MA9H 4QYOB 2K7QA 4PJ5D 1KN2H 5A2JH 5ISZA 2FZ3B 3EIFA 5CAYB 5H35A 5MEOB 2H1PH 3BHBB 2R29L 3MLVL 5I8KL 7FABL 2IPUK 4JZOB 4TSBH 1YMMB 2WBJD 5A2LH 2ICWB 1G7PA 2I9LB 3LMJL 2BRQA 3KYKL 1S7TA 2ICES 1B0RA 3I75B 3K0WA 3MPCA 4S1QH 3IFNH 4OFYD 2NY0B 1A3RH 3P40A 2J8UE 1H5BA 4F9PA 3FQNB 1OTSC 2X89D 4RAUB 1CGXA 3CXDL 1MJUL 4EJ1C 1RFDL 3LD8C 5IT2H 1U8QB 4LLAA 4DOHE 3RVXC 1H3PL 4PY7A 4U6XA 1KFAL 4HFUH 2B0SL 4GW1B 1JNNH 1NGQH 3O9WB 4PRIA 4GG6A 3FT2B 4F58L 3I84A 1EERB 2XWJA 3GJEB 4GSDL 4ODHL 1NGPH 3D2UD 1RSFA 2XZCL 5F7DA 2DQIH 5TDOA 3QAZB 3MBEA 4PGDB 2BVQA 1C08A 2ZOLB 3OB8A 1CFSB 3VXME 1R0AH 1MRCL 3X11B 3TJHC 3HE7A 3VFTA 5DDHB 4HKXA 3V6BR 2BDNL 4CNIA 5C08B 2PETA 5D5MB 5GRUL 1H3TA 5BRZE 5HHNB 3E2HB 3GKWL 5SX4H 3VXRE 4MS8D 2NXZD 5DQJA 5CEYA 1WCQA 3G6JE 3OHXB 4M43L 4OGZA 1WQVT 3V0WL 4TTDC 1NC2A 2C1OB 3G6JF 4YUEH 3T2NL 1U8KA 2Q6WB 2HKFL 4MQXD 3VFGH 4MNQE 3S3SA 3WLWC 4QWWC 4LLMB 5D1ZD 4QOKD 5I8EA 1HCVA 4UUJB 3WYRA 4C56D 2HFFB 3GMMB 2NY7H 3GRWA 4ZFZB 4KAQH 2MQCA 4K8RC 3FMGH 4RWHA 1EX0A 3RVTD 2B1HH 3CH1A 5KTEL 2J5LB 2Y5EA 3A0OA 4ZXBD 1BOGB 2BJML 3S3PA 2VNCA 4OZGE 3PGDB 4F7EB 3BPOB 1BVLA 3BAEL 4HCRH 1GGIH 2IAMA 1WFUA 5EUOE 3T4AA 3MNVB 4YGAB 4OZGF 5EU3B 5IMKB 1SEBA 4U1JB 2PCPB 4H26B 1LK3L 1ZGLM 2IANA 4MD4A 2XKSA 1KB9J 1XAUA 1IL1B 1WWCA 3TESA 1FVEA 1FNSH 2P8PB 3QIUB 2BNQE 2VOTA 4G8EA 1JGVL 3WJLC 4GG8B 2W65A 3ABZA 4S0SD 2CKBH 5CD5C 3QULA 1UM4L 3ZTNH 5IP4A 3ULUC 4YDKH 3MLWL 5ANMA 4Z7VB 3MRMB 5DJDA 5D93C 5DZOA 1KLFA 3MUHL 4CJ0A 3PWLB 4GAJL 2VDKL 3W9EA 3WJJA 3IFPA 1J8KA 4P46D 4ZUWB 4KRLB 1I1AC 5C0AD 2PYED 3LV3B 4DZ8A 1FO0L 1ED3B 3SE9H 1RIUL 1OQOA 1TZGH 2MSPA 1Z9LA 2VDOL 5DMIL 1BFOB 3EYOA 1YEJH 4HWNA 2WLYA 3KPRE 2VH5H 4ZUSA 3QIBB 5C0FA 3VFPB 4XNUL 5EO0B 1AHWB 4GKZA 2WP3T 5IVZA 1IT9L 3KYMB 4QGYA 4MA1B 4YHOH 3T4YB 5BXFA 4Y5YB 2JJUA 1U3ZA 3G6DH 3C2AL 1NCDL 1IGYB 1N0LA 4CBPA 3RFZC 1PLGL 3A6CH 5EZLA 1NAMH 4I0CC 2P42B 3HAEB 5EUKA 4C54A 1EMTH 4NQXB 5MHSE 2F5BL 4YDVA 3DBXA 4Q6IB 1F5WA 4WUKL 3FFCA 5EOQH 1C7TA 3RRQA 1ZANL 1I9IL 2IGFH 3BIKA 2AGJL 4GRLA 1WWBX 2G9HA 4QRRE 2A73B 4P23B 4MA3B 2X4NA 5C0BA 1KCLA 4HXAH 5FECA 1BD2E 1QFUH 5KG9A 3DHMA 3MJ7B 1OW0A 2YC1A 5DQDL 5A2IH 2YPLB 4OFIA 1IGML 1KJ3H 1U91A 5GSRB 3MV01 5MENE 4CDGC 2OR9H 4DK6A 4RFOH 4J7RA 5D2NC 1UWEL 5EA0L 4ELME 1G7JA 5F1IA 4TNWF 4WO4D 5A16A 5F9WC 3V79C 2J4WL 1REIA 5F7KC 1D5ZB 1NKRA