4WO4C

The molecular bases of delta/alpha beta t cell-mediated antigen recognition.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
200
structure length
200
Chain Sequence
QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGVTGKLTFGQGTILTVHPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular bases of delta / alpha beta T cell-mediated antigen recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d
total genus 43
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2014-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wo4C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wo4C01
3WXVL 4JGJA 4NQEE 1CTNA 4X9HA 5J3HC 4XGZA 4F7PA 1PQZB 3WUWA 1K8IB 3K3QA 1KBGL 3A6CL 1XGUB 2W9EL 1I3RA 4M7ZB 4TQEH 3O6LH 3QDJB 1VHPA 5BXFA 4R4FH 3SDXB 3QEGH 4PY7A 2AJSH 2I07A 3G6AB 4K3EH 5IMKA 1HSBA 1DP0A 3MLUL 2EXWC 4PGEB 2DQGL 2OLDA 4HLJA 3S35X 4UTAL 4YX2H 2L0DA 5C0CE 4L8DB 1SJHA 2AEQH 4UT6L 3RIAK 5IMMA 5IVXA 2DJSA 5FM4A 2A1WL 4ZTOH 3RHWF 2DQTH 5ITBL 1IL1B 4LBEB 4PS4H 4ODUA 3MRJA 2ZUQB 5DMGC 2J3SA 4ODVL 2XFXA 1YQ2A 5C86A 4X6BA 4Z7VF 1AO7E 3BO8B 2AQ1A 3WDJA 4Q2ZA 4TVPH 4OLWH 1DLFH 3MLVH 1CQKA 4K2UH 5D8JH 5BV7L 1Y0LA 2ICWJ 5J6HB 1KJ3L 1P5VA 4Y1AB 4P4KD 2ARJQ 3O11B 1QLEL 3QQ3B 2LQRA 5HYJD 2GJ6E 4PV9A 3MRFB 4UI2A 1OOAA 4UT9L 5MEPA 2V17H 3UDWA 4S1SH 2R0WL 4H5SA 12E8H 5IG7A 4KMTH 4EDWH 2OL3B 4KV5E 5CSBA 3S35L 4P9HC 4MQ7A 3GHBH 3BUYA 4GW4B 3CVHB 4RBPH 5CLWA 2I9LB 4LRIA 1ZEAL 3EOYG 3WNKA 1EX0A 2MOVA 1RY7B 4PLNC 4QRRD 3W2DH 4Z0BH 4CVZB 4U1KB 5BV7H 3DX6A 3HPLA 1QRNE 4M1CD 2JJWA 1OGAB 1QLEH 1RQ5A 4P2QD 4TULH 2XN9A 2RR3A 3DX7A 1JGLL 2ZCKH 5DEFB 3KWWA 1QHPA 3P2TA 2P5WD 3NA4A 1ZXQA 1MPAL 1URLA 1BQLL 1IAOA 4M48L 2CIIB 4KKBC 4KJPD 3GSWB 3L5WA 1LE5B 1H0DA 1U8JB 4LSRL 4WHTB 4F2MB 5BVPH 3WIIL 1L7TH 3ZYIA 3QHFL 3OAUH 2LTQB 2VDMH 2C4XA 2IANE 2IF7A 5TE4L 3QUMH 3WIHH 1RIVH 3M45A 5JW5A 5K59F 5J1TC 4PRIE 1GC1C 1CDBA 1GRWA 4DAGL 3MLXL 1NFDF 4WVRA 1L0YA 4DN4L 2CRYA 2EIDA 3K2MC 1HQ4A 3B5GA 1RIHL 2X7LA 2W92A 3MRGB 3VCLA 1QNZL 1T83C 4MLSA 1CICA 2IADB 2DDQH 3B43A 4PJDE 3UBXI 4DFHA 3FT2B 3CZFB 1MLBA 2ZJSL 4LP4A 4MHHI 5DJ8A 4CW1A 2HMID 1FN4A 3DTXB 5DYOA 3RFZC 2QJDA 5DO2C 1FGVH 1LVEA 3MJ9A 5MEOB 4POZD 4Z7NF 4CMMA 1TFHA 1AHWB 2NTFA 5KVFL 4PJGF 1FNSH 4C57C 3CCHA 4FHBD 5EZJA 4A6YL 3G6JE 3KPRB 4GFTB 4RAVB 4CJ1A 3E2HC 1IJ9A 1XR8A 5DFWH 2NR6D 4XNUL 5D7LA 1MFEL 4MNQD 4JFOA 1DUZA 1Y18B 5I19H 3SJVA 1NBVH 4YDKH 4D0CB 3EW3B 3T0EB 3I02A 3QCTH 3HCVB 3PWJA 5DRNA 1B4JH 5D72H 2V7NA 4BH8A 3HC0A 4AT6B 3S7GA 1G7PA 1YA5A 1YQVH 2E7CA 1C1EL 3SPVA 3KHQA 5F6IB 3UTSB 3K8KA 4YHIA 2D4DA 4NHCH 3G08A 1N7ML 2EDQA 5M94B 5MENE 4TOYH 3NN8A 2Y7QA 4Y5YC 3LSOA 4GXUM 3VGAB 3H9ZA 4NBZB 2NZ9D 5EDXA 5A16A 3ALWA 2WANA 1NC4A 8CGTA 2X4QB 4NWUH 1CVSC 4BA8A 4QRPA 2YEZB 2JCCB 2ZOLA 5HYQA 1HE7A 2B8OT 2X89A 3LN4B 4N90D 4G8GE 4DN3L 4NM8H 3VRLF 4F7TA 1HQ4B 1QPPA 2H1PH 1DBAH 4YHPA 5HD8D 4C4KO 5I18H 1AO7A 2VZSA 5IBUB 3TO4D 2HN7B 1CICB 4UOW0 4ZFGH 1E4WH 1OGTA 3UZVB 2V2TB 1IQDB 2OI9C 3MRBB 2AJ3A 4MSWA 5F7YC 4Q9QH 4HPYH 3QUXD 2BHUA 4KHXH 1U6AH 4P2RE 3QFJD 1ZOXA 4HBCH 3T08A 2XWTB 3MFGB 3D9AL 5HHVH 4QHMB 3HZVA 2R1YB 3JWOL 4IOSD 5D1XD 1YEHL 4FABL 1P7HL 1ND0B 2BVYA 2HRPH 3AS1A 4O2EB 4MJ5B 3P4OB 2DN7A 3VFOB 2FJHA 4ODBD 4MDJB 5KOVC 1OF2A 4J1UB 3KHOA 3TNMA 4L8SB 4RGNB 5E9DA 4J3VA 3E6FA 5K9KA 3PWJB 4IRSC 5B38A 5I1JL 2EZ0D 2ID5A 1AFVL 4FQPA 3ARDD 4JDTL 3B3IA 2JIXB 1N5YH 3G5VA 1CQYA 4MJ6B 2D2OA 4U6TA 2ZUSA 1TCMA 3GSVA 3IF1B 2GJJA 5JUEH 3U4EB 2MQ0A 3LB6C 4F8QA 1QSEE 3B9KB 4GQ9L 3Q2CA 1XIWB 3SGDH 3EYOB 5J6HA 5C0RH 3OZ9H 1T1WB 4MNGB 4NN6B 2YUZA 1A5FH 3Q5TA 5JW3H 3MXWL 4E5XA 3C60D 1RSFA 4PJCB 5ADPL 3MR9B 3BH9A 4PJ8B 5FYLL 2R0KL 2NXYD 3B2UC 5IB1A 2AXHA 2ICWA 4JB9H 4OZGB 4PJCF 4ORGB 4XAWH 1U9KA 4XPFL 4HWUA 4UV4H 4KRMB 3RTQB 5J7CC 3ALXA 1OM3H 2WSKA 3SY0A 4RGND 1CDGA 5AYUH 1RI8A 3PABB 2Y23A 3TCLA 4U6XA 4G80A 4NHUB 4ALAL 1YPZF 2FSEA 1DANU 2UY7A 5F7DB 3T09A 3TN0B 5D1XB 4I3SL 1DCLA 5E7BA 5TJWK 4QRRE 5E2WL 1KCKA 3PWPD 3MLTB 3VD9A 5FO8A 3MRCA 1K4CB 1A6UL 1QSFD 2DMCA 2OTPA 3B9EA 3LKOB 4ZG1A 1XH3B 3N0PB 4PG9B 4G8GB 2NX5D 4WW2B 1L7TL 4CU6A 2NY4D 1FO0B 4DGVL 3WNMA 2PXYD 4M7ZC 4Z77B 1FL3A 5HI4D 5BW7C 1TCRB 1ZHBA 4RGOH 3V7AG 1TLKA 4PJDF 1PDKA 1SMOA 4XXCA 4UTBH 5ETUA 1E6OL 3KNBB 5E5MA 3VRIA 4FG6D 4GS7B 4HBCL 1FORL 1A7NL 1QQDA 2H2SC 2GTWA 3CVHH 2BDNL 4YDKL 5HHNB 3AU1B 1JWSB 5DJ6A 1F00I 4JE4B 2ZG3A 3IYLW 1A1NA 1E4XH 1HXMB 1QRNB 3MR9A 1S5HA 4PJ8A 5C0DA 4HKXA 1Q9KA 3NAAH 4L3AA 4MJ2A 3KJ6L 4JRXE 3S98A 1QHOA 3MJ9L 4I2XB 5TDPA 2G75B 3KLHD 1T89A 3TM6A 3C5JB 1JRHL 1G0DA 3X12B 3LY6A 2IGFH 1V7NL 3SE4A 1I3GL 1F8TL 3RNQB 4F7EA 2C1OA 1HZHH 3PP3H 1RV6X 2XQBL 2FNBA 4LSUL 1EXUB 3W39B 5SWZD 4GUPA 3VI3E 4U4BA 4R96B 3MLSL 2CR3A 4N5UA 1AI1L 2YA1A 3MLXH 4PJXE 2JB5H 3ECBA 3IAQA 5J56B 2E27H 1J05A 5H2BA 2AI0L 3DIFA 4OZFA 1MCQA 1L6XA 4F3FA 2LFGA 2D7PA 2YUVA 2QKIA 2PXYA 4XCEB 5CILL 3C87A 4QRQA 1S7TB 4DW2H 1XFPA 3ZKXC 4PB0L 2JJVA 3UAJC 2ZJSH 4QOKE 5F9OL 1KYOK 3HZKA 2H3NA 1WK0A 2JELH 5BXFB 3ABZA 5DMJB 2R9HD 1IEBA 3NBNA 5CJQH 3ESVF 4X6EA 1A3RL 2VTFA 4HKXB 1Q94B 1NLBL 4OCYH 3BZFA 2X4UA 2NZIA 4G6FB 3O3EB 1KEML 4XVJL 1NANH 4AY0A 4PJFA 2Q6WA 5FB8A 4EI6A 3O2VL 3S3SA 1NMBL 3BYYA 1EO8L 3MCG1 1EPFA 5D70L 1MIML 5GJTH 1LE9B 2IQ9L 1RZKL 3JVGA 2FEEL 4NO3A 4L3ED 4MCYA 3HR5A 9CGTA 3QFJE 4PYHA 1FZOA 3PV6B 4QYOA 4DKDC 2GSGB 5GGRB 5B21A 3BDBA 1X5XA 2ZCKL 4PB9L 5EBWB 3CCHB 3JV5A 4ONGH 2DM7A 3GGWB 2N7AA 3HMXL 4R6UA 4R0LA 3E6FB 1XGYH 5I71C 3NH7H 1X4XA 1G9ML 3MRKA 1JJUA 3VXOA 2Y1VA 1PX3A 3G5VB 2IC2A 1OHQA 2F8OA 4U7KA 3U4BL 1R3JB 4HIXL 2XWJB 1AGCA 4L8CA 5DRNB 1E4WL 5KSUB 1ZA3A 4KRPD 1NPUA 2KQMA 4DZBA 1W0WB 1J0HA 4OQTA 5C07D 1E6JL 4KVCL 2IQAB 1F4WH 5EFIB 3T8XA 3K4AA 3NPSC 5CD5C 3HZKB 1R3HB 2J88H 2AJVH 1X3DA 2BY2A 3QUZD 4PP2B 5FUZL 2GK2A 2DB8A 3GMPA 4NQDB 5IFJA 4KI1A 2ZOKA 4N68A 3O6LL 3LQAH 3ETBF 4P46D 4PY8I 3LPGA 1T0NA 5AD0B 5FCUH 4Q6IA 3UJIL 4YE4H 2CIIA 4RRPG 1PJ9A 2HN7A 5D5ME 2GK0A 3DUHA 4G9FA 4NKDA 1BF8A 1D9KD 1WBZB 1S7SB 5TE4H 4ZODA 2RJMA 2OX5A 5KN5A 1UWGH 4WO4D 5K33A 1C08B 1RZJC 4RSVA 3RIFK 5D5MF 5D6DC 5EN2A 5JW5B 5IHBA 5JTWA 4KZDH 3VXMA 2DQTL 1EFXB 2OI9B 4PPTA 3TV3L 2BNRD 3H9SB 2BRRH 4W4NA 3IFNL 4P5TD 5CP7B 5A2IH 5IB2A 1T5WA 5CKAA 4HG4K 1H0DB 1QUNA 1GGBL 3V9FA 3WXWH 5HGHA 5IT2L 2QADD 4U0RC 3CX2A 1DN0A 1KN4H 5EOQH 4U3CA 3WSQL 3MFFB 3HNVH 1PW3A 3LRGA 5D6DA 1JN6A 2EDEA 2YD4A 1KTLA 3FO1B 4ALAH 1F90H 1PBYA 1EGJH 4WWKC 5J11B 4PJ9D 2R56L 1AR1D 4TSBH 4NNPH 2PO6A 4KRPC 2X4TA 1N0XL 2QADC 1JF6A 2IGFL 2JJTC 1K6QH 4OD3L 4PG2C 1KELL 2VQ1A 1D6VH 4NC2B 1WEJH 3LS5H 3U1SL 2HFFB 3MXWH 4TTGA 5EBLA 2Q3ZA 1QBLL 1MREL 4JZOB 1CFSB 5F3HB 2ADGB 3HE7B 1XMWA 4FQ1L 5BJTA 4UIKL 3OAZH 4ZPVA 2ADFH 1G7IA 4KY1H 4N0CC 4I5BB 5I1EL 4JFHE 2D0HA 1JGDA 4YHIB 4KROB 2QSQA 2RIKA 4PJIB 4HT1H 1HCFX 1RK0B 2BVTA 3MRRA 4CU7A 2A74A 4X9FA 4M8VA 1UM5H 5D71H 3PQYD 4GW1A 2O5ZL 1OL0A 1KENH 2XNAA 1PLGL 4NJAL 3RDTA 5JQ6L 5EN2B 5I75B 4CRPA 3P4LA 3H3PH 1DL7L 3SOBH 5C2UB 4JPKH 2AEWA 3KPMB 5EA0H 4AM0B 2VITA 5F1OB 1H3GA 4NCC2 5TDNB 2ICEB 3V4UL 2BY3A 4AK1A 1MHPL 2W38A 4JEGB 1LO5B 5I1GL 5IJKA 5JHDB 2YC1A 3RKDC 3UX9B 4P5TC 4MA7L 2LU7A 1HHGA 4JO2L 1NUFA 1LEIA 2VQTA 2VLJD 5IMOA 1QQDB 3QJFB 4R9HA 2YPLB 5GS2D 3D85D 2F74A 4KKAD 5SWSB 4YQXL 5D8JL 3H3KA 1JHTB 4M7LH 2Q8AL 3MLRH 4YBHA 3VXSA 1ZK9A 4IOIA 1VFAB 1ES0A 1U8JA 4JQXC 3OGCB 2YZ8A 4MDJA 4ELKB 1H3UA 5IHUH 1YEDB 1CFSA 2Z8VC 1QACA 2P24B 2WBJD 1INQA 1XF3B 4WI4A 1HILA 4M6NH 4Y89A 5EU6E 4ZUTB 4JCLA 4GKNB 4P4KA 1FPTL 4XBEH 2R23B 3U6RA 3KAAA 1EVUA 2XKUA 2Y25A 1J18A 2KZ1B 1I1CA 4L3EE 3S3JA 2CLRA 2C5DC 2D03H 1N6QH 5T3ZH 1DQDH 4TUJB 5I1CL 4RX4A 4Z6AT 5FA4B 2IPUG 3VXME 2DQIH 1YEEH 4XP9H 1YEFH 3O6FD 3AGVA 1F11B 4Z7WA 4G42A 2P5EE 4TUKL 4YXHL 3RWIB 4XPBH 4ONOA 2NZ9C 5MEQB 4HMCA 3PHOA 2YUWA 1WIPA 2EYTA 5IHZA 5IW6A 5KVGL 2ADJB 2BNQB 1NCUA 2LE9A 2O5YH 4V1DA 4X7DC 1HHHB 2VLJB 3GSOA 2ZPKH 4XP6H 4JFDE 5ESVA 4JFZH 3OKOB 3WLWC 6FABL 1T1XA 3DLQR 3E3QC 4MQSB 4JZNB 1CCZA 3MBEC 3TO4C 3BRGC 4RISL 3QDJA 3ARVA 2HKFL 5EZJB 3RDTC 1AKJA 4GKSB 1F6AB 3LN5A 3ULVF 5KVGH 4Z7OF 1Q0YH 4XX1G 4WV1A 4DWHA 3BX7C 3GKWH 5J4MA 3BW9B 3EZ8A 5JORA 2Z9TA 4B7LA 1O0VA 1OTSD 2CK2A 5E70A 3ZE1E 3P40A 4MQTB 4XBGB 1P4IL 4FMKA 4BZ2H 2ESVA 4R26H 2GY7B 2E7HA 3ALPA 5E2UL 3V0AC 3LRSA 4MXVE 1F4YL 1KIUA 4PFEA 2ICES 2F8VA 5FYKD 3CFJB 2J8HA 3AY4A 3N1GC 4LSRH 3BISA 3VRIB 4WUUA 4M6OH 2EH8H 2OJEA 5JOPE 3MNVA 5DMIH 3HMWH 1G6RA 4JFPA 2MKLC 4LOUD 4PG9A 1CDYA 4M7LL 1IGIH 4EDXB 1EZVY 3FONB 4RMRA 4PR5B 3BSZH 2FZ3A 2IH3B 1WLHA 3IDIA 1U3HC 3QFJA 2H2SD 3D85A 3IDNA 4X6DA 4NO5B 2YXMA 4NZTH 2I5YH 4V1DD 3VG9B 3AB0B 2IAMD 1DBAL 5E8NB 1FL5B 3BT2L 4M4RA 1FG2A 2DLFL 4J8RB 4R8WL 2HT2C 3UYPA 1XGUA 4UOW1 4MS8D 3DETD 4G8EA 4RFNC 1UKTA 3C8KA 3KR3H 1CU4H 1ZGLB 2Q1EA 1CD9B 3MV01 5CFHA 4HIEB 5T33H 1CGUA 1VENA 2G9HB 2HP4A 4K8RD 4ZO6A 5MERA 5TPWL 5FGBC 2XRAL 3O9WD 1OT1A 3ULUH 2DQJH 5ALBL 1RURL 1HIML 2OZ4H 3LIZH 3MLWH 2VLRD 4GXVL 1ZT4A 2EYSB 3I6LD 3O3BB 2FO1A 1F2XK 4JJ5B 2NY2D 4OZIE 3RVTD 2BOCA 2DYPB 3QP3A 3EO0A 5E5RB 2XTJC 3V79C 2PKDA 4LEXH 5D7KE 1I8KB 4WJ5A 3WIHL 2WP3T 1YYMH 5CD3A 1I3UA 1L7IH 1YNTA 1Q9LA 2MHAB 4GLRI 3BXNA 4NN5C 5J3HD 1NCNA 3MOAH 2AK4D 4FNLH 3VI4E 4OAWA 4PJXA 4X7FC 1XGTB 5F9JA 5FECB 2H3NB 1FFNB 4JKPL 1FGVL 5DZNA 1LDPL 4P23A 1T7ZA 4PRAB 3RVVD 5I74C 3NA9L 4EI5D 3RTQA 4LF3A 3ARUA 3MRPB 5FA3A 4JY5L 2NXZB 4OGZA 3WNOA 3AREB 1B3JA 3BP6B 2GW5A 3VFVB 2DDQL 1IC7L 4Y4FA 3HG1A 3CFCL 3RGVD 5EBMB 1YY8A 1GHFL 4YDLB 4YHZL 3OJMB 1FL5A 3S36X 3CJJA 1KPUB 1A6TB 1Z3GH 1I1FB 2KPNA 5DQDL 5C9KA 1FV1B 4M3KB 1H8OA 4EOWH 3I75B 5FCUL 5IMKB 5C92A 2X4RA 3PWNA 5JUEL 1IGMH 3QPXL 5JOFB 1FSKB 3SE9H 1VEOA 2VKWA 5A2LH 2NY5H 3AB0C 5E00B 4HKZA 1KB9J 1YUHB 4WU7A 1SEQL 3U9PH 5JO5A 3SCMD 1KTKE 1WWAX 4QHLB 1EFXD 4A6YA 1T2JA 1YJDC 3I02B 1YEDA 5IFAH 3Q6GL 3HZVB 2ZKHH 1MJJA 1CDIA 1DQLH 3HZYA 2AERT 4N0YH 1QSVA 1HKLH 2XZCL 3SGDI 2OR8A 2K3TA 5GRUL 1UVQB 3IDMA 2IG2H 5BV7B 1R24A 4NIKB 5B38B 5D1ZC 15C8H 3I3BA 1AI1H 1VFUA 2ESVD 1FNAA 2EDBA 4MA1C 4WW2F 1GGIH 3I9GH 4KHTH 4X8JA 4EZMA 1DSFH 1OD7A 4LEOB 2ORBL 3VFTB 2HMIC 4PRNA 3BWAA 4JM4H 2C26A 3KYAA 1A0QL 3B9VA 3GSUB 3W5NA 4I1NB 3VWKC 3VCLB 4P2YA 4BQBA 4OM0L 3LB6D 4NO0B 1V8HA 1CYGA 3MO1B 4NQXB 3TGXA 3VW3L 1BFVL 1NC2B 3I6GA 2RCSH 5MI0B 3G9VA 5KSAC 4HW6A 5KG9B 4YDJA 3ZKQD 4X99A 3MNZA 2AJSL 1RFDL 2D9QB 2M2DA 4RDQG 2VZOA 1TITA 1LO2L 4R96A 4JRYE 3A6CH 5HJ3B 3Q3GB 4BFEA 2I07B 3G6DH 2Y36H 3CGTA 4ZS7H 3QUXC 1Y18A 3ESUF 4S0SD 1FLRH 3QCTL 2CXKA 5F7WC 2D7OA 5IQ7H 3MJ7B 4N0YL 4J3OC 5CSZA 1LHZA 4P46A 4NQCD 1U58B 5JZ7D 1IQWH 3ZYZA 5E56A 1VKXB 3RVWD 1RZ7H 5EU4B 3EIFA 3P9MA 2VDNL 3FO0L 3ZMRA 1MCEA 3MBEB 3ULUC 1PG7W 1FJ1B 4LCYB 2BZDA 2VR4A 3DVNA 1MI5D 1MH5A 3BPNB 3HUJA 1CXHA 4Y16C 4NBYB 2BVEA 2DM2A 1MCPL 1KEMH 3FONA 3O2DL 3SO5A 4ZS7L 3IDUA 5T5NG 3B5TA 4KK6D 3QPQC 1R3KB 4HMDA 5KSBF 3QDMA 4HXBL 3S37X 3FB5A 5JDSA 3OR7B 4GG8A 2BHYA 1NL0H 3V5KB 5GPRA 4BQ9A 4NHUA 4LLVA 4HJGB 4AL8L 3FMGL 1NGXB 1U8NA 5FYJD 2OR9L 3BUYB 2VLLA 3GSOB 4X0KB 1EO5A 3MYJB 1JUFA 2YRPA 1JRHH 4Y19E 1S7UA 5L0QB 1LK2B 1B6DA 5CMAA 4QT5A 2FWOB 2P46B 4RNRB 2DJ4A 4P5TB 1LO4H 2ITDA 2GY5A 4JRXA 1A8JH 1G7HB 5GGSA 1BD2E 4UDUA 4G8FA 2AQ3A 5MENB 1JF1A 3HB3C 3NIGF 5LGJB 4Z7VE 2CKBA 3L3KB 2E9JA 2GAZB 1EAJA 5L6YH 3QDJE 1C7SA 2XV6B 4OLWL 5KANI 2VLRE 4D3CH 2Z31C 2M8XA 2H32A 5JHDE 4B41A 5C0GA 3EYVA 5DC4B 1RUAH 1UYWL 4ZPVB 2IPUK 3SGJA 4UOJA 5H8DA 1H5BA 4XNQA 3T77A 4QTHB 1MFCH 1AXTL 4Z8FL 1D9KB 4K8RC 5JHDA 2W0LA 3RY6C 3T04D 1WWCA 1FYTA 1RZKH 3EAKA 4WFHE 4OCWH 1TZHB 5D7LE 1GSMA 1OTUD 4TSAL 1ZSDA 4YBQD 1GL4B 3ULUD 4PJIE 4HX1A 4YZFE 3MRNB 4MXWH 5FYLD 3UJJL 4Z0XA 1X5FA 4WY7L 5AD0A 2O5XH 4PTUA 1AJ7L 3UPRA 1BPVA 4NJ9L 4Z78A 3FT3B 5IVOA 4LLMB 1KIRB 2MQ3A 3RWHA 3PGDB 1ZANL 2DTMH 2YRZA 3GMMB 1LO5A 3HI1B 4JM2C 4JHZA 4LLVB 3K1KC 4KU1A 4KRPB 1G9NH 4C56D 5EIIB 4I9WE 5DZOA 4D9RE 1GXEA 1P4LA 3TPUA 4Y5XA 5KN5B 3T0DA 2G60L 3S97C 5J6GB 1I75A 5DMKB 3A6BL 4IIQA 4FFWC 3SQBA 4P5TA 5HI4C 4MD5A 4PJ9B 4IDJL 4K3GA 4P99A 4OCSL 1WSST 1G84A 4HUMB 5TE6L 5T3XL 4NFBA 4JKPH 5DLMH 3VXSB 3GSXA 2YD6A 5ITFB 3RIFF 1C1EH 2IANA 3GMOB 4RMVA 4HUUB 5CHNA 2JTDA 3JV6B 1RUAL 3MRLB 5IW1B 4NM4H 4V1DB 4J3WA 5C0FA 3L1OH 3TH4T 2WMPA 3FO1A 4ZO9A 1KCRH 2IMNA 2FRGP 1IAKB 3F58L 5C7XH 3BIKB 4KK8C 5DUBA 2D03L 4LKCA 3ZYOA 1MLCA 5AYUL 1NAMA 3CH1A 3N9GL 4EBQH 1QBLH 1BEYL 3K7UA 1WUNT 3S4SB 3R0NA 1A4KB 3SDDC 4PV8A 1PZ5B 3WUZA 4L4TD 3NACH 1CU4L 4PJ7B 4HX1B 3C08L 4ERSH 3R1GH 1NGQH 1HOCA 1A2YA 1MQKH 3DROA 5GS0C 1DFBH 3VD4A 1F3DJ 4RFNB 3U0TA 5ESVB 1IAOB 4HWZA 3ROLB 2HVKA 1HEZB 3P4NA 1T7VA 5DK0A 1DQTA 5I8EB 3RQ3A 4NQDD 1XF2B 2D7TH 5CP3H 5T5NF 4NKIL 3HR5B 3RAJL 3ARDA 4FXKA 4YWGH 4OIIH 2W0PA 5HGBA 5DSCA 4JCMA 1U8PB 2W65B 3DGGA 4P0DA 4QY8B 4HDIA 5EO9B 5E8OA 5HI5C 3DRQA 1JGEB 1IGJA 4IOFC 3REWB 3CFKA 4MAUL 3GSXB 3WHE1 3O3DB 4OLUH 1VGKB 4QWWC 4WWID 1YY9C 3KNBA 5K9JL 4JG1H 2APBA 4R2GD 1U3HA 1I8MB 1Q8MA 1HQRA 1NQBA 4FQJL 3BPOC 3DMMC 1P2CB 1YPZE 1CD1B 1M05B 1UWEH 5EU7E 4Z7UA 1B0RB 1JPTL 4D3CL 4L8BB 2YPVH 1UCBL 1YEGH 3OBAA 5HHME 3C6SA 2ZCHL 1IGCH 3QISA 3ARBB 3DMMD 4WFFE 4PREB 5EORH 2EDNA 4X6CB 4PD4J 4GSDL 2HKFH 3MRJB 1CFNB 4ZMAT 4RFOH 2PR4H 3WEXA 3MYJA 3D39D 2I9TA 4NWTL 3U30B 3E2HB 4RWYL 4NHCL 3QULA 1EXUA 4NQVA 4AL8H 4ONHA 5IV2B 4Y19D 3PE9A 2HH0H 1HXYA 1IGFL 3DX8B 4HPOH 4M00A 3EHBD 1H15A 3FFCE 1N6UA 4PJ5A 4LU5H 1NFKA 4JFDB 3HNVL 3BPCB 3CK0L 4NRYA 5DHVB 1N5YL 1EHAA 4LDOB 5DJ0B 2F58L 5F1NB 4BH7B 5FGRA 2ZSVB 3SKOB 3PXHA 3RUGE 1V3MA 3WHXB 1I1AC 4XNQB 1T1YB 2H9GB 1A3LH 5D96C 4JY6B 4MAYC 2BOCB 4LKXB 4JZNA 1YEHH 1QSEB 4U6HB 2FX9L 5ISZA 4UAOB 3WJJC 1OCWL 2SEBB 5T3XH 4HIIA 3QXAA 1U58A 1NFIB 2WLZA 3Q48A 3NFPA 5I1AA 1YNTB 4EUPG 2VN7A 3ZTJH 4KXZH 1CDUA 1MHCA 4XPGL 5L8KB 1V3LA 2KH2B 2GEEA 2X4RB 1Q94A 1N8ZA 2DLEA 3IDXH 1A02N 4NRXA 1G7QB 4LSVH 5F9AC 3QO1B 5TFSH 1RZFL 3KPNB 5I2IB 3TIDA 1SBSL 5DFVC 4JQIH 2COQA 5DJ6B 2PO6D 1HWHB 1A7PH 2J5LC 1SEBB 4H8WH 2V5YA 3RL2A 3NCEB 2IBZX 1K5NA 4Y4FB 4U6VL 3DURA 4A6YB 3DXAE 2H1PL 2W0FB 4Z5RA 3ZSTA 4OF8A 2ADGA 4MVBC 4Q6IB 3TCXA 2NCMA 1ZS8B 5IQ9B 4OF7A 5T5FL 4S0TD 2FH6A 1U8LA 4S1DC 4D9RD 1S7SA 2ZP0T 2VLLB 2VZTA 2A74B 1Q38A 4FQHB 3FQTB 5LWYH 3X14B 4OGXH 4LVOC 4DKFL 1GOFA 4JPWL 4YPGA 3PL6D 2ERJC 2WP3O 2VR5A 4JM4L 4TVSa 1TVHB 5J57B 4LLQB 3V7MA 5DURB 3IDNB 5E24E 5BS0B 3BUTA 1MLBB 2VXVL 4PGCB 1F11A 4Z7WB 4HIHA 2EYRB 5GIRA 4MNHB 3OKDB 1NCWH 3HC4H 3BP5A 3EFFB 4D9LL 2K7QA 5L6YL 4KY1L 3PL6C 3EO1A 2XTLA 1ZAGA 2V5RA 3OXRB 5F3BA 3EZJB 3CIQA 1EJ6A 3BZ4B 1JPGA 3S8WA 4M5YL 5E4EC 4NQUA 4NQED 3WKMH 1UENA 2PCPB 2PR4L 2X4PA 4X98B 2ICWB 2D0FA 5D1QD 3KLHC 2F15A 3BWAB 1FL6B 1A14H 3F6IA 1JNHB 3FFCA 5BCAA 2HJKA 1KF9B 3ULSA 5C0CD 4WNQA 2EKJA 1P7QD 1C7TA 4R4BB 2YPKB 5GGUA 4YHMH 5DD3H 1UCBH 1YEGL 2IBBA 4KHTL 4OB5H 3REVB 2N1KA 4HFUH 1NDMB 4O02H 1RPQA 1CGSL 4JHWL 3UXFA 4KKAC 5GS0L 3V6OA 4O4YL 3WFEL 5CD3B 2VAJA 4XNMB 3QNXA 3P9MB 3DI2B 4JFYB 1XIWC 3TH3T 3FB7A 4QHKJ 5GS1C 4ZTOL 4Y1AD 4FQHA 4JVWA 3RJDA 4U1NB 4CAGA 4N0UA 1GAFH 4H1LH 4MB3A 3D25A 1LWRA 3HNSL 3H2WA 5E2TH 3MLUH 3VXUD 3PGCB 2F9BT 4ZUSB 1AC6A 2ADJA 1Z0NA 2C4FT 1AR1C 3GUTA 2X7LB 1T22A 1KSRA 3ZKNC 1QBAA 2AJ3B 2BP3A 5GQBA 5ETUB 1IGML 1UXSA 5DJYA 5BQ7A 1OSZB 1OAZL 3ILQD 1C12A 3GI9L 2P1YA 3FFDB 5FV2A 2IPTH 4S10A 4X6DB 5HYJE 5L88L 3QHZH 2GTWB 5KSUA 1BQSA 1EJOH 1RIUL 2MCPL 3L3OB 4EN3C 2VOTA 3GDBA 1AKJB 3R06B 5F96H 2AK4B 3FQRA 5KSAD 5EG6C 1BAFL 2BHZA 2BVUA 4KQ4L 2VIRB 4YFEA 5C9JB 4CU8A 1T4KB 3T2NL 2JE8A 2QSCH 2E7BA 4F33B 1LDPH 5FEBA 2AP2A 2FO4A 4P57A 4NUGL 4U1LB 2P4AB 4GRWH 1JGUL 3X12A 5C0BA 1CG9A 1TQBB 4PJ7A 2VH5H 1EA9C 4GMSH 1D5ZA 5D7SH 2ZG2A 3QIUA 5T1MB 1FO0L 3SDAC 2XYCA 4POYA 4LFHD 2ATKB 1UH2A 2FEDD 3V4PH 3U4BH 2FGWH 1FVDB 3ARQA 2Z92B 4ODHL 1S9WB 4UT7L 2B1AH 5DHVA 2C7UA 3CVHL 4LARH 3BHBA 1LD9B 3G5ZB 3SDYH 5E4IA 3P0YL 3LZFH 4RGNE 3HN3A 1A7RH 4YC2B 4U1NA 3SKNA 1MCSA 1VERA 4G6KH 4QRTB 4JVPA 2JCCA 2Z0BA 5KJRH 5CEZL 3IFOA 2VQUA 4NKQB 5IG7B 2HKHH 4FP8L 5EU6B 4PTTB 5GJSH 3REWA 1EUUA 4D8PB 3T0XA 4RCAA 2SEBA 3X3FH 1GC1L 1WBXB 1F4YH 2WNGA 3KPRD 3RWCB 4HG4J 2GIYA 1NSNH 4YHLH 4U1MA 4NGHL 3LKRA 4CN4A 1LEGB 1LEKA 4I0PB 3UTOA 4AENB 43C9A 1AHWC 1KN2L 1U8QB 5BZDB 3VFUB 4MSWB 5GGTH 2W91A 4U6VH 3OR6A 1U91B 4BYHA 2AK4A 1JK8B 3KYNB 2VLKE 2A77H 1BOGA 1RMFH 3FZUC 1I85C 2PO6B 3U0WL 3ZDZF 1Q0YL 4HS6A 5JW4N 3SCMA 2VL5A 1XCTB 4MXWL 4WI3A 1JV5A 1W72B 3DWTA 4D0BA 4M7JL 2FGZA 1RAMA 1RZIA 2HLAA 3KYKL 4KDTC 1NSNL 1VGEH 2X4NB 4GAGL 4WWKB 4GKNA 4P4KB 2YKLL 5GGRY 3HR6A 1M71B 5F88A 3F65A 5KZCD 1LP9B 1BFOA 1MUJB 3TBYB 1A6ZB 3WEXB 5ECJE 4OV5B 3D48R 1NKRA 3AREC 3SCMC 3W11C 3STLB 1ZKAA 3LZFL 3O8XA 1RUPH 3LH2H 3SGJC 4OQTL 4YHYC 1NAMB 3OB0H 2BNQA 4AEHH 3F7RA 4MVBD 4PP1D 1T20A 5EOCH 3BP4A 4NNXA 1QSFA 1MFEH 2IH3A 3IDIB 1IKFL 4P23D 4HXAH 3UDWC 3X13A 4Q9RL 5DJ0A 1G9NC 4C58B 2GITB 4OZGA 5I15H 3I3DA 4XAKE 3WBDA 1FAIH 3MRMB 2BVQA 2DS4A 2YD5A 2YMXH 2GHWB 4KUZH 2N4IA 3GRWH 2NY0D 2R2CA 4XBEL 4G8GD 2HT4C 1JPGB 3VFGL 4O00A 4HH9B 4P5KA 1D6VL 3QZWG 1CBVL 3QAZB 2QSCL 5GS2H 2FR4B 3BZEA 4UDUB 3CFIC 2BNUA 2EEBA 4JR9L 1J11A 3CDCA 5TE7H 4XVSH 4P2QB 1A47A 2DKSA 1QR1B 3G6JA 4LASH 2XWBB 4LSPH 2Y4SA 4K23L 4P9MH 4QRSB 1BOGB 1U8PA 3T0EA 5EU3A 3VG0L 2VXQH 4KJQC 1W72A 3IS1X 4Z7UF 3QIUC 1EMTH 1W0YT 4D0DB 5CP7A 4CMHB 2FYYA 1EHNA 4P9HL 4FQ2H 4HCRH 5BS0E 4M8QA 4XVTH 1ZWIB 5L2KA 1VACA 4WW1A 2A6IA 1OAYH 5CZVL 5IESL 5DD6A 3V6ZB 1DVFD 2J4WL 5C08A 5GGVY 4BK4A 1V05A 5JR1L 5EZIH 3FQXA 3HE6C 4URTB 4WO4B 3QEQA 4PJ5E 4L9LC 1UKQA 2HG5B 4JKMA 3I6KA 4Y5XC 3CUPA 3IU3B 1E4KC 3GRWA 1RHFA 3CFKB 2NXZD 4YXKH 4XPTH 2Y07L 4EI6B 3LEYH 1KIRA 1QTYT 5MEQA 1BD2B 4M5ZH 5EBMA 3CC5B 3BJLA 5KSAB 1T0MB 1DBBL 1A6TA 5DI8B 2ADFL 3QI9D 4Z0BL 5INCB 3D69B 2FD6H 3TO4A 4LMQI 4PYGA 2GSGA 3ZYJA 1J1OL 3L9RA 3QULB 2G9HA 4DKEL 1U2HA 3BZEB 2MPAH 5HVFB 2J6EL 4O5LL 1IFHH 3TIEB 1QSFE 3X3FL 3RVTC 4EXKA 5E4EB 1WZMA 4OD2B 5I76B 1T6VN 2EECA 1JZ8A 2VWEC 4J4PC 1HHJB 4OCXL 1Z9MA 1WT5C 4UT9H 2IBZY 4I4WA 3GMOA 4X6CA 2MCG1 2DYPA 4PJEA 1NEZG 4Y2OA 4OV6F 3DIFB 4OZFB 4XC1H 5B8CB 3H7BA 1G7IB 2DKUA 4XBGA 4G6MH 2NX5E 5IV2A 3SGKA 2IPTL 1NDMA 4HC1H 2VISA 1OAKH 3QT2A 4C83A 4G6FD 2X4SA 4Z7OE 5C08B 4U1HB 4ENEC 1CD0A 3E8UL 4CDGC 5ITBH 2BSTB 4JPWH 4RGNC 4K3DH 3GMPB 4MNQA 3QEQB 2NX5B 5DDHA 3WIFA 4NKMB 4U0QB 1MVUB 4LDEB 4NT6A 1FYTB 5HHVL 4EQ3A 5K9QI 1YN6A 3C09B 5A2FA 4O51B 1YMHB 3L5XL 4NO2B 3RGVA 5ID0B 3WFBH 5JDSB 5DD0H 1YEIL 1BLNB 3ET9F 1OQXA 1JNJA 3STZB 4ZAKC 4R7DB 5I73B 5IOPB 2NNAB 4LLWB 5CBEA 1NMCC 1P7QA 4XCFH 2WBJA 1PYWB 4NOBA 5IM7A 3M1BB 4JO2H 35C8L 4IRSD 1OAZH 4ODWB 3SDXE 5KVDL 4XCNA 2MMXA 1KN2H 2CKBB 5FA4A 5KW9H 2JJSC 1ZEAH 3ILQC 3ROOB 4HIEA 1X5HA 1QR4A 5D7LB 3FB8A 3ZT5A 3PGFH 2ITCA 3OB0K 1FBIH 3V0WL 1BF2A 4OCWL 1G0XA 1HH9B 2EDKA 4JLRA 1I8MA 4LAJH 3X11A 4P46B 2VLJA 3SKUD 2X6MA 4K71B 1A7OL 5C0IB 3J8F7 2JIXD 1CG9B 2GJZA 2R0ZH 4KI5F 4JRYB 4OFIA 2VL4A 2OS7A 2NYYD 3CX5K 3EOTL 4PRHA 2BSRA 2QHRL 1MH5B 4MAYD 4Y4FD 2WUBL 4FXGA 1YYLH 1MY5A 4MA3B 3G5XB 4LRIC 3JV0A 1KGCE 5DEZA 1F02I 1MNUH 1XCQB 4OSUL 5AAWA 3TF7C 5E95B 2WUCL 3QUYB 4ETYA 5J06A 3SEPA 2AS5M 1NC2A 1CE6A 4LLYA 4XXDB 2IAMA 3EDFA 1AE6H 3U36B 1CGWA 4OQ1A 4CVUA 3MUGA 4QRRA 2OQJA 3IFOB 5ALCH 2PO6C 2R8SL 5D7JA 3LDBB 3RPKA 3PDOA 3HHRB 5JPMB 4P4RB 3T3PF 4KRLB 3CLFL 4P2RB 4DQOL 1NUNB 3MCLL 1NCCH 1JUFB 4W4OC 1CXKA 1MCNA 4M43H 2MKWA 2MWCA 4XVJH 4PJ5B 5KVDH 4HXBH 1NCWL 3KPTA 2CXGA 4BH7A 3IDYB 2NTSP 1UA6H 2CDGA 4OKVB 3D2UB 2C9AA 4BELD 4LCWB 1DBJH 4XH2A 5E8PB 5ICYA 4OJFL 1BOYA 3FOLA 4XTRC 3KS0J 5ERWA 4WHTA 3QUML 1YEIH 4ZSOA 4G7VL 4X80H 4WFED 4YBLB 3V6OE 1UJ3A 4JY5H 5EZLB 3TYFA 1MF2H 4BZYA 1S7VA 4F9PA 4QF1B 3N50A 1IC5H 4FQXB 3QJFA 5EZOL 4ZUUB 3QUZA 1CK0H 2WM0A 3P3YA 2NY6D 4N5ED 1FLRL 1ZLVK 2WINA 2EDLA 1JYWA 3CLEL 4X6EB 1K2DA 3M8OH 1NCTA 4TQEL 1FH5L 3CFEB 3TA3C 4JHWH 3OAZK 3MLSH 4GBXA 4AEIL 3CH8A 4MYWB 3F7PC 4J12A 3D0VB 2EE2A 3GUTB 4JQIL 1ZT4B 25C8H 4U7SA 2A6DA 4HKJA 4LSQH 4X0KA 3SE8L 5ACZB 1MFDH 1UXSB 5DJYB 1MVFA 1JPSH 4FQIH 1FNGA 1NAKH 5EBLB 3JTSA 1DDHA 4IMLB 5L2JB 3MPCA 3O4LA 3TH2T 4QGYA 3MREA 3KJ4C 3GHBL 1A3QA 5FKAB 5GHWH 2F5AL 3FRUA 1INDL 4YLQT 1T2QL 2AJUH 1J86A 5FM8A 1EHLH 3AMLA 2ZUWA 4LCCA 3N9GH 1BBDL 1LNUA 4G43A 5BRZA 4F15C 4Y5YA 1YMMB 1Q9WA 2Y06H 1R0AH 3LAFA 3M17B 3EJZC 3VGHA 4RAUB 1KCSL 4QRTA 1FO0A 1QEWB 2NY3B 4YHKH 3VFPB 4HUXA 5J8OA 3BGFB 3O6MH 3EYUH 3AM8A 1NGZA 2WLYA 3VFMA 4OIBA 3QQ4B 2N56A 5BRZE 3T4YB 2H26B 4FFZL 3VFRA 4FZEH 2F5BH 1ZA6B 5KSBB 3A67L 1JVKA 3VXRA 2P8PA 4J6RL 4O2CA 1FFPA 2YBRB 1E27A 5C07A 1WGOA 1QFWM 2BNRE 2ICEA 2YN3A 4O9HH 1NDGB 3ULVC 3I75A 4Q6YA 1FZJB 4DJMA 4U1MB 1YEJH 4FFVC 5C0EB 3MODH 2DLTA 2X41A 4TSCH 4WV1B 4KZEH 2DQDH 3QXAB 5F6HI 1KCVL 1DVFA 1WAAF 4OCRL 4UTAH 2EE9A 3S96B 1MHCB 1UXWB 3KYKH 4LVHC 1S9XB 3MJ6A 3BE1L 3GNML 3FO9B 2ESVB 3QDGD 1H3WM 5EO1B 4RZCB 2LVCA 4XNXH 1H9VA 35C8H 1RUQH 1NCBL 1BWMA 1WBXA 4AMKL 1FNGB 4G6JL 4WO4C 1KBGH 5CZXC 4A2MA 4KGJA 4K8RH 4G9FB 2CJUL 3IDGA 5DFVD 1BJ8A 3VXQB 1BFOB 1INDH 1MUJA 3RNQA 2FH8A 3RUGA 2YRLA 1A7QH 3BKYH 1MHPH 1OM3L 4D9QD 1S78C 3U6RB 2C3VB 4FQCH 1AHWA 2FJGB 4JFDA 4NRYB 1J12A 4KTDL 1G7HA 4PGEA 3OKEA 4JFHD 2VXUL 1AD9B 3UJTL 5H94B 4U05A 3H9HB 4NDMA 5I76A 3HFMH 4OLZL 3UTTE 4KROC 2ZPKL 1ED3A 4XP6L 3LCYA 4I3RH 4DUVA 2R4SH 3AC0A 4GAYB 3LMJL 4J8RA 2DWDB 1UM5L 1CS6A 1A6UH 2BOBA 1KFAL 3D1MC 1RZ8A 2DIBA 4PJEF 5JHLL 4X6FA 4XPBL 4Y2DA 1C5CH 3H7BB 3VDCA 1AFVH 4WTZA 4YDJB 4HAFA 1BD2D 5GSVB 4ODXB 4YHNB 3VWKD 1JZ7A 2VO5A 4U1KA 5KSVA 3UCRA 1JI2A 4NRXB 1T83A 3TVMD 1QFWI 1HIMH 4HWBH 5KVFH 1NC4B 3ZTNL 3HFML 3EFDH 3FQWA 3MC0A 1NAMH 3C9NB 1LO0L 4XP4L 2J8UF 4LGRB 4AG4H 2NYYC 2UUDH 1AQKL 4YHYB 4ZFZA 3KPPB 1CDCA 2Q6WB 3X3GL 4LVNB 3VI4F 1FVEB 2RAMA 4IS6A 5CEYA 1UH3A 3MRCB 4AH2A 4YDVB 4KAQL 2DM3A 3WSQH 4ZFGL 3KPSD 4DUXA 3LHPL 3WFCL 4P46C 3CU7A 2UZXB 3O41A 3P9LA 4RDQF 4QYOB 4M6MH 5DFTA 5LBSH 4JN1L 3BDXA 1R5IB 4G9FD 1TNMA 3BE1H 5BO1H 4XPHH 1P84J 3OXSA 2XTJB 3F7QA 4OT1H 4RIRB 4Y4KA 4GRWE 4PJHF 3JWOH 3QHTC 4AIZA 4EDXA 3S88L 3QQ9D 3MRGA 3MV8E 3HE6D 5EZLA 4KZEL 3QDHA 3V5KA 5FDWB 1A6WH 5I8OL 2Z4QB 5DUML 2X09A 4L8CB 4LCUA 4ZUUA 1UJTA 1IT9H 4EJ1C 1PEWA 2ZUQC 3UYRH 1XZ0B 4TRPH 1LEIB 4EXPX 4EUPB 2J1KA 1EMTL 2E5EA 4FQLL 5TF1L 1ZANH 2DTML 1MHHA 2EE6A 1RJZB 3VFSA 4FRWA 2BCKA 1FL6A 3PP3K 3T0BA 4FXGB 1I8IA 3OGOE 5GGTL 4XNUH 4QXUH 5DHYA 5HHXL 4Q0XL 1AR2A 2IFGA 3F7VA 1QLFA 1F3JB 3F62A 3W2DL 2YD1A 3NABL 4P3DB 3PWPB 2R4RH 1I1AA 2X10A 4GKZB 5AWNL 5IB1B 2CR6A 4RA3A 5CEXB 4HV8B 3PP4L 5FOJA 1JNLH 4TSAH 3ZLQC 2R1WB 5EOTB 1E28B 1QZ1A 4EI5B 5B8CA 4I0CC 3OKMB 1U8LB 4RNRA 2ZSWB 1N0XH 2P7TA 3G08B 2AV1A 4GRLB 1G7JB 4K94C 4GRWF 4OZFG 4NNPL 4WHYH 3CVIH 4ZOCA 4NZDA 3MSPA 3T3PE 4PRPB 4PRBB 1S9VB 4E41D 4X7SH 5CGMA 1T20B 4KQ3L 5HGBB 2EDHA 3BKCH 1C08A 1MCWW 2BSTA 2YWZA 4K2UL 2E6JA 5TH2A 3ARGC 2FGWL 3WFBL 1MI5A 3RY6A 3GSNA 1IM3A 4WI8A 4GRMB 5I66A 2ILLA 3BDYH 3BJ91 4PTUB 2ZUUA 1VADB 5LQBL 1KB5A 5KAQG 1FNSL 1UACH 3MV9E 2CO6B 5DD1L 5LWYL 1OSPL 3BKML 3HG1B 5DLML 4LK4A 3MV7A 1YZZA 1AXSB 1O7SA 2I60L 4GQPH 4LL9A 3T0WA 2V9TA 3MRBA 4Q58C 1DVFB 4UMGA 4LAQL 5J6GA 1PGRB 1HN1A 1FSKC 1P7QB 4JN2B 5DJAB 3S3PA 4X5XB 1P7KA 1G9EA 1H8SA 2E6QA 3ARTA 5IHLB 4JM2D 4XCNB 1F45A 1T4KA 1U91A 3QZWA 4NO2A 1FGNH 5I1DA 3S37H 5ID0A 3FB8B 1RJLB 4S1RL 5IT2H 1OGTB 2VDQL 1VACB 3U2SA 1M7IB 1NGYB 1NEUA 1T6WA 1ZLUK 4H8WC 3QWOB 3SDXF 1RFDH 3L5HA 5JXEC 4OI8A 2AJZB 2X1OA 3M1BA 3C6LB 3SO3B 5F8QC 1U8HB 2HG5A 2L7UA 3ULVH 1MCDA 3HAEG 5I8KH 1CGXA 3LKPB 3V8OA 1SVZA 5LCVL 3L95B 4ZFFB 4I8DA 4F7CB 3D25B 1KPRB 3MBED 4J3XA 1YQVL 1MEXL 4OD1H 2HT2D 4OJFH 3W81A 4HUUA 5ESAA 3IRZA 1OAKL 4RBPK 2X89D 4Y5YB 2UWEF 2JB5L 5CBAA 4JFXB 2Q76B 4LQ1A 2L4OA 1T0MA 1ADQL 4AQ1B 1ZHLB 1TIUA 2XACC 3GSNL 2VMFA 3OKYA 4JFQB 3SKMA 4XGZB 1MAMH 4J23A 1F3RB 1LO3H 4R4ND 2F53B 1KCSH 2IAND 3KXFA 2PYEE 1F2QA 5F7DA 3DSFL 2ITDB 4JRXB 5GGSB 3T0EC 3NCYP 3BN9D 2UYLA 3P73B 4PP2A 4RGMC 3G5YB 4KK5C 5FDYA 5BMFL 2JB6A 4HK3N 1P7KB 4F57L 5HDBF 3T2NH 4LLYB 4XXDA 1JGEA 2FHCA 4ORZC 3DX9A 1S5IH 5C71A 5IB3A 4NCDA 4A2LA 2B20A 1ONQA 1ZV5A 3QUKB 4M7LT 4JJ5A 5MP6H 3BZFB 3UTSA 2ENYA 2WIIB 2AAVA 3RNKB 3QPQD 1U3HB 3H9YA 3RWGB 4YJZL 2PN5A 5T1MA 4BKLA 1AP2B 3WO4B 4N8CL 3BEWA 4YHOH 4ZUTA 3V95A 2G5RA 4MAYA 1FIGL 4MJ4A 1RU9H 3G6JF 3L3DB 4HDIB 5EO9A 3W9DA 4MA8H 3ES6B 4F7TB 2XPGA 4NC1E 4MGXA 1MCCA 2FJGA 3NA9H 4Y4FC 2E7LA 1N59B 4HIJB 1SEQH 3U9PL 4HUWA 3W9EA 5ANMB 3C60C 5ESAB 1F5WA 1CF8L 1TCRA 1ZHBB 1JZ6A 1EHXA 4ZXBC 3LEVL 5FHBH 1MFBH 2F19L 3UC0L 2GI7A 2E9IA 2CPCA 5I8CA 5F21B 3ARFD 1OAQL 3MX0A 4X7SL 2IADA 4WDIB 2HVJB 5EC1B 5C0CB 4EUPA 2P8LA 2D3VA 3MXVL 3QG7L 4OCLC 1ERNA 2W9DH 4KKCD 1KIPA 3QA3B 5I1HH 3KXFE 4NQCA 1A1NB 2NY3C 3KYNA 4LASL 5E6ZA 3F5WA 1KOAA 4NN7B 5GGVH 2HT3C 3T65A 5BRZB 1RUML 3ARED 3BZDA 1IILE 1VFOA 4S1SL 4JFFA 4CL7A 5EO0B 1AH1A 3ZTNH 3JVGC 5DA4A 3LN9A 1C5BL 1ZLWH 4IRJC 4P2RD 1ZA6A 2N7BA 3KPPA 4NYLA 3IDJB 1SYVB 5T3XD 4L5FH 5LG1A 3C5ZC 3BEWB 1FRGL 2B0SL 2GK0B 4NKDB 4OLVH 2X2YA 4QO1A 5TH2B 4GUPB 1Y0LB 3L3GB 4LEOA 2V7HB 4NPYB 4WTWA 1SHMA 2QHRH 2NY0C 4HPOL 4FG6C 1FIEA 3HMXH 4GAFB 1FZKB 1KJMB 2VR9A 3BSZL 4UQ2B 4WI7A 1KJ2B 1HINL 1MCLA 1R3IL 1DVFC 3PABA 1FCGA 3KLSA 3QFJB 3RWCA 2C4FU 1BGXL 4XPHL 3ULVL 5IFHL 3OF6D 5LXGL 5HDBE 3BKJH 3T3ME 5FYKU 1YN6B 3I85A 3MV9D 5I17B 1QSED 1FBIL 3V0WH 5IESH 3PP4H 4M61B 5EC1A 1K4CA 1JPST 1DN0B 4P3CH 1UKSA 1FFOA 4QXGL 3CSGA 4JAMA 4OFKA 2HLFD 3ARGB 2VWEE 2WBWB 5C3TA 4ZPTB 1B4RA 5HDQH 5B22A 1ZHNA 3EO9L 4LQFL 3B9DA 4XCFL 4KVNH 1MRCL 3S5LG 1S9YA 3IGAA 2X4UB 1ORSB 1CL7I 1K5NB 3NTCL 1FCCA 3O45B 3QDJD 3VD3A 1J7VR 1FG9C 4KK9C 3QO0A 4LDLB 4R0LB 1QYGL 3V52L 1KC5L 1AIFA 5LAXA 2VDRH 1EO7A 5H37G 4MJ5A 5C0BB 5DJ2A 3SBWA 4M8QB 4OCRH 3TT1H 5KS9F 5IBTL 5K9KB 2VE6A 1VB9A 1MCOH 4MA1B 3LEXB 3VI3F 4WCYH 3TVMA 3V5HB 1BZ7B 4G6KL 1U92A 2O5YL 4WFHD 5GRJL 1UYWH 5EBWA 5KSVB 4PJXB 4X98A 2EO1A 3G5ZA 1S7XB 3D6GA 3MV8A 2ADIA 3U9UA 5CGYD 1R3KA 1UADC 5GGQL 2G75A 1VPOH 4ODHH 1Z9LA 2X42A 3P0VL 3QDMB 2HTKC 4Q7DA 5FYLE 4JFQA 3CVHA 5B39B 3HE7C 1DE4B 3VGBA 3VFVA 3C5SA 4HH9A 4P5KB 3W82A 3WDIA 4ORGA 5HBBA 1NGXA 1U3ZA 1U8NB 3MREB 4R2GB 4XCCL 4YO0B 5CJBA 5I17A 4MA8L 5JIHA 5BOZG 3QG6A 5CMAB 4IRZL 3AROA 3SDDA 1NBZA 1UM4L 3ARZA 3P30L 4KKBD 3EDDA 4KJPC 3AFLA 5D9SB 2HTLC 1R3HA 1IFHL 1YMMA 3U7WL 4G6AC 2APXA 4PY7B 3ARDB 4KVNL 1OVZA 3MV9B 4AMKH 4DGYH 5HDOA 1NCBH 4F3FB 3NFSL 5F7HA 2KZWA 5A2KH 5CJOH 5EH1A 4QHLA 4POUB 3O9WA 4KDTA 4HKBA 1A9BB 1MY7A 4L8SA 5E9DB 1W2KT 5TGBB 4WW2A 2FX8H 2Z8RA 3N06B 4K3JL 5C0JA 4U2ZA 5I18L 1N26A 1FDLL 4M02A 3VXRB 4YNYA 5ISZE 1S7TA 5I1DB 5FHAH 3MACL 4LVNC 2G2RB 3RZCD 4G8IB 1KJVA 4PJDA 3TA3A 3MLZH 2BSRB 2EICA 2H2PC 3L3OA 2EXYC 4H0IA 1F4AA 3TBSA 3CXDH 1HI6B 4X5LA 1X5IA 5LXGH 1BIIA 5C09D 4IDJH 1WFOA 3VJ6B 2HFTA 5D2NC 3KLAB 1RJZA 4NT6B 1ULVA 4HS3A 3V52H 2XA8L 4H20H 4CN6A 4H0GA 1FG2B 3MACH 3SDYL 2NY6B 3U0WH 5FAAA 4YIQB 4J3SA 4XC3H 2CLVA 2ATPB 5I16A 3EO9H 4LQFH 2CD0A 2EC9U 3I6GB 1A7OH 4OGXL 1WICA 1T1ZB 5T1LA 3U79A 1C16A 1GZPA 3L3IA 3QA3A 5BVJB 2WWMC 3C8KB 2ATKA 3D0LA 5T3ZE 3X14A 5CLTA 4LSPL 4M93C 1XF5B 4S2SB 1QFPA 4JO4L 5B8CC 3AAZB 4BZ1H 1DFBL 3P9WB 1IEHA 4HWEH 5FKAA 3FB6B 2BC4A 4OKDA 3BKJL 4NQDE 1I7UA 4L9LA 4HHAB 5CCKH 5FYLH 4I77H 4JO1L 3H3PL 4GRLC 3QJHA 3B6SB 2B5IB 5HHPA 1TJGH 3PDDA 3FKUS 1JFQH 1D3CA 3LRHA 3PQYB 1IKFH 3GSWA 3L5WB 5JIKA 4WJ5B 4YHNA 5GSVA 1I9IL 3EYUL 3U4EA 2CK0H 3TT3L 1EEYA 1AP2A 1MCRA 1ITBB 4PS4L 2WINB 3KLDA 1XCQA 4K7PL 4F58H 1IMHC 4ZNEA 1J1PH 3L3DA 1PEZA 2IFFL 1T2QH 3ARBC 3QNZB 5DRWA 1EHLL 4QEGA 1RUKH 3P11H 4ZS6C 2RB8A 3D0VA 2X1PA 2XOTA 4ODTL 4U1GB 4RX4D 4X80L 3RZWA 3O0RH 4YBQC 4ELKA 1B2WL 1LEGA 4JREC 1JGLH 5KSAA 4FS0A 3W0WB 3QWOA 5MP6L 4L9DA 5I8CB 5ENWB 2OL3L 1C16B 1GZPB 3UTQA 5TF0A 4ZOBA 2FLBT 2W9EH 3FRUB 3DGCR 2XA3A 1P1ZB 3D69A 3TO4B 2APFA 1JNNL 1UM6H 4I77L 2O5XL 3FFCD 4P3CL 3B83A 1EV2E 1EFXA 3QIBC 1GH7A 3PHSA 1WT5A 4I0KA 5ALCL 4YDIH 2BXZA 3X11B 2MPAL 3WFDL 5MERB 2J88L 3FOLB 5DJ2B 4YGVB 2I26N 3WL9A 3IF1A 3GSVB 1TENA 3D39B 1M7DA 4LP5A 4MQ7B 1QFUH 3NCFB 5GSRA 2OSLB 3CNKA 1JTPA 2M26A 2UY6A 3AS3A 2AEIT 4CNIB 3R4DA 1BZ7A 1CWVA 3UZQA 1A7RL 1S3KL 3EO1B 5D72L 5KAQF 1RZ8B 1B0RA 3T0VA 3PJSB 3EYSH 3JWNC 1DLFL 1WFNA 1ZVHA 3TZVB 2APTA 4P5MA 3QBTB 4HQQL 2NY7L 1KPRA 4MNQB 3BGMA 4APQA 3TJHD 4J2XA 4HF5H 1M6OB 1SY6A 1X5KA 1S5IL 2VZUA 4P23B 3DYMA 2VSDA 4GMSL 5EU3B 2VAAB 2RBLA 4U3XA 4I2XE 1D6EA 3DJ9A 4DKFH 4GW4A 4OT1L 5TPWH 1QFUL 5JW4M 1TJHH 3C2SA 3C60B 3S35H 4G3YH 4Z7QE 3LS5L 3FCTB 4HCRA 4P2OA 4WFGD 4EDWL 4NQTA 3ULVE 4Z9KB 5KS9A 4F2MA 4XWGH 5ICXA 2NY4C 3NZHH 4WW1B 3CXHJ 4UBDD 3H8NA 4NO3B 3MRRB 3Q3GA 4G8GA 4HGMA 4MAYB 2XNAB 1PYWA 5IM7B 1BFSA 3L7EB 3PWVB 4XB8A 5HHOD 1HDMA 1UZ6E 1X4YA 3INUH 1DQQB 4ZD3H 5ELIA 3EDJA 3UP1A 3I6KB 4Z7WF 3IFPB 3DVGA 3B8YA 3VRJA 4N0UB 5F9WC 4NSKA 1WCBB 4F9LC 3WMSA 3RWFA 1PKOA 4PRHE 3NGBB 2R0ZL 4PGDA 3IJSA 3TWCH 1OF2B 4J1UA 4UNVA 3MBEA 5CZKA 4MB4A 3LKRB 3DOSA 4G5ZH 1J8HE 4AIZB 2ZKHL 3GRWL 2CO7B 4DW2L 4E9LA 1JMZA 4Z76A 3WNPA 1Z2KA 1RZ7L 1BECA 4YEFA 4L3EB 4RMSA 5MEOA 1HXMA 4PRHB 5J11C 3ORJA 2VJXA 3W9DB 1MLCB 3TIDB 1AY1L 4R2GC 2BX5A 2AGJH 4P2OC 5KS9E 4RAVA 2A38A 1X7QB 4BFGA 2VDPH 3TT3H 4OCYL 1RJYA 3IJHB 4YC2C 1NH6A 1IGTB 1T3FB 4IJ3C 3CSBA 3QEUB 3CAFA 1SY6L 4G7YH 1JYNA 3GMNA 1QFOA 4LIQH 5C0BD 2NTFB 1JNLL 3U46B 3DPBA 4HC1A 4ELME 1FFRA 4QHNA 4R3SA 2FEEI 3QDME 1J1OH 1AGEB 1TTFA 3TIEA 1TZIA 3VWJB 2BERA 4YZFF 2FD6L 2DQFB 4OD2A 4C59B 3OJVC 4LLDA 5JPNB 3Q1SL 1NBZB 5CILH 4NNXB 4Y1AE 3TPKA 4HGKC 1QEWA 3MJ9H 1R5IA 2BSSA 4FTVB 2YMXL 4W6XB 5EORL 4D0CA 5C0RL 2XZAL 3OG4B 5IW6B 4GQ9H 4UQ2A 1UT9A 1KB5L 2NW2A 5DJCA 4OKVA 3ZDXF 4DVRL 4OSUH 3F12B 1G7PB 2ED9A 1JRHI 4JFEE 2DWDA 1AKJD 2HTLD 4KKLC 4ZUWA 4YHLL 4ZAKB 1AGCB 4Z7VA 3V6OC 5FUOH 4XC1L 1U3HD 3DX6B 1IGFH 3HAEA 4Y2DB 4IMKC 2NPLX 1KB5B 4F9PC 2DQJL 2GSIB 5HVGB 4FQQB 1F6AA 4I18C 1I3RB 1MFCL 4HLZG 5E1AB 4OAWB 1CGTA 5HYQB 1OY3B 2XZQL 4FQXA 2Z93B 4MX7A 2A6JB 2QQQA 5FO7B 1I9EA 3FQNA 2CDFA 4JN1H 4LF3B 4MWFA 1QRNA 1YN7B 1D7FA 2X1WL 2X1QA 2R4RL 5FYJL 1OAUL 4XVTL 1ZWIA 5A43C 3G9AB 5J1AB 1B90A 5TDPB 3SKJL 3OPZH 1B0WA 2D9CA 1X5JA 1CIDA 3UTQB 1FVEA 4OGAD 4XHJD 2E7LC 1EK3A 2B1HL 4OI9A 4XVSL 2DWEA 3HUJE 5HI3D 3VMPA 4OLEA 3Q0HA 2CKBH 2BSED 1Q0XL 4P9ML 2C3WA 4YFDB 5CIPH 1IGIL 3MNWA 5E8EA 1IAIM 3IU3A 4IRJD 3LEXA 1UG9A 3H9HA 4NDMB 3MUHL 3ARFA 4BQ6A 4NWUL 3T4AB 1OWWA 4M6OL 1N59A 4GAYA 4B7IA 5FGBA 5FFLA 3HI5H 1DL7H 1NUDA 1RJCA 3FT4A 5E94A 5LAXB 1N3NB 1W0WA 1OAYL 3O4LE 5CEZD 3IJYB 3QWRA 2YSSB 1YYML 3LKNB 5GRZA 3DHJA 5L2KE 2E27L 3BIKA 3DYPA 4DEPB 1P4BH 2Q76A 3TN0A 3RRQA 5KSBA 1JN6B 1DR9A 1PX4A 5F6HJ 2OTUA 5I9QC 2ZUTA 3JUZA 5E6IB 4Y88A 2MQCA 3QH3A 4NQEB 3NFNB 4NOFA 2VXUH 2QQKH 3RVUD 2KUTA 3HPLB 3CD4A 2AXGB 3GSRB 4DCQA 1BJMA 3JSSA 2UYLB 4BSVB 3RBSA 3WN5B 5I1LA 4G5ZL 4JFEA 4JDVA 1NFDB 5ESQB 1K8DB 5HHQA 3B5HA 3TCLB 1WQVT 5AZ2H 1TPXB 4HV8A 4OCMC 3NCCB 2WW8A 4AH2B 5AG8A 1U42A 4N9GB 1NGYA 4C56A 4X9IA 4K71C 2R56H 2KL6A 1RK1A 5D6CA 3HG1E 5KTEH 1TVBA 1JGDB 2DLFH 3U82B 4ZS6D 1U95B 4ELMA 1RK0A 5ENWA 2C3GA 5T1KA 5L88H 4M4PA 5IKCB 3VE0A 2Q8BL 4BFIB 3WXWL 3ZL4L 3LEYL 1KACB 3FN0H 3K2UL 1AO7B 5LGHH 3VJ6A 5IFHH 4Z77A 4LFHG 4XI5C 1WZ1H 3GGWA 4EN3D 3CUPB 3CSYB 4HJJL 3UJTH 1N3NA 3ZTJG 2Q87A 5KZCB 4HF5L 1GVIA 3WL9B 2QR0A 5F44A 1J8HD 3JTSB 5DS8A 1OLLA 4Z8FH 1CL7H 4XWOC 4TYUA 3SDAA 3V6BR 5E2VH 3O3AB 4H1LG 5C0FB 3ZZ1A 2XG5A 4P9HH 4XAKD 5DHYB 5HYSB 4FZEL 4XHQA 1EBPA 4PGBB 4HGWB 4R4NC 2RFXB 1J8HA 3WLWD 1RJYB 3IJHA 1ORSA 2CMRH 3KDMA 1JNHA 2VYRE 5ACMA 1T2XA 1K4DB 4WY7H 1T21A 4QRUA 1ZLWK 3BVNB 3VWKA 1PD6A 4JFOB 3L7FA 1UVQA 1RULL 3V5DA 3MQIA 5IB5A 4ODUB 4ONHB 5GGVL 3RL1B 1IGYB 5SWSE 1U3JA 1I9RL 2P8PB 4O2CB 4BQ8A 3BMWA 2AV7B 3R8QA 1MWAH 3VFGH 1VEPA 1WBYB 3IETB 3C6LC 5IK3B 4EOWL 5K9OB 3O8XB 3VH8G 2IWGA 2ADIB 3U9UB 3M17A 3UTPE 3EJJX 5DJCB 4MZ3A 1T5XB 2DQCH 4YK4C 2Q7YB 1S8DB 5I1JH 4KI5D 4YAQA 4RIRA 1P84K 4KH2A 1BJ1H 1AGFB 4ISVA 4JFED 2X05A 1VGKA 3U30C 5F7EH 1FE8L 2ICWI 3TV3H 4WTZG 3VXMD 1OTTC 3ARBD 3DMMB 1MCBA 2DQEH 4NQSB 2OR7A 4MX7B 3O3AA 4NZRH 2X9WA 2ENSA 4HMEA 1U93B 1CIUA 4NQCB 4FOMA 1UA6L 3D2UA 1J8HB 2ARJA 1MFDL 3QPXH 4JFFE 1JZ2A 3ARGA 3WFEH 1ZVYA 1OW0A 3RTQC 4F33A 4D94A 3ARBA 2O61B 4RRPA 3VXNA 1TJIH 4K94L 2FJHB 5FYKH 1T3FA 1S7VB 1MWAL 1WIUA 5CIPB 4TTDC 4QTIH 1L0XA 1ZVSB 4MA7H 5ABDE 1SJEA 2EDDA 4E42B 5ICZB 1U8KA 2NW3B 4RFOL 3DVNB 1EEZA 5GSRB 2I9TB 4PB0H 4KKNA 4ODXA 3DHMA 2RCSL 3RJQB 1D5MA 4KDWA 2YA0A 3BHBB 5CUSH 4TSCL 1W0VA 4GMTH 4XP1L 3V8CA 4TVPD 5L7XL 5AZEH 2E9WA 1ZHLA 1R3IH 2QLVB 2B2XH 4LHUG 1PLGH 3DSFH 4NJAH 5DF0A 5D1ZD 2P47B 4POZC 4K7FB 1I1YA 5I16B 3MRLA 3G6DL 4XPTL 3O4LD 5CEZE 4L4VD 1ZT7B 3H9SE 4FQJH 1AGFA 3BD5A 4ISVB 4R7NA 2YXFA 3OKKA 5IVXF 4H1LA 1S7UB 4ZTPH 1NJ9B 1DE4A 2ICCA 2C1OB 1HZHL 1MHEB 2UUDK 3V4PL 4L4TB 3PDOB 4LCWD 3ZE2F 3AAZA 4NZRL 1YNKH 3WCYA 5D1XA 1S7RA 4X7TB 1H3VA 1CLOH 1LNUB 4G43B 5KG9A 4ZQKA 4PRDA 2BC4B 3MLZL 4JDVB 4JFEB 1J0JA 2AJVL 5CZVH 4P3WA 5E8DH 2NY1C 2QHLA 4I4WB 3ZDXE 3VD5A 1UEYA 1CZ8H 1N4XH 2VDQH 2CIKA 2MFNA 3SCMB 5I74B 1L9NA 3OXSB 5I71B 2EYSA 5IEHA 3C8DA 5IVZB 4XMLH 3MROA 1E27B 2X4NA 5FYJE 4JRWA 5DR5H 3VXNB 4QTIL 1DQMH 3FHAA 3IDMB 3NFSH 4HKBB 4WGWB 3WV0A 2UWEB 2WAHA 5D2NA 5TGBA 1A64A 1FGNL 1A6ZA 1SYVA 1UEMA 4ZDHB 3VH8A 3DI3B 4RQQA 3PWUA 5T1DL 2W59A 2IAMC 2VZ1A 2AGJL 4QRPD 4JQVA 3U4AA 1FNLA 5IIEB 4NKMA 1GZQB 3CFDB 3QUZB 4ZUSA 4ODTH 5I0ZA 3CSYA 5JHDD 3IXAA 5F97E 1UB5A 1GAFL 1NGWA 5C0DB 3RWFB 1WITA 3IXTB 5GJTL 5SWQA 2BJMH 4OZHF 2A83B 4PREA 2NY3D 2VDKH 2EYTB 3ZHLA 5IHZB 2R2BB 5SWZB 1HQRB 1OQOA 4PP1C 5L8LB 3RX8A 3B2VL 3CMOH 2OJZH 4XBPA 4UV7L 1XZ0A 3I84A 1HK6A 3HNTH 5TQ2L 3SE4C 3QI9B 4OZGE 4H1LB 2C1PB 5DMKA 3WHE0 5AUMB 3TBTB 4BSWA 4GG6A 1WZKA 4Y4HB 3MGOA 5IVNA 4OLZH 2GJ6A 2AVGA 4CDHA 1R5VA 1HXYB 3DX8A 4NZUL 4RMTA 1J87A 3WFHB 3DXAA 2JB6B 4QHUA 3EYQD 4QRSA 1NCCL 1TQCC 3QDGA 5F93C 1U8IA 4QOKA 4BZ1L 5FF6A 3D39A 2XY2A 2R9HC 3BW9A 3NZHL 4ZYKB 3VRLE 1KC5H 1GGUA 1I7UB 5JORB 3NABH 1LP9F 5AG9A 2FX9H 2NY1D 4Y7MA 3ZT6A 5E6IC 2BFVH 1R3LA 3TZVC 2JIXA 4GXUN 1U0QA 5TDNA 3VFPA 1FYTD 3ZSSA 3BXNB 4HUVB 4ZAKA 5EOCJ 3RNKA 5K9OA 2AJYH 4L29B 4XNZC 2YBRA 5DD6B 2R0LL 3EJYC 5C1MB 2A73B 5KTEL 5DVLA 4JFDD 5DZLA 2CKNA 4PV8B 3RI5F 3RVXD 3BPCA 5JZ7C 3CK0H 1IBGH 4X4YB 4ELMB 1ORQA 3BI9X 1BWWA 2FDBP 5JA9A 4NC1C 4OUUA 4DVBA 3N1PC 2GFBB 3RKDD 2NW2B 3FRPG 2W9LA 2XA8H 4M7KH 2DD8H 1K85A 4HJ0D 3SOBL 2VLME 2YD2A 4AM0A 3C60A 2HRPL 2EIBA 4JZJA 4PLJD 4XMKH 4HK0A 4KUCF 4WI9A 4N8VB 3P4NB 1YJDH 1HKFA 3BGFC 5JPMA 2H8PB 4PJFF 5J1SC 2NY5C 5LBSL 2WBKA 2PTVA 1ZLUH 3BAEH 3S9DB 4QT5B 2R23A 1MRDH 1P4IH 4BZ2L 1I9JL 5E9DD 3TLRA 6CGTA 2CDFB 3VU2A 5HYSA 2PNDA 4ZFOA 2GAZA 3KJ4B 1PG7X 4OZHE 4M5ZL 1ES0B 3BPNC 5FDWA 2BFVL 4GBXD 3SJVB 1UJ3C 2AJUL 2Z4QA 3DUUA 3VXRD 3GFUA 3O3BA 1P6AB 1U3YA 4XPGH 5E03A 1MQKL 3LPWA 4F15B 2APWA 5EO0A 4R97C 3ZKMD 4OTXL 4HFWB 1NANI 5CHNB 3ZHDA 3C6LA 2DOCA 2CLZB 5DC0A 2D0GA 3TA3B 3I2CL 4Y4KC 2YUXA 4LCYA 3VFTA 4HXAL 4ZFOL 5EU7C 3AUVA 3AU1A 1T89C 3TN0C 3QHZL 1FVDA 1V3KA 3F7VB 1IAKA 1FAIL 3N1MC 5JHLH 3VFWB 3NFNA 2V2XB 1ACYL 2DLHA 5AAMA 4YWGL 1XF1A 4NQCE 3ZT7A 4JZOA 4X5WA 2LU4A 3QDGE 2DQCL 3GMQB 4MS8C 1KTDA 4EIZC 3W11D 2HH0L 2Z35B 2ZSWA 1BLNA 5MI0C 4KTDH 2BVOB 3DROB 1BVKB 4MZ2A 5F3BB 4E41E 1I3GH 3VWJA 4M6NL 4PRDB 4F7EB 5FV1L 1A6AA 1AD0A 1IAIL 4I0PD 4LRNH 4WI5A 3PUCA 1JGVH 1LDSA 5GS0D 2ERJB 4GOSA 1KT2A 3L3KA 1RZGA 3O9WB 3ECBB 4BK5A 5DJDB 2OM5A 2DJUA 5B4MD 4QXGH 3IGAB 4HIJA 5C08D 1DQQA 4D9QE 5HHPB 2FB4H 4Z7VB 2HFEA 1G7LB 1I85A 2PYFB 4DAGH 5DD5H 1ZTXH 5T3ZL 2EDJA 1JGVL 4JJHA 1WVZA 4DN3H 5F1SA 3UTSE 3UTTD 1WIOA 4KJWD 5C0ND 4HUNB 4OZIB 1IAII 3BQUC 1TJHL 3CFBB 2XFXB 3RTQD 3NZ8B 3VXTA 3MFFA 1GC1H 1A1OA 3D18A 4XMKL 3BRDA 3HMWL 1CT8A 2FX7H 3MV11 1A0QH 3QQNA 3TVMB 4MNGA 4JANA 5EZIL 4JPKL 3ILPA 3MODL 4PUBL 4Z95L 2X40A 3VFSB 2CSPA 1WZ1L 2FATH 3UPRB 1H3TA 1XGYL 3O2WH 2EIZB 5HPMB 1JL8A 1MQ8A 5A3ID 1KTDB 2G5BA 5D96B 3NCMA 3IDGB 5CAYB 3EO0B 5D7LD 3VGGA 1VCAA 1D5ZB 5LGJA 3SO3C 3Q6GH 3TJEL 2HJLB 2PYEA 4KFZC 5J13B 4GW5B 3OKMA 3P4MB 2DBLL 2NXZC 2OBGA 3OKNB 4O58H 5HYSG 4JY4A 4UDTB 4X6CF 1IZJA 4RMQA 3OKEB 2HJFB 1OP5K 3N1FC 4FQIL 4UBDC 3EYVB 1GOHA 1ED3B 2OR9H 4DOHB 2XN9D 1TJIL 2PYED 1IVLA 1H5BB 3QIWB 4H8WL 4KK5D 1CICD 1IM3B 1KENL 3THMH 1GIGL 2ORBH 2R2EA 2UZYB 3OXRA 4PLKC 1B4JL 4Q9RH 1FYTE 1CFTB 2R39A 2A73A 3CMOL 4NBXB 1B88A 3LQZB 4J4PD 3T8XB 3MJ8B 4I0PA 1FH5H 1RUPL 1GGBH 3W0WE 3SN6N 1CT8B 1RUKL 3P11L 4PRPE 4X4MA 1MRFH 3MRPA 4FQQA 5IB3B 1MFBL 2OP4H 5DJAA 1CI5A 2IH1B 5F7FA 4G7VH 4WEBL 1RD6A 1ITCA 1D9KC 1KEGH 4N9GA 2VLMD 4KDVA 2YKLH 3EKCA 1CFQB 4HKJB 3FZUD 3WUWB 4X9GA 2WBJB 4F37K 2ATPA 1NL0L 5L2JA 3QRGH 5DD3L 4YHML 2VDLH 1QPXA 3OF6A 5DR5L 1AGDA 2J12B 3FJTA 1OGAD 3QI9A 5DRXA 5ALBH 3MRHB 3L7EA 3RBGA 3IU4L 1T66C 4F80A 4XNXL 3UO1L 2R15A 3W9EB 4GO6B 1W0VB 3DBXA 1U8OB 1S7XA 2V5TA 1SJHB 4NZJA 1WCBA 4NUJB 4XZUB 1VSCA 4GSDH 2BY0A 1F13A 4NO0A 1TVHA 4HK3J 4UILH 1SMAA 1S78D 2H2PD 1J1XH 4L1DA 3QFDA 2R69H 2DI9A 5DUBB 1N0LA 1G1YA 1FFPB 4AT6A 2CRIA 5JNYA 1CLOL 3QR2A 5C8JB 3LD8C 1N6VA 1MHEA 5FM5M 2Z8WC 3QDAA 5HHOB 2GUOB 4PJAF 4KKLD 3EOTH 3O2WL 3SDCC 4LHQB 1LO3L 2X4SB 4LPTA 5CGTA 5GISL 1K4DA 4JO3L 3SQOL 3MV9A 3BEVA 2A9NL 3LN5B 1KB5H 3R8BB 2X4PB 4R97B 2BJML 3RA7L 5D7SL 4HWNA 2VLKB 1NKOA 1CFNA 2FX7L 5J1AA 4ENED 3JV4B 5EOTA 1XF4A 4OGYL 1DQLL 3K1DA 1KCUL 4U3HA 3QG6B 1G0YR 4IIQC 3VW3H 4IOFD 3VFNB 3L5IA 4LSDA 3RWGA 4J4PA 3N85L 5F9DC 3U7YH 3QCUL 5E8EB 5GS1B 3OAYK 3Q6FB 4PRAA 1SJVA 2AJXH 2J8UE 4XPAL 5CBEB 3SKNB 1QLRB 4IRSB 4NZUH 2CDGB 3CU1A 4ZAKD 2AXFB 4K94H 3FN9A 1IC7H 2HAZA 3FO2B 1FVCA 2EDOA 5E2JA 4XNZB 1Z3GL 2ZSVA 5DQDH 3GM8A 1A7NH 4HS3B 5E94B 1I7RB 4XAWL 1UZ6F 2HFGH 1KLUA 1Q72L 1ZT1A 4HLZH 1KB9K 2JELL 3PG2A 2J6EA 4M61A 3V7AE 4G8IA 3ULUE 2R1XA 4LPYA 3A0OA 5CJXA 3ZO0A 3PL6A 4QXTB 3MOAL 3DECA 1UACL 2Z91A 2GJ6D 2MTPA 4PJAE 2EKSB 3MGTA 3GJEB 5T1LD 3RKPA 1WCQA 4HKZB 4PJHA 1KCRL 2A9NH 1XIWA 3GIZH 4XTRD 3L1OL 1EAPA 4KWUA 4JO3H 4J3TA 4C56E 2DQIL 3LQMA 4KQ3H 4NFDA 1MJJB 3B9KD 1D5BA 2EIZA 5HPMA 1VFAA 3LMJH 2QQLH 4HS8L 3GJFA 2YPKA 1IL1A 3RU8L 1QRKA 4WWKD 4NQVB 2L7JA 3O4LB 1A2YB 1SBBA 3FOMA 3WS6C 3IFLL 5HYFA 8FABA 1LK2A 1AC0A 2OYPA 3LV3A 1JZ3A 4GRLD 3GO1H 4G8FB 2VLKD 4JQXA 5MENA 3MUJA 1N4XL 4DZ8B 3IDJA 2Y7QB 3MNWB 3FB6A 3P0GB 5K93A 5JXAH 4OZ4A 4MJIE 3O11A 4PJ8D 3DXAD 2Z92A 2CJUH 3LDBC 3RWIA 1FDLH 4G6JH 3OZ9L 4H5SB 3VXUB 4LHUB 1TTUA 4PJCE 3QQ4A 1JHLL 1E4XL 4WFGE 2BVQB 5C0AB 2EYRA 2WUCH 5FA3B 3PQYA 3RDTD 1T04B 1BVZA 1OP5H 4ZO7A 2CMRL 3BP5B 4KK8D 4JDTH 3SPVB 3V0VA 3U0PB 2IEPA 4RFEA 3WLBA 2NMSA 5DS8B 3U7WH 2FR4A 3SE3A 5HYEA 4UIMB 1Z9OA 2JJTA 1N8ZB 4NNYA 3SDDD 2A6JA 3LIZL 1GYAA 4WEBH 4LLWA 1KIQB 3VWJD 3GKZA 5KOMC 1NMAH 4QRPB 3KXFD 3S5LA 3D9AH 5BO1L 4MD4B 2QADB 3QNZA 5DRWB 4AEFA 5JA8B 5JXED 3EYFA 4ZPTA 2F54A 5E1HB 5FUOL 3ZDZE 1IRAY 1ZS8A 2P8MA 4LARL 2X9YA 3PGDA 5T5FH 3BQUD 4Y8AA 5D93C 1IGTA 1V3JA 2NR6C 5I1EH 3REVA 3MV7D 3TNNA 3C8HA 3RL1A 1P4LB 3THML 2LTQC 1BIHA 3FQTA 3BESR 4LPXA 1NEZB 3HZMB 5T3XE 4PBWD 5E6ID 3GIVA 2VUOA 4WHCA 1V5JA 5JXAL 3OJDA 1TZIB 5GHWL 2JJSA 1K6QL 2V2WA 3QXDA 5DD0L 4OZ4B 1L4IA 4LPVA 1FHGA 2B4CL 3S4SA 4X6DE 5HYJB 5DMIL 1PZ5A 2WWMD 3EJYD 4XZUA 4P59H 5DMGD 5IJKC 3DV4A 3CDGB 2DL2A 5GGTA 4K55A 1JI1A 1RVFL 2X70B 4Y19A 5I66B 1UB6B 3P77A 1D6EB 3OHXA 1XGPA 2B1HH 4K3DL 3ARGD 3WHXA 3D0LB 3ZE0E 5HDQL 4WDIA 3C5SB 4NM4L 2VDPL 2GCYB 1MCPH 1P9MA 3O9WC 3GSQA 4ETQA 2AK1H 1CFTA 4EN3B 5I19L 4JGUA 1YEFL 1NFDA 2B4CC 1XR8B 5ESQA 4NQDA 5IFJB 3OJ2C 4PUBH 4Z95H 2AABH 5FUCE 1U8IB 3ELAT 3ULUL 4WCYL 1TETH 2APVA 2BY1A 3WS6A 1MCOL 3BN9C 1YN7A 5DJDA 3ZE2E 4IRJA 4DKAA 2LVEA 2QBWA 1G9MC 5BV7C 3V5DB 5KS9B 3BH8A 4EVNA 4JQVC 3O3EA 1VESA 2MJWA 5JW3L 1TMCB 3A6BH 2Y9RT 5B38G 3FB7B 1IBGL 1WJ3A 3Q6FA 4Z7NE 4EI5C 4AQOA 1DQML 4PJBF 3CDFA 1PFCA 3BT2H 4QF1A 1DBBH 2FL5A 5CWSA 2A77L 3MRIA 4BUGA 4L8BA 4Y1AA 3U7YL 5L9DH 1OPGH 4ONFL 3K0WA 4LSTL 3QRFM 4CADA 4MJIA 5CP3A 1RIVL 1YMHA 5ADOL 1I7ZB 1Y6NR 4CJ0A 2DQDL 2B39A 3OAYH 5ERWB 1UC6A 2HKHL 3WJLA 2R1XB 4Z18A 1CL7L 3QNYA 4FZ8L 4XRCB 1UJ3B 4EUPH 2A6DB 4Y5XB 4YDLC 3QIBD 3GMNB 5D71L 2YSSA 4FTVD 3LKNA 5ILTH 1UZ8B 4WENB 4D9LH 3MLVL 4HH8A 1MHHB 3FRPA 3JWDC 4QNPE 2YA2A 3PNWB 1FRGH 3WE6A 2YD9A 4GKSA 2Y06L 1H15B 4JDZA 5E6IA 3SDAD 4X4ME 3CDYA 3MA7A 1NUGA 3MA9L 3VFOA 2BSSB 5DTFA 3MGOB 1JF1B 4OLVL 1A1MA 5L7XH 3HE7A 4U2YA 4PJAA 5IFAL 5HI3C 2Z31A 4A6YH 1D5IH 1JTOA 4HFWA 1OARL 1WBYA 2FECI 2WIIA 2VLKA 3HS0A 5DJZB 4YR6A 5E6YA 2A9MH 2VE6B 2Y6SD 5JXEA 1YC7A 2F5AH 1LILA 2Q86B 5TQ0H 4XVUC 5LKNA 1UM6L 1JYXA 4BM7A 4S1RH 4W6WB 1A4KA 4UUJB 1A9EA 3OX8A 4KQ4H 5ISZD 2BNQE 2VC2L 3HE7D 5DQ9B 5I73C 2VERN 1JPSL 3BN3B 3J7HA 5T1KB 5IKCA 4FN0A 5FO7A 3ARXA 5JMRA 1RZFH 3BYTA 1TZHA 1OW0C 1IARB 2P5EB 4PR5A 3ULVD 3BD3A 5MEPB 1X5YA 4XMLL 1K8IA 1B0GA 1I1YB 3WFZA 5E2TL 4DVBB 4YFLI 1N6QL 2BVOA 2OMBA 3U7AA 1T5WB 3N1QC 3K8LA 2ZUXA 3OAUL 1MREH 1MFNA 3BWUC 3MGAA 4N8VA 2QR0B 4JGMA 2JCCF 4JRXD 2A0LD 4U1JA 1INEH 2AEQL 4UT6H 3O2DA 4GAJH 3LKOA 5TE6H 1SM3L 2W65A 3DGGB 1W8OA 2VL5B 5I75C 5C6TH 3KVQA 1ADQA 5DRXB 5F89B 4QHKI 3RP1A 2AKRB 4IIQB 1PY9A 5DO2D 3ZDYF 1MWAB 4WW2C 1QNZH 1A1MB 3FQUB 1NBYA 1RIHH 2A0LC 3VD7A 1H3PH 4Q97A 4CVXA 5C70A 2EXYD 1AQDB 1L9MA 1WV7T 4PJ7F 3H42H 5SWZE 3ARWA 1R3JA 1KTRL 3STLA 2DI7A 4GMTL 1BFVH 5CCKL 2J8UA 5GRYA 4F57H <