4WO4C

The molecular bases of delta/alpha beta t cell-mediated antigen recognition.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
200
structure length
200
Chain Sequence
QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGVTGKLTFGQGTILTVHPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular bases of delta / alpha beta T cell-mediated antigen recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d
total genus 43
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2014-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wo4C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wo4C01
4MS8C 4M61A 3D69A 5TE6L 1FO0A 3RX8A 4D9LL 1KCVL 3BKML 1WT5C 2W60B 2DLFL 1LDSA 3OX8B 3ZDYF 1I7TA 4HH9B 5CBAB 2YD1A 4PJBA 4L1DA 2AJSH 1OARH 4FG6D 1FYTA 4JVUA 1QBLH 4LCUA 3BKMH 1WF5A 1IM9A 5EIQA 3QI9D 4EIZC 4JREB 3PIQB 1TZGL 5SWZE 2AV7A 4KK6C 4G7VH 1WZMA 2AK4B 3EFDL 4YXKL 1T1ZB 2AXFB 2AJ3A 3FB6B 4DEPC 3O4OB 5JMRA 2NY4D 2HN7A 4NUJB 1A4KB 5F6IC 4CW1A 2XKSA 4EN3A 2NY0C 1DQML 3QEUA 5F93C 2G9HA 4I5BB 4JG1L 4NP4L 5GZND 2Q3ZA 5SWSA 4YHNA 4UV4H 1EGJA 4FQ2H 1F11A 1LWRA 3UO1H 4X4YB 4N5ED 2XT1B 3N06B 1XH3A 4JHAL 4ZTPH 3CGTA 4XNQA 3ZT5A 1NGWB 3DMMC 5D4QA 2PW1B 4FTVE 3CC5B 2AEPL 4MB4A 4NZTH 1JHTA 2XQYK 3RIAF 3K4ZA 4TQEH 2FB4L 1YC8A 1ZT4A 3DXAA 2JJWA 1MRFH 3DIFA 3VJ6B 2YEZB 3RY6A 2I9LA 2DMBA 3U9UA 3FTGA 5D1ZC 3V4UH 3CU7A 5INDB 3SKUD 4AMKH 1FVDB 1LVEA 1Q9OB 1P1ZA 2NY6C 5FYJU 5SV4A 1CLZH 3HI6H 5GGUA 5DK0A 5E2VL 2B20A 4ZPVA 5HY9A 4LCYA 1KTLA 1XGYL 5E8DH 4V1DE 4NNPH 4NKOA 1K5NB 2WM0A 5EOCL 3O41A 3MA7B 1MIEH 4O4YH 5FEBA 5GGTH 4LSVL 3B9KB 4AMKL 4CDHA 4DN3L 4ISVA 5F72S 3L3IA 5I76B 3LHPL 3MLYH 4Y4KC 5TPWL 3D2UD 5HHOA 4NO0A 3V5KA 3RWEA 1J8HA 3AC0A 5DYOA 3CSBA 1I7ZA 3QUYB 3QHFH 4R7DB 2WBJA 3PWNA 2DI7A 3PP3H 2X42A 4Y16D 1X44A 5MERA 1IGMH 3LDBC 1K3ZA 4M6OL 2FO4A 5SWQA 1TJIL 4U2ZA 1DR9A 1CFNB 1D5MA 1T2QL 2V7NA 4Q9BA 1OL0A 2KH2B 4FP8H 3JBG7 5DK2B 2D7PA 5FKAA 4EEEA 2WBKA 4BELD 5EZIL 1IGJA 2GSGB 5HYJA 2YD8A 5ISZD 1ZKAA 2JJSA 1TJIH 3FTGB 5GZNC 3GSUA 1L9NA 5D1QD 1KB5B 4QRSA 5CSBA 4K3JL 3DIFB 5HI5C 5I16B 1JYNA 1W0WB 4XP9H 1FYTE 1CGWA 3TH2T 1YMMB 1DQJB 1DBJL 1Y0LB 2QLVB 4JFDD 1T6VN 4OF7A 4LSTH 1QRNE 5D7IF 3LS5L 1V7NH 4MWFA 4GH7B 4IBLT 5E0QA 1AHWA 2E9IA 3VXRD 2VR9A 4NQDD 1DBJH 1U41A 1AR2A 5CSZB 3L7EA 1GRWA 1TCRB 3L3GA 4TTDD 4YZFF 4GG6F 4OFPA 5C6WH 1UQSB 1MCPL 1TVBA 1YEFL 1QTYT 2WUBL 1EEYB 3IFOB 3PWVB 4NHCL 5GSVB 4POYA 5L8JB 4QKXB 5IGXL 1KTDB 4GW4B 4OCLC 3SHSA 3CH8A 4FN0A 4H88H 2UUDK 3C6LD 5HY9B 1JZ6A 1U3ZA 3AB0B 3RVTD 3U2SA 3P4OA 4XWGH 4FABH 4M7LT 5I30H 5EO0B 4TOYL 1MNUH 4NRYB 4LVNB 5IGXH 2LE9A 4HF5H 3QH3A 2MTPA 4HIJB 2OP4H 5C9JA 3MUJA 3BVNA 1U6AL 1MFDH 3CC5A 5BS0E 5DLML 2P8PB 1C8PA 1CD0A 4PRAB 4RGOH 1IC4L 1LK2A 4Q2ZB 5D1QA 1NCBH 5GS0D 5F3HA 1MNUL 2QHRH 3P9WB 5EZLB 2NPLX 3VH8B 2R56H 3CMOH 3BKYL 3QJHA 2DKMA 4NN7C 4P5TC 4Y5VC 4QXUL 3TBTB 3O2DL 1SEBB 1VFBB 1KENH 2JJTA 5CP7B 1MCIA 4L1HA 2AKRB 3BZFA 4P2OD 5FGCE 4M7KH 1DBBL 5GS1A 1T6WA 4RGOL 1B4JL 5F6HJ 1VDGA 7CGTA 3FB6A 5HI3C 1SBSL 4OI7A 4OJFL 1XGPB 3F7PC 2ZSWA 5HHOE 3RWJB 3ESUF 1MFEL 4U2YA 5HYFA 1NGZB 1RZFL 1YMHA 4IOFC 5KSAB 3G6DH 1A8JH 1JPGB 2ADIB 1PY9A 4DKEH 5CGMA 2HG5B 4G6JH 1UG9A 4Z5RB 3I9GL 1JI1A 3IXAB 1HOCB 4P5TD 3VFGL 1V8HA 1KLFA 1ACYL 1JNNH 4HS8L 1BF8A 1H15B 3PGCB 4NCC2 4PV8B 1T3FA 1M7IB 2VQ1B 5EORL 3W2DH 3ULUF 2ARJQ 4OBSA 4G43B 4DGVL 1MI5E 1NCDL 2XA8H 5EU6B 2EH8H 1OD9A 1G9MH 1S5HA 1FNSL 3BP5B 1T03H 3QUXA 3RWHA 2DLHA 4M7LL 1RZGB 4JFEA 4KK6D 1GIGH 1MCOL 3D6GA 3EOYG 1I75A 3DSFH 2ZNXA 4XGZA 2P44B 4L4VE 5TF1L 3WDIA 2NY4C 3EYUH 5I1LA 4ELMB 3PHOA 5IMKA 3PWPD 3GIZL 5HYJD 4ACPA 2VQ1A 5FYJL 4RFOL 3T8XA 4H8WH 3SO3B 4OT1H 1RFDL 3DX7B 5TDPA 3MV01 3K0WA 2BVPB 3L9RB 4P2QD 1KCUH 2VXQL 1PEWA 3MFFA 5F3BB 4NQXB 1NCCL 3LKQB 1BIHA 1MCLA 4TUJA 3WUWA 4UOJA 1C5BL 4GRWH 4FNLL 5DWUH 4LPXA 4OFVA 3O3EA 2GJZB 2X4OB 5EBLB 3IJSA 1NCCH 4JVPA 3EZ8A 1R3KA 4IS6B 3O8XA 1P5VA 1NUDA 4ZUVA 1WCBA 3DUSB 1J1OL 4AM0B 1UJ3B 4MQ7A 2H1PL 3F8UB 1WWCA 3RNQA 2E8ZA 2IG2L 1NMBH 4M4RA 2ZUTA 1E4WL 4XCNA 1R3LB 2YMXH 2HJLB 3WLWC 3ZKND 1RMFL 4RFEA 5HDLA 3OWEA 3MGOA 3P0VH 2BRQA 3HI5L 2X1OA 5B38A 4I4WA 43C9B 4WV1A 4B5EA 1FV1A 5HHNA 3JV5A 5HPMB 3P4LA 3AY4A 4GS7B 1S78C 1A6WH 3HG1E 4IEFB 2FGWL 3N85L 5J1AA 2GCYA 3H7BB 1UYWL 3CFCL 3RBGA 3MRIB 1OAKL 1BOGB 2JIXB 4NKDB 2DQUH 2E7LC 2YPLA 4P5TB 3NIGF 2Y07H 1PG7L 3RVVD 3WSQL 1N26A 1QFWM 5CD5D 1PJ9A 4PJFE 4XRCA 3FT3B 1S3KH 2XN9E 5KN5B 5GQBA 1OGAA 4NM8H 4AT6A 5DJ8B 1P4LA 2FGZA 3DURA 4Z76A 2NY3D 1MJ8L 2Q3AA 1AJ7L 5EBGA 3MO1A 1J12A 5MP6L 1JPSL 3S37X 1UB6A 2CH8A 1EZVX 3O3UN 4DW2H 1ZGLA 3GGWA 1RULH 4NHUB 4X5WA 4BKLA 3K2MC 4UT6L 4BFIB 5E8NA 2XWTB 3WS6C 4L4JA 5T1KA 3MJ6A 3QNZA 5ADPL 3Q0HA 2GFBB 1J8KA 1MH5B 4A2LA 1CDCA 5EWIH 5C0DB 4XP5H 2OXGA 1LE5B 4WWKB 4UT6H 3FO2B 2R9HC 2GJ6D 1MRDH 3HMXA 3K74B 2I07A 4U1KB 2KL6A 1LK3L 1KCKA 1ZWIB 5BXFB 3AMKA 3VFUB 4YLQT 3IB4A 1JGVL 1HXYA 4JB9H 4C57C 3UTPE 4LCWE 3MOBL 4JO1H 5DA4A 1K8DB 2L4OA 2N7AA 4X7CC 3BEWA 4RAUB 5E6ZA 2FBJH 5CIPH 3G04B 3VGHA 4NQVB 3EO9L 4H5SB 4FHBD 4RNRA 1I8LA 5C7XL 4LFHD 1LK3H 4O58L 3QHZH 1H0DA 5ANMA 4P4KD 2H32H 3O6FA 5CILL 1QFHA 1R6VA 2HFGH 1RHHA 4JB9L 5HYIA 3UTOA 2H26A 3QULA 4AG4L 2DRUA 3E2HC 5DJ6A 5C6PB 3MBXL 3MRLA 5KVGH 1YDPB 3PV6B 2EEAA 4EBQH 3FO9A 1CFSA 1SYSB 1WAAE 2XFXA 5F7DA 3REVB 3CH1B 1VPOL 4OM0H 4PJ8D 2QSVA 5C09B 1P4BH 1OAYH 4RWHA 1RURL 2MCG1 4PR5B 4JKKA 3JWOL 1KTLB 4ZS7H 1MCCA 1JTTA 4KJQD 1T1YB 3HUJB 1MRCL 5FO7B 1F4AA 3VXTA 4DCQA 3IDNA 3MV9B 1CLOL 4PUBH 4RIRA 3WIFB 2OMNA 5AUMA 2DQTH 1S9WB 4XTRC 1RURH 1XGQB 1IBGL 5JPNA 1XEDA 2H41A 1L7IH 1U3YA 5AZEL 2EYTB 4JJHA 1DLHB 4XNXL 4ZS7L 1UM6L 3T04D 2XZCH 1W72L 5J6GB 1S9XB 2D0HA 3VXSE 1CGYA 5DJ2B 3H3BC 4RQQA 1MWAB 1T80A 3CJJA 3VFOA 1KBGL 1TQBC 4OLZH 3ZKMD 1EEYA 2VXVL 1ZE3C 3FQWB 4PJHF 4UDTB 1UZ6E 4X7DC 5HD8D 1DQDL 4QOKE 3BH8B 4DN4H 5E00B 2E7CA 3MXVH 4PGJA 3KPSB 4S1SH 3CIQA 1BPVA 2CRZA 2BVQB 4QHMA 1BWWA 2WLYA 3ILPA 4LLDB 3VG0H 4M48H 4YDVA 4OCXH 3C2AH 1IC7H 1MVUB 1QBML 2FX7H 2NR6D 4DAGL 4OZGB 2W92A 3PHQA 4QWWD 4OZFB 4XBEL 1FVCB 2MJWA 3BSZL 3AMLA 4RMWA 1QA9B 4X9GA 1B2WL 2WNGA 5D2NC 4YQXH 1II4E 1GC1H 3MBEA 1U58B 2UVEA 1C12B 5FF6A 3V95A 1SJHB 1AGFA 3GRWH 3KNBB 4GLRH 4XPTL 5DSCA 5F88B 5E9DE 1RJCA 3GKWH 4NNXA 4TTGA 4YBLC 1JP5A 2E9JA 3MCKA 3QUMB 3UROR 1Q9WB 2CR6A 4U1NA 2WWKO 4YXLH 3L5XH 4XPTH 4JFDA 5HHVL 3ESVF 5MEQA 1HIMH 4G9FA 5JQ6H 2EC9U 5C6TH 1KUMA 1Z5LA 1QBBA 3WXVH 3BZEA 3W5NA 4OCSH 2BNQA 4JQVA 4JCMA 5A2LH 3UBXA 3QI9A 2HT4C 4WTZG 5EU5B 3ROLB 1M6OB 3TV3H 3JWNC 5GS0C 2LVEA 1CK0L 3IGAB 1EFXA 4K94L 4X9IA 5LGHL 1KEGH 2KDGA 4Z76B 3LIZL 4N0CD 4XBPA 5LWYH 4HKJA 1I1YB 1KTKE 1NBVL 2IBBA 4JO3H 4NKOB 3K7UA 3S3JA 4FTVB 4FFWD 1EJ6A 2RCSH 5GGVH 2X1XR 3OKLB 4TSCH 5LCVL 3LB6C 5E1AB 1NAMA 4LBEA 1MFAH 3QB7C 4TNVK 2KPNA 1T89A 2VL5A 1JK8A 2Y1VA 1OAZL 3VJ6A 4G8FA 3NZHL 1DBKL 2LAAA 2P24A 5EOQH 5F96H 3DGGA 1J8HE 1F4WH 4Y88A 2IQAA 4XPGL 2WANA 1RD6A 3CMGA 4TSCL 3IDJB 3KYKH 3FZUC 1DBAL 2FEDD 1SM3H 2YPVH 4V1DB 3GSXA 4M4PA 4HKBB 1A4JB 2EO1A 4G80A 1XGRB 1IC5H 1G7JA 3BWAA 2X4PB 4QCIA 5CINL 3VXPB 4RWYH 3DYPA 2CLZB 2QQNL 5DJDB 5H37G 1U92B 3MOAL 5IB5A 4OI9A 4I3SH 3U1SH 3EDFA 3BKCL 4NN6C 4AM0A 4YHKH 5HTSA 3MRQA 5D1ZB 3DXAD 3SDYH 5JNYB 2GJ6B 4HPYH 4WCYH 3FOMB 1UJTA 4G6FD 4G7YH 4KJYA 5J6HB 4KJPC 1KULA 2H9GB 5FCUL 1SJVA 1F4HA 1Z3GH 4BJLA 1F8TL 2V9RA 4JRYD 1VACA 1JYXA 3DV6B 5IJVB 2JIXA 4GBXC 3LQAH 2QSCH 4NZUH 5JHDE 1VFUA 4G7YL 4X9BA 5F8QC 3KJ4C 3HR5A 4QHNB 4D9RD 5GJSL 4N0UA 1G6RL 1YUHA 4HLZG 4CVZB 5DGQA 3LCYA 3T0EC 5D1ZA 3OX8A 2NY3B 3QEGL 1H8NA 2IMMA 1YEHH 1JGLH 3HRZB 5DF0A 5D1XB 2P42B 2DQDL 2EICA 1FLRL 1WBYB 2VABA 2AXGB 4K7PH 5GGRA 3MRFA 4MA1C 5D1XD 4LNVA 1KF9B 3U83A 5I0ZA 5A16A 4U6YB 2WLZA 4PJXF 1O5DT 4KJQC 3SCMB 1J1XL 4HK3N 3OKDB 1ZV5A 1QRNB 2EDTA 5HVFB 5IFJA 3MYJB 3BP5A 1CLYH 3HN3A 1NLDL 4LVOC 5DJ0B 3SE9L 5L2KE 4JFXB 4JHZA 5CP3H 1K8IB 2IBGA 4BFGA 2AS5M 2BC4B 5HJ3B 1X7QA 1JK8B 4HWBA 5C86A 3MRKA 4LAJH 3GBLA 1G6RA 5F3BA 5E8OB 1WZ1H 4X8JA 2CXGA 2BVPA 1WC7A 4LGRB 4JPVH 3NCYS 3ZYJA 2A74B 1LQSR 3B43A 3GMRB 2RR3A 1KFAH 1I9IH 4F58H 4C4KT 2VAAB 2N1KA 4I9WD 3L3JB 3RDTA 1WVZA 1CR9L 5BW7C 3X3FL 4KRPB 4XPHH 4Y5YA 5HJ3A 3NCJH 4OLXL 3MV7B 1CT8A 2Z92B 4DVRL 4YEEA 4K8RD 43CAB 2ZSWB 1W0VA 3ZLQC 5BRZE 5EU5A 3ROLA 2O93L 4NQDA 4EVNB 3RVVC 1F42A 1MUJB 2IALB 5JDSB 3ARVA 1U8KB 3MRHA 1QLEH 1YPZF 4NP4H 3NCJL 3WFEL 2AXGA 3VFSB 4KU1A 1RUAL 3QJHB 3MRGA 1B0WA 2ESVA 4PS4L 4MA3B 4NQEA 4MYWB 3ZE0F 1KLGB 3O3DA 5HI3D 3SJVA 2FLBT 3CFEA 1WIUA 3JTSB 4RGNC 2V5YA 4XVSL 5FUCC 5C9JB 3EFFB 3GMPA 3GSWA 2BHUA 1MHPL 3S37L 4OF0A 1ZHKA 1PKQB 1VACB 1MIML 5AWNL 2NLJB 3MODL 3PP3K 2AJZA 4OD3H 4MHHI 3EBAA 3RY6C 3DVGB 3LKNB 2X44D 4HUXB 2IAND 4J3SA 4QRQB 4S2SB 2V2XA 1FE8H 4R0LC 1YEJL 3BN9C 3CK0L 1AGDB 2SEBA 4L8CB 2FJFA 3OKNA 4NQSA 5IBUB 1FL3B 5FHBH 3GMNB 4X6FB 3SDAD 1T0NB 1U92A 2YRPA 2D7MA 3TCXA 4A6YL 4JJ5B 2IBZY 3SPVB 5JR1H 3MRDB 4WGVB 4MZ2A 2QQLL 1CE6A 5FM8A 4ORGA 3AB0C 4P2QA 1YEJH 3CK0H 3IRZA 4R4FH 3KLSA 2F9BT 5FV1L 1MREL 4F9LA 1HEZA 2DLGA 3Q5TA 2AJVL 5KG9A 4Y16B 2PXYC 2X4TB 4Y5YC 3IJHB 3MZTA 2ITCB 3RWDB 4PJDB 1P2CB 2IQ9L 5DT1L 1NCWH 1EEQA 3ZT7A 1YMMA 3J8F7 3L5JA 1XGQA 1REIA 1WICA 4QHKI 1EIBA 5DURB 3RIFF 5T3ZH 2CQVA 3CVHB 4HCRA 4I0PB 4NO5A 1K4DB 4I77H 3S36H 5IFHL 4F2MB 3FHAA 3U0PA 1ZSDB 3BD5A 5KW9H 5J13B 2BNRB 5EZIH 4PJFA 4ZUTB 3DI3B 1I1CA 3TBYB 5SX4I 5JOEA 4QWWC 3CFDB 3QP3A 2NX5E 5E2UL 5CBEA 2F74A 1FHGA 3TVMA 3GSRB 3P0YL 3CZFB 3KDMA 2Z31A 1NUGA 3F7RA 2BHZA 4IDLA 3SKOA 5AZ2L 5IG7B 4D0BA 4WW2C 5GRWA 4L3AA 3CLFL 2VDML 5HGGS 2H3NA 3Q6GH 3FO0H 3T3PE 4LGPB 2C5DC 2KZ1B 2XKNA 4EZMA 4TVPL 4CN1A 2F54E 2V2WA 4Z95H 4HKXA 1EUTA 1F3DH 3T0DA 3C60C 3NIFF 1HCVA 1LEIA 4L3CA 2XNAA 1EGJH 4NNXB 5BXFA 3T0WA 4XWGL 4LCYB 2VISB 5IROA 1HXMB 4FQJL 5EOTA 4D3CL 4P5MB 4NQEE 1B0RA 4Z95L 4S0TD 4XNYL 3V0VB 2D4DA 4WFEE 3GFUA 4I0PA 4K8RL 4PTTB 5C0JA 1LNUB 4HF5L 5KSUA 2OMBA 5IVZB 4M8VA 4PJ7E 2DQFA 1HILA 2NYYC 1QA9A 4LLMA 1RZ7H 4ENEC 4JN1L 3E8UH 5DLMH 4PY8J 4X83A 1OTUD 5ANME 3HE6B 3O4LE 3T0VA 3PWNB 3Q6FB 1WJ3A 1LE9A 2WUCH 2MCPL 1H3UA 4J3OC 4XNYH 5JIPA 4J3XA 1I7ZB 1A5FH 3QUYA 3UTQB 2NY6B 3UYRH 1CXIA 4G8GD 5CEXA 1DSFH 1EZVY 3ARUA 3BEVA 3SDCD 4UNTA 4RGNE 3S35H 3D3VD 3F7YA 2ATPB 4YDLC 3KDMB 1QKZL 5I1AB 1ZLWK 1I3VA 1F02I 3B3IB 2GAZB 2FH8A 3O2DH 4N0FB 2VDNL 4P48A 3OG6B 1OAUH 5DJ8A 1CICA 3IFNL 1IAIH 4JFZH 1UADC 4ZNEA 1AGDA 1N64L 4GAJH 4X99B 5EC2B 5LAXB 1A2YB 4J8RA 2X4SB 4ODHH 5EUKA 5GGUB 4HGKC 3V8CA 3DARA 1PFCA 1QHPA 9CGTA 3VXOB 3IJYA 4MLSA 4FG6C 4X4ZA 4QRTA 2VMFA 4R9HA 1B0GA 1KYOK 2BZDA 1AD0B 1JBJA 4R90H 2GT9B 2B4CH 3HE6C 4YC2C 2RAMA 4XB7A 5I1EL 4PJDA 4YJZL 2FD6H 3HMXL 5BMFL 4ZFGH 2O5ZH 1CFBA 3ZKQD 3HKFA 1UCBH 1A14H 4JREC 1Q9LB 1T7YA 5D7LB 5F1NA 4ZXBC 5FIEA 4E41A 3V8OA 1L0XA 2NX5A 4HMEA 4X80L 3ZO0A 3MRHB 2WBWB 4EQ2A 3LRGA 3M8OH 1G6VK 5I1CL 1H5BC 2X4OA 4HUXA 4WFHE 5EBLA 3O4LD 4LDLB 2HVJA 2VXSL 3H3PH 3QDHA 4ZQKB 1U8JB 4HIHA 5DD1H 3TZVD 1I7UB 2J8UF 1CDIA 4RDQF 5GZOD 5ICZB 1EERB 3D85A 1S7SB 1NDGB 2VLJB 4ODBD 1VGEL 1QSEE 5D1XC 2E7BA 3VFUA 2VAJA 3T0XA 4NOBA 5EN2A 3KPTA 4X8JB 3UJTH 1K3IA 3E2HB 5TDPB 3T4AA 5FUZH 2X9YA 5I1DB 4MA8L 1BLNA 2X4UB 1T4KA 5E70A 1FAIL 5C0GA 3KJ4B 3MRGB 1TITA 4OB5H 3BZ4B 2VB5A 2VYRE 3VGBA 3E6HA 2X1WL 3PHOB 3GJFK 2VDRH 3TIDA 1HHJB 1GGBH 5C09D 3RWIB 4BZ1H 2AK4D 3VXSB 2UWEE 1HN1A 3CXDH 3FO1B 3V6OC 4RBPK 1UVQA 3C60A 1I9RH 2K7QA 3RWHB 1JGDA 1JE6A 4JM2D 1KJ3L 1MY7A 1PYWB 3BPNC 1PSKL 5AYQA 1AI1L 1AXTL 5F7NC 2GYSA 5DVNA 2DWDA 4ZFOL 3DURB 5FK9A 3H6JA 4HFWA 3G5YB 4I18B 4Y16C 5DMIH 3EO0A 4U7KA 5I8KL 4PJHE 4K8RC 2A38A 3L3JA 3CXHK 3S6CA 1DQTA 5B3JE 1NANH 4DUVA 4K23H 3RP1A 3HNSL 3V5DA 4GW5A 1KJ3H 3LRSB 1MJUL 1KIQB 2HT2D 3DO7A 4OZGE 2FEEI 4NFBA 3GSOA 4U1GC 5CJXC 4LLWB 4F37K 2Q1EA 4Y89A 3BPOB 5KVFL 3D85B 5C07A 3ULVF 4KI5E 5E4EC 4GKNB 5HHME 4HPOL 4YDIL 5CCKH 5L8LB 1S3KL 3C8KA 3TGXA 1OW0C 3FFDA 1DFBH 2OQJA 5GSRA 3K2UH 5GS1B 1ZHNA 3MUGA 2JJUA 3DHJA 5B38B 3RWFA 3C9NB 5F9WC 2R1YB 3QIUC 2E5EA 1TNMA 3PQYB 5MP6H 5D2LA 3ULVL 3HPLB 3W0WA 3ARBB 4JDZA 3QEHB 4CVWA 2Y36H 2VLKB 1ZT1B 5T3ZE 1ORSA 5J9PA 1XCTA 1FQ9C 1ZS8A 1QNZH 2APBA 1G7IA 3MRPA 4OQTH 1OAXL 4NBXB 3NA9L 2CDFA 4XAWL 1CGSH 1IARB 1LEGB 2YC1B 5CUSL 4QRRB 1U36A 3FL7A 3IJYB 4MJIB 4Y4HC 5IJVA 4OZIB 1TMCB 1EO7A 5I1KH 1LO2H 4OTXH 4U3HA 2Q86A 3U82B 3U6RA 1OQOA 4MXVF 3FN0L 3VFTB 3HZYB 5C0BA 5LAXA 3LKOB 3TBVA 4FQ1H 5MHSE 3TFKD 1QQDB 3NZ8A 3RPKA 3NAAL 3GSQB 1BFVL 2BFVL 2FR4A 5IHUL 3LN5B 4P4RB 2ORBH 4XH2A 3P4MB 3SE8L 4ESKA 3BP4A 4D9LH 2XTLA 4KKBC 1VGKA 2CK0H 4OZHB 5HD8C 4V1DA 1KB9J 5F7MC 2R2BB 1JV5B 4LL9A 4NM4L 3PL6D 1CFVL 1YC7A 4NN5C 4K3GA 1BIIA 1YPZA 4Q7DA 5IMLA 4LVOB 1QRKA 3IF1B 4OCRL 3E6HB 1Q1JH 3V52H 4HZLB 5DGRA 4UT9L 4WO4C 4L3ED 4XNZB 1KJMA 5FO8B 4LHUD 1Q72H 3PGFL 3QUKA 4DK3A 3AREC 1XIWC 3B9AA 4M1GL 1X5JA 5T1DH 1TZGH 1RZ8A 1IJ9A 4FFYL 1KCRH 5F44A 2CDGB 1K6QL 4G9DB 3MXWH 3W39A 5TF0A 3C09C 1X4ZA 4LLYB 3FFCA 2GSIA 1OSZB 4Q6IA 1F58L 1E4KC 3SDDB 2FO4B 4XBPB 5SWQB 1IBGH 1QSFB 1FPTH 4HIHB 1N3NB 4O9HL 4HUVB 2P8MB 4JG1H 3ARRA 5J1SC 1FVCA 4Q6YA 4Q97A 1BAFL 3KPMA 3GJFA 5IR1B 2IAMD 3ELAT 1N4XH 4PY8I 2G75A 5E5UB 1ZVSA 4PJXE 3PJSB 4PJIB 4GBXB 3OAYH 5JOFB 1IZJA 5A40E 3TO4B 3VA2C 3F7VA 3QFDA 2B7DT 1WUNT 5ACLA 4E41B 4S1SL 2DQCL 5E6IB 4OLWH 1AO7A 3D2UA 2OS7A 5T3XH 1Q9WA 5JIIA 1AGCA 5JHLL 4OM1L 5C2BL 1F00I 2R4SH 3C5SB 1TTFA 2YXFA 4MXWL 3D18A 5EU6D 5HDBE 4J6RL 2CIKB 3R1GH 3DJ9A 4ZO8A 1TZIB 3HMWH 1S9XA 3OB0K 3SGKA 3I02B 4PGBA 1UXSA 3RU8L 1Z9SA 1MJ7H 4CMHC 3H7LA 2EYTA 1DLFL 4IOIA 3OZ9H 5IVXB 4PRDB 4OGXH 2IPTL 5FF6B 2VC2L 1E28A 3ZTNH 3U0TB 3TM6A 3IDNB 3MV9A 3VXOA 4KRMB 1AC6A 4X7EC 4M8QB 3TZVC 1RJZB 2XI9A 4ZFZB 1ZGLM 2CR3A 2F53E 2CIKA 1WV7T 1QFWI 3SEPA 4NRXA 1KTDA 2ESVD 1QLFB 3ARFA 1IKFL 1MRFL 2OTPA 3C5SA 4JO4L 1NJ9A 3VXUB 4O51B 1A21A 1A6PA 5IQ9A 3WNMA 4B50A 4PRPA 1CFSB 3D3VE 1BFOB 3VW3H 1SEQH 1CFQA 5T1MA 5GXBB 3VXUA 5CZKA 4EN3B 5AAWA 3QULB 1UACH 2H26B 4K71B 4UTBL 3HLAA 3MRNB 3CUPA 3H9SD 3KYOB 4LHUG 1J9CT 2NCMA 2F19H 5DEFB 4O00A 4JRYB 4C56A 2L7JA 4LHJB 4P2RD 4FP8L 1AD9A 5LGHH 1E27A 4X5LA 3DYOA 5FB8B 5JPNB 2VDQH 4X7SH 4YFLI 4FQHA 1PKQA 3HNVL 5IVZA 3B5TA 5KJRH 1W72A 4Z7UA 4F57L 5ESAB 1QD0A 1ND0A 3MGAA 3EDJA 5E1HB 4NGHL 4LLVA 4YO0A 3RWGA 1UB5A 4JDTL 2OI9B 1JYVA 3QQ3A 2FX9L 3NCCB 3CNKA 2BOCA 3OAUH 4MXQC 2FECL 3LS5H 5DMKA 4WI4A 3JUZA 1I8KA 1WIOA 4P2QE 1F4WL 1HK6A 1NQBA 2NZIA 5FXCH 5J11B 5B3JF 3ES6B 2Y9RT 4YDKH 4M03A 1JZ3A 3LD8C 1X5AA 2W0FA 5F7KC 4HXAH 3HG1B 2P48B 4KI5C 3F58L 1FNEA 1KB9K 3DUHA 5DJZA 4LK4A 5D2NB 5HI4C 5K9JL 1CLCA 4HIIB 4Z78B 4X7TA 4ZSOB 3KPMB 2IPUG 4H5SA 3MV7A 5DRZB 2JLLA 4OGYL 1P7KB 4R26L 5I30L 1RK1B 4YDJA 4S1DD 3F58H 5FGSA 3PL6C 1JHKL 5FCUH 4AEHH 1S7VB 4JQVC 1U6AH 1WT5A 3G6AA 2QBWA 5D7KD 2R1XA 5ISZB 5IEKB 4NHCH 4B7LA 1URLA 1K8IA 2I60H 4LEOA 1JRHI 3O45A 1G6RH 5IQ7L 1W8OA 5JORA 4JANA 4PP2B 1F3JB 3TIEB 1T1XA 4L3EE 2YN3A 2B1HL 5F9OH 1CE6B 1AQKH 1J88A 4YZFE 4GG6E 4H1LG 3QCTL 4NRZB 4ZO9A 1NUNB 3OPZH 3VG9C 1FN4B 1FGVL 3LN4A 2R1YA 2FATL 5T5NF 5IBUG 3QFJB 4GKZA 1NSNH 4H1LB 2HA1A 1UJ3A 3V4PL 3O8XB 2F5BH 4AYFA 5C0BB 3KPLA 3TO2B 4I48B 1NLDH 3ZHLA 4IRSA 2FO1A 1F4YL 4ZMAT 2GTZA 1HHGB 3V0AC 2CDEB 3NCMA 2DN7A 4C83A 2AGJL 3D1MC 1IFHH 1YNTB 1TTUA 2AV7B 1OW0A 4XP6H 5BRZA 3VFGH 5A3ID 2J12B 1F6AA 3X14A 4NO2B 1XF1A 1KJ2L 1BVZA 2HKFL 3V5HA 2R4RH 5SX5H 1DVFB 1HHHA 5EORH 3W2DL 1J0ZA 3OXSB 2V6HA 2XA8L 5IMOB 4GAFB 4PGZA 4I48A 3T0ED 4E9LA 5J56B 3S3PA 4OD2A 4OUUA 1MHEA 3PWJB 4NQEB 1MHHA 1XCTB 3KPRB 4MJ4A 3P73B 3IFLH 4TNWK 3X13A 1FDLL 1ITBB 4I2XA 3X12B 1OQXA 4ZO7A 4DGIH 1JGDB 4YE4H 4AENA 5FYJH 2AI0H 1U8KA 3IKCA 4HS8H 3FFDB 2QV2A 1F3JA 5DHYA 3C8KB 2NXYB 3FOLA 2A1WL 3VXRE 5HVHB 5C0CB 4G42A 1ADQL 1CXKA 5T33L 1PQZB 2C1OA 5GGVY 4N90D 2VXQH 1JWUA 4FXGA 2AQ1A 4Y19A 1LP9E 2UY6A 3U4BH 4JY4B 2Y5EA 1M7IA 4NZDA 4XC1L 5TH2B 1IM9D 3H42L 1ORQB 3QWRD 1JGUH 5DI8A 5BS0A 4P46B 3T4AB 3MLXH 4GKSA 2A77L 4XX1G 1HNGA 5EN2B 4PJEF 1U2HA 5F7EL 1JPGA 4XC1H 3BAEH 3EO1A 2P5ED 4MCZB 1JWUB 3DTXA 5INCA 5I8EA 3DUUA 2C1PB 3DSNA 4W70A 3HA0A 4E42B 1ZA6B 2LU4A 1CXHA 4EI5C 3KAAA 4A6YH 3L3HA 4J12A 5FOBA 1Z5LB 1GPOL 2DM2A 4FFZL 2Z8SA 2FJHA 5IBLD 2VLRD 5ACZB 3O3BA 4BQ9A 1A9BB 5ITFB 5A1AA 4P5KB 5EZOH 1QPXA 2R23B 1ZLSL 3UPAA 4GG6A 5FGBA 3V79C 3PWUB 4PG9B 4D9RE 1BOYA 3KWWA 4RZCB 4APQB 2IG2H 4Z5RA 2A9NH 5E08H 5L2JA 1MOEA 3P0VL 4NM8L 1ZEAL 4BZYA 5DC0A 4M43L 1MI5A 3QWRA 3ARYA 1CFTA 4WU5A 1NGZA 4UNUA 2M2DA 5CP3A 2UWEA 2YKLH 1UH4A 4C83B 1SVZA 2I9TB 1NFIA 2PO6B 1CE1L 3KYNA 4WENB 4LRIA 1OAKH 2GJ6A 3OJDB 3GNMH 4PD4J 4LLQA 4PBVC 1SEBA 5CP7A 3BIBX 2LTQC 1PG7H 4PRPB 1E6JL 4GW1A 4AL8L 5H35A 1LP9A 1G7JB 3AS2A 3BWAB 4ZAKA 3H9HA 2UV3A 5DFVD 2VXUH 2R2CA 3M17A 5KS9B 1HQ4A 1FSKC 2MKWA 2VR5A 5DJ2A 4KVCL 3GMOB 4KHTH 1A6AB 1OOAA 1L7TH 2ICEB 3GRWA 3K3QA 3CX5J 5AYUL 3WJLA 3QPXH 4HIJA 4R3SB 3U0TA 4UV7L 4UUJA 3NFNA 3IRPX 4XPAL 4YFLF 5HHPB 4J4PC 4BSWB 2VL5B 4FQQA 4JO1L 3WIFA 1EGJL 1TETL 1PZ5B 1Z6JT 3VXTB 1WBZB 4GQPH 4FQJH 1GGIH 4O58H 4KQ4H 5E5RB 4X99A 1NEZG 1WWAX 1O7VA 1MWAL 3ALPA 1D5MB 3FB8A 4XPAH 4QHLB 3TH3T 4HDIB 5IROC 3UPRB 1I3GH 1AC0A 1D6EB 4U1IA 2BMKA 4YGVA 3WJJA 4HKXB 3L3GB 5HDBF 5E6IA 1H8SA 1RZIB 2YD6A 4E5XB 1C5CH 1IGFL 3QRGL 1OY3B 4KVNL 2WBJB 3UYRL 3A6BL 3HG1A 5F71A 1YEEL 3LS4H 5IESL 1RHHB 1FNGA 3KYMB 3S35L 4YIQB 3QIUD 5HDQH 1OGTA 4KUZH 1CDHA 1TENA 1AGEB 4JO2H 1MRCH 2JTDA 3U48A 3BEWB 1AE6H 2UYLA 1LEKB 3B9KA 4M5ZL 5DFVC 4Z77B 4AG4H 1EAJA 2DI9A 3TEUA 3AS0A 3TBYA 5HYJB 2GSGA 4KZEH 2R1WB 1IAIM 4HUWB 3F6LA 1UM6H 5FKAB 4KUZL 1RVFL 1T66D 4LDOB 1AGFB 1ZXQA 1T5XB 3FO2A 3KYAA 4HFUL 3WN5B 2BSRB 4U6VH 3NACH 5DUBA 4PP1C 2H45A 3D0LA 5MERB 4OZIE 3HPJB 3OKEB 2D03L 1RVFH 3HMXH 3VFVA 5KBNC 1BBJB 1BD2D 2GUOA 2VERN 4TRPH 4EIGB 4J3UA 5HHOD 4PJXA 3CUPB 3KYOA 3MRNA 1UCBL 3M17B 5C1MB 3RFZC 3RVXC 2VDOH 4LHUA 3EOTL 3KLDA 4OCWH 4GRLB 3SGKC 4D8PB 2IF7A 3WLBB 1AQDB 2BRRH 5K9QG 4P4RA 5DRNA 5SWSB 2GY5A 4HT1H 2Z93B 3O8XD 5MI0C 4X80H 3EOAA 4OIIH 4LDEB 2XWJA 1XCQB 3QFJD 5I73C 4NC2B 3K80A 2JJTC 1A7QL 1R5IB 5IBLC 5IVNA 4BSVB 3FB7B 5IV2A 1IGTA 3MCG1 4UIKH 1T1ZA 2C3WA 4U1SB 4DN4L 4U1MB 1MPAL 2VH5L 2H8PB 5D7JA 4HT1L 5DO2D 2OL3L 3LY6A 3AM8C 5EC1A 4EKXA 1JHLH 5FO7A 4JR9H 4LASH 1E6OL 3NGBC 4M7JH 1F45A 3BT2H 3RUGE 3SY0B 4YUEL 5FUZL 2NY5L 3KWWB 2Y5TB 4HH9A 3RNKA 5DRWA 5D8JH 1CTNA 5D70H 4ZOAA 3TV3L 3HPLA 4MNQD 1UKSA 3W0WB 3FO9B 4EDXA 3H2WA 2A83B 4U1LA 5IK3B 1A7RL 3VRJB 4CN4A 4AEIL 2XKUA 3LKSB 5FECA 2GJJA 1HCFX 4ONOA 2XPGA 1ZVSB 2HRPH 2IALA 1A9EA 3TBSB 3OGCB 2EYSB 2AJ3B 2D7TL 3FQTA 1BGXH 4WU7A 2HLFD 1QUNA 2RCSL 3GI9H 5GGVL 4R96A 1AKJA 1PKQE 2HRLA 5ERWA 5HHMD 1RU9H 4AEFA 3TNNA 4RMUA 4PJ5E 4QNPE 1A1NA 3GBNL 3SDXB 4LARL 3RDTB 5DJAB 5CJ8A 4KTEH 4Y8AA 2A74A 3GMRA 3MC0A 2LFGA 3N9GL 4G8IA 4P3CL 4PJ9C 3V5DB 3KPQB 5L2KD 2PF6A 1FG2B 4KDWA 4MLIA 4QOKA 5IBTL 5A3IC 2W60A 1AXSA 4JFOA 3TCLB 1I8IA 1YNLL 2EIZB 5DHVB 3AVEA 5EA0L 2OTWA 1XF2A 2Q7NA 4ODTH 1U8MA 3FT2B 3PGDA 2NW2A 3QDGB 3QZWA 2VLRA 5C07D 5HVWA 3FOLB 2DJUA 5EFIA 2KKQA 4WEUD 4HWEH 4GRWE 1CG9A 4HKZA 4U0RB 1ZA6A 1Q9KA 3LSOA 3SDYL 1IMHC 1OTSC 4WVRA 5F96L 4P2RB 1G1YA 3A67L 3IDUA 7FABH 1I8IB 2AEWA 5FM4A 3QG7H 5CJOH 1MEXH 5I17A 3G5ZB 5J57B 2BVEA 1YEDA 4HWEL 3PGCA 4MXQD 2X4UA 2OCFD 4TUOA 1BF2A 3LRHA 4PB0L 3B8YA 4YXHH 1KC5H 3MREB 5DRXA 5B39A 3QCVL 5GJSH 5CUSH 3NCFB 4JM4H 3I3BA 2NY0B 2AJXL 3EJZD 4LFHG 1KCLA 2OJEB 1UH3A 3EDKA 2WIIB 4WW2F 5C08D 1F3DJ 4NDMA 1DE4A 1KPUB 1XGPA 3MYJA 5I8CB 1ZANH 4KHXH 2F8XC 4KGJA 1HQRA 3ARZA 3WNNA 1EDQA 1HDMA 5IM7A 5J9PB 3TZVA 2OI9C 4RFEB 3MJ8A 2VABB 4I2XB 4U49A 3BZDA 3G6JB 4NRZA 1QBLL 3VH8A 4QCIB 5ICXA 5IF0B 2PTTB 3MA9H 2G2RA 3QO1A 1VFAB 1AIFB 1ZHNB 4KK8C 1JPFA 3U30C 1FVEB 3P2TA 3QEGH 4ZPTA 5DRWB 4M6AA 2ZPKL 2DWEB 1NMCB 4G7VL 1A6TA 5D2NE 5I8CA 3P4NA 2YA2A 5ID1B 3NMEA 2GJZA 5MI0B 4OCRH 3W11C 3K8KA 1QYGH 2DLIA 5EC1B 2DLFH 3V5HB 5ETUA 4W6XB 1BQHA 3UC0L 3VFPA 1DQMH 2VJXA 4MVBD 3EGSA 4XMLL 4HC1A 4ZYKA 2HVKA 3T77B 4UU9A 1CZ8H 2OTUA 4UV4L 4R8WH 4Y2DC 1U8PA 4XCFH 3MV8D 4LPTA 2VLRE 2ITDA 3MNVB 1XCQA 3UC0H 3SN6N 5JXED 1Q0XL 1U93B 4X98B 4OF6A 1A3RL 3QPQD 5CSZA 1WZ1L 5IWLA 2WBJD 2VLME 4R8WL 4CGTA 3SGEI 1AQDA 3VXPA 1OB1A 2J8OA 1PDKA 4HC1L 1UENA 1K9TA 3NCBB 4LHUB 3GO1H 3QI9B 1A1OA 2B4CC 2G60L 3TBWB 3UBXB 1FZKA 5EIIA 2E3VA 2W65A 3FN9A 4O2CB 3GSNH 5DO2C 2JELL 1NCUA 2IQAB 4RMVA 5T5NG 3BGMB 5DHVA 4HC1H 3U79A 2QKIA 2K3TA 3P40A 2XZQH 5JZ7D 1QLEL 4N0UE 1VESA 3FRPG 5AWNH 4HG4J 3DO3A 3UTSD 4FTVA 2WBJC 1YN7B 5E5MA 4TQEL 3TO4C 3OHXA 1NFDE 1C08A 3DX8B 4ELKA 4S1QL 1MCRA 1N0LA 3MV9E 2J4WL 4Z8FL 3K8MA 2PCPB 1H3VA 2Y23A 5DMYA 5T5FH 3BYTA 4FQHB 2P7TA 4HS3A 4Y2DD 1EXUA 2CIIB 1M6OA 2ARWA 5L8KB 1R0AL 4ZFFB 4DK6A 4S1QH 4I3RL 3NN8B 2CO6B 3VRJA 2HFEB 5SWSD 1MQKL 4PLKD 2IQ9H 3MLVH 4H0HB 2P5WA 5DT1H 4JFED 4NJ9L 4NCDA 3EAKA 4IRSD 2ZCHH 4YGVB 5E99H 4WFGD 1FE8L 3E3QC 4BQ6A 1EO8L 5C0AB 4QRPB 1S7TA 4K3JH 2HTLC 4DKFH 1FZOA 4RAVA 5J0BA 3ARBD 3L6FB 4HJGA 3PQYD 5I1JH 5C3LD 2GT9A 2FSEB 2CO7B 3HNVH 4Z7UE 3FAWA 4FRWA 4LKCA 1A6VL 1HSBA 2YEZA 3B2VH 1M71A 3QCUL 2FSEA 5DTFB 2Y7QB 3L5WA 4KUCF 1MCFA 4FXKB 4JDTH 1B9ZA 1I4FA 3G5XB 3IT8D 4P4KA 4GKOA 1HEZB 5KG9B 3B83A 1MQ8A 4PV9B 4GMSL 4GQ9L 3RX7A 3EOAB 3OB0H 3I50L 3WO3B 1NAML 3SQOL 4H88L 3BFOA 1ROWA 1NC2A 1YY8A 4CMMA 4WUUB 1D5XA 3QEQA 1S7QB 4NQSB 1F2XK 4TOYH 4APQC 2P5EB 5EPMA 3PJSA 3MUHL 2BVOB 1I1FA 4LCWD 4YPGB 3WKML 4Q9RL 1I8LC 3LEXA 4NQVA 4XC3H 1X5GA 1K2DB 3V4VL 5LVEA 5AZ2H 4NQCB 3QZWG 3EFFA 3VXSD 3IETA 5DDHA 3V0WL 1QFOA 2GSIB 5I6XC 4AEHL 4OLYH 4HBCL 4U4BA 4PRBA 3QO0B 2Q7YB 2J6EA 3O3DB 4CU7A 1DBBH 4RDQG 5E2WL 5I2IB 3PNWA 2BSSA 4N0YL 5FO8A 3SBWC 1UEMA 4YR6B 1SBSH 4XNMA 5FHAL 1FO0B 4IRSC 3V0WH 2AV1A 4MX7A 1TIUA 3QDME 3UYPA 2MKLC 3I6KA 3EUUA 2B1AH 4YNYB 1SY6L 3M45A 4D3CH 1RIHH 1CICD 3BIAX 1ZT7A 5EDXA 1CWVA 3L95B 4ONFH 1IC4H 5EIIB 5JDSA 3ZDYE 5DYOB 3AGVA 1N6QH 3WIHL 1ED3A 1ONQA 2FHBA 2YPLD 3BH9B 3OKMA 4X5XB 3GBMH 1DDHA 2Z31B 3VD7A 3ECBB 2B1AL 1HYSD 2X10A 1G9NH 3T4YA 1EAPA 4MJIE 1H9VA 3TA3C 1SY6H 1QSFA 4X98A 3TT1H 5HGDB 3OR7B 3C08H 3QA3B 2NXYC 2CRYA 3I85A 1N6QL 3B4NA 1NCDH 2PO6D 4U6XB 4R2GB 2ZUWA 1LO3H 3V2AR 2FD6L 1JZ5A 1G9NL 2Z31C 4KK5C 1FVDA 1Q9OA 4LVEA 4PFEA 1IC1A 1WFNA 3LKRA 4FQXB 1ETZA 3W11D 2QHLA 4RCAA 4MGXA 2ZKHH 3JTTB 4J23A 4MDIB 2A6JB 4R3SA 3EYUL 3IF1A 3MNWB 5C0IB 3WKNA 1LO3L 5ID1A 2I27N 4G42B 2ZSVB 2R2HA 3G9VA 4JQIL 4YX2L 4WI9A 3RWCB 1FVEA 5CZXD 3R0NA 1P7HL 2DI8A 5HVGB 3BESR 3H9HB 2Z91A 3J7HA 5BZWB 4XCCL 1IAKA 3QIWD 4FOMA 2DS4A 3I6LE 4Z7VE 1Q94A 4HS6B 1JNLH 1TTGA 3TP4A 1UFUA 3QEUB 4YX2H 2AI0L 4F33B 4AT6B 2RQ8A 3BW9A 3MUGB 1A4KA 3O8XC 3STLB 4OUUB 2APVA 4WI3A 6FABH 4QLRA 3UJTL 3LQMA 2OJEA 4OZIA 5DHXB 2N7BA 4K9EC 4WI8A 4NKDA 1MI5B 5C07B 1UGNA 5B21A 3KLAA 1RFDH 1C1EL 1WZLA 3DV4B 4LLWA 5EUOF 2AJUL 2CDEA 1EPFA 4U6HB 2F5AH 4F7PA 1ZVHA 3LMJH 4M62H 1X3DA 4PB9L 4WV1B 4QHUA 4URTB 1NGYB 3NFSH 4M3JA 4HFWB 1I9RL 1A6WL 4FNLH 2HJFB 3BPCB 4LSUL 3D69B 1DN0B 1KNOA 4LSSL 4XP4L 4ELMA 4NQTA 3ARFD 3WCYA 4MVBC 3RZCD 4XP1H 2HLAA 4XHQA 2CGRH 2E27L 5C92A 1MJJB 4LRNH 3ARDD 4PGCA 4KK9D 4ZS6D 5CGYC 1WCBB 1U3HB 4MA8H 5D7JD 3H3KA 1TVHB 1QEWA 3QUXB 4Z7WE 1UXWA 1E4WH 1U8MB 3FT2A 4LNRB 4LSUH 3SJVD 5HYQA 5T1LD 4KGLA 43CAA 3KPOA 2B5IC 3D39E 4XP1L 3QUXC 4PRHD 1J8HD 2VE6A 1U8QB 2GIYA 2WQRA 1G9MC 2R1XB 4AJ0A 2VAAA 1N59B 2AK1L 2ZOLA 4PJDE 4P9HH 3DO7B 4WEBL 2OL3B 1IGYA 4DW2L 1BQLL 1AI1H 4G8IB 5FYLH 4OF5A 5MEND 3ARBC 4TNVF 3LZFL 1YEDB 3HZVB 2DQUL 4MNGA 1X7QB 2AK1H 1P7KA 4XXDB 4FQCH 1C5DB 1EFXB 2FH6A 4WEBH 3NABH 4Z7VA 3STBA 1BQLH 3BDXA 5C0BD 4X5XA 2VWEE 4S10A 3FONA 1R3JA 3OGCA 1Q9KB 4IRJC 4XP5L 1YA5A 3MACH 3F6IA 4U6YA 2NX5B 4JM2C 3MRBA 1U8HB 1N6UA 3MLSH 4Y1AD 4F9PA 2NX5D 2B2XH 2HJFA 3BPCA 4XNMB 1D6VL 1V3LA 3R4DA 3MLPA 5IB3B 2BSSB 1H15A 2ILLA 5DJCB 5I0DA 1NGQH 2I26N 1FFOB 4KVCH 1EFXD 4JZNA 5D5MF 3RWGB 3T3MF 4G9FD 4F9LC 5DSCB 3VXQA 3FN0H 4ZG1A 1VERA 2Z35A 4QGTA 3SKNA 1D6VH 2ADIA 4PRNA 4KDTA 4PJAF 4NQCA 1B0GB 4GAGH 3VMOA 1BD2B 1AO7E 2CLRB 4P23C 1H3PH 4LCIL 5KVEL 4R96B 1OAXH 2HMIC 2J2ZA 4X4MA 5JZ7C 2OBGA 4U1MA 3P4OB 4L8DA 2X4SA 2QR0A 4OZGA 1IGTB 3FB5B 2AXHA 5EO1A 4HMCA 2CRIA 3KPNB 1FFNA 2RBLA 4PD4K 4DUWA 2ZJSH 2XG5A 4HXBL 1TVBB 2KUTA 3TWCL 1CICB 1KLUA 2A83A 1CFQB 4LCIH 1PGRB 3Q3GB 3ZYIA 1LO2L 5J13C 2XTJD 3WFDH 2X1PA 2CPCA 4KVNH 1KJ2B 4PJHA 2OSLA 1U0QA 4XWOC 3AXLA 5IESH 3X3GH 3ARFB 3O6LL 3RNKB 1A1MB 4ZXBA 4NFDA 4IMKC 1MAKA 3WO4B 3IDJA 4OZ4B 1WSST 1A64A 1TNNA 4D0CA 1UM5L 5IWLC 3L5WB 3MRJB 1RUKL 1OARL 1AE6L 3P9LB 1IQWH 3S5LG 4RMRA 3LKRB 4FQXA 3X3GL 3L3OA 4WW1A 5E7BA 1IKNC 4KZEL 1FPTL 1G7PB 2AJYH 3BQUC 3QG6B 3L6FA 1YECL 4HJGB 1UEYA 4L3EB 4L8SA 1RV6X 1FRGL 4G6AC 1T2XA 1RK0A 2YBRA 4MNQB 3W0WD 1CU4H 5ESQA 5C0ND 1L7IL 5T1DL 3CVIH 3MCLL 1AGEA 3PV6A 2AJYL 4IMLB 4F7EA 3DGCR 4X7TB 4ZSOA 3QIBC 3MRLB 1DUYB 5C09E 3WN5C 2GK0A 4MWFB 1KBGH 5D2NA 2H3NB 5T3XL 5JOFA 5KSBA 4HV8A 2DLEA 5JHLH 2R4SL 3GRWL 2G75B 1FNAA 3GK8H 3FT4A 3GJEA 3U4EA 4O9HH 4PGEA 1MCBA 5HYSA 5BCAA 2EDQA 4OLVH 3VGAC 2F74B 3MPCA 3D0LB 3QUML 3VXUD 5K59F 4WTZA 4UIMB 4K7FA 3SDDA 1T0MA 3V0VA 1OSZA 1IC7L 1QBMH 4PRPD 3FQRA 4RX4A 4K3DL 1WIPA 1MCHA 4QRRD 5HHVH 5ID0B 1CLZL 2VISA 3V7AG 5C6TL 2HKHL 3BSZH 4XVUD 3WXVL 1CF8L 5FM5O 4D2NA 1OLZA 1UWGH 1WK0A 2QQKH 3T2QA 1C12A 2G5BB 4OV5A 1L4IA 2VLJE 3BD3A 5C0DA 5F7LB 5FDWB 3AAZA 3BGFB 4PJEB 5JUEL 4J6RH 5BVPL 3HMWL 1J86A 2NY5H 3VW3L 4C56B 1MJ7L 3EZJB 5J89A 5C0RL 4HAFA 3AUVA 3FFCE 32C2A 2X4TA 4KRPC 5D8JL 4OGXL 1NGWA 1F90H 2HFFB 4XNQB 1INDH 3SKOB 4EDWH 5GRJL 2Z31D 1SJEA 4KK5D 1LP9B 2F19L 1ZGLB 2Z8VC 5JUEH 3TPUA 4IMLA 1HIML 2CLVA 3B2UC 5BVPH 2VXTH 2P4AB 4G6FB 3SPVA 4BUHA 5CS7A 4JN2A 4X6FA 2FIKB 1IKFH 4CW1B 3KVQA 1T22A 5HGAA 3VFOB 4Z7QF 2H6PB 1NFDA 3FT3A 2BP3A 3ARGA 1JNJA 4L3EA 4ZPVB 3IVKA 5D9SA 3N1PC 3D5OF 4CJ1A 4BM7A 2EE9A 1PZ5A 2YPVL 2LU7A 1GXEA 2MMXA 1U8OA 3GBNH 3O3AA 3QIUB 1KEMH 5EUOB 1P53A 4XP9L 3CDGA 4IDJL 3ISWA 2W07A 1NEUA 3IU4L 4HUNB 4KY1H 5IB1B 3EYQC 5HGHA 4P9MH 5F7UA 5I1HH 3S5LB 1MFAL 5CBAA 2AEQH 5BV7C 1KT2A 1KG0A 3DNKA 1FJ1B 1QFPA 1KCSH 3P77A 5D96C 4YHYB 4UB0H 5C70A 2VLKA 2QADB 4F57H 1YNLH 1F11B 2ZUVA 5SX4H 4RRPG 2PXYA 3UTSA 4CDGC 4IDJH 5I1GH 1KSRA 3UDWC 5IB4A 2EDWA 5EBWA 4N1HB 5DA0B 1LD9B 3TN0B 4KC3B 1RJYA 3FQUA 5GGQH 2IH1A 3OJDA 5IVXF 1IC5L 5FYKU 4IS6A 4R97C 5SWZA 3ME0A 4HMDA 4IHOA 1FAKT 1JHKH 1DE4B 4LOUD 4LLUA 3BIKA 4PJGF 4HX1A 4I3SL 3U1SL 1JJUA 2PR4H 3ET9F 4YHKL 3HZVA 5FAAA 1CD8A 5MENA 3RZCC 1FL5B 2MQ3A 2NNAA 3CDYA 5B39B 3ZSTA 4G9DA 1YN6B 1CD9B 1VEPA 1MFDL 3GI8L 3VXRA 5BO1H 3T08A 3GIVB 1LO0L 4V2BA 4ODXB 1T7ZA 3U7WH 2Y6SD 5FA3A 1KJMB 2WW8A 5BQ7B 4PRPE 4PJ9B 4YK4C 5F97E 3WFHA 5JHDA 2R15A 3UAJD 4O2EA 1KOAA 3SE3C 2FJHB 1ZANL 3OPZL 4KHXL 2GK2A 2XWTA 1H5BA 3VFMA 1HH9B 3NPZB 3V4PH 3U7WL 1VGKB 4OZHA 1Z9OA 5HI4D 4JFEB 1JGLL 2VLKD 3PP4L 3HUJF 3BP4B 2D9QB 1OCWH 3P11H 4L8BB 4LVHB 4NKIL 4DTGL 3T0EA 1CDYA 4ZUWB 1DN0A 3O6FD 2XACC 1OHQA 1RUPL 5C08B 1KFAL 3MA9L 5D6DA 5BVJA 4WUUE 5BQ7A 4Y4FB 5FA3B 5BOZG 1KJ2H 3X3FH 4APQD 4LU5H 3WXWL 5F21B 1WGOA 3PWJA 3BJ91 4OLXH 4MB5A 4U1JB 1CBVL 2W9LA 2B1HH 5CEZD 3LKOA 3CX5K 4DTGH 3DBXB 3RGHA 1A6ZB 2NY5C 1AQKL 4ZAKD 4QHNA 3U6RB 3RAJL 4ODWB 4LIQE 3MV7E 2HVKB 4KROB 5L2KA 1FGVH 4DVBB 1EV2E 5F6HI 2CMRH 1NSNL 2JK5A 5J7CC 1AKJB 5JOPE 4IIQB 1F4YH 1RUAH 3ZKMC 1G9ML 5A2JH 5C0CA 2J7LA 1FNSH 4KJYB 2HH0L 4M7LH 3BQUD 2W9EH 3DLQR 1XF3B 2DLTA 3EJJX 1AIFA 1QSFE 3NH7H 3RJDA 1MJJA 4U1LB 5IK3A 1W2KT 3QEHA 2AABH 1KNOB 4XVSH 1XT5A 1D5BB 5D7LA 5F1NB 3X13B 3GSVA 5I73B 5JW3L 2HH0H 1INEH 5ELIA 1HDMB 2FJGB 4MB3A 2EDLA 4MAUH 1T89C 4OD2B 1ZOXA 3BX7C 3BKJL 2PXYD 4Z7WF 1IEBB 1ZA3A 1S78D 5ESVB 1RZKC 1D7FA 3QXVA 1S8DA 2ADJB 3OXSA 4P49A 4MJ6A 1R5WA 4IJ3C 3KLAB 5I75C 4YE4L 1FL6B 3QIUA 4ZOBA 2XTJC 3QUZD 4PJBF 4YPJA 3LEVH 2VZTA 3DHMA 5BRZB 1U2CA 2E6QA 2A1WH 1JCKA 5E95B 1A6ZA 1QSEA 1EHLL 5I9QB 5I74C 4JY6A 1J1OH 3G5YA 3H42H 4HKJB 4I18A 2R69H 3LN4B 3KPRD 5D5MA 1P84K 2GAZA 3ECBA 3E1F1 3T0EB 1OT2A 1E4XI 4WGWB 1OP3H 4HQQL 3TPKA 2ZUQC 1MCNA 1YEGL 4JQXA 4XZUA 5F7EH 3FO1A 5DEZA 4XCEB 1A4JA 3VI3E 4PJXB 3Q6FA 2HWZL 2EYRA 2ATKB 5JR1L 4EI6A 4NJ9H 3LPFA 4G9FB 4PRIB 2ZCHL 3DGGB 5FGRA 4G43A 4X0KB 1AXSB 3P30H 5IEHB 1ETZB 2G5BA 2HLFC 5EBMA 4HIEB 5I1DA 4ODVL 3QQ3B 1JL8A 5I18L 4JRXD 5ITBH 3UTZB 1HE7A 1RZJH 2FEEL 3Q1SH 4LPWA 4YHYC 2YKLL 4PRBB 4UINH 4NN6B 1NCWL 5B8CC 3BRDA 4LLVB 2O61A 3G6JF 3R0MA 2BVTA 4Q0XL 1PZUB 3C6SB 5HHQA 3H9SA 1A6VH 1S7SA 1A1NB 3QCUH 1U95A 3RRQA 2MWCA 2V2WB 3S36L 4CBPA 5IFHH 1B4RA 2GY7B 4FQLL 4PJGA 2JB6B 5KW9L 4LLUB 3WFZA 3O0RL 1RZKL 2I25N 4PGEB 3FMGL 4ENED 3OSKA 2GHWB 1S7UB 5IB2B 1QR1B 4OAWA 3BDYL 5DEFA 2IEPA 2YOCA 2ZOKB 4F7TA 1TVDA 4P59H 1SVCP 5E2UH 3NFPA 4WY7H 4OFYD 4CMMB 1I1AB 4AK1A 3V6OE 5FKPB 3ZE1F 4JKPL 3IXTB 3D25B 4OKDA 5D2LE 3GM0A 3PNWB 3U4AA 3QDGD 4JFYA 2BNRE 1NC4A 3BXNB 5DFTA 5GGSB 4O02H 1INQB 4F15B 2UZIH 4HIXH 4JN1H 4EJ1C 4YO0B 1BP3B 4Z7WB 1RJZA 4ZFZA 4GBXD 3U0PB 4YHOH 5INDA 1E28B 1HKFA 4U6TA 3NFNB 4Z7QE 3BP6A 1FNHA 2I5YH 3QDGE 3HG1D 3MRJA 4HHAB 3VU2A 4OZFA 5ENWB 1VFOA 1FGNL 2NY7H 3L3KA 3U2SB 3GSNA 1P4IL 1DQLH 1TZIA 5IV2B 3HNTH 2BVOA 1ZMYA 4M00A 2O26U 3LV3A 5CILH 2D7OA 3IFNH 2P5EA 2A73B 5EPMB 4DGYL 5JIHA 3MR9A 3OAZK 5C0AA 5F1IA 5C9KA 2I5YL 5T1MB 5GISH 4M6ML 1B88A 3KPSA 4LAQL 2D7QA 3BI9X 4JY5H 1AFVH 3TO4A 1NBYB 3HZKB 3M1BA 2XY1A 2D7NA 3ZE0E 3LPGA 1QLFA 1LO4H 4GRWF 3RI5F 2DIAA 3CFJA 2V2XB 4I3GA 4YHLH 3REWB 4M6MH 4P23A 3MLZL 1NL0L 1BBJA 1FYHB 2W9DH 3DVGA 3WD5H 1L6ZA 4GS7C 5JW5B 3AS1A 3EJYC 2H2SC 4UDUB 3WE6A 5C0JB 1IAIL 2CKNA 1Z0NA 2OK0L 4W68A 3GMPB 4LSPH 3TVMC 3H9SB 3QSKB 3PWLA 4XNUL 4GAJL 1N64H 1HXYB 4DCQB 2E9BA 2WINA 3JTSA 3VG9B 5K9QI 2XZCL 3WD5L 1INQA 4HUWA 1YJDL 4PJBB 4HCRH 4G6ML 4RAVB 2XNAB 1C16B 2XQBL 2XN9A 4HIEA 4M5ZH 2QL1A 4WWKA 4LKXB 1FZJA 3PWPE 3RVUC 1D9KC 3MRMB 5D93C 3A6CH 3SGDH 1NDMA 3QQ9D 1AO7B 3IDXL 1DQDH 3IU3B 4WI7A 1UWEH 5GRVK 4JDVB 2O5ZL 4HGWA 4R4ND 4FQXD 3TVMD 4DZ8B 3C2AL 3QXTA 4QRUB 1P6FA 1KXQE 4M1DL 3TYFA 4K07A 4L4TA 5FM5M 3P4MA 3S88L 3DTXB 3E6FA 5INCB 1BJ1H 4KI5F 2X05A 2APTA 1FSKB 2BY0A 1MFCL 3BD4A 5CHNB 5GRUH 5LXGL 2YBRB 4MNQA 5KN5A 2J6EL 1EO5A 3C5JB 2VDRL 1ULVA 2AP2A 4OSUL 1E6OH 2E9WA 4UILH 5GJTH 4YHIA 2C4XA 2YPLB 1K4DA 3QUKB 1MFCH 4W4OA 1DBMH 3MUZ1 3QEQD 1HZHH 3CVHA 3QNXA 1BQHB 3DXAB 1C1EH 3BN3B 1MFBL 3GMLA 3L5XL 1DANT 3KPOB 2E8YA 4JRXE 5E9DB 1I9JL 4ZFOB 3VXME 1P2CA 1X5FA 2NXZC 5T1KB 2ZCLL 3KXFA 5JQHC 2OL3H 4OCSL 4QOKD 1A1OB 4G5ZL 3S34H 1JWSB 2BK8A 2W0KA 5A16B 3K4AA 4ALAH 2R39A 4PJHB 2WV3A 3VDAA 1BGXL 4M7JL 3R8BB 4WIQA 2Z0BA 1WAAA 3P73A 2WZPD 3GMNA 3OKNB 2D4FA 4G5ZH 3S34L 2RB8A 1HQRB 1M05A 3JWDC 5KSAC 1KJVB 1QLRA 4JM2B 2AXFA 3N9GH 3LOWA 4IIQA 3MUY1 4PREB 1DVFA 3EGSB 4TUJB 4YEFA 1JPTL 2X4NB 2GTWB 1BD2A 2VOTA 4J1UB 1IM9B 5L9DH 3O6KH 1BOGA 2FZ3A 4PRNB 2DBJA 1CN4A 1R5WB 2VUOA 4P9HL 1LDPL 3T0BA 3TT3L 4WUUD 1HHIB 5F9WB 1KPRB 5J06A 5J1AB 3AY4C 15C8H 1OPGL 4WO4A 1A6TB 4TSBL 2Y36L 3PQYE 4JZNB 4JKMA 1ZS8B 3HFML 4XVJH 1F6FB 2VLKE 5IB5B 4NQDE 4TTDC 2H2PC 4Y1AE 5TDOB 3UJIL 3RTQA 5DJDA 3TT3H 1Q94B 4HS6A 4LSRL 3V7AE 4YDIH 2YWZA 2AEIT 3MJ8B 1L9MA 2D2OA 3VFWB 2QQNH 3AU1A 1QRND 3TZVB 4TPRH 3BPOC 2WQ8A 3MOAH 1DFBL 3WS3A 1RIVL 2OQJB 3SE4C 4PB0H 2WP3O 2BVUA 5H8DA 3QIWA 4HPYL 3UJIH 3L5IA 3C8DA 3TF7C 4LEOB 1CT8B 1Z3GL 4QGYA 4EXKA 5HVHC 4XXDA 4JFOB 3TCLA 3CFBA 4Z0BL 5ADOL 5MENE 2X5PA 5KS9E 1EMTL 4IRZL 1NAMB 3LQAL 2E6PA 4NZUL 3RL2B 3VCLB 2P8LB 5JO5A 3NA9H 3CFKA 3LKPA 4TVPE 2GQHA 4MXVE 3WNKA 4NSKA 5IMMA 4HK3J 4FZ8H 1QVOA 1XZ0A 2ZOLB 2IH3A 2A6IA 1OP5K 2YR3A 2UWEF 3EO0B 2PKDA 4Y4FA 4N0RA 4X4ME 5FGCB 3D39D 1H3PL 5KVEH 1GGCH 2IJ0C 4ZQKA 1JIBA 2YD3A 4TYUA 4YBLB 1EFQA 1Q1JL 2Z9TA 2EH7H 5DJXB 1OVZA 5TJWK 4IHOB 4HXBH 1MAMH 2AJXH 3BYYA 3LKSA 4YHML 1GOGA 1CCZA 4MJ2A 4C4KO 2YUVA 4N8CL 1VSCA 3O2WH 1LHZA 1K6QH 4YFDB 1CLYL 2AJSL 3C09B 3UTSB 5FYKD 5IT2H 4DUXA 4S11A 2EH7L 5DR5H 2VZSA 1T3FB 1FZJB 3UBXI 2WK2A 2EE3A 2Q8AL 3IDYC 4YHZH 1G7LA 1NMAH 1UB5B 4WO4B 3ROOB 3JV4B 2EDOA 1Z9LA 2GW5A 1NGPH 4OFIA 1KCVH 5EUOA 3FQXB 5DR5L 2F58H 4GRMA 4YWGL 4GG8A 4D0DA 3F5WA 2R0ZL 4NO2A 3EHBC 4XPHL 4XPBH 2V17H 4PJ8B 3B8SA 3LQAC 2DQHL 4FTVD 3WFCL 4L4VB 4OZHE 4DVRH 4PG2C 4FQ2L 1XMWA 3CFJB 1X5ZA 3UO1L 2J3SA 1F58H 3GO1L 2ICWB 5EO9A 3FQUB 1FIGL 4GKZB 2EDHA 1ZK9A 4XMLH 4JN2B 1D9KB 1T5WA 3CVIL 2V17L 4WUUA 5D93B 1BAFH 3FAXA 3MV8B 3VFNA 3TPUB 3OZ9L 1AHWB 1FJ1A 5JA8B 2FL5A 1FC1A 4Q9QL 5IVXE 1F5WA 3TIEA 2VLJD 4Y2DA 4JPIB 3TNMA 4XMPL 1J0KA 3HI6L 2JKXA 1Y0LA 2QTEA 3M07A 1S9WA 5C08E 5DD0L 4JHAH 5EO0A 3WN5A 2YZ8A 2G60H 4MXWH 4Y19E 1U8OB 4K3DH 3G9AB 2R0LL 4NC1C 4HEME 5E1AA 4P5MA 3VGEA 1UXSB 4OD3L 4ZAKC 3SKMA 3VXUE 4WWID 4CU8A 1Y6MR 4GOSA 5J11C 4YAQA 1DLFH 2H6PA 3BXNA 4Y5VB 1R0AH 1UWGL 1R3HB 5D7LD 2ARJB 2HYMA 3HZMB 5T3XE 2XV6B 4J2XA 1DJSA 2YN5A 4KJWD 4H0GA 1R3IL 4L29B 1DDHB 1GC1C 5C0EB 2QQLH 5DQJB 1UA6L 5E99L 4YIQA 2OR7A 4KKCC 5KJRL 3MBEC 3ARXA 1MF2H 1MIEL 4O4YL 4R4FL 5BZDA 2NY0D 2BNQB 4ZFFA 5TE7H 2H2PD 5GGTL 2XWBB 3U36A 4JDVA 3VE0A 2VXTL 5I76A 1BZ9A 2A9ML 2JB6A 4A6YA 1SEQL 1L6XA 3NIDF 2NYYD 5I16A 1UA6H 3B6SB 2W1NA 3FJTA 2XN9B 3SBWA 4Z7VF 2GEEA 4I3RH 4JFPB 5TE7L 5HGBB 3KJ6H 1K5NA 2BCKA 1HXMA 5IHLB 3LQZB 5DD3L 1FNFA 1VKXB 4X6CA 2X4RA 1TJHL 2PN5A 4KWUA 1KEML 3RKPA 5KOMC 2FX8L 3ULSA 5CKAA 4HZLA 2VDKL 1C7SA 1KIUA 3VA6A 1BZ9B 3IU4H 4LGSB 3P0YH 1YNKL 1P69B 4YPGA 5I1HL 1OTUC 3RUGB 4R7DA 1VENA 1HQ4B 4LP4A 2OYPA 4HV8B 1FZKB 4KTDH 1WFTA 1T1WA 2BVQA 4NO0B 2CKBB 1XR9A 1IRAY 1S7RA 4LSQH 3W9EA 4ODSH 3Q6GL 2VDKH 2IAMB 4GW1B 3HC4H 4XH2B 4YDKL 3RVWC 5ILTL 4NUGL 4OIBA 4IOFD 1D9KA 1RUQL 1T5WB 4CVXB 2X4QA 5EO9B 1HI6B 4F8TA 1MCDA 2H32A 2A73A 3FB8B 1V7NL 4NRXB 1NAMH 3SQOH 5IUSA 4P4KB 3HZYA 4JFHE 4MS8D 3VFTA 3T3ME 4OLYL 4QYOB 5ILTH 2ICWI 4PJCA 2ZUYA 4R26H 3HE7D 4FQQB 1NCBL 3PDDA 4UUJB 4MQSB 4NC1E 3QCTH 2M26A 4QXGH 2ITCA 3RWDA 4ZXBB 5FA4A 4XC3L 4PG9A 2X6MA 1JZ4A 1AGCB 3N1FC 3QFJE 2HFTA 5H35B 4WDIB 1BVLA 1CDBA 4R6UA 1D5BA 4YHPA 5B3NA 5GGRY 4M5YL 3MGTA 3MRRB 2VDNH 4EN3D 2Z8RA 3IDMA 3TT1L 1NKRA 4MQ7B 3AREB 1ERNA 1QSZA 3C08L 4GBXA 1J1PH 1FBIL 3VXMD 4JFZL 3RKDC 3DROA 2XTJE 3S35X 2ERJC 3IDGB 3VRLE 3VFRA 3CMOL 5HPOA 3SCMD 1V05A 4MCZA 2NLJA 4XBGA 5D1QC 3QEQE 3O6ML 4NWTH 2FHCA 1ACYH 1KIPB 3NOIA 4XHJD 3DMMD 4KQ3L 5TFSH 3GDBA 4ONFL 4LQFL 3DVNB 2DICA 2FDBP 1TLKA 3DMMB 3Q5OA 4PBWD 3D9AH 5AG9A 4R90L 2DIBA 3L9RA 1YN7A 3RVTC 2VIRA 5DVMA 5GRZA 2DIJA 3S4SA 3RY4A 3DX7A 1BBDL 2P8LA 3KPSE 3QIBA 4GG6B 1ZTXL 3UDWA 2HKFH 4RGMC 5CEZE 3F62A 4KQ3H 2R4RL 1P7QB 4EUPG 1FORH 4JZJC 4G6JL 4KPHH 3VFSA 2R29L 3BPLC 5JW4R 1YYML 3O9WB 1QOKA 1BBDH 2IANB 5MEOB 2MHAB 4Y4HB 4IIQC 1CG9B 4HKZB 4PY7A 1JMZA 1MUJA 2DTSA 1JGUL 4HEPG 4X6BB 5DJXA 2HAZA 5D7LE 1IGCL 1FFPA 2A77H 4R0LA 2EIZA 4OQTA 4I2XE 4HUUA 4U1HA 1UCTA 3EO1B 2VXSH 3H3PL 1INEL 4WNQB 3CD4A 5F9DC 4JY6B 4ODXA 3BUYB 3RTQD 3UTTB 4ETQB 4V2CB 5F70A 1XZ0B 1IGYB 1YN6A 3WHE0 4MNHA 4L9DA 4I8DA 1BQHG 1A7PL 3SDDD 1N59A 5TH2A 3VMPA 1S9VA 2H1PH 4GO6B 4JY4A 3SKJL 2VQTA 4FFZH 4JFXA 4TUKL 3V6BR 4OB5L 4PREA 1MAJA 3QDJB 4XP4H 3RWJA 2EIDA 2CDFB 1LMKA 4HW6A 1U8LB 4BZ1L 5IW6A 2PTVA 1V5JA 3O4LA 3IKCB 1BX2A 2IH1B 3D0VB 3OXRA 3S96B 1KIRA 3JZ7A 3PDOA 3TBTA 3FRUA 5DWUL 3ARBA 5JW4M 2F5AL 4QTHA 3S96A 1T21A 2IPUK 1LP9F 1YPZE 1XF3A 3DUSA 3K46A 2VQUA 3G5VB 1KT2B 1AR1D 3NIGE 4HKBA 5L7XL 4PRAA 1T1XB 1MHEB 2J5LB 3EYOB 4MMZC 3O2VL 3MQIA 1OAQH 4NDMB 2ERJB 3RZWA 4GKNA 3T2OA 2Q76A 3H0TA 3WUWB 2FZ3B 4OLEA 2MPAL 4FMFA 4PJEE 2JK5B 3PUCA 5KVFH 4ONHB 3VXMA 1JF5A 1QACA 5F8RC 3OG4B 1M7DB 4KXZI 3Q1SL 1RZJL 3C6LC 3HB3D 4R97B 3DX9B 3FCTB 5DJYA 2A9NL 4PJ7F 1JPSH 4MJID 4BSVA 3HCVA 1ZLUH 2Y25A 1CGXA 3WEXA 2OJZH 1U42A 2YPLE 4L9LB 4LCCB 4QXTB 4C54A 1TCRA 4KMTH 3L7EB 4R0LB 3WSQH 3C5ZA 3I84A 2VWEC 3EHBD 1T7VA 2JCCF 4XTRD 1FFPB 1KV3A 1NUFA 2WWKT 4JRXB 4L4TB 5HI5D 1S7RB 5CMAB 3W9EB 1W8NA 5CEXB 5CGYD 2BNUB 3CLEL 1KACB 4G80B 1T1WB 3S3SA 2APFA 1UC6A 1MRDL 3ABZA 3LZFH 3IDIA 1LE9B 3DRQA 4HLZH 3FZUD 2IANA 3I6LD 2R2EA 2NW2B 3QDGA 3QZWB 4KMTL 4WY7L 4CADA 3MLRH 3UBXG 1Z9MA 5JHDB 4L8SC 2EKSA 4KV5E 3HAEA 4BQCA 3BZ4A 3ULSB 3C6LA 5JPMB 2DQFB 3MOQA 4PJ9A 5GPRA 3MNZB 1TQCB 2P5EE 1WLHA 2EE6A 3NA4A 5C0AE 1MHCA 1S5IL 5I1KL 3EO9H 3MYZA 3ZE2E 2FYYA 2B2XL 5HGBA 2F15A 3SDAC 4QRRE 1W72B 4Z7UB 4YDJB 1YEEH 3NGBB 3NAAH 3KLHC 4K7FB 3UZVB 3B9KC 1BFVH 4UIMA 5HDQL 1A3LL 1NGQL 4UI2A 2NZ9D 3OL2A 1FGNH 5ECJE 1WQVT 3VI4F 1CL7H 4KAQL 5DMGC 3Q5YA 4GJTB 4X6EB 1YEKL 2EZ0D 3PXJA 1I1FB 1J5OL 1JGVH 3SDCB 2RHEA 1AY1H 2XPGB 5HYSG 3L95A 3G08A 1QG3A 1A3LH 2OX5A 4HUMB 4RGMB 5GISL 2FBJL 3K1DA 3C87A 3OKKB 1ES0A 2RIKA 3DETD 2VITB 4KKAC 3ZL4H 3QXAB 4MD4A 5CBEB 1YEIL 2PXYB 5MEPA 3QHZL 4OCYL 4H1LH 2X9WA 2EDDA 5I71B 1BZ7B 1AY1L 4LKXA 4B7IA 4MDJA 2BERA 3LS4L 2ZJSL 2DQTL 3TLRA 3MLZH 4YAQB 4HWBH 2W91A 3T65A 5J6GA 5DD6A 5IFAL 3CDGB 5DTFA 4XXCA 8FABB 5D6CA 1SJHA 3OBAA 4S1RL 1UZ6F 2ZZUT 1CIUA 3MBEB 1HSBB 4LSPL 3RVWD 5HHPA 2EDJA 2EEDA 1ZT4B 1P4BL 1Q0YH 1IAOB 4KV5F 3HTLX 4XHJC 5BJTB 2YA0A 4HWBL 2XXMB 4M02A 4XMKL 5F1OB 1T1YA 1XGTA 1UM5H 2DDQL 1AKJD 2EDXA 1MVUA 2PW2B 2LV4A 1FZOB 1A7NL 2DKSA 3VG0L 4OCXL 2V7HA 1EUUA 4Z0XB 1BFOA 5IW3A 4DFIA 3KR3H 3BDBA 2DQCH 4Z9KB 1YECH 4XAKD 2EZ0C 4NCC1 1U3JA 1B2WH 2BNQD 3PXHA 3BUTA 4I1NB 4W4OC 5A2IH 3G08B 1W0YT 2VDOL 2VXVH 2PW2A 3DVIA 4FS0A 3RUGA 4X8XA 3O6FB 4NNYB 5IR1A 5JOPD 1EXUB 4FXKA 3MCLH 5ENWA 3OB8A 4M8QA 2AJZB 1DCLA 1N3NA 4HUVA 3PIQA 5JA9A 3UTSE 3CDCA 5LXGH 1BQSA 2VZVA 2B0SH 4L4TD 4KUCD 4WW2B 1IGIL 3WO4C 3TA3A 3GK8L 4YXLL 5L0QB 3DWTA 4WJ5A 1I3RA 2DKUA 4O2FA 1G7LB 1TCMA 4N9OB 1NC4B 5GGSA 4U0QB 1I7TB 2IAMC 1S7TB 4JFYB 4YQXL 2UY7A 2HRPL 1F90L 4NQUA 4HSQA 2D7TH 5GRJH 4X0KA 1MH5A 3JWOC 2APXA 1S7XA 4WI2A 5CD5C 3D87B 1KEGL 2HKHH 1RU9L 4OQ1A 3U46A 4PTUA 4YBQD 2R2BA 4JG0L 3NN8A 2QQKL 3ZTJG 3GB7B 3VRLF 2GK0B 4OFDA 3MBED 3JVGC 5F89B 2FBOJ 4F7EB 4PJAB 3IDYB 1EJOH 4QXTA 4AEIH 1U95B 2IGFL 2BMKB 4Y5YB 3EW3B 4HWZA 3GSQA 3UPRA 3HE6D 1C08B 3DX8A 4YGAB 3GZKA 1DBKH 3TBVB 3TN0D 4WI5A 1NLBL 4GSDH 2C4FT 1VADB 4KRNA 4Y1AA 4XRCB 2CDGA 4XPGH 1GOHA 4ODTL 1WBZA 2OTUB 1T7WA 3KYKL 5E8OA 5AEAA 3LIZH 4KKCD 4MCYA 4BA8A 1NGXB 4AH2B 3PG2A 3OAUL 1FL6A 1DZBA 3BO8B 1O0VA 4GRWB 4Y19B 1JFQH 1G0XA 5I1GL 3WV0A 1BIIB 1F97A 4J3TA 1A7OH 3GMOA 5CJOL 2NR6C 3QRFM 1FV1B 3KLHD 4XCEA 4YBHA 5IHBA 1WTGT 4PRIE 2X70A 4P2QB 5CMAA 5ICXB 1E4XL 5EOQL 5K9JH 2YSSB 3C5ZB 1WBYA 5LGJB 5F9JB 2BX5A 3RTQB 5I8OL 4NWUL 4LEXH 4OZFH 4JAMA 3JV0A 5GIRA 3KPRA 2QSCL 4X4XB 5JLZA 2VLMD 4UB0L 1E4XH 4S2SA 3UP1A 1KPUA 3HR5B 3VI4E 4P5TA 3NCEB 4J7RA 4ZYKB 1MEXL 2CSPA 4NWUH 1CFTB 4WU5B 3ARTA 4LEXL 4CNIB 3VFPB 3F5WB 5E8EA 4DFHA 3SE3A 4GRMB 2BNRD 1BVKB 3HE7C 2Z35B 1LEGA 4M3KB 3SKNB 4CAGA 1S8DB 3RI5K 1AHWC 5DRXB 4CU6A 4MNHB 4I0PD 1UJ3C 5B4MD 1F8TH 4JM4L 1Y18A 2FHFA 4P3WA 1JZ7A 5HHNB 5D7SL 4Q58C 5CJBA 4CUCA 4M6NH 4KI1A 1ORSB 1GGCL 3QFJA 5I15L 5CWSB 4NIKB 2ESVB 3CVHL 4RRPA 1MLBB 4XI5D 4GXUN 1RPQA 5HSFA 5D2LB 5SV3A 1M4KA 3VD3A 1QFWL 5KAQF 1PW3A 3U7AA 3L3HB 2D31A 3HE7A 1N6VA 3NIDE 1WEJL 2O5YL 4U7MA 3C60D 1G7HA 4MJ5B 2ZCKL 1YEHL 1S7WA 3W82A 5I15H 1T04B 4M93B 3U0WL 1U8LA 1CBVH 4H26B 3MJ7B 1OF2A 2JIXD 3O3EB 1PG7X 2JCCE 2Q87A 2D3VA 2R8SH 2AGJH 2JB5H 4P2OB 5IEKA 5FDYA 3DETC 1CR9H 4KKAD 4PV8A 4QXWA 1ZVYA 3G6AB 3VRIA 2MOVA 4YHIB 4ZNCD 3D3VA 1F4XL 4TULH 4P3DA 3STZB 1HOCA 4N68A 4ODWA 4K7PX 5E6ID 3DBXA 1PBYA 1A7BA 1WISA 2F58L 1G6RB 4GMTL 3VRIB 1EK3A 4ZXBD 1CDUA 5D1ZD 3MRKB 4N1CA 5TQ2H 4BUGA 1U8QA 5I17B 2BC4A 3RKDD 4Y5XB 1G7MB 1CZ8L 2OZ4L 4JPKH 1EEZA 3IGAA 3WHE1 1BEYH 3VFRB 5DUML 1FC2D 3WDHA 1QRNA 3GEWB 5CJ5A 2DQEH 3KPRE 1FIGH 5FECB 3BKJH 5CJXA 1X5KA 3I6KB 2Q20A 4O2EB 3I3DA 5BV7L 5GZOC 2VZOA 1JUFA 2PETA 1MLBA 2CK2A 3CSGA 4ODUA 2LQRA 4I0CC 3QDMD 3ZKSD 4PG2A 2BOCB 4QOKB 2DQEL 4W81A 1LK2B 4MZ3A 3LEVL 4QT5B 5JW4N 3VXRB 1GZQB 2AEPH 2JELH 2PYEA 1DL7H 4ZUSB 1SQ2N 3B9VA 3PWPB 3TA3B 2PYFB 2XY2A 5DD0H 4WUKL 4ZUUA 5L6YL 3F12B 3V4UL 2RGSA 4UDUA 5E94B 4NN7B 3CSPA 1BJ1J 4MAUL 1CDJA 3T2PA 2P5WE 2EXWD 1MQKH 4XBGB 3MLVL 3K1KC 1FLTX 2R9HD 4CL7A 5EUKB 5E8DL 3PHQB 3IVKB 5J6HA 4ZOEA 3BWUC 1A9EB 1OWWA 5CKGA 4RA0C 5JNYA 1YJDC 2A6DA 3DX6A 4Z8FH 5JXEA 4LSVH 4F33A 4CVXA 1ZHLA 4GXVL 3RY5A 1R3IH 5EBWB 5F9JA 3B3IA 2D9CA 4LVNC 2YSSA 2IAMA 3SDXF 2ATPA 2J8UE 5E6YA 2V7HB 4Z0XA 1SJEB 5E8PB 3QHFL 3HC3L 4FFWC 4P4KC 5F1KC 3WUZA 3RWCA 3IAGC 4F7CB 5ITBL 2R2HB 2GUOB 1AR1C 1I4FB 3RGVA 1CGTA 5KSAD 1AO7D 4PYGA 5KVDH 1IAOA 4LMQE 1VB9A 1J7VR 3L7FB 4G8FB 1A02N 2BSRA 4QRTB 4KI5D 1NGXA 2X40A 4AH2A 5I19H 2AJVH 1T5XA 2APWA 2JCCA 5EU4A 4KKBD 3X11A 4X6CB 1YMME 1KGCE 3V9FA 2BDNH 1VKXA 3O0RH 4G6KL 3FB7A 3WFBL 3N1MC 4GW4A 2DTML 3D18B 2H32B 1QBAA 2P47B 2NTFB 4RSVA 3IXTA 4JFFE 3REVA 4P59L 4A6YB 1WTLA 2CLVB 4F80A 4K2UL 4UINL 3V6FA 3KPPA 4AL8H 3GMQB 4PJCE 3X17A 3FT4B 3GJEB 4DZ8A 4LSTL 4EUPB 1J8HB 3WJLC 2W0FB 1J11A 5DQ9B 3U46B 3KPPB 4HBCH 5E2TH 2UVFA 4L29A 4KHTL 5IP4A 4XCYA 4WEMB 3KS0J 1RUQH 5AYUH 2DL2A 1RY7B 3ORJA 1BMGA 1CI5A 3T2NL 2VLLB 5DHVH 3TJEL 1MCQA 1B0RB 2VDMH 5L88H 1ZWIA 1U8IB 5EULV 3CAFA 2R1WA 2WINB 2DD8L 2IFFL 4L3CB 2NY4B 3V4VH 5EBMB 4FMKA 1JMXA 4DGYH 1A3QA 3FRPA 1ZLVK 1EBAA 1G7QB 1K2DA 1KTRL 5FOJA 5HYSB 3VE0B 2YUWA 1HNFA 5D71L 1C5CL 1OGTB 3ZE1E 1IL1B 3WDJA 5E8NB 3IDIB 4WFHD 4WFFE 2UUDH 4N5UA 4BKLB 4D0BB 5E8PA 5FHAH 5KANG 3E0GA 4ZNEE 2R56L 3UJJH 4R4BB 4JHWH 4RISL 4ISVB 3Q48A 4M5YH <