4WOKA

Crystal structure of udp-glucose 4-epimerase from brucella ovis in complex with nad
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
325
structure length
325
Chain Sequence
ANNVLVVGGAGFIGSHTAKLLAGQGYAPVVYDNLSTGHQSAVRWGDFVEGDILDQARLVETMEKYAPVAVIHFAASAYVGESVEDPAKYYRNNVGGTQSLLDACRLTRTQNVIFSSSCATYGVPSRLPIGEGEAQNPINPYGRTKLIAEHMLADYAVAYGLRYVALRYFNASGADIDGELGEKHDPETHLIPRAMMAAAGRLDVLEVYGDDYETPDGTCIRDYIHVTDLARAHVLAVEHLKEAGGNLAVNLGTGRGTSIREIVQSIGRLTGRSVPVAMRARRAGDPPALYADPALAAEKLGFHTVYSDLDTIIRTAAPHFGLEVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of UDP-glucose 4-epimerase from Brucella ovis in complex with NAD
rcsb
source organism Brucella ovis
molecule tags Isomerase
molecule keywords UDP-glucose 4-epimerase
total genus 117
structure length 325
sequence length 325
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wokA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4wokA02
3ZWYA 4Z9YA 4DPLA 1B14A 1BDBA 4WCFB 4FJ0A 3GRKA 3UCFA 3E9MA 5A3VA 4PG4A 1SNYA 3SJ7A 1W73A 1RPNA 3TZHA 2G5CA 2X9GA 1XYGA 5LC1A 1XWFA 4ALJA 1R4NA 3EAGA 5JAZA 5CDTA 1EEHA 1ZK3A 4YJFA 3AUUA 1DSSG 3WS7A 3N7UA 4LVUA 4J0EA 4O6VA 5F5NA 2GR9A 5BNIA 4XRGA 3ZNQA 4B3HA 4TROA 2IODA 5JO9A 3WGQA 4LN1A 4R3NA 4NZ9A 1E3EA 3UKOA 2NVUB 3DHNA 1KEVA 1NVMB 2Z1MA 3KOUA 3ZWBA 2O3JA 3QWBA 2BI8A 2HMTA 3DMTA 1SOWA 4CMIB 4YQZA 3O4RA 1O6ZA 3U4IA 4OJNA 1M67A 2NV6A 3KYBA 3L6OO 3WWYA 3Q6IA 2R6JA 1GV0A 1N8KA 2I66A 3QVOA 4AJNA 5A9SA 2WEKA 1OOEA 3MOIA 6LDHA 2RH8A 3QRWA 1DHRA 3BMOB 3JQCA 3FTNA 3M1LA 1UZMA 1LDYA 1E7SA 1NAHA 4Z0HO 1BXGB 2YW9A 2Q50A 4B4VA 2VT2A 4RDHA 4BKPA 4URFA 3H9JA 5AXAA 2DTXA 2FWMX 1GV1A 3PWZA 3GG9A 3WBFA 1B16A 2VYVA 3BTUA 4AJKA 5JMWA 2BRUA 2E48A 4MVJF 4NJMB 1YB1A 1Y7TA 1XKQA 2VRCD 2YDYA 1NFFA 4R3WA 2XOXA 3WIEA 5HA5A 4DVJA 4NMHA 1BHSA 2B5VA 3UAGA 3I1JA 1MG5A 1Z7EA 3H5NA 3ADOA 3V2HA 2IE0A 2VTDA 1GD1O 3JQFA 2ZQZA 3MCVA 3JD0A 4CM8B 3LLSA 1PL6A 1HETA 4OSOA 3VPGA 4ALMA 1X13A 3ZZNA 3QIVA 1XQ6A 4RF5A 3RUEA 1KC1A 2OO5A 1E7WA 1PL8A 2X0IA 4DMMA 5DN9A 4E6PA 5ER9A 4YT4A 5A1TA 3NGLA 3V1TC 3WDSA 4D7AA 5I7VA 4GGOA 3GH3A 1NPTO 1QG6A 4FFNA 4H7PA 2PZLA 1ZSYA 4IS2A 3IUPA 3KEQA 3KM0A 3U62A 4FJ2A 3K31A 1SBYA 5KKAA 2VOJA 3AM3A 4UUOA 1DAPA 2BFOA 3UXYA 2W2KB 5FI5A 4RQTA 2JCYA 5C7IO 3VKVA 1T1SA 4CV3A 3SVTA 4W82A 3WYBA 1SPXA 2ZJ0A 5LDHA 3QVSA 4D45A 3D4OA 3FRJA 1DB3A 1V35A 2CMDA 1NR1A 5CP8A 4CV0A 3L6EA 3RBVA 4BB6A 3AI3A 5F5LA 4BNGA 2WYVA 3TNLA 2V6MA 3LVFO 2BFPA 3C1OA 3O26A 3ZV4A 1P1FA 3ENKA 2VZ8A 4LK3A 4GLOA 4CM9A 3W6UA 4INAA 2HLPA 1QV6A 5G4KA 3U5TA 4DRYA 3GK3A 2YQ5A 1D1SA 1OAAA 1GL3A 5K6AA 3MJEA 3UCXA 3WTBA 2NLOA 4XWYA 5G0WA 1L7EA 4H15A 4IZHA 1EK5A 2AE1A 3FR7A 3NTOA 4XQEA 2IYPA 5DBFA 4AICA 2HMUA 1HKUA 2B4RO 4M54A 3TFQA 4CQMA 3Q2KA 4YTEA 3S55A 2C2XA 1JKIA 4IDFA 5CAEA 4G5HA 1SZJG 4IUYA 4IS3A 1VSUA 2PKQP 3BXXA 4ND1A 4RPLA 3PIIA 4JGBA 3RKRA 3ZWMA 4KTTE 1U4SA 4E2ZA 5DCYA 1S7CA 4WLEA 1KY4A 3OP4A 4XIYA 4XCVA 2R00A 4RDIA 4ND4A 2ZB3A 3W4KA 2E37A 5C3MA 3BMQA 4WCFC 4F6CA 2HMVA 3AFNA 3BMCA 3PQFA 5K0ZA 3VDQA 1V0JA 1H5QA 4L9RA 4ZQBA 1ZH8A 1ZO8A 4WEOA 1I33A 2B4QA 1MLDA 4L0QA 1DFIA 2VQ3A 1LQUA 2AEJA 4R5MA 1VJ1A 1ZW1A 3FCOA 1U3VA 3DHEA 4BKUA 3GGOA 2Y66A 1C1XA 3TN7A 1XDWA 2NNLD 3C8MA 4NPCA 2FSVA 1GPDG 4PG5A 4WNCA 4LCJA 3WJAA 2YY7A 5B1YA 3LT2A 4A10A 2CDAA 5AXDA 1I5RA 1EDZA 3QVTA 3ON5A 4DTIA 3KUXA 1Q2XA 1GTMA 2BGKA 1HDZA 4GH5A 4J4BA 1J4AA 1T25A 3WOHA 1DC4A 1PJBA 5L45A 3RSHA 4RVGA 2B69A 4BKOA 2NVUA 3T7CA 1ZSNA 1E6WA 3W8DA 3C85A 1NP3A 3JCZA 4JCOA 4ZU3A 1BDMA 4Q3DA 1WW8A 1E3LA 3A14A 1E5LA 3VKUA 1D3AA 1J0XO 2ZYAA 2NADA 2J3IA 2Y1FA 3PLNA 2VZ9A 4X54A 4R1NA 4OQZA 4E21A 5DCUA 1RJWA 3LT1A 3ASUA 8ADHA 1Y8RB 1YS4A 4LRTB 1YBVA 4W99A 4IDEA 2X0NA 3DMYA 3ITKA 5KJ1A 1EVZA 4BV9A 2W8ZA 1GZ4A 3KETA 5C7LO 3EUWA 5L7TA 4BMVA 1AHHA 4M8SA 1U28A 2PFGA 1ADGA 1HE2A 1UAGA 3AY3A 3DZIA 3JD4A 1G0OA 3O9ZA 5TJHA 3V5NA 5G2OA 1LDNA 2GZ3A 4N54A 3EDMA 1GEEA 1PGPA 4I08A 3NJ8A 2J8ZA 1B15A 1HYEA 3I9JA 1K0UA 3E5RA 3RWBA 1TA4A 4KUHA 1LI4A 1Q0QA 4CR6A 1Q7GA 3S8MA 4Y98A 1U3WA 1OMOA 1TT5A 3I83A 4XQCA 4Z3KA 1Q7CA 1P31A 4HNGA 4K1LA 3PDJA 3QP9A 1Z74A 1JDJA 3UN1A 2VNAA 2XXBA 4FIZA 4ONEA 3DQPA 2EF1A 5KOIA 3PPIA 1XG5A 1L1FA 2C20A 3LC7O 1GEGA 2O2YA 3DTTA 3FTPA 3GMDA 4KQWA 1PQWA 1YQXA 1IHXA 1C1DA 4PLYA 3BTSA 2W90A 3GFGA 5CPBA 4Q39A 4B4WA 3GGGA 1QRRA 1XU9A 1GU7A 4PRKA 3CINA 2RIRA 5A06A 2DBRA 2AQKA 2QW8A 3L07A 4PN3A 1GYRA 1EBUA 1R15A 1DXYA 1ARZA 1XR3A 3ORFA 3JYLA 2CVQA 1U2GA 2X7HA 2Q2QA 2D4AA 2O4UX 5TRTA 4M1QA 2X22A 1TT5B 4OOEA 1HDGO 3VVBA 1HE4A 5L40A 3D3EA 1JWAB 4QQRA 2H1SA 3ZNPA 5MDHA 4R54A 3I9OA 2X0RA 4IMRA 4PZDA 1QYWA 4IIUA 1V8BA 1Y9AA 3PIDA 1G1AA 2UUOA 1JTVA 7MDHA 5ITWA 3E5MA 2Y93A 1B8VA 4N7RA 1UH5A 4GGPA 2FOIA 4I9HA 1XU7A 1NHWA 3FBTA 1FMCA 2Q1TA 3ABIA 3D4PA 3SC4A 2VUTA 4P4GA 2VHWA 4HUJA 1MXHA 1I2CA 5TC4A 1D7OA 3LC2O 3MJCA 3UCEA 3K8ZA 4M86A 2F1KA 5CG2A 4Y6RA 2OP1A 4D43A 1M76A 4FGSA 2Y0DA 1BWSA 3ETGA 5JS6A 1I36A 4FPXA 3KZVA 1SCUA 2E6UX 3GZNA 4K9DA 3NT5A 1U8FO 2Y1GA 3VPHA 1U3UA 1TXGA 3H8VA 4AJPA 1SO8A 3HZZA 1K6XA 3DAPA 4MO2A 2NU6A 2WD8A 3OJ0A 2FPGA 3WSWA 3ENNA 2PH3A 4XJSA 3ZU5A 3DXFA 3C24A 5KTKA 2AQIA 4XRRA 4J6FA 4YJFB 5KVSA 3PFWO 2PGJA 3O38A 1FDSA 3DDNA 2ZTLA 3JYQA 3ZW9A 4XYMA 1KEPA 4JIGA 1B0AA 3NDRA 2EGHA 3H2SA 1T4BA 1R4MA 5EMHA 2YFQA 4L73A 3U4DA 4BNJA 3CMCO 4J90A 4MDHA 1CERA 1PJLA 4IY1A 4YWJA 3TZCA 3TZ6A 1SEPA 1O8CA 3K5PA 4AG3A 1BVUA 3E82A 1X0XA 3HFGA 4OO3A 2YQ4A 1PEDA 1DO8A 5I9NA 4ALNA 4QX6A 4NK5A 1PR9A 2O3UA 2BF7A 1GDHA 3VZRA 5L9AA 1W4ZA 1N2SA 4F6LA 3MWEB 3GDGA 4OKNA 4GWKA 1CJCA 3ROPA 2I99A 3GAZA 1LSUA 3KXDA 2VN8A 2JD2A 2GD1O 2OL4A 2HMSA 4CV1A 4PLFA 3PQEA 1IUKA 4NU6A 1E1KA 1XELA 3D4NA 5JLAA 4DGSA 1KY5A 4HFRA 4MP3A 5EL0A 2Y0CA 4ZQHA 4YT8A 4ID9A 1R4MB 4PVDA 4ZICA 3E18A 4UEKA 5T6BA 1V3TA 4M49A 5EJ2A 3CMMA 4I5GA 4NJOA 1R16A 4BNVA 2PKRA 3OECA 2CVOA 3OJOA 1P3DA 5JBIA 4J16A 4PZEA 5K6AC 1VJTA 2VT3A 5C5IA 1DEHA 1QYCA 5AXCA 1LU9A 2YHUA 4A27A 2IZ0A 3DBVO 3AUSA 3PJEA 2G0TA 3QLJA 4ITUA 3L4BA 2PZKA 4LSMA 1GQQA 3GHHA 3I6IA 4J3FA 5CPFA 4Z3DA 3TZKA 4F3YA 1SB9A 1U5CA 2VHXA 1NASA 1ULUA 5BT9A 1VC2A 3IUSA 4NK4A 3T4XA 3WQSB 5KVVA 1LJ8A 1KVSA 3GHYA 3F5SA 2OMEA 5B4UA 4UAGA 1JKFA 4GQAA 3LF2A 4YAIA 4D0SA 3AY7A 2JJYA 3OEYA 1MG0A 1ZEJA 1WZEA 3PHHA 4RZHA 4JP3A 1VKOA 4JBHA 1N1EA 1UXIA 2GPTA 3KTDA 3BMQB 5IXYA 4W4TA 4E33A 2VOEA 2QYSA 3LZ6A 4Y8VA 3T4EA 5DULA 3TZQA 4CLXA 4YXFA 3EW7A 3JD2A 1HDRA 3R0IA 3G1UA 1JN0A 4JP2A 4JX8A 1YE3A 4IDCA 4B4OA 4J2HA 3WYEA 4UULA 1MC4A 3AM4A 4PLTA 3RC7A 1I3LA 4FFLA 1SC6A 1PTJA 4XQGA 2VYVD 2ZCVA 3RJ9A 4WCDA 4RCVA 2Q2WA 4R9RA 1ZZEA 6ADHA 4CMAA 1DAOA 3OSUA 4MVJD 2PLAA 3UH1A 3MTGA 4DA9A 2PGDA 5B12A 4B7UA 3RBXA 2P9CA 4CMEA 1DC6A 1P0CA 3FN4A 3F5QA 4FR5A 3RU9A 2X4GA 5ICSA 4GI2A 1DFGA 4R9SA 1E7QA 3WSVA 3S2EA 4AJ4A 3MOGA 4I5DA 1E3WA 4NI5A 1NFRA 4YT5A 1QSGA 2B0JA 4J0FA 5FEUA 3ANLA 5C7OO 3JQEA 4WGGA 4HY3A 3AY6A 5CDSA 3D64A 2VYND 5JDCC 4CPDA 1DJNA 4PLPA 1FDVA 2E4AA 2VHVA 3W6ZA 1EE9A 2FPIA 3K2EA 3ROQA 2ZQYA 3VZPA 3A28A 4CLRB 4D0RA 4BKQA 2YHIA 4LGVA 4AJJA 2UDPA 2DBZA 3P2YA 1DHTA 1ZEMA 3DAFA 2Y1EA 2Z5LA 4OYRA 4B3JA 4EUEA 2V7PA 2YJZA 4BVAA 4B3IA 3JQFC 4TRMA 4CM7A 2AE2A 3ICCA 3G79A 4BNMA 1ENOA 1KBZA 3F4LA 2V65A 3OETA 1A72A 4L4SA 1ZIDA 4O5OA 1UXGA 4IDBA 4A03A 3I4FA 2O2SA 1DFHA 3QWHA 1VI2A 3DBLB 3PJFA 4B7XA 4ALLA 3VH2A 1PZHA 4PVCA 3PLRA 4BIIA 4WPGA 2B5WA 3HN2A 4RZIA 3UICA 1E1MA 4LCEA 4E5NA 1RM5A 4U8GA 1PJ3A 3ST7A 4YYZA 2X8LA 4G81A 5L51A 4I5FA 5H81A 1A7KA 3U49A 2ET6A 2DKNA 5ENDA 3GOHA 2SCUA 4TQGA 5G0UA 4CLEA 1PJTA 1LX6A 4MKRA 3AM5A 5DT9A 4DYVA 3FR8A 4FFOA 1YVEI 1VL8A 2C7VA 4Y9DA 5EQDA 3WGHA 4E2WA 1ENYA 3R3SA 3K9QO 3QA9A 4YRDA 3OIGA 4GX0A 1GCUA 1LLCA 4FSHA 3ROKA 3PWKA 2QZ9A 1I2ZA 3VC7A 4OQYA 3QWIA 5A03A 1CETA 1U8XX 2VWHA 4QT0A 4J1NA 5KJEA 4CM8A 2AQHA 1CQJA 3FHLA 2X1HA 3EZLA 1LDEA 3DC2A 5A04A 1P1IA 2W4QA 3EZYA 2NTJA 3Q3CA 2PK3A 2I3GA 3WXBA 4YJDA 1ZCJA 3TJRA 1XLTA 4QO7A 1I0ZA 1LC0A 5IN4A 5TSDA 4NU5A 1UDCA 2WYWA 4XB2A 1LDGA 3C7AA 1ISGA 1NWCA 1VSVA 3DEYX 4R01A 1YB5A 3EYWA 5KNLA 1W6UA 1VL6A 4D3SA 1P74A 3RKUA 3D7LA 1ZBQA 1UXKA 4A7PA 3E6AA 1ZXBA 5JCJA 4EJ0A 2NU9A 2CFCA 4ND2A 1BTOA 5KWEA 1EQ2A 1P1HA 2ZCUA 2FN7A 2NM0A 2HU2A 4R69A 4CLOB 1N9GB 2OP0A 3BZUA 1YXMA 3VPSA 1K6IA 5TX7A 4BGEA 3DONA 3P19A 1JVBA 3ZDFA 3SX2A 2EEZA 3B1KA 1AUPA 2ZTUA 3RFXA 4NQZA 1NNUA 3OQ6A 3I9MA 4MPDA 3ANMA 1NR7A 4PLZA 4XYEA 3ZWAA 1H6BA 4IGFA 2DUWA 3DZGA 2YYYA 4QUKA 4B8WA 1XEAA 1WAMA 3DZBA 3F47A 4ND3A 3INRA 5AXBA 2ZIZA 4RPKA 5I7SA 2AW5A 1H2BA 5G0TA 4CMHA 1BW9A 3HSKA 3QWFA 5JAIA 2J3HA 2GZ1A 2D5CA 3PGJA 1E7RA 3IJPA 4R41A 3OMLA 3RROA 1ZK2A 1NQOA 2LDBA 3E9NA 4RPGA 3L0DA 3I5MA 1T2CA 2XXJA 2E82A 3WG9A 4EI2A 5IN5A 3RVDA 2NVWA 1DOHA 4EZBA 2V6BA 1O9BA 2HK7A 3RIHA 3UW3A 2Q1UA 5B4TA 1SAYA 3N58A 2OBYA 1NVGA 3O8QB 1D1TA 1K2WA 1YB4A 2EW2A 1P9LA 2PD6A 2F00A 4J1QA 2CUKA 3EVNA 3WQRA 1UUFA 1ZJZA 3HN7A 1YJ8A 4IGEA 5ES3A 2HSDA 1HDYA 2I3AA 1CF2O 2C7GA 4NFYA 3Q0EA 1WP4A 2DU8A 1ZFNA 2X9NA 3AUTA 3PYXA 4M55A 3GGPA 5CHEA 2BGLA 2G1UA 5G0SA 3JQ8A 3M2PA 4DYDA 1KEUA 2Q1WA 1ONOA 2PY6A 1HDXA 4LISA 4KUEA 5EIOA 4WLNA 5A02A 4OL9A 5KCZA 3ZV5A 3PTZA 3V8BA 4CMJA 1Y5RA 3QVWA 4CMGA 3HDHA 5TF4A 1T26A 4UUNA 5G4KB 2X9VA 4TSKA 1TB4A 5JAMA 3I9LA 3PHGA 5HBRA 1PGNA 4DC1A 3ONEA 4MKXA 1EVIA 4JROA 4L4RA 1V6AA 1GUFA 2YV3A 1NQ5A 4EEZA 1K89A 1JAYA 4RV9A 4K6FA 3CEAA 1UP6A 2X23A 4RF2A 3ZWOA 4RVUA 1H0KA 3IKVA 3KRTA 4BO2A 3D3WB 3JYOA 4J7CA 2HKIA 4ZRMA 3E48A 1GYPA 3HADA 3RU7A 4AFNA 4KQXA 5JCXA 5JNLA 2EJVA 4OXYA 1A71A 4UEJA 2GCGA 4YRBA 4NFSA 1R0KA 3S2FA 1ZNQO 3MZ0A 3W4JA 2EKPA 5FFFA 3ONDA 5IAAA 3PZBA 4BO6A 3TFOA 3PHIA 2FMUA 4JBGA 4HBGA 1GCOA 4WUVA 3SJUA 3PYLA 5ER6A 1IULA 1P1RA 1ADCA 2AEFA 5TIIA 1ORRA 5A5FA 3H4VA 4U7WA 3SBOA 4BNHA 4DBVO 4TVOA 4BMSA 5ILGA 4I1IA 4Y67A 1C3VA 2IXBA 4NBUA 2QYTA 3DBRB 4R1SA 5DF1A 2DPHA 4ZA2A 1QYDA 4DQUA 5HS4A 3MJTA 4M87A 2Y99A 4WECA 3ZWXA 5DDIP 3RD5A 2OXIA 2P2SA 4EJMA 4YCAA 3TL3A 4WK6A 1QYVA 3OFSA 4NBTA 5U9CA 5DOVA 5FYDA 1UDBA 2HJRA 2X5KO 1XSEA 3L6DA 4IJVA 2VYNA 5MGBA 3VVCA 5JYEA 2D3TA 3LQFA 3NRCA 1KERA 1FDWA 4UEOA 1JWBB 4CM4B 1E0DA 3WGGA 1J5PA 1P1KA 2EP5A 3A1NA 3VH4A 4A26A 1O0SA 5AOVA 1WDKA 3BAZA 4BO1A 2EW8A 4E32A 4NNJA 4XD2A 3RI3A 5CDYA 3S2GA 3DB2A 5JMPA 2A35A 2NACA 4GX2A 4S1VA 5BNFA 1YOVB 1U4OA 3WIDA 1KVUA 1TI7A 5A9RA 1GADO 5F1PA 5IG2A 1FDTA 1ML3A 1GFSA 3H3JA 4HKTA 2FHSA 2CSUA 4AJLA 4E13A 4L4XA 4MOWA 3KSDO 4BUCA 2G17A 3I3OA 2VUUA 1WLYA 2HO5A 1Y8RA 5GMOA 2FR0A 3I9KA 4YJHA 4GL4A 1ZK0A 3IMFA 3RUFA 4CMCA 1I30A 4MVJG 3EY4A 1EQUA 4WLOA 3ICPA 3JQAB 3JD3A 4CM1A 3INGA 2Q49A 3AI2A 3OF2A 3DZKA 4BO0A 2D8AA 3U4CA 4W7HA 4E5KA 2NTNA 4XEHA 2NWQA 2B4TO 3BTOA 3TOZA 2JFHA 3GN2A 3HG7A 2O4CA 3NEPX 5AQ1A 3GNQA 4E2YA 4Z6KA 3GEDA 4O0LA 1GZ6A 1QXSA 1ULSA 4MJLA 1MX3A 2DFVA 1A27A 1DIGA 4HNHA 1F8GA 5KVCA 3GA0A 3CKYA 3B70A 1M66A 3GZ4A 1PJ2A 4WCFA 2WWRA 3ZH2A 3JQBA 4MKZA 4YDRA 3PJDA 2DUUA 3RFVA 3QVXA 4GAEA 4PG8A 1RYEA 5JC8A 3TPCA 4AL4A 5CEJA 1EK6A 5JDCA 2IXAA 5COQA 2O50A 2VHYA 5COAA 3ZI0A 1U7HA 1LRKA 2CF6A 4YA6A 1SOVA 1EUZA 1P77A 4B7CA 4LMRA 3F4BA 1EFLA 2NQ8A 3A9WA 2QX7A 1JQBA 4GVXA 1T2DA 3IJRA 1C1DB 3B1JA 1AHIA 1U3TA 1EMDA 3OBBA 1UXHA 2B37A 3I6QA 1PWXA 2FY8A 2GLXA 3BTVA 4IDAA 4Q3BA 4Q3CA 3G49A 3BMCB 3AK4A 2EG9A 4HX5A 1WMBA 1PZFA 5IDYA 2EIHA 3HDYA 4FD3A 4UVHA 4UVEA 1ONPA 3ADPA 1MUUA 4ILKA 4J9VA 3OJFA 4JBIA 1DRWA 3B6ZA 4CJXA 5COBA 1EUCA 3G1TA 3NJ4A 3GT0A 5FI3A 1IYZA 2JFFA 3JQBC 2YHIB 5H83A 4JN6B 2YZ7A 1T1RA 2DQ4A 1KEWA 2RAFA 2OORA 3ZHXA 5H82A 5HTOA 3IOYA 4O1MA 2CZCA 5IZCC 3DBHA 2RHRA 1FF9A 3G3EA 2X6TA 1YL7A 3WGZA 4ESOA 4A0SA 1DIRA 1QKIA 4DIBA 1JA9A 1PJCA 4EUHA 5GZ1A 2AEMA 2Z1NA 3NTRA 4PZCA 4BNLA 1YONA 5IDQA 4MVJP 1NYTA 4NJMA 1NHGA 2CF5A 1PS9A 1YKFA 3UFXA 4XJTA 2B36A 1AN9A 1LDMA 2OGUA 3QV1A 2DC1A 2W98A 3OA2A 5T8KA 4BGIA 2EKLA 1NX6A 1O89A 3K92A 3ZU4A 3WTCA 3GFBA 4WLUA 4NDNE 3WICA 4CL3A 3KHUA 5DP2A 1HDCA 4CLOA 3CXRA 1B8UA 3BHJA 3NGXA 2YV2A 4CUJA 2GRAA 2PNFA 4QECA 1NPYA 3JQ6A 3VH3A 4CODB 1AE1A 3WR5A 3DBHB 5L95A 1BVRA 3TF5A 4BO5A 1AGNA 3DBRA 1NAIA 3OIFA 1OI7A 1K3TA 4YAKA 3ZGYA 5JY1A 3OEWA 3KB6A 4XA8A 2W2KA 2FR8A 3OQBA 4N5MA 2DTDA 1OZAA 1P0FA 1ADFA 1E7MA 3A06A 2H5LA 4DQVA 3WMXA 4JXKA 3W8FA 3CUKA 3X2FA 3SC6A 1ZMOA 4ZQGA 4ZRNA 4UVDA 1GY8A 3PEFA 3EGOA 3WGYA 2VWGA 3WFJA 3BMOA 3K2BA 1I3NA 4RJTA 4IDDA 1RYDA 3F1LA 1NFQA 2Q4BA 5JE8A 5TGDA 3NTQA 1NQTA 1FJHA 2JKVA 2IRWA 4PCVA 5JDIC 1YOVA 3BMNB 4CQMD 4OOFA 2RCYA 4Y6SA 4H3VA 3RC2A 1NVTA 4CUKA 4BNIA 4J7UA 5IXSA 1E5QA 3PP8A 3LC1O 1QLHA 3CZRA 1H6AA 4R51A 1KVTA 3ZWCA 4MVJE 3JQ7B 1AXEA 4GKVA 3R1IA 4HFJA 1ENZA 2ZB4A 5KIAA 1WNTA 2DBVO 4OXNA 1TT7A 1G6KA 1E77A 4IBOA 3JSAA 4E5PA 3KYDA 1EDOA 4OSPA 4RVFA 2Q45A 1Z75A 2Q1SA 3AOEA 4B8ZA 3TRIA 2HRZA 2O7SA 1H6DA 1MC5A 5A9TA 5T5QA 4IM7A 1HLDA 1Y6JA 3ZU3A 5K9ZA 2FZWA 5A4DA 3BMNA 3IP1A 3OM9A 4CL8A 3HUDA 5JDIA 3E9QA 4TZKA 2HK8A 4R1UA 2NUAA 5CDGA 4TRRA 5TS3A 3DHYA 3G17A 4XR9A 3NX4A 4OIMA 3D3WA 1F12A 2JL1A 5ADHA 5F3RA 4XDYA 3NT2A 1B7GO 1E3WB 3AI1A 3U09A 2HRBA 1XGKA 1YL6A 4C4OA 1YL5A 1BSVA 4ZN6A 4J4HA 3RJ5A 2GSDA 3RUIA 4FFMA 2BGMA 1J49A 3JQDA 4DLBA 4GX5A 2GN8A 5DZSA 3I23A 3KYDB 1BXZA 2D59A 4I8XA 4GVLA 1A7AA 5I8WA 2PTGA 5DCWA 5C37A 3F1KA 3HB5X 4PLVA 4FFPA 4PFJA 1KYQA 2ILTA 1I8TA 1E3JA 1DC5A 2PWZA 4P8RA 1F14A 1E1LA 3Q1LA 2Q99A 5I9MA 1PJSA 4FJ1A 3GG2A 4P22A 4WNIA 4GKBA 2W2LA 2JHFA 4J1SA 5LCXA 4Z0PA 1XCBA 3UGKA 1T2AA 1W8DA 1GAEO 3WB9A 4WJZA 2QG4A 3WNVA 5BSGA 2PZJA 5G0VA 4ZQFA 3NAQA 3VTFA 2GN9A 2X5JO 1A4UA 2Y68A 1MFZA 3OJEA 4MINA 4EITA 4EW6A 4NG5A 4XGKA 3M1AA 3WLEA 2ZYDA 3LLVA 3FWZA 3GY0A 4BGVA 4BO8A 2AG5A 1LLQA 2GO1A 1E3SA 1O95A 1EZ4A 1UJMA 5JW6A 3RC9A 1RM3A 3R6DA 4BKRA 4QTZA 1A9YA 3GVXA 4TMFA 3AOEC 1HSOA 1ZUD1 4FW8A 3STHA 4R5HA 1YRLA 4AJOA 4D41A 3JQ9A 2DBQA 5JSFA 4L8VA 4CMIA 5KJ6A 2BD0A 3QE3A 3WLFA 2Y1CA 4XX0A 2GF2A 2AHRA 1PIWA 3GDOA 4TKLA 2CD9A 1NM5A 3DAGA 3WGOA 4AJIA 1MFPA 4CMKA 1XA0A 3KYCA 4RVHA 5EERA 1Z73A 2IDZA 1N1GA 2QQ5A 2YUTA 3QWAA 1U7TA 1HT0A 3RCBA 4BQPA 1M6WA 4EGFA 4DIOA 1S6YA 2PZMA 2A9FA 3DOOA 1GQ2A 4D46A 4XZ3A 2ZATA 4BGUA 2JCVA 4WOKA 1YJQA 5BQFA 4QO8A 3RASA 8LDHA 3DOJA 1YO6A 4Q3EA 4OAQA 4KWHA 4IXWA 1A4IA 2D0IA 2O48X 3FPCA 4YACA 3DFUA 4N5LA 4JK3A 3VPXA 4CQLB 4Y6PA 5JXWA 3IKTA 5L7WA 2HJSA 3DOCA 1X15A 4Z9XA 1X7HA 1UP4A 1LRLA 4HP8A 4N5NA 1ZK4A 2BMAA 2H6EA 4YJGB 3ZNNA 2VRCA 4AJ2A 4FB5A 3HB4X 3PRJA 3WQQA 4RLSA 2BKAA 4YPOA 2XAAA 4M89A 2Q4EA 3C1TA 4UREA 4YAEA 2I6TA 4BO7A 3GEMA 4AJ1A 3PZRA 3L4SO 4A5OA 4OGWA 2XF8A 1DIAA 3FD8A 1KOLA 5GZ6A 1WWKA 4MIYA 2OZPA 1HE5A 4MP8A 3I9NA 4RF4A 3L4BC 4DUPA 5TT0A 4F46A 1Z82A 4CV2A 4BOYA 2WJPA 4J7XA 5L3ZA 3FNGA 4OMUA 4ND5A 1E1NA 1QYXA 2WDZA 2PD4A 2WM3A 4LRSB 3WYCA 7ADHA 3HDQA 4QFDA 3FNEA 2X0JA 3G0OA 4E2XA 1PZGA 2PV7A 4FBGA 1GUZA 2TMDA 1LQTA 3AUAA 9LDTA 2O23A 3IDSA 1PQUA 5CG1A 4BNUA 5JY6A 4WEQA 2IEDA 3PHJA 4FFRA 4YQYA 1E6UA 3BA1A 1PJ4A 1WVGA 4BO4A 4DPKA 1U2DA 4RQUA 1HYGA 1U5AA 2PH5A 3IQDB 4CR7A 4BNTA 3GC6A 5IDWA 5L4LA 3GZNB 1YGYA 2O3QA 4IXTA 3ULKA 4AJHA 2DM6A 2FR1A 1NXQA 1VE9A 2ZTMA 4TRJA 1I24A 4W6ZA 2J3JA 3EK2A 1T2FA 2NVBA 4XYLA 5THKA 4EUFA 2CY0A 4YAJA 1IY8A 1OC4A 4KP7A 4DMLA 2EV9A 4TWRA 4CLDA 1EVYA 2IEBA 5EINA 1HZJA 2POQX 3EVTA 1VM6A 1YBAA 2GYYA 4J91A 2VUSA 2D5AA 1DLIA 1GYQA 1R0LA 1W0CA 1IL0A 3NKLA 4AJEA 4DLLA 3F9IA 1VLLA 3PYMA 4FQ8A 4W9NA 1A5ZA 1MV8A 2DFDA 2LDXA 2EP7A 3GUCA 2X5OA 2P91A 1LC3A 1YQDA 3SLGA 3QJ5A 1F0YA 4G65A 2GN6A 4RVSA 5HRUA 4QFCA 5KJCA 1C0LA 1LSSA 2Q2VA 2UV8A 3ASVA 2BELA 4W9NC 1BXGA 4J43A 3EMKA 1E3IA 1H9AA 3DTYA 5TNXA 1V3UA 1B2LA 2HCTA 2CNBA 1Y1PA 1Y81A 3H5AA 5F1OA 2W2LD 2PKQO 1ADBA 5DOZA 3ZV6A 2J5KA 3DL2A 3NDIA 1GR0A 1RM4A 1CIVA 4EBFA 4RL6A 2TMGA 3GVPA 3OJLA 1H2HA 4FGWA 4RPHA 4IJUA 4ALIA 3TDKA 5IZ4A 3TQHA 5LDGA 4P4NA 3H6KA 3O8QA 1DDOA 2IYOA 5T57A 3QY9A 3LF1A 2A4KA 2YFHA 3H9EO 2PA3A 3DO5A 3FNFA 3Q9UA 3SEFA 1U9JA 4PLCA 1Y8QA 3HNPA 1LXCA 3KVOA 1QORA 2Q3EA 2DAPA 1ZK1A 3B20A 3GUYA 3ZHZA 4PG6A 4TKMA 1GZ3A 2DTEA 9LDBA 4MP6A 4YVFA 3EHEA 4KOAA 3RUAA 4Z9FA 4U6QA 4J9UE 2ZYGA 1CRWG 1SEVA 4BNWA 4GBJA 2Q46A 1HTBA 2JAPA 4KMSA 3VZSA 3IAHA 2GNAA 3HDJA 1NTOA 3BIOA 1EVJA 1IZ9A 3VHRA 4GMFA 3LYLA 1QLJA 5BSHA 4YRAA 4GWGA 2EXXA 3HQ4O 5BSEA 2OHXA 1B3BA 3GVCA 5FF9A 2FPPA 4R16A 4BNZA 5IJZA 4DC0A 1PS8A 5IFLA 1BXKA 1F8FA 4FC6A 3IS3A 4U0JA 2PR2A 1C0IA 5DBIA 4RLHA 4IMPA 4Q3NA 2GGSA 2HMWA 3H7AA 4ZJUA 5BNTA 2HK9A 2YV1A 2E49A 2GDZA 4QEDA 3HHPA 5F1KA 4CUZA 4RO0A 3V1YA 3LU1A 4IJWA 4RORA 1X0VA 3E8XA 2VTEA 1HEUA 2X58A 4ZGWA 5CEEA 1D8AA 3PDUA 1ZVMA 1P33A 4BB5A 1LSOA 3D1LA 3HWRA 3ZU2A 3VAZA 5EQFA 2EJWA 4A2CA 4FS3A 4MVJH 3I4CA 2EHDA 2JD1A 3U4HA 2WSBA 3RC1A 3L77A 4KUGA 1P44A 2C29D 2UYYA 3KBOA 2BHLA 4PGFA 1PZEA 4NHEA 3AU8A 1CDOA 1HZZA 2D2IA 1NQAO 2WD7A 1T4DA 1R6DA 5I8ZA 1NWHA 3NV9A 3T7EA 3QSGA 1PGOA 4IQ0A 1D4FA 1Z45A 4HFNA 5EN4A 4JJIA 1F17A 3ZNOA 3ZWWA 2HUNA 3OH8A 2EKQA 3SLKA 4BO9A 1LLUA 2AG8A 1IPFA 5TJ9A 4NH4A 3W4IA 1H93A 2C07A 4J1TA 4UUPA 3JYNA 3PJGA 2UUPA 4GMGA 1IPEA 3WJ7A 4D79A 1A9ZA 1U1IA 4YR9A 5B4VA 1MB4A 4YEDA 1MGOA 1RWBA 3N74A 4NBRA 2AMFA 1C1XB 3O03A 5KKCA 2ZB7A 3WX0A 4PIVA 1I3MA 4W7IA 4QSMA 3WWZA 1JW9B 4R68A 3NDJA 1VL0A 4GX1A 4TRNA 3PI7A 1KC3A 4BHTA 3H65A 2PD3A 2QRLA 1ZKMA 3GAFA 4GSKA 2DVMA 5B37A 1N92A 3H5RA 4IIVA 1JAXA 1ZMTA 4F45A 4FCCA 1V3VA 1TVEA 4Q3AA 1I10A 3FPLA 3H9QA 1BGVA 4CQMB 3DR3A 2H63A 3CH6A 3VTZA 1IHYA 1X1EA 1VRWA 2P9GA 3WBBA 3QHAA 4P4LA 2J5RA 4BQRA 2G82A 1UAYA 2P5UA 3MTJA 1JKJA 1PSDA 3JQAA 3OQ1A 2EWMA 3RUDA 1H6CA 3JTMA 5U4QA 3JV7A 1Z7BA 1PGQA 3M2TA 1SMKA 1M75A 1Y9EA 4HXYA 1DLJA 1G0NA 3KYCB 3BHIA 3ZWVA 5EPOA 5ILOA 1GUYA 3DZHA 4RVDA 3NT4A 3ANNA 5JC1A 1LTHR 2QZZA 3A4VA 3CSDA 3ZWNA 3QQPA 2A94A 2C2YA 1DC3A 2ZJ1A 5I7EA 3Q9NA 2ZTVA 3P5SA 3GMSA 1LDBA 1E92A 3GF4A 2NSDA 4IQGA 4WE3A 1ID1A 3CIFA 3CZMA 3GVIA 3B1FA 1LEHA 3E03A 5JPIA 2JFGA 4XKJA 3RAJA 4KDEA 4BNNA 3ROMA 4TVBA 3F3SA 4I9UA 4LMPA 1CQIA 1WDMA 5L7YA 2FP4A 4NBVA 4GPD1 4UVIA 3ONFA 3ETEA 4CM6A 2IZ1A 4II2A 1VPDA 1Y8QB 5A9SB 2O3RA 2J5QA 1HXHA 3GPIA 4II3A 4ALKA 3GQVA 4IDGA 3U3XA 4MIOA 2P4HX 3AFMA 2DLDA 3F6YA 2I5PO 2JHGA 5L53A 3C3XA 4XIJA 3W8EA 4D3FA 1N7HA 1Y5MA 1YDEA 4DBZA 1MXFA 1H9BA 1R66A 1T24A 2A92A 4HWKA 1WDLA 4OXKA 4S3MA 2O7QA 2VNSA 5GY7A 4BV8A 5A3JA 5ITVA 1R4NB 4O63O 4ROSA 3UHAA 5IDXA 4OKIA 5L4SA 1SB8A 2QRJA 1ZXLA 3VDRA 3ZN2A 3JQ9C 4NIMA 1HE3A 2H9IA 4JNKA 5I9LA 5IZCA 1N5DA 4JJFA 4J49A 3ZHYA 4B4UA 3PQDA 4FOOA 1K6JA 1R12A 3X2EA 1LSJA 1DRUA 1EUDA 5CEFA 1ISJA 2R2GA 3K6JA 2DT5A 3IL2A 2I65A 3VZQA 5J23A 3AWDA 4WKGA 3KSUA 3VPFA 5KJFA 3JQAD 5TLSA 2C0CA 2C59A 3R3JA 1C0PA 3L9WA 2Y05A 3CPSA 4O59O 4XQ9A 4KZPA 4ZHSA 1IE3A 5DP1A 2OFPA 3LT4A 4CM5A 4EYEA 3DMTC 4BNFA 1UDAA 4CR8A 4J4TA 1BMDA 2NQTA 4FC7A 4KWIA 2V6GA 1B26A 3LT0A 4YT2A 1EFKA 3OIDA 1N7GA 1UP7A 4PLHA 1XIVA 1TLTA 4TZTA 1WZIA 4MIEA 4XGIA 3LDHA 3RFTA 4HADA 4K6CA 1Q1NA 3GPDG 4BMNA 1WMAA 3MEQA 4E4YA 4DPMA 3EC7A 3AOGA 2Y1DA 3JQGA 1CYDA 1HWYA 5AVOA 3TSCA 3JQ7A 1YBMA 3KV3O 4NR0A 2GASA 4EEXA 1MP0A 1ZJYA 1BRMA 3U0BA 2FZEA 4CM3A 5JCJD 2VCYA 3UF0A 4I5EA 1DJQA 1TEHA 1UR5A 2J6IA 3AU9A 4OM8A 3GLQA 3GRPA 1PX0A 1I2BA 3MWDB 2OOSA 3JQ8B 1X14A 3IIEA 1FDUA 4N18A 5BSFA 2V6FA 3V2UA 1ONNA 1LUAA 4CMEC 3HE3A 5A05A 1AXGA 1MA0A 1KETA 1PS0A 3INTA 1EBFA 1N9GA 3L9XA 3WNQA 4PRLA 2OBNA 4IPTA 3V1UA 2O3TA 1IB6A 1Q0HA 1YQGA 3C1AA 3NYWA 4BO3A 1E7YA 3V2GA 4LW8A 3CE6A 3PWSA 2WTBA 1LRJA 4IJKA 3GR6A 4Q9NA 1FK8A 2FRDA 3ETDA 3MJ4A 4UVGA 4XDZA 4BNKA 1DIBA 2WYUA 1M6HA 4FN4A 2AXQA 3I52A 3JQGB 4QXMA 3WGTA 1E6EA 4E5YA 2JAHA 2O3SA 3VOSA 1DPGA 2C82A 4E12A 3WGIA 2NU8A 3H9GA 3GN1A 1BW9B 1KS9A 2R00C 1I01A 4WLVA 3ZV3A 3QW2A 2X86A 2HAEA 3GEGA 2Y1OA 3K73O 1FXSA 3BYZA 3FF4A 4IINA 1ISFA 1VJ0A 1XQ1A 2B83A 4KTVE 1HDOA 4NBWA 4Z0TA 5T8KC 1PGJA 4AVYA 2QIOA 4CLRA 2ZB8A 2UVDA 4U0KA 2GUGA 4K26A 3WMWA 4DLAA 1O94A 3FI9A 4DXHA 5FWNA 4WOJA 1I3KA 3LK7A 3P2OA 1HLPA 1Q0LA 1QV7A 2FSSA 1QMGA 1PQPA 1LLDA 1ISIA 4HV4A 2EERA 1GPJA 1UZLA 4UUMA 4I9NA 1HSZA 2NU7A 4RF3A 2WMDA 4P38A 1JLLA 1Z6ZA 5I7FA 1DRVA 1NPDA 5JFOA 1X7GA 1IZ0A 1C0KA 1B3RA 3C7CB 3OICA 4BNXA 4ZQEA 3K96A 3RUHA 4U6SA 4WLFA 1M2WA 1NBOA 4PLWA 2UAGA 2AA3A 2CVZA 2RHCA 3FWNA 3S2IA 5F21A 5JO0A 3GNTA 2VWQA 4E30A 5JYDA 4C7KA 4CM4A 2BFAA 4B79A 4RGBA 3F46A 2I76A 4CMBA 4ZD6A 1HRDA 1KVQA 2GERA 4PG7A 1LA2A 1P45A 2BI7A 3BHMA 1ENPA 3D5QA 4IZIA 3HFSA 2NTVA 4XGNA 3PVZA 1DIHA 3GVHA 4J2OA 5BR7A 3ZWPA 3E1KA 2Y67A 3GDFA 3M6IA 4D3DA 2JD0A 1DBVO 3C7DB 5ENVA 1R37A 2HDHA 1Q7BA 4ZVVA 1X1TA 4R4JA 4YAGA 3COSA 1I32A 1JVSA 1J6UA 2YDXA 2RBEA 1UZNA 2Z95A 3VH1A 1K5HA 3NUGA 4IQ8A 4MVJA 4RPJA 2J3KA 3MJVA 3MJSA 3ZW8A 4CQLA 2AQ8A 2DPGA 5TQVA 1UXJA 5L4NA 3H9UA 5T67A 3AJRA 2I9PA 1T2EA 3P7MA 4JJGA 4XB1A 2ZK7A 3UOGA 4DWVA 1O5IA 4A73A 2VRBA 5CFZA 4LSWA 5U1PA 1PR3A 1P1JA 2GZ2A 3KEOA 4YJGA 4CM9D 3D5TA 3ITDA 2IZZA 1YWGO 3DWFA 3DZFA 3OA0A 5KVQA 4MVJM 3KLMX 1ISMA 4XYGA 4NFHA 3W1VA 1ZSVA 3KO8A 1C14A 2CDCA 1YH3A 1ISHA 5EESA 4D42A 4E31A 1BG6A 1PU2A 1WXDA 5AYVA 3Q2IA 3RBZA 1KIFA 2BLLA 4E3ZA 2VHZA 1PL7A 1R0SA 1RM0A 4DIFA 1CWUA 2G76A 2C5AA 1HF3A 5JAQA 1XHLA 1YDWA 3UVEA 1PJQA 5DBGA 2VWPA 1V9LA 4HFMA 4WASA 3U9LA 2D1YA 2VZ0A 3FSRA 4R1TA 4DREA 4L74A 4YB8A 2I67A 2P68A 3IC5A 5CDUA 3JD1A 2PGLA 2JCXA 4K28A 3TOXA 3LSYA 1HL3A 2P4QA 3H3FA 2CDBA 4XR4A 1HYHA 5THQA 4DL9A 2WE8A 4DQXA 4H16A 1H94A 1WPQA 2BH9A 4OHUA 2Y0EA 2WD7B 3OHSX 1OFGA 1EE2A 5HM8A 3FBGA 2HQ1A 3KLPX 3DFZA 4E5MA 2B35A 3RUCA 1LNQA 3PGXA 4L76A 3GNSA 1X7DA 3TL2A 3ZHBA 1QP8A 3JYPA 4MVJI 4YBZA 4BL5A 5A5EA 3UUWA 1PWZA 2C5EA 4JLWA 3ZCXA 4LVCA 3FNHA 2WE7A 1OC2A 4BS9A 1KVRA 3SXPA 4EJ6A 3PXXA 1RKXA 3RQSA 2QRKA 4U5QA 2EGGA 3IP3A 4FOSA 3HJAA 3DBLA 5G4LA 4L75A 2C54A 3H2ZA 4G2NA 3S1LA 3TWOA 4D44A 5GZ3A 3AW9A 4YJHB 2RH4A 2XPCA 2QHXA 4E0BA 4GLLA 1VKNA 5DNAA 5TT1A 4OH1A 1F06A 3K30A 3PFFA 3CTMA 4PLGA 4GSLA 5ICMA 3DZJA 3KSZO 3Q11A 5IF3A 1IOLA 2BFMA 3WFIA 5T64A 1B8PA 4EDFA 1L7DA 4XYBA 4BNYA 1OBFO 4FDAA 2ZKLA 4JQCA 3PHLA 2P5YA 2GN4A 3PK0A 1QR6A 1LBEA 4C7JA 1GQYA 3D0OA 4KDFA 1CEQA 2OUIA 2P9EA 5HS6A 5HWSA 1JU9A 4CLHA
chains in the Genus database with same CATH superfamily
3ZWYA 2BKVA 2EQAA 2ZE6A 1B14A 1BDBA 1W29A 1T8TA 1G4UR 1U2GC 3GRKA 1FIUA 4PG4A 1SNYA 3PVCA 3M1IA 3E53A 3TZHA 3BMXA 4L7VA 3TYXA 1L8QA 2X9GA 2A33A 5FTLA 4DIUA 4J0CA 1XWFA 4CT5A 3B3QA 3E1GA 4ALJA 1R4NA 3CRRA 3RDPA 1VCHA 4UBJA 3TXYA 2REQB 3IFSA 5T4EA 4YJFA 4CKYA 2VJPA 3K4QA 1S2LA 3EC2A 2R6HA 3N7UA 1ZW6A 2OG1A 2R4TA 4J0EA 4C08A 3U80A 3H2HA 2XH8A 1EXDA 5BN3B 3F6RA 2VG8A 4WNAA 4F56A 3LGSA 1AVTA 1D04A 3I92A 4QHYA 3ZNQA 2H1OA 3GLFB 3L7KA 5MFPA 3GEEA 2IODA 4H3HB 5HCIA 2GVZC 4MUNA 3WGQA 3ZDEA 4ZI7F 3KTOA 2JBHA 4JLPA 2J32A 2HBZA 3FTFA 2QG6A 5IAEA 4LE2A 1KE1A 3K70B 1GCAA 1MA3A 1M1YB 1PK8A 2Z1MA 4TS1A 1TADA 4BX3A 4EABA 2O3JA 4YALA 2HMTA 2XTJA 3AEZA 1G17A 3DMTA 3F49S 4YGXB 4YQZA 2CB0A 1B0PA 5GM2A 4JLMA 1OV6A 3O4RA 5EFOA 2C9ZA 2EWVA 1TMYA 3PNOA 4BLSA 2NV6A 1QKJA 2P75A 1JFFB 4KYUA 1PV4A 3KYBA 2HXGA 2XTMA 5FUXA 3WWYA 3EXEB 2QMHA 4BLTA 2UXCB 1T3HA 5AW5A 4DQDA 2OA0A 4AJNA 5A9SA 2G77B 3ERCA 1J42A 1QDEA 1OHHA 1UEJA 2YX1A 3A11A 1UZMA 1E7SA 1JEDA 4Z0HO 1T29A 4R2MA 3F0TA 4WOBA 5HKKA 1E5TA 3UQZA 4HNTA 1UIMA 4W9MC 3LFTA 1L5HB 5CLLA 2G0AA 4EPXA 3H9JA 2ZWVA 2D7CA 2FXVA 1JHUA 4GDMA 3DP9A 2FZKA 3GA5A 2EZ8A 5AXAA 4G41A 2C5LA 4B6SA 1QRSA 2HT1A 1K7YA 3WBFA 5GP1A 3BTUA 4QPCA 4AJKA 1CUFA 3I8SA 1YA6A 5GOZA 2GF0A 4NXNB 2C4NA 1QS0A 1YB1A 3REFA 3H13A 1XKQA 2YDYA 2Z57A 2WJ4A 3ED1A 2XOXA 3QKSB 4NCIA 3SQDA 4DVJA 4NMHA 3OEEA 4BGDA 1KIAA 3H5NA 2H1LA 1WEHA 2QNRA 4MA0A 1ECFA 1K5GA 1KJ9A 1NMXA 2CFSA 3LBHA 3JQFA 4GPEA 4TKVB 1KSGA 3ZYZA 4B5LA 4RTPA 3FY4A 4CN9A 3VYUB 4JR0A 4R6WA 2IC5A 3D31A 1PL6A 1HETA 1Y48E 4X97A 4OSOA 4TKZA 4DSAA 3KX2A 2FPOA 3QIVA 4IRMA 2NOAA 1YRHA 2JIZA 4OQFA 4RF5A 4WA7A 3EPHA 1KC1A 2FW0A 1PZXA 1EHIA 1SBZA 1E7WA 5E6RA 3ZHQA 1TTPB 3CO0S 3FG9A 4JEMA 3NGLA 2IYEA 4TWBA 3JQPA 3TG8A 2JI4A 2YQZA 1ETHA 3ZTYA 5B1DA 5HPYB 5IYZB 4NMWA 4UDNA 1XXLA 4FFNA 1S4QA 2PZLA 4PS0A 3EQ6A 1W87A 2J0UA 2QTAA 3EPPA 2IPAB 1GARA 3AP1A 3DTVA 4KSBA 3IUPA 4E1AA 3KM0A 3Q5DA 3CSUA 2J48A 2A4MA 2YFYA 2EQ5A 3NM5A 4NG4A 1HOTA 2X2OA 3HXKA 5KKAA 1AT1A 3Q6MA 2XD9A 3NTUA 4X1YB 1ZGHA 1L5GB 3UXYA 3UYLA 5E9JA 2N46A 2VVTA 1YU6A 2BTOA 4Q37A 3TW0A 3WYBA 1T0UA 3ZE9A 1W49A 5HKOA 5LDHA 5JQGB 1Q15A 3QVSA 3W0LB 1K7SN 1FYFA 1BE1A 2ZRPA 2IEIA 2G72A 4U7FA 2QX4A 1T0HB 3ABSB 3ZXIA 4LF4B 1VA4A 1Y3HA 3IBTA 3R5HA 2NTYC 3BF7A 2DHEA 2XQGA 1UT8A 1H2ZA 2ERXA 3AI3A 2VXCA 3JATA 2ZI4A 4L28A 5DSZA 1O5TA 4U39A 5BN4B 3UANA 3C1OA 2GTIA 4FOLA 3RVJA 2VZ8A 2X2EA 1CVRA 1Q7TA 3IALA 2P3QA 3RS9A 4YV0A 4L78A 2HHLA 1GAQA 4ENSA 5KS2A 1VB5A 1RVV1 2Q5HA 3ROGA 2OV3A 4DRYA 3U5TA 4AS3A 2HA3A 2FPXA 2P7IA 5EL0A 4IL5A 2JGFA 5BXYA 5TQ2A 4GL2A 2PMCA 3CLSD 4WKPA 5BYKA 4LHSA 2J6BA 4XWYA 5DLDA 5G0WA 3VYSB 4EB3A 4JKOA 1CK4A 2JB9A 3BL6A 2GF9A 1OH8A 4J7AA 1QWSA 3NWBA 3ZE0B 4C4TA 2AC4A 5CIYA 4AICA 4BXOA 1DNPA 2HMUA 2IIPA 1Y7LA 3HKBB 4KZKA 2QEQA 1G8YA 4DJAA 3Q2KA 1OW3B 1SQ6A 5BN1A 1TYCA 5I8PA 4ENWA 1GNTA 1L4KA 4IUYA 1D09A 3BXXA 3CR7A 1N4DA 1C1HA 4JGBA 3RKRA 2PKXA 5EHZA 1O0BA 1FMLA 1JJVA 2ATIA 4PO3X 5JCOA 4DLZA 4E2ZA 4IJSA 5E38A 1EZZA 2YXPX 1XF1A 2C7RA 3OP4A 1US8A 4U5XA 2ORWA 2GN2A 1NYQA 1WKVA 4OQEA 3D2BA 1XF9A 2Z56A 1IBSA 3HXOA 1H4QA 2E37A 2VJOA 3PL5A 1ICEA 1NZFA 4JJ7A 1Z5WA 1NVVQ 4F6CA 1Z07A 5JNTA 3AFNA 4HEQA 4L9RA 2HRDA 1CW2B 1I33A 2VF4X 3LFHA 4L0QA 1LQUA 2AEJA 5B2FA 6GPBA 4M8NE 3STTA 4Y2UA 5TB5A 3GGOA 2NU6B 2A9QA 1S9DA 3BGIA 3A1DA 5KAMA 3S2ZA 4R81A 4F4JA 1JDVA 5LD2B 1TQ2A 2BMJA 2NNLD 1TKRA 2IU4A 3OT1A 4NPCA 3RB8A 2FSVA 4KFCA 3OY7A 4CRWB 2PL1A 3NCTA 4N5DA 2YS6A 4D8UA 2B8NA 1NW6A 2DG2A 5CLJA 5D3MA 4QUJA 4IHJB 1DXOA 1M34A 3CLUD 4JHLA 1VG0B 1QIKA 3TQSA 1MX5A 1O0CA 1K8YB 3I0MA 4HGZA 2GZAA 3PL1A 1RU3A 3RKSA 4DGQA 5AVXA 5HZMA 4J2TA 5KPJA 2QR2A 3QU7A 4KI7A 1NJGA 1GTMA 1HDZA 1VLQA 4YGYA 4J4BA 1T25A 3N3AC 4KO1S 3T3MB 4K8OA 2EARA 1DC4A 3NBXX 5B7NA 5IMBA 4UPDA 3BEOA 4RVGA 5CYFA 1N5RA 2B69A 3SEAA 4BKOA 1W96A 4PC7A 1R8JA 5BWNA 1YS1X 2P3OA 2PKYX 1OAKA 3C85A 3RJTA 5ESRA 4OQXA 3ZK7A 4TMXA 3T7TA 1BDMA 5LIPA 3ADBA 2FNAA 3A14A 3FUUA 4MW0A 1KPGA 1TVCA 3P27A 3GCWA 2FJ0A 4F8YA 5HZKA 3W5IA 4CW7A 3MG9A 1IJBA 1GSAA 4D0LB 1RRFA 5KEIA 3WNDA 1AGYA 4FYHA 5J59A 4E21A 2MTBA 3DKIA 2AG1A 2H1IA 3HU5A 4RH0A 3LT1A 2CHUA 5DCUA 5BSKA 5LP1A 5TF0A 5IKMA 4XM2A 4F96A 5D1NA 3ZBQA 3G13A 3KQTA 1SXJC 1I9CA 4I1RA 1A8HA 3KZOA 4CDRA 1XP5A 4R31A 2FZVA 3VKHA 3DE7X 1KWKA 4TUYA 2GK4A 4O4JF 4M8SA 3RUHA 1IVYA 4X1IB 3DZIA 1UAGA 2LZ0A 3AY3A 3H2BA 1G0OA 3O9ZA 3V5NA 1L7XA 3G5MA 1BKSB 4IVPA 1LDNA 3IXMA 4RZ3A 3TCNA 3GARA 4K3VA 1UBMS 3IQIX 3STYA 4N54A 4MMZB 4D3YA 5AD1A 4MQEA 4TMVA 5KQRA 4KIUA 4AI6A 5CYPA 1NBHA 3LCVB 3QMPA 3J7TA 1F9AA 2BUBA 3I9JA 3JU3A 2DQKA 1Y80A 1AS2A 1K0UA 3GLIB 5IK2D 3PUVA 4JGGA 4L95C 1TA4A 3KU4A 1KFBB 4IGKA 1XHFA 4DV4B 2CMGA 4CR6A 2RFLA 2YXLA 5A4MS 3MHTA 1R6BX 4C2UA 4COKA 4RBNA 1TT5A 2PVPA 3I83A 4IDNA 4XQCA 4Z3KA 1ISPA 1M5TA 2W2NA 3BH6A 5HEKA 1P31A 1PDVA 1Q12A 3R0ZA 3PKIA 4FFBA 3RHTA 4YXWA 4D98A 5KOHA 2QAJA 4Q6WA 2I3BA 5AR1A 3SHQA 1Y1TA 1L4BA 1T5BA 2G9QA 2RJ3A 2ZIVB 2E4YA 4FIZA 2RHMA 4ONEA 4PPGA 1G2IA 1XG5A 2C20A 3CEMA 3DTTA 3GI1A 3GMDA 1DXQA 3G8BA 4DS3A 1QG4A 1YQXA 1THMA 3WSTA 4PLYA 3LCUA 2W90A 3FIUA 4X1YA 4Q39A 3GGGA 1QRRA 2HBYA 3EGDA 5BVGB 5C34B 3L01A 3D43A 3L8MA 4IKEA 1OBCA 4GBMA 5A06A 2QV7A 2FQWA 4BNDA 3EFBA 4QGHA 3W1EA 1OIVA 1EBUA 1KTVA 1DXYA 1XR3A 3ORFA 4WTOA 1ZVVA 3SJBA 3ZGOA 1NJSA 1PV1A 4P3OA 1Z3CA 4WERA 5BRNA 1PO7A 1ORTA 1H3EA 3HBLA 1WIWA 2WIAA 3DNMA 1DADA 4M1QA 3AF2A 1IY9A 1I6LA 3ILYA 1DIOB 3NZEA 4UXHA 1Y3IA 2GJ4A 3D3EA 1U04A 4TL9A 3WZ2A 1JWAB 4P0QB 3NH9A 5MF6A 2X1MA 4QQRA 3AHGA 2HLDD 3MJDA 4BLQA 5CMLA 2ATEA 2PBFA 4IIUA 3EQ8A 4DCOA 4DCPA 2DCMA 4RFLA 4EJ2A 4JOBA 4QRDA 3IP6A 2J9ZB 2IXGA 3C3EA 3PIDA 4KAXA 3VQTA 1OPRA 4MDYA 1DKMA 1L5RA 2G67A 2Z4SA 3GW8A 4F1WA 3FDFA 3RS3A 3DQQA 3LBAA 3HB0A 2VO1A 4B6FA 5ITWA 1VLVA 5DVZA 4ASUA 4UDOA 4REOA 3TUIC 4ZAYA 4GYKA 3L0SA 3T3OA 1S2MA 4Z54A 4RJJA 4HDRB 2WDPA 4QGFA 1NHWA 1HEIA 2CKMA 4L6IA 3FBTA 4DSZA 4CWAA 1RT9A 1R0RE 1CNEA 2E6KA 2Q1TA 4P7JA 3CB4A 2V0GA 3DEFA 2HIGA 3VPCA 2VHWA 3LUHA 3EF3A 5HQTA 4JT4A 4HUJA 3M5WA 2IH2A 4FMCB 1D7OA 3TLJA 3O90A 2EIXA 2H4JA 3K70D 1K86A 2F1KA 1RWOA 2D4HA 4RMHA 4OF4A 4D43A 3M4JA 4GXTA 1M76A 2A88A 4TWIA 3TIGA 4C6HA 4EG0A 1ECGA 1H0HA 1Y4UA 3U39A 4X6UA 3HJUA 1IM5A 1HQKA 2IXTA 5JS6A 3P9KA 3DMPA 4K9DA 1RHKA 5AJYA 2WYOA 1UQRA 3V3TA 3F73A 3NT5A 1U8FO 2G6TA 3VPHA 3V4ZA 3R5KA 4KQ9A 5DBOA 2TSYB 1OWNA 3H8JA 3HZZA 9ATCA 4BTLA 5FT9A 3VBEA 1UBSB 2NU6A 2WD8A 3OJ0A 3ZXUB 3ZD7A 3G2OA 2HC9A 4UNRA 2H8KA 2Q3FA 3KQNA 1OFTA 3DXFA 1JBKA 3KE8A 3R9IA 5TR9A 3Q8KA 4WY2A 1FS6A 3HYTA 2OVBA 1BE8A 1W5EA 4YRNA 2XCTB 2CXSA 2VP6A 3PFWO 5M7EA 1P1CA 2N47A 3DDNA 1M34B 3ZW9A 4EMUA 1PUJA 5DWQA 1B42A 2FP4B 5CU7A 4MV9A 4PO8A 4BZXA 2A5LA 1XJWA 5LIRA 2WF7A 4BNJA 1N75A 2CMFA 5L3SA 1KXZA 4DM3A 4OK6A 4TV8A 4F5WA 3M4ZA 2V3CC 1HZZC 3HCEA 3AYZB 2AXEA 2VP3A 1BVUA 2OYSA 1X0XA 3HFGA 3CZ4A 2YQ4A 3NOXA 4LDNA 4OO3A 4INJA 4TTVA 4L72A 2IEZA 4GU5A 5I9NA 3FDJA 4IMJB 1EB9A 3M6VA 4DIKA 4TL6A 1N0UA 3MVEA 3WMEA 4P31A 3EGEA 3VZRA 4D9EA 3KS9A 1O97C 4JYPA 1TYDE 4KXQA 1N2SA 3DW1X 3MWEB 1M1XB 3EXFA 3EE6A 3GDGA 3ROPA 3ZX4A 4GKJB 2GJAA 4BFWA 5CR9A 2XMQA 1GN8A 2ZWMA 5LOVB 3G2MA 2DSNA 4U7HA 2HMSA 3UMBA 4KNYA 2Q0HA 3TBHA 1TECE 3FETA 2YUIA 3NXSA 1M6EX 3ECSA 3O1LA 4HRYA 4HVAA 3PQEA 1IUKA 3V55A 1N36B 4FNAA 1E1KA 5AKHA 1XELA 5JLAA 3PFGA 4KYVA 4BTEA 2G25A 2KMLA 3EFEA 1G66A 2EJBA 4HFRA 4M76B 2PKWA 3BE8A 4WA8A 4YT8A 2QQGA 1R4MB 3R0VA 3RVQA 1NIJA 3EIOA 4IDPA 4X1IA 4YJKA 4F1JA 4KE7A 1ULHA 4M49A 3B60A 3A6FA 3EIUA 2QUKA 2ROQA 2ZULA 1S3FA 1VJCA 3OECA 1YJBA 4F71A 1VL2A 1TTTA 3CUUA 2BOVA 2CVOA 3MAGA 2A59A 4IV5A 2BGWA 2YWRA 5BSUA 2O2EA 5DIZA 1ICIA 1XN4A 1VJTA 4QELA 4EJSC 2OT3B 3Q3GE 2X0DA 5BMVB 1PR2A 1SKBA 2IZ0A 4MEAA 1B0UA 4TTAA 4UE2A 1YVPA 3PJEA 4ZI7A 3D9QX 2YVAA 4OYLA 2XMCA 1HDIA 3QLJA 1TEZA 2V74B 4N76A 1GQQA 2QAIA 1Y89A 2WZCA 4J3FA 5IT9A 5JSHA 1IWOA 4YJ2B 3ZGLA 5J1TB 2VHXA 3A7EA 5F3WB 2E4XA 2P90A 1ULUA 4NZPA 3MTEA 1GPYA 4O4IF 4R2IA 2Y1LA 3T4XA 3WQSB 3BBPA 2YJGA 4LTDA 1VCMA 4HDQB 2NO6A 5AJUA 3F5SA 3HNOA 4LKOA 5CLHA 2ZUTA 4B85A 3G0HA 4INOA 5I47A 1QH1B 3HH8A 3R3HA 3VU9B 2ZJFA 4RTNA 2ZRAA 1Z0DA 3M9LA 1T9BA 5KTNA 4C06A 2WWHA 3JRWA 3LF2A 4LHXA 4D0SA 3Q7IA 2HHHB 3GWZA 1SD1A 4LDJA 3OEYA 1QRUA 1MG0A 1ZEJA 1Q83A 1WZEA 3OPYI 1UJ5A 1XTVA 4JP3A 1JSXA 4RZHA 1CUVA 4JA2A 1CFJA 1VKOA 3UC9A 1Z5VA 4R7GA 2GPTA 2GKOA 3FYUA 3BMQB 3ANSA 1UPAA 5CCDA 4Y8VA 3I8XA 1YZTA 1X9HA 1FLDA 2P9FA 3JD2A 1HDRA 3R0IA 1BDHA 1A5TA 4JP2A 1RXEA 1L5WA 1KDOA 4N0QA 1QCZA 1Z2AA 3VBCA 4JMLA 4B4OA 5C1BA 5IVHA 4UULA 3AM4A 3HCWA 3MERA 4PLTA 4YLYA 1O6BA 5HZGA 1PBTA 4ACAA 2QXTA 1X1CA 5E1BA 1ETUA 4QU5A 1PTJA 1NF2A 2R8PA 4MWOA 4MW4A 4R9RA 4DR7B 2CXHA 1ZZEA 4AMYA 3ZG6A 3WKAA 4CMAA 2AJLI 1FSGA 3MM4A 2AOUB 4E15A 1NSFA 2WHYA 3UY4A 3PNKA 1M2OB 2SKCA 3AJAA 4WFJA 4JOCA 4BKMA 5EWJB 3IAFA 1V1RB 4V02A 3QFHA 3SICE 4Z1OA 1F6BA 1S89A 2GEUA 2CNKA 3OC6A 4GI2A 4EB8A 4UTPA 3I76A 3WSVA 4AJ4A 4M7PA 1XRPA 4ZYYA 3VNBA 2ZRNA 3W5SA 2I0FA 2C2HA 4HXEB 1NFRA 4NI5A 1R6AA 3K4HA 5CM9C 4KBYA 1O94C 2RG1A 1WW3A 2W2TA 3LDUA 1AS3A 4J0FA 2FFAA 3HXQA 3ANLA 3A3YA 3CR3C 3JQEA 3IAM1 3RS8A 3KT6A 1SVIA 2VYND 4P0TA 2CCKA 4E5UA 4G1BA 2K87A 4JUCA 5ED0A 1UAAA 3KZXA 3A28A 3LBNA 3QHQA 3KOMA 4PXAA 3O3CA 1U8AA 4KBFA 2UDPA 4JODA 5CA0A 1DHTA 4JQZA 3DAFA 4DJTA 3A4LA 2Z5LA 3EASA 4B3JA 4EUEA 4NICA 1HFWA 2HYIC 4BVAA 4C7BA 2QUAA 1OLSB 2V8OA 3KUUA 3COZA 2PPLA 3O83A 4PYQA 4YO7A 4ARZA 1OUMA 4B2LA 1BJKA 4MV4A 2M6SA 5HK9A 4X65B 5J1SB 3H5WA 3AVTA 5IWCA 3F4LA 3HYSA 4Q4HB 3VR3A 3A10A 5A6VA 1AY0A 1WCYA 2HNAA 4AUMA 1FU7A 2IPLA 4AXXA 5FI0B 5FL3A 1DFHA 1VI2A 1IWBB 3IEMA 4RY0A 3VH2A 1R9NA 1L8LA 1U3GA 2WU8A 16PKA 1V4BA 4GBED 1JEEA 2FSHA 3DV0B 3M6MD 4BZWA 4E5NA 1RXVA 2VEDA 2J45A 5EE5B 3IESA 1WXWA 4K46A 1VBNA 1QTQA 3GLGA 2MSWA 4Y1RB 4LF8B 2I87A 4FYXA 1KJIA 4G81A 4KG7A 4OFXA 4OAPA 1JU4A 5AT1A 1KO1A 5H81A 1A7KA 3O9MA 1OQAA 4E5DA 4HG2A 4Q9JA 4G8JA 2DKNA 1ODCA 1P91A 3Q3VA 5FUVA 2PJUA 1VP9A 3RHSA 4CLEA 3QK7A 1IIRA 5DI3B 1BVYF 2B92A 5DT9A 4BMXA 5F2EA 4XX1A 1ZAKA 2AOTA 3W8RA 5EQDA 1VL8A 3RS4A 3K8OE 4OK3A 2W6QA 1N6PA 4FLEA 1A9QA 1ENYA 2P67A 2IOYA 5HF9A 3M3DA 2FR8C 3KFXA 3K9QO 3QBVA 4P2GA 3UMCA 4CCYB 2AFHA 3R7NA 5DEOA 5HUQA 2BP7B 4FSHA 2QZ9A 3KLNA 4OA8A 5AKZA 4HUTA 4BLVA 2H9AA 2A3NA 3QWIA 2RGYA 5A03A 2FK8A 2LVBA 1SZPA 2ZYWX 1CETA 1KARA 5KJEA 4ARBA 1JS1X 1FTNA 3OWXA 4J1NA 4CM8A 3M89A 3OUTA 2G1PA 1CQJA 3IPRA 3CFYA 3FHLA 4GI7A 4QUGA 4RMNA 5J2UB 3FHOA 1CJKC 2PG3A 3R20A 4JX9A 4P84A 4TPKA 3T9BA 1YI8A 3BDAA 1Y0BA 5TMPA 3Q3CA 1HQCA 2P27A 1H3FA 4LXYA 3OX4A 4YJDA 4Q1CA 1SKMA 5KNCA 3RE1A 2A8YA 3TJRA 4MDEA 1LC0A 2NSYA 4MQLA 4ZDKA 5EC8A 5TSDA 2YVQA 4NU5A 4DJEC 4URVR 3K20A 2QYOA 1ISGA 3ME5A 2E5FA 1ZPDA 3N2IA 3R3ZA 4UJ5A 1BMFD 4D3SA 4WH0A 3V4LA 3E8SA 1ZXBA 1N1DA 5CIWA 2FSPA 1ZNWA 5B1IA 4ND2A 4EJ0A 2I4OA 5KWEA 5MN4A 5GIOE 1SVWA 4GPTA 4KLAA 1RXCA 2NM0A 4H35A 5JANA 4B43A 1Z2EA 3BZUA 2ZRBA 2Z4TA 1L6IA 2PN1A 5CGZA 3QU2A 4H4DA 5LVAA 4BGEA 5TGTA 1JVBA 2Q2OA 4PTZA 3SX2A 2CHQA 3RAGA 2EEZA 5AP9A 3B5EA 2QVGA 4NQZA 3OQ6A 1XI2A 4MPDA 2C57A 2ST1A 3ANMA 3M34A 1E20A 2RHHA 4PLZA 1A7UA 4XYEA 1KAMA 4E22A 4IGFA 5H59A 4ZYZA 1FBTA 2YYYA 3DE5X 3UG6A 1XEAA 1NW3A 3L8FA 3HGMA 1MB2A 1VJGA 5E7MA 3SZUA 4MCHA 4ND3A 4Y2QA 3BWBA 3INRA 2ZIZA 4LYDA 3Q0TA 4QOIA 1I9GA 1N6NA 4XDGA 4IJQA 2CKDA 4MXDA 5JAIA 2X42A 2GZ1A 4QOEA 4BLPA 2BUCA 3AETB 4JH0A 1O87A 2XVZA 4MCJA 3BGWA 1J70A 1KU0A 1NP6A 3E22B 2IEGA 5JJIA 3AW8A 5ITZB 3UMGA 2XCLA 4MV3A 1SH7A 1ZK2A 4LFBB 2CLOB 4MLCA 2G4CA 3N70A 1T3TA 4IXMA 4RPGA 1FW6A 1WV1A 1T2CA 2FCAA 4H1HA 4V0KA 4YCSA 2R96A 3WG9A 1TRHA 3P45A 3UPUA 1DQZA 4G5XA 2HPVA 5H8WA 1O03A 3MXOA 1USIA 2W6ZA 1QVWA 1FFYA 3R3XA 1YJ5A 4B6QA 2PFKA 3JZAA 1QQAA 2HK7A 3RBAA 3N58A 1E89A 1V25A 1NVGA 1Z7GA 4CXMA 4QM7A 1E9AA 3E35A 1VJ5A 2EW2A 2PH7A 3W7BA 1JXQA 3EVNA 2OCDA 1G5HA 3NW9A 3EEQA 1UUFA 4GC9A 5ES3A 4OJQA 3ZPXA 1CF2O 1W1WA 2ONCA 1AKNA 2BJWA 4IIJF 1WP4A 1ZCAA 2DU8A 3X43A 2ACVA 3SIPA 3J81A 5KYNA 3QSYA 2G1UA 1Y42X 2PXCA 4A6PA 4AKSA 1A77A 2RGWA 4NABA 1IK6A 1KEUA 3MAJA 4I36A 1Z29A 1OVGA 4NEGA 4M0KA 3A2NA 4MRNA 4BLWA 4KUEA 5EIOA 1XRJA 2LIVA 4OL9A 5CFNA 3G2JA 3NM6B 1YKGA 3HGQA 3WGUA 3P9PA 2UXDB 2OB1A 4CMGA 5JLJA 3L40A 2XNJA 4EHHA 4F9EA 2X9VA 4I9GA 1TB4A 1NGSA 3I09A 3M7IA 4A82A 1JT9A 4Z9AA 4DC1A 4ISCA 4AMUA 1EVIA 5A3QA 3VZDA 1GUFA 4X7BA 2YRXA 2BKXA 2NZVG 2VJLA 3NOOA 4EEZA 5EJMA 4RV9A 3B3FA 4C4YA 4G0ZA 2JFWA 3CEAA 5DKFA 4RKEA 1L1EA 4RF2A 3VHXA 3ZWOA 3ZGXA 4M8IA 1U1DA 1XV5A 1WOMA 2GLTA 2ZUSA 3IKVA 3OF5A 3D3WB 3PUJA 3TX2A 3DM9B 2HKIA 4FKZA 5AQEA 1GYPA 3HADA 5EJEA 4C43A 1XZBA 4KQXA 5DGCA 1JYFA 4XSHA 4DZZA 2EJVA 4UQLA 4NESA 3OESA 4BQIA 3I1FA 1U4NA 3IV9A 4MJ7A 4UEJA 1AKTA 1N9KA 2PSDA 5MFZA 4YRBA 1R0KA 2AN3A 2VH1A 1VCIA 1V1MA 3DLIA 4UEQA 1X8KA 2EKPA 1C3JA 2WIBA 3ONDA 1DJPA 5LQUA 4U2BA 4D9FA 5CVTA 4RA6A 4C2TA 1NKVA 4MPPA 4BO6A 3TFOA 4K0KB 2FMUA 1FJXA 4XM0A 1GPLA 4CHGA 1DINA 5ER6A 1P1RA 1U7WA 1ADCA 3KZKA 2QTWB 3PNVA 1IM2A 5E7IA 5TIIA 1ORRA 1KZYC 3A58B 2KJQA 6CHYA 2O57A 5HZHA 1FW8A 5ABPA 2IXBA 3DBRB 1SQGA 3ABOB 1TYBE 2PWPA 3TGLA 1ZY2A 3ASZA 4I46A 5SV2A 4UKDA 2Q9BA 4M87A 4WECA 3ZWXA 1QC5B 5EJ5A 1OAOA 4LF5B 2QNIA 1J0CA 4YCAA 4BU0A 1UWLA 1QYVA 2PXAA 4WK6A 5U9CA 1P2SA 2FUEA 4GOMD 1UDBA 1W5AA 2OZVA 4H18A 3THYB 2V7BA 1XSEA 3L6DA 1T34A 1X1QA 2VYNA 1M2VB 1THGA 4HEJA 4EG5A 3OTOB 2D3TA 2N42A 3CLKA 4WDRA 5JVDA 1DAHA 4OIFA 3LTNC 3M0EA 4N01A 4UHHA 3KNZA 4G1UC 7REQB 5I6DA 2MJLA 4M9SA 3NHJA 2QSJA 5HOQA 5KSWB 4BO1A 1XQ9A 2FPWA 3OSZA 1CC1S 3BCSA 4NNJA 4XD2A 3V4PB 4AAYA 1DO0A 1OFVA 2C8KA 3S2GA 5K4HA 5DI9A 3O4JA 3DB2A 2A35A 1UC5B 2NACA 2AR7A 2CYCA 4HNVA 4P92A 5BNFA 4S1VA 3A05A 1PR1A 4DRXA 1W4CA 1G59A 4DSTA 1U4OA 2EBWA 1XL0A 3F9CA 2P2YA 1YJAA 4QGGA 3WIDA 2DWOA 5F1PA 1ZJ5A 1FDTA 1ML3A 2CVHA 3B6EA 3H7IA 3EAFA 4KVZA 4M1YA 1YTUA 4X45A 1II9A 2IV7A 1Z88A 1WQ3A 3Q5GA 3PITA 4L4XA 3BRSA 4FU0A 3KSDO 4CKCB 3TBFA 4C3ZA 4BUCA 5E1OA 3A9VA 2VUUA 2ZBVA 4UBNA 1DX6A 4C0XA 4LZJA 2IOHA 1VJRA 2FCRA 2FR0A 3I9KA 4JJKA 3K6SA 2GXAA 1MJGM 1G7RA 1U8YA 1VQ1A 4KYIB 4CMCA 5A2QA 4F92B 3L8CA 1NSYA 7ABPA 4E88A 3EY4A 4Q1FA 1EQUA 2H0QA 1PQYA 4BDTA 2M32A 3ICPA 3G85A 4TX1A 4MVXA 2Q49A 1RI5A 4BO0A 1NJ2A 3EQZA 3ORQA 4XEHA 4CFZA 1POXA 4GQBA 3UAYA 4AS2A 5BYAA 3BTOA 5IVKA 1IONA 2JEZA 2FDRA 5EXPA 2O4CA 1AKRA 3GPBA 2ZGVA 1GKYA 4LFCB 4Z6KA 5I48A 2UYHA 4GE0A 4O0LA 3L7AA 1EX9A 5CFLA 4F84A 3IUBA 4MJLA 1Z15A 1XMPA 3DKVA 2C04A 4HNHA 4OP2A 3ZIAA 4AWXA 3C97A 1I4EB 2C03A 3GZ4A 3FPSA 4WCFA 3ZWDA 2X41A 3LKDA 1Y5IA 2H4XA 3JVVA 3JQBA 3HO6A 3LX4A 3OE4A 4HVCA 4A1FA 3AILA 1KZ7B 5ETJA 4PONA 1LX7A 4QDKA 1V2HE 1RYEA 2GRUA 3X0DA 4RV4A 5MN6A 1EK6A 3UOWA 4Z8YA 2DH6A 2XYRA 5COQA 4D0GA 2JFZA 2VHYA 5COAA 1RBMA 5FFMA 3ZI0A 1AF7A 4C30A 2CF6A 2QZ4A 1CUUA 2W11A 3R0XA 1P77A 3DWGA 4JC8A 5C5DA 3F4BA 4BFCA 2GBCA 3V8RA 3A9WA 2QX7A 4GT1A 3C3JA 3DW3X 1T2DA 1IRXA 4M9ZA 4W1PA 3B1JA 4NOLA 3ZY3A 1AHIA 3MQ2A 4LYYA 4WBXC 5TE9A 2WWTA 1JH9A 4HDKB 4JQSA 1Z0IA 4IDAA 1HURA 3QOWA 5JISA 4KGDA 1RCFA 4ZVSA 2EG9A 1Z4IA 3BXPA 3FFXA 1QDLB 3BJRA 4TTJA 4W6QA 4GF5A 2EIHA 4A3SA 2J59A 4EIWA 2C83A 3GRVA 1OLXA 3ADPA 1MUUA 3TQIA 4A2WA 3OJFA 1NE7A 1X74A 1DRWA 1FC0A 2XTZA 4X9XA 2O8FB 3THXA 3G5UA 3RSCA 4AY3A 2BMDA 2XDYA 4IDHA 4D92A 2I2AA 5FI3A 4JB3A 1IYZA 4QFBA 1Q19A 2ZSAA 3JQBC 5H83A 4CZ2A 4XUCA 4LDZA 4FM9A 4H7JA 4P5DA 4NULA 4MHSA 5F2NA 3E4CA 5HTOA 4RKYA 2O8EB 3IOYA 1RQPA 4O1MA 2CZCA 3DP7A 1EUQA 1NZJA 1HG1A 4BVFA 3DE1X 3G3EA 4E1BA 3PGA1 2GH1A 4BEJA 1YL7A 4IAOA 4UBIA 2WT9A 4FIDA 2AKAB 3N8IA 4EI7A 2NIPA 4UQPA 1I0IA 4ABTA 1MOPA 4PZCA 3MGGA 1YONA 5F7JA 3RS5A 2ISQA 3GJZA 2CF5A 4NENB 4QASA 3ZY4A 4NQRA 3W05A 4AWBA 1C41A 2XHZA 3UV7A 1Q0UA 4N9WA 4XJTA 4OHBA 4JI5B 4CFYA 4MV7A 4ZJYA 1Q7EA 3PGVA 2XA2A 2BEUB 2HV9A 1A9XA 3CNHA 1U1CA 1L0BA 2I7CA 1IJFA 4R2XA 4EF5A 2QU7A 2DC1A 1A1SA 2W98A 4MKIA 5KWSA 2WA1A 1LJLA 2YIDA 1ML4A 2C94A 3GFBA 1ISSA 1WUTA 4WLUA 2GA9A 2OHJA 5ALFA 5DP2A 3QLTA 4H59A 2BFDB 1MGPA 4K8RB 4ENVA 1B8UA 4S0XA 3W5VA 1G8JA 1N2CB 1RRMA 2SCUB 1WD7A 5KYXB 3LGXA 5AI5A 4D97A 5EJIA 2C4WA 2FG5A 3G6KA 4DQKA 3DBHB 5L95A 3KXLA 3TF5A 5CLIA 1XYVA 3L46A 4BO5A 4E2FA 3DBRA 1ZJWA 1NAIA 5KYTA 4CIBA 1UBEA 2IIQA 3OIFA 2CV0A 2GBPA 4IO1A 2PS0A 4BJHB 1VI6A 2VT6A 4LI3X 4XA8A 4QD3A 1L5OA 3IJ5A 3W2FA 1P0FA 5AQ1A 2H29A 1LK7A 3DFMA 1C3OB 5A02A 2YY5A 2HU5A 3MCZA 3A06A 2H5LA 4LE0A 5KAPA 1E9FA 4ZVKA 1ATIA 2WABA 2KW5A 3OZXA 4QC2A 4DQVA 3PEWA 4YRFA 3JASB 1BOOA 3LLCA 3PSHA 3N0WA 3SC6A 1EP9A 1Z4MA 1GFIA 1GY8A 2EFJA 3WGYA 1I7LA 2VWGA 4KITB 4C29A 1SGWA 3K2BA 1RZRA 1JIKA 1W9MA 4W1SA 2IYWA 4ZK6A 4F72A 3CLHA 1GL7A 4WXRA 4QZVA 3V7YA 5K8LA 3NTQA 2QRNA 1COZA 2KWIA 2OFXA 3KAQA 3NBUA 2IRWA 3OO0A 2OGTA 1XMXA 3G9ZA 2NU9B 2YJ4A 3ABZA 1YI1A 2EW1A 4BB0A 1OXTA 5CITA 3PA8A 1KZ1A 4HEHA 4DNXA 2BTQA 3O95A 1KI9A 3WNBA 4P0PB 2QS9A 4B84A 1NVVR 5F9MA 3LTEA 5CJPA 2O06A 2R68A 1UPXA 2OZEA 4CUKA 3RRXA 4BNIA 1GGNA 1O57A 2WTUA 1T1GA 1K5PA 3U7RA 1E4EB 1SR8A 3LC1O 1H6AA 3OCJA 3ZHCA 3CU5A 2EQBA 3ND9A 4MAMA 4TWAA 2NX2A 6REQA 5K8IA 3AEKB 4FN5A 2OCAA 3ZWCA 3MCUA 5HDBB 4HWGA 3N07A 3LUBA 4J75A 3TTTA 1QF9A 1O5OA 2H1FA 1QFXA 2VF7A 4GKVA 4LJ5A 2FLKA 2VKQA 5E2BA 1TT7A 2VLIA 1G6KA 1E77A 2LKCA 3JSAA 3QU4A 4IBOA 4H27A 3RTCA 2ZIXB 4RVFA 2FX2A 2Q45A 2LGJA 3FTCA 3IQFA 3K8QA 4G07A 4GP7A 4XI9A 4B8ZA 1WEKA 4Z4IA 1MC5A 5A9TA 5FI1B 4IM7A 1HLDA 3DL0A 2G40A 2XE6A 3D0QA 3KD2A 3MLBA 1KE2A 4BAUA 5A4DA 5K9ZA 1NUQA 1JLHA 4WN9A 3IP1A 1G55A 1L2TA 3FB4A 1EGHA 2MT9A 2NVOA 3PQ3A 2NUAA 5BW5A 3KPVA 2IU0A 2Z09A 1ORHA 3BGOS 3DHYA 1G2PA 3OLZA 2HIHA 3PFCA 5F77A 5F3RA 3L8HA 2AK3A 2P2DA 4W8OA 1E3WB 2IXEA 4WK4B 3UMJA 1WV0A 5JQGA 3U09A 4UHEA 5KUTA 1U02A 3LV8A 3PV0A 1IDOA 3OUZA 1YL6A 3IQXA 3QPDA 1RIFA 3PGMA 4HAOA 3U7QB 4C4OA 3WIVA 5JS8A 1UBTS 4O4IB 3R8FA 1BSVA 1JAHA 3QXJA 4WZAB 3NEJA 2CUNA 5C2JB 2MSLA 3NIGB 1CQXA 4O4HB 1LVGA 3RUIA 1CXZA 3X1JA 1SG6A 2QJTA 4FOTA 2G09A 5FPKA 2IIBA 3DDSA 1J49A 1ZI9A 4GBGA 1E69A 3IUMA 3TOVA 4KNWA 3LC0A 3QPWA 3C3CA 4GX5A 1FRQA 3SXUB 4WKBA 5DZSA 4ZARA 1BE0A 2ZEJA 3RRNA 4FS8A 4GVLA 5HCNA 3CY6A 2OB2A 3T0IA 5I8WA 4X71A 1JQJC 4D9HA 5C37A 1QFSA 3IR6A 4FFPA 3AUXA 2RG7A 4RAQA 1P7WA 1E3JA 1E1QA 3H1EA 3ZU6A 4HAUA 4QJ3A 1O95D 4N47A 4M53A 5I9MA 4FJ1A 3GG2A 3EODA 2Q0XA 1QYRA 1RQ7A 1XZIA 2VUHB 3T7RA 4WNIA 3D7KA 3I1IA 4IDOA 1XCBA 4Z0PA 3UGKA 5I5EA 2VJAA 4KACA 4EJFA 1E98A 3CX3A 3IELA 4F4CA 4JI8B 1T36B 2KLBA 4US1R 3N8GA 1CNMA 1NVEA 2SBTA 3MF4A 2GJSA 3L84A 3OJEA 1A76A 2XECA 3UUEA 3HR4A 4NG5A 1FTQA 1JR3D 2TMKA 3C7KA 4KPUB 1QQTA 1RHMA 2AG5A 4L27A 3WQBA 3FSJX 1E3SA 1I4TD 1O1YA 1UJMA 5JW6A 2QDXA 4QBHA 3RC9A 3KOWA 4TMFA 1AGPA 2V7EA 4IOLA 1SXGA 3LNTA 1D5CA 3B9BA 4J3JA 4K86A 5LM3A 2VRNA 4OLFA 3W5CA 2IDKA 3GLRA 1JG1A 1UQUA 4C07A 1JJBA 4D41A 2GDJA 4AUNA 3BZBA 1MV5A 2CXNA 3MD0A 1LNSA 1Z8HA 2O6LA 1WUIS 4CMIA 3G2NA 1B4DA 3ISVA 4XX0A 2NN3C 3VFDA 1MW9X 2OYCA 3K0AA 5LSAA 3GDOA 1FX0B 2R86A 2CD9A 3GUVA 3IRUA 1MAUA 4D56A 2HJ9A 4QLAA 3CKKA 3KYCA 4OBEA 3RCBA 1N1GA 1JEJA 1HKHA 2QQ5A 2ZRFA 1XDZA 3QWAA 4MMYB 2R84A 4WT7A 4FXPA 2UZ4A 4JYBA 4WGFA 2IHBA 3C70A 3PPWA 4YRPA 3BWDD 3TINA 2W2PA 4AG5A 2OQIA 4XZ3A 1J22A 2YVLA 1KGSA 1SURA 1X8XA 4U2FA 1VE1A 3FYHA 1QQBA 1LTQA 5EZYA 4KW7A 2O52A 5CT8A 4KREA 4WOKA 2P0YA 1WY7A 4LQ4A 1MOQA 1M8PA 4Q3EA 3KQSA 3O93A 4B4KA 1H8ED 2C0PA 3EDYA 2HDNB 4HLDA 2JATA 1Q1EA 5FWDA 3PQ4A 2WA2A 3FYUC 3RYHA 1S96A 1C3OA 2WICA 4MWGA 2Q9AA 4N5LA 4CQLB 5C4MA 3G0DA 1LPNA 2HJSA 5C5CA 3DOCA 2JGRA 3CR8A 4IDXA