4WOKA

Crystal structure of udp-glucose 4-epimerase from brucella ovis in complex with nad
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
325
structure length
325
Chain Sequence
ANNVLVVGGAGFIGSHTAKLLAGQGYAPVVYDNLSTGHQSAVRWGDFVEGDILDQARLVETMEKYAPVAVIHFAASAYVGESVEDPAKYYRNNVGGTQSLLDACRLTRTQNVIFSSSCATYGVPSRLPIGEGEAQNPINPYGRTKLIAEHMLADYAVAYGLRYVALRYFNASGADIDGELGEKHDPETHLIPRAMMAAAGRLDVLEVYGDDYETPDGTCIRDYIHVTDLARAHVLAVEHLKEAGGNLAVNLGTGRGTSIREIVQSIGRLTGRSVPVAMRARRAGDPPALYADPALAAEKLGFHTVYSDLDTIIRTAAPHFGLEVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of UDP-glucose 4-epimerase from Brucella ovis in complex with NAD
rcsb
source organism Brucella ovis
molecule tags Isomerase
molecule keywords UDP-glucose 4-epimerase
total genus 117
structure length 325
sequence length 325
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wokA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4wokA02
1T2DA 2Q2QA 2VTEA 2RBEA 4WE3A 4D42A 2YQ5A 1TT7A 3AM4A 4BS9A 1NYTA 3D4NA 1P0CA 1E7MA 5TC4A 1Y8RB 1O94A 1YBVA 2AXQA 1D1SA 1GYPA 2X5KO 2VUUA 2GN6A 3E82A 1ENZA 2P5YA 4IDFA 1E3SA 4LSWA 4OOFA 1T4DA 1O8CA 5T8KC 3QV1A 3RKRA 4E6PA 3NJ4A 5HWSA 3QVOA 1UP7A 1HDOA 3PJGA 4FOSA 5CPFA 4AJ4A 3GA0A 1MXHA 1SCUA 5AXDA 1E7RA 1NVGA 5A06A 4RF2A 1VPDA 3TOXA 2SCUA 2VTDA 4W99A 4D0SA 5EL0A 3K2BA 1EVYA 1B14A 5COAA 4L73A 4EDFA 3ETGA 3MWDB 1YL5A 4QFDA 4DLAA 3PYLA 2I9PA 3HN7A 3KYCA 1X15A 1E5LA 1XELA 3W4JA 2EWMA 4CM4A 4OXKA 2IYOA 4JX8A 3BA1A 4CM6A 2AG8A 1X0XA 1F8GA 2VHVA 2W4QA 4KZPA 2X1HA 3TSCA 3DZBA 3EAGA 3GVHA 3QSGA 4Y67A 1DEHA 3LLSA 2VWQA 5JAZA 2D2IA 3K5PA 2VUSA 3UGKA 1BG6A 1PS9A 3F9IA 3O9ZA 1Q2XA 2NQ8A 4PRLA 4WEOA 4DQUA 1YGYA 4CMBA 1XWFA 3ROPA 2EP7A 4BO5A 1I33A 4R68A 3HE3A 1M75A 4NI5A 5C3MA 1EK5A 3KETA 1CQIA 2HMUA 4R54A 3RKUA 4PLYA 3SX2A 3E18A 4M49A 4EJ0A 4DPKA 4RVUA 1UZNA 3IMFA 3CE6A 3QVSA 1C1XA 5JPIA 2AEMA 1N2SA 3TL3A 3V2UA 3V8BA 3MZ0A 2NVBA 3TOZA 1V6AA 2QW8A 2EJVA 3GRPA 1VC2A 2VQ3A 4ZD6A 1ZUD1 1HSZA 2WM3A 1HE3A 4DLBA 3CMMA 4FOOA 1JWAB 2OBNA 1Z74A 2XF8A 1VL6A 1ZSVA 2DC1A 3L9XA 4LN1A 4NPCA 4RPKA 3WGGA 5IZ4A 1VSUA 4IBOA 2NTVA 4EW6A 1YE3A 1T1SA 4QUKA 2BFMA 1FJHA 4IUYA 3NX4A 4PLTA 1BW9B 5DDIP 1JAYA 4S1VA 4TZTA 2QYTA 3OJEA 4CMGA 2HK9A 2HCTA 4CMJA 2W2KA 2EGGA 1HZJA 4M86A 4TRJA 1QMGA 3CUKA 4GLLA 3GY0A 9LDTA 1HYGA 4J0EA 1E7QA 2YHIB 3EK2A 3BHJA 5BT9A 3WMXA 3KYBA 4BNHA 2PWZA 4CMIA 5A02A 2ZTLA 3V2GA 4G81A 4CPDA 5DCYA 5I7SA 3FCOA 1Y81A 3FSRA 2I65A 1PGQA 1JN0A 1AN9A 4HY3A 1E1KA 4OQYA 3RUAA 2E49A 5IZCC 3GMDA 1ZJZA 2VWHA 3GT0A 4J4HA 3OJ0A 4MP8A 1HRDA 4RF3A 4KUGA 1KY4A 3OFSA 4ZQGA 2C2XA 3VVBA 2YV1A 2DBRA 2I3GA 2YHIA 4LCEA 5COBA 1NQOA 4IJUA 3C8MA 5JS6A 4RPLA 1XU9A 3TF5A 1SAYA 2JFFA 4GVXA 4D3SA 1ZXBA 3GNSA 1X1TA 4BNVA 1TT5A 4NJMB 1NAHA 4GVLA 3PHIA 3FHLA 4YCAA 2I5PO 4TRNA 1U1IA 1P1JA 1YB4A 1GR0A 3KBOA 4R3NA 4R9SA 3PRJA 4GLOA 3W4KA 4R69A 1Q1NA 3N74A 2PZJA 2JCXA 2JFHA 3NV9A 3IUSA 3ICCA 2PV7A 3F4BA 1KEUA 2RAFA 4BKUA 1KVQA 2W8ZA 1QG6A 1DOHA 3JCZA 2UUOA 4ZJUA 4XQ9A 3B1FA 1Y9EA 3KRTA 5KWEA 4ZRMA 3MWEB 3HG7A 1ISMA 4ND1A 4AVYA 1P0FA 4LRTB 3DHYA 2VN8A 3GOHA 4KDFA 2ZB3A 1WXDA 4FD3A 3ZDFA 4DC1A 3U09A 2B0JA 5HRUA 1HL3A 4BNTA 1J6UA 5CAEA 3RFVA 2YJZA 1VKOA 3EW7A 1U2GA 4XYGA 2ZK7A 4MINA 2CDAA 4D3FA 1P1FA 3INTA 5GY7A 2GD1O 3WDSA 3GGOA 3ONFA 2G1UA 4LSMA 1XDWA 4YPOA 3Q0EA 4P22A 3VC7A 1QSGA 2FOIA 4OXNA 3B6ZA 1GDHA 2P91A 2BFAA 1A9YA 4I5FA 2BD0A 3FNEA 4CQMD 2DTXA 5KJCA 4FC7A 4JJFA 3OA0A 3C7DB 5JDIA 3V1TC 5JC8A 1LJ8A 1MB4A 5EINA 4R9RA 1JKJA 1B2LA 2D5CA 3T7EA 1A9ZA 4E4YA 2E4AA 3MTJA 4NMHA 3S8MA 3WX0A 5K6AC 3KSZO 2HJRA 5T57A 3IKVA 3PI7A 4ZQHA 3I9KA 1ZK1A 1WDKA 1GQYA 3EZLA 4N5LA 4PFJA 1YO6A 4EEZA 3HWRA 5KCZA 2WYVA 4BNGA 3RCBA 1ISJA 4H16A 3WYEA 1IY8A 3WLFA 5CDGA 1Y6JA 4YJFB 1N8KA 1ZMTA 3GVIA 1E92A 3WJAA 2NWQA 4O0LA 2AHRA 2Z95A 5U1PA 1HXHA 4YRAA 1NWCA 3VH2A 1WNTA 2JJYA 1C3VA 4D79A 3GZNB 3WR5A 4MVJA 3WTCA 3TNLA 1WAMA 1U4SA 5ES3A 4WUVA 3P19A 4XQCA 4TWRA 1AHIA 4CMKA 1DBVO 4GMGA 4KOAA 5I7VA 1Y8QA 1HE2A 3JQ6A 3BHMA 1N7GA 2DU8A 1FDWA 3LK7A 3FRJA 4WLOA 3TL2A 2ZQYA 3ZU4A 2TMGA 2OMEA 4E5YA 5DOVA 3PXXA 1PJTA 3DTTA 4E0BA 4JGBA 3EHEA 2NQTA 1MFPA 3DBVO 3KSDO 1ONPA 4CLHA 2IDZA 4P4GA 1YOVB 4CL3A 2D4AA 3LC7O 3UXYA 2RHCA 2O3JA 2GLXA 4LMPA 3UOGA 1Q0LA 3GN2A 1D8AA 2EEZA 3V1UA 5IDQA 2QIOA 1KEWA 3AY7A 4CQLB 1T4BA 1SEPA 1C1DA 1M6HA 3V1YA 3OECA 4BV8A 4F45A 3G79A 4NU5A 4E2YA 3JD0A 2Z1MA 5CG2A 1QYVA 1QXSA 1XLTA 4ZRNA 3I52A 2OXIA 3KSUA 1RJWA 2EV9A 3INRA 1EE2A 3PQEA 4WNIA 4BNJA 3BHIA 5G4LA 3ZW9A 4GGPA 4DWVA 2FR8A 1N92A 3UCXA 3AU9A 2Y0EA 2NSDA 5B12A 2ZATA 4XRGA 4BUCA 4WEQA 4YT5A 4Z0PA 3M6IA 3AW9A 2VZ9A 2AQIA 1O95A 4NG5A 2I99A 3U3XA 3LT0A 3JSAA 1U3VA 1DFGA 4C4OA 2J8ZA 1KBZA 3ZHBA 5BSHA 2FSVA 1X7HA 1R15A 2W90A 1YDEA 3IKTA 1K6XA 4AJOA 4CM1A 1R0LA 2NTJA 4A0SA 3PDUA 4R5MA 5FFFA 3MOGA 1PJ2A 4H3VA 4RZIA 3IL2A 3OM9A 2HMWA 2GZ3A 3ANNA 2VHZA 3ZHXA 3DR3A 5TGDA 1IZ0A 3F1KA 4NH4A 2X0IA 3QW2A 5L40A 2QRLA 2GRAA 4D0RA 4CLRA 1HT0A 2D8AA 1VJ0A 3ASUA 3K8ZA 5DCWA 5ENDA 2A94A 3QWBA 4YRBA 1NVTA 2PZKA 1JKFA 3QRWA 1E3LA 1Z82A 4OAQA 3WGYA 3DFZA 1R16A 2TMDA 3GN1A 2ZYDA 1H6CA 1WPQA 1YL7A 2C0CA 4IXTA 2WJPA 4XGIA 4AJHA 4Z9FA 4RLHA 1E5QA 3RIHA 5BR7A 3GAFA 4L74A 4RF4A 4DXHA 3KYDA 4GKBA 1BDMA 4PRKA 1CQJA 3NGLA 5CDUA 8LDHA 4XCVA 2EKQA 3BAZA 2Y0CA 1YB1A 1G0OA 4YAKA 2FZWA 4IIUA 1YB5A 2PKQP 2VRCD 1BXGA 5F1OA 5IFLA 4Y8VA 1NXQA 2G17A 5IN5A 3S2GA 2Q2WA 3VPFA 4AJNA 1CDOA 2RHRA 3FF4A 1S6YA 3EC7A 2NUAA 3FBTA 1GYQA 3KYDB 1DRUA 3DMYA 3OBBA 4J1SA 3H8VA 3JV7A 1YONA 3NTRA 4BB5A 1MLDA 2NNLD 3O8QA 4F46A 4J1QA 4MVJH 3ETDA 3GGPA 4RQUA 4HFMA 1K5HA 4DMMA 1AHHA 4BMNA 1UAGA 4TVOA 4WLUA 4IGEA 4JNKA 3U9LA 5H83A 2YQ4A 3PZBA 1DC4A 1HE4A 4B8WA 1B15A 1EK6A 3DBRB 1AXGA 1NPDA 2A9FA 4J90A 1QKIA 1BXKA 3FNHA 3JQGB 1R0KA 2RH4A 3QQPA 1X7GA 1AGNA 1NX6A 1PL7A 2PD4A 3ZWCA 3H4VA 3PJDA 4B79A 4XWYA 5C7OO 3VKVA 3FR7A 1HDYA 3KV3O 4JXKA 4BNYA 4R16A 1F8FA 3TDKA 3WTBA 3ULKA 4XIJA 3SVTA 1R4NB 2P9GA 5FF9A 1GU7A 1I0ZA 2FHSA 4MJLA 3SBOA 4E30A 3FN4A 3PQFA 3JQFA 3PLNA 4PVDA 5CDTA 4PG7A 1KETA 3AM3A 5L7TA 1DIHA 5BNIA 2HLPA 1A71A 3GPIA 3IS3A 3MJEA 3DZHA 2PFGA 5KNLA 3GDFA 1DC3A 5IG2A 2ZYAA 3HUDA 2WE8A 3PWSA 1EUDA 4K6CA 3PVZA 4E5NA 1B0AA 2AE1A 1R4MB 2NV6A 4FN4A 4I1IA 2VHXA 1BW9A 1E1LA 4OOEA 4I9NA 4XQEA 1TA4A 1NFQA 2B5VA 4NFSA 5FWNA 3AI1A 1WZEA 1QLHA 4CMCA 2O3SA 4LVCA 2IEBA 4MKRA 3GDOA 1D1TA 4PZEA 3TZ6A 2CUKA 1F14A 3HDQA 3IOYA 4BKQA 5DOZA 3RAJA 3DAPA 1PZHA 4QECA 1E6UA 1YQGA 1NPYA 4K6FA 1GZ6A 1NQ5A 1P74A 4M1QA 3U49A 4TVBA 5AXBA 1SMKA 3IJRA 2VWGA 5MGBA 2Q1TA 3DTYA 4FBGA 1J5PA 2BRUA 3ZNNA 5JC1A 2O50A 2GN8A 1ZMOA 5KJ1A 1YBAA 5EPOA 4E2XA 2Q4BA 4XX0A 4YB8A 4YT2A 1VL0A 5AQ1A 3JD3A 2NU7A 5JXWA 4YYZA 3VDRA 2C59A 2PD3A 3CZRA 3AWDA 3O26A 4HP8A 3BXXA 4U7WA 3L4SO 3DZFA 1B8PA 3QE3A 1RM3A 1T2EA 3AUSA 6LDHA 1YL6A 5CEJA 2LDXA 3S2EA 1GPJA 3VPHA 1B16A 2W2LD 4D44A 4CL8A 2VT3A 1DIBA 4JQCA 5CDSA 4KTVE 4Z0HO 5A04A 3I6IA 4WPGA 1P3DA 2VYND 4L9RA 4ND5A 1CIVA 3MEQA 5CEEA 4L4RA 5ER9A 4BNIA 5JSFA 1P31A 1FDVA 2H9IA 2VYNA 4EYEA 6ADHA 1JQBA 2NACA 1U9JA 1PGOA 3RBXA 1EQ2A 2BI7A 2GZ2A 3N58A 3TPCA 4OHUA 2Q50A 3F46A 3ZNQA 1EDOA 2UAGA 4FFMA 3DOCA 1A7KA 3LU1A 1U28A 1BGVA 2G5CA 2DKNA 5C5IA 3WQRA 5KVCA 3RU9A 4R1UA 4ALKA 4W7HA 1LA2A 4NQZA 3QWAA 3SEFA 2Y66A 2JKVA 4R1NA 3EMKA 2E6UX 4KQWA 2O3QA 3L4BA 1BHSA 4YAIA 3DONA 1OOEA 5G0WA 1I3KA 2A92A 1K6IA 3K92A 4NR0A 1KVSA 2HRZA 3MJSA 3LDHA 4CMEA 3OJFA 1Z7EA 1BTOA 1RKXA 2HU2A 1LC0A 4BIIA 4O63O 4CJXA 3WICA 4MVJF 2FN7A 3B70A 4AJEA 5CPBA 1EBFA 2BGLA 2BF7A 2DQ4A 4TZKA 4J16A 3RSHA 4O1MA 2AG5A 2R00C 1IUKA 1PS0A 3DDNA 3GG9A 3T4EA 4QX6A 4ESOA 4XA8A 4YBZA 3S2FA 3WGZA 4GBJA 4R1SA 4CR6A 4WJZA 2BHLA 3UH1A 3FWNA 5EIOA 1YBMA 3GPDG 2HJSA 2O48X 1DAPA 4GI2A 3CH6A 4K9DA 4TRMA 5JLAA 4CQMA 3OHSX 4A73A 1H2HA 3OETA 2P9CA 4HNGA 1LDNA 3VH3A 3DHNA 1XG5A 3VKUA 2ZJ1A 3VAZA 4HUJA 4HADA 1YH3A 2E82A 1U7TA 2CF5A 1SOWA 5A1TA 2D3TA 2Q49A 3AU8A 3ZWYA 4CM7A 3WBFA 1GY8A 4JP2A 2PLAA 4XB2A 1L7EA 2CY0A 3W8EA 4ZGWA 5LDGA 2P4HX 2EGHA 5L3ZA 3PJEA 2AMFA 4BMVA 1XIVA 3VPSA 2PKRA 3OQ6A 4IJWA 3GZNA 4W9NA 1GEGA 1PZGA 4B3HA 1MV8A 3R0IA 5A9SA 1WMAA 4ONEA 4M89A 4NJOA 2IODA 3CIFA 3QVWA 3ITDA 4MP3A 5AXCA 5IJZA 2XAAA 3FWZA 4YAGA 3O8QB 5ICSA 2PGDA 2W2LA 2NTNA 3WSWA 1KS9A 1KC1A 3JYQA 1LDMA 3MTGA 3WG9A 1VM6A 1ZCJA 1UP4A 3RC9A 3ICPA 4MVJP 4MP6A 4L76A 4MVJD 3F5SA 3AFNA 5F3RA 1LDBA 5DZSA 2O23A 3KLPX 4XR4A 3Q9NA 4WGGA 3HHPA 4E2ZA 1DJQA 3F1LA 3GVCA 3JQ9C 4BOYA 5U9CA 4K1LA 4KP7A 3E9QA 4HX5A 4U6SA 2C5EA 2VYVD 4NBVA 5TRTA 3K30A 2C54A 2X5OA 3P7MA 1ISFA 2JAPA 1PR9A 4DVJA 2Q4EA 3KLMX 2V6FA 1BVUA 1PQWA 1M2WA 3NT5A 3JYLA 1DJNA 4DYVA 2FPPA 1W8DA 2JHGA 3AM5A 1P1IA 4XYBA 1PJLA 4YQZA 4TKLA 4JK3A 1EVJA 3OSUA 3V2HA 2GZ1A 1ONNA 3GAZA 1ORRA 3HSKA 2AW5A 4YJHA 3E48A 4W4TA 4RVFA 4PLPA 2DFDA 3BTOA 3ZH2A 4BGEA 2PD6A 1GYRA 4IM7A 4BKRA 3FPLA 4HFRA 3E9MA 4NHEA 1CERA 1KERA 1R4MA 1VI2A 2HDHA 3K31A 3WXBA 4TQGA 1QYXA 2D5AA 4IDGA 4Y6RA 4ZA2A 3E1KA 1I01A 1WMBA 2B5WA 3ROKA 3L07A 3VOSA 4GL4A 4O59O 1N9GA 3ZI0A 4AJ1A 4A03A 3H9UA 2Y1FA 3E8XA 4WLVA 3ANLA 1A7AA 3TZQA 1LDGA 3U4DA 1EDZA 4YJDA 3TZHA 4XYEA 5C7IO 5DN9A 5JAQA 4B7XA 3PWKA 4BO3A 4ILKA 4FC6A 2OGUA 4WCFA 5AOVA 1MX3A 5LCXA 1I36A 4P4NA 4XKJA 4NIMA 1EUCA 2XXBA 3CSDA 1YRLA 1E6WA 5HTOA 4J9UE 4I8XA 1AE1A 1DRWA 3ABIA 1K2WA 3JQDA 1ARZA 3Q11A 2H63A 1Z73A 1H0KA 1B8UA 1CJCA 3B1JA 1WP4A 4J3FA 4NBTA 1JAXA 4OSOA 4FGWA 1B3RA 2HK7A 2X0JA 4MVJI 3BIOA 1VLLA 1I30A 3GR6A 1I2CA 4YWJA 3EUWA 5ENVA 3HZZA 5JCJD 4FW8A 2QYSA 5THQA 5DBFA 4EJMA 1M66A 5A5FA 1H6BA 3M2PA 3KVOA 5ILOA 2NM0A 3PFWO 4J9VA 3IJPA 4N7RA 2X58A 4CLXA 2C7VA 4KMSA 4FFOA 4CMHA 1KVUA 1NHGA 4GKVA 1LNQA 4PLFA 1ZJYA 4TRRA 5DULA 4MIEA 3GVPA 1OC4A 4NDNE 2CF6A 2CVQA 2BGMA 2ZCVA 3VZQA 3IP1A 3PLRA 4IIVA 5G0VA 2A4KA 2LDBA 3FTPA 1EFKA 2OORA 3OIFA 3JD2A 2CMDA 1U2DA 3ROMA 4RPGA 1FF9A 3ANMA 4MVJG 4BO2A 1TVEA 2Y1CA 1P45A 4FPXA 1PIWA 2HUNA 5ITWA 3RJ5A 5ITVA 1T25A 3W1VA 3U4IA 1DIGA 4HXYA 4Y6PA 3WFIA 1JKIA 4UAGA 3TZCA 1UJMA 4MO2A 3H9GA 2GF2A 4NBUA 2UDPA 3H3FA 5JYDA 4AG3A 3BMCB 5C37A 1UAYA 5L53A 3BMQA 2C7GA 2EP5A 3ENKA 3UF0A 3O4RA 5KVVA 1TB4A 3NTOA 1ZW1A 1CEQA 1PU2A 1XU7A 4CLEA 2EF1A 3KXDA 4BQPA 2BLLA 3NTQA 4IS2A 3G49A 4XIYA 2JHFA 3U5TA 3RASA 4WNCA 3G17A 3JQ7A 3QP9A 1CWUA 3GNQA 4CMIB 1HETA 4S3MA 1GAEO 1Q7GA 2GR9A 1KY5A 1PS8A 1NQAO 1WVGA 1H9AA 2D59A 2H1SA 2NU6A 3FPCA 4IMPA 3OIGA 3B20A 3DB2A 3QWIA 3G1UA 4XYMA 4RDHA 3GH3A 4PLWA 4YAJA 2CZCA 4IJVA 3T7CA 4I5EA 3VTFA 4QEDA 4YA6A 2YDYA 3VH4A 4XEHA 3ZCXA 1GV1A 2Y1EA 1U8FO 2Q99A 1XGKA 3OQBA 1OFGA 3DMTC 1B3BA 4QO7A 4CV2A 1HWYA 3H5NA 1HDCA 4D43A 4II2A 2VYVA 4XYLA 2O3UA 3PWZA 1NHWA 4EI2A 1VRWA 4L75A 5AVOA 4II3A 4AJLA 5IN4A 5BQFA 4DPLA 4R01A 1UXGA 1E3JA 2Y1GA 3CEAA 3L9WA 4RVGA 3DHEA 2B36A 4BO4A 5JDIC 1XEAA 5IXSA 3IAHA 1FMCA 1DFHA 1I2BA 1SB8A 5TT1A 3SJUA 3LLVA 5A9TA 2ZJ0A 2ZB7A 2F00A 1ADBA 4DRYA 4YXFA 3RROA 3UN1A 1NR7A 4DQXA 1LUAA 4KUHA 5F1PA 4NU6A 3JYNA 4UUOA 3GFGA 4IJKA 4FSHA 2G0TA 3ZWNA 3RD5A 2QHXA 1ZK3A 3EVNA 4QXMA 4J2HA 4D41A 2B35A 4KQXA 2GN4A 1O9BA 1GFSA 4LGVA 3WLEA 1HSOA 5K9ZA 3KOUA 4YQYA 3GVXA 4JBHA 4WLNA 3UUWA 4OQZA 1PWXA 1XCBA 4RJTA 2FSSA 2Y05A 4YDRA 5GZ6A 3PGXA 4KUEA 4O6VA 2AE2A 1C0PA 1K3TA 3D3WB 3VHRA 4BL5A 4HWKA 3DXFA 3GNTA 3HQ4O 1I3MA 4M8SA 4DA9A 1U3TA 4R4JA 2J5RA 2EKLA 1NFFA 1RM4A 1E3WB 1IPEA 4N5MA 5JDCA 1GPDG 1B8VA 2B4RO 5JAIA 1LSOA 4NJMA 4TMFA 3NRCA 3UKOA 1LLCA 2GGSA 4IS3A 1E77A 1PSDA 3PFFA 3ZV4A 3Q2KA 1IE3A 1PJ4A 4PGFA 4Z9YA 3KB6A 1ISIA 3AJRA 3RUIA 3VPGA 1E7SA 2J6IA 4FJ1A 5B1YA 3K9QO 5ILGA 4AJPA 1ZO8A 4DLLA 5JMPA 4B4WA 4J43A 4URFA 1JU9A 3DBLB 3RQSA 4E13A 5JW6A 3DEYX 1LLQA 1IHXA 1K0UA 3AFMA 3GFBA 4JIGA 1H93A 1UDBA 1SNYA 1TEHA 4N54A 1UR5A 4Q3CA 1F0YA 1ZEJA 5I9MA 1YQDA 1MG0A 2JD1A 5CFZA 1LRJA 3D3EA 1KIFA 1BXZA 9LDBA 1SC6A 1J49A 2CVOA 1CF2O 3PPIA 1P9LA 3NGXA 3GZ4A 2JCVA 5KVSA 3HB4X 4CV3A 2ZCUA 2O2YA 3L77A 1A5ZA 4CV1A 1H6AA 5TF4A 4B4VA 1NFRA 5DT9A 4FFRA 4X54A 3PYXA 3UCFA 5T8KA 3D1LA 1GEEA 3FR8A 2DM6A 4EBFA 3MOIA 1I3NA 1AUPA 3W8FA 3OJLA 4ND4A 2PKQO 1OAAA 4K26A 1YWGO 5LDHA 3F3SA 2OO5A 1PEDA 1UXHA 3SC4A 4Q3NA 1UDCA 1UP6A 4R51A 4ALIA 4BNWA 1Z75A 1M6WA 3GGGA 4J49A 2YDXA 4ITUA 2DT5A 4UUNA 4UULA 3W4IA 3GQVA 3MJVA 4FIZA 3HDJA 3DZJA 1YDWA 3AOEA 1N1GA 3AY3A 4ALLA 1EEHA 1R37A 3RI3A 2C29D 1P44A 4XJTA 5LC1A 1DB3A 1R0SA 4CM4B 3RUHA 4AJ2A 1UDAA 2Z5LA 3AI2A 1VL8A 3TZKA 5K0ZA 3LC2O 5GMOA 1C14A 1H9BA 4BMSA 3I4FA 4MIOA 3WGIA 3SJ7A 1V8BA 3K73O 1R4NA 4DL9A 1C1DB 2XXJA 2EERA 2JFGA 3TRIA 1SOVA 5GZ1A 2G82A 4J1NA 3C1OA 4EITA 4D46A 4DTIA 1PJCA 3DQPA 5L45A 5CDYA 1L1FA 2O7QA 4KDEA 5F5NA 5TQVA 4OL9A 4D3DA 3U62A 4BNXA 1T2FA 4IDBA 1QYWA 1WZIA 3ADOA 1E6EA 1NBOA 1Z45A 2QRKA 3KEQA 4I5GA 2IZ1A 1X13A 2WTBA 1MGOA 1QR6A 3ONEA 2VOJA 5KVQA 1XSEA 2BELA 3QIVA 2HQ1A 3V5NA 3ZWWA 5JO9A 2X6TA 4NFHA 2V6MA 1C0LA 3A9WA 3PHGA 5JY1A 1ZVMA 4B3JA 1EFLA 3WJ7A 4XGNA 4BKPA 3PHLA 2OOSA 4B7UA 4CM8B 1H94A 4HFNA 1LRLA 2O4UX 3BZUA 5L4SA 2WD8A 2YHUA 4U6QA 1MC4A 3JQ7B 1RM5A 1ZSYA 3ENNA 5HS4A 1ADGA 4DREA 1XYGA 4OH1A 4XD2A 3UW3A 3DOOA 1YJQA 1LQUA 1T24A 4JBIA 4IDAA 3OEYA 1QP8A 2ZTUA 4JN6B 2ZTVA 1PQPA 1ZK2A 4Y98A 1ADCA 2GSDA 2DTDA 3JQFC 2X4GA 5AXAA 3LYLA 3WQSB 8ADHA 1HTBA 1T2CA 5KTKA 1MXFA 5A3JA 3WGHA 5JAMA 2XOXA 1H2BA 3NUGA 1KC3A 4LK3A 3Q9UA 2GERA 1MUUA 3QA9A 1X14A 4AL4A 1ZZEA 5T5QA 1VJ1A 1NASA 2QRJA 2AEFA 4MOWA 5I8WA 5BSFA 3GRKA 1ISHA 2YV3A 4MVJM 4UUMA 4Q39A 4IDCA 4P4LA 1U3WA 2AEJA 2R2GA 2FRDA 3D64A 2EHDA 4UVEA 5EMHA 1X1EA 4BNKA 2ZB4A 1DC6A 3DBHB 4XZ3A 5I8ZA 4Z0TA 1LXCA 2HK8A 1P1RA 1PJSA 7MDHA 4B4UA 3C3XA 4L4SA 3F47A 4G5HA 3WIEA 1ZH8A 2J5KA 4RQTA 3WYBA 5L7YA 5TIIA 1DXYA 1E7WA 1GUZA 2IRWA 2R00A 1ID1A 3I5MA 4GX1A 4ROSA 3TFQA 1UXIA 5IDYA 4Z3DA 3O03A 3Q1LA 5G0SA 1DHRA 2NVUA 1ENPA 3SXPA 4OIMA 4DMLA 3PJFA 2HRBA 3R3SA 1NVMB 4D7AA 2HKIA 4XGKA 4J4BA 1JVSA 2OP1A 1HDXA 3A28A 5THKA 3ZWXA 1LRKA 2VUTA 2EW8A 4PG4A 1M67A 2QZ9A 2EIHA 2X0RA 3ITKA 3RUDA 1B7GO 4ZQFA 1KVRA 4NZ9A 4GX5A 4N5NA 1LSUA 2X0NA 4E5KA 3M1LA 5KJ6A 4FGSA 4QTZA 3I9JA 2FZEA 1DFIA 3WWZA 2H5LA 4RPHA 1HDGO 2JL1A 3WIDA 4LMRA 1CYDA 3Q6IA 5DBIA 3JQAA 4F3YA 1A27A 4UVGA 1NR1A 4GMFA 4J1TA 3VPXA 2VZ8A 2CDBA 4BNNA 5EQDA 1QRRA 1SZJG 4J7CA 2D0IA 3NT2A 4R5HA 4CQMB 4WCDA 5ICMA 1BDBA 3R3JA 5ER6A 5EN4A 5IF3A 1EVZA 2GCGA 3DZIA 4Z6KA 1Q0QA 4BNLA 3P5SA 4UREA 1CETA 2PGJA 3BMQB 4AFNA 4TROA 4Q3BA 1I24A 2WWRA 3U4CA 1OC2A 3R1IA 4UVIA 1WW8A 1PJBA 4OSPA 2P5UA 4CUJA 3EVTA 1WLYA 4IMRA 5IAAA 1Y8QB 2FWMX 2HMTA 2QQ5A 3OIDA 1R6DA 4ALMA 2BI8A 5JBIA 1XQ1A 3Q2IA 3HFGA 1ZXLA 3EY4A 1UZLA 3WNQA 5JE8A 5T67A 5A4DA 2HO5A 3WWYA 2EJWA 3DL2A 2I3AA 4DBVO 5A9SB 4JJGA 4YT8A 3RC7A 5TSDA 2X9GA 4RO0A 2B37A 3D4PA 1P77A 3LZ6A 2PR2A 3PEFA 2VCYA 1FDTA 1YOVA 1GV0A 5KIAA 1PJQA 2XPCA 3ZHYA 4DQVA 4F6LA 1T1RA 4BO7A 2Y0DA 1ML3A 4IQ0A 2HAEA 1V9LA 4IZHA 1HE5A 5K6AA 5MDHA 3COSA 5G0UA 3P2YA 3GK3A 1JTVA 1V35A 1Y9AA 1ENYA 5JMWA 4J7UA 1Y5MA 4KTTE 3ROQA 3S2IA 1NAIA 1I2ZA 4E2WA 3H6KA 3IDSA 3R6DA 3WOHA 1TXGA 3FTNA 1W0CA 2AA3A 2BKAA 1P1HA 4FFPA 5CHEA 1GCOA 3PK0A 4NK4A 2VNSA 3H3JA 3TJRA 4AJIA 4PVCA 4OO3A 5JNLA 1E7YA 2EKPA 4R41A 1N5DA 1V3VA 5AYVA 4F6CA 3EDMA 4IY1A 2Q3EA 3I9LA 3L0DA 3RJ9A 2NU9A 2DBVO 5JCXA 2ZQZA 3BYZA 4J2OA 4JROA 3ZU5A 5DP1A 3WGTA 4UEKA 3GEDA 1QLJA 2YYYA 2J5QA 2JD0A 3D7LA 5HS6A 3ASVA 3KHUA 4G65A 3WBBA 3I9MA 3STHA 3A14A 5A9RA 3HFSA 4PLHA 2WE7A 4W7IA 1DSSG 4HBGA 3RWBA 4BV9A 1LSJA 1VSVA 1PX0A 4WCFC 3ZW8A 1E1NA 4PG5A 4OM8A 4YACA 1BWSA 3JQ8B 1D4FA 2GYYA 1JW9B 1LDYA 2DFVA 1KVTA 4IGFA 4AJKA 5TJHA 3AK4A 1UZMA 3NDJA 4PLVA 5BSGA 1N9GB 3ZU2A 1VKNA 2PZMA 1OBFO 2UUPA 1ZK4A 2W2KB 4U5QA 3LT4A 3TQHA 3ADPA 4U0KA 2OBYA 1LSSA 1X7DA 3JYOA 2BFOA 2EW2A 3RC2A 3E6AA 5HM8A 4PG6A 1Y5RA 1ADFA 1I10A 1UXJA 1I32A 2H6EA 3I6QA 1LU9A 2PNFA 2ZKLA 4W82A 3SLGA 4MIYA 1M76A 2B83A 1QYDA 4L0QA 1O0SA 3VZSA 5A03A 1HEUA 1VJTA 1GADO 1PTJA 2X9NA 2CVZA 4JP3A 3I9OA 4W6ZA 5L4NA 3DWFA 1J4AA 3PP8A 4DC0A 5JYEA 4E32A 1DIAA 5I9NA 3OF2A 2X8LA 3B1KA 4GAEA 4IPTA 1Z7BA 4YRDA 3L6EA 1R12A 3HDHA 4J0FA 1YQXA 1PWZA 5G4KB 4CR7A 3LT1A 2FPIA 3WYCA 2RH8A 3TFOA 3AUAA 5DNAA 4WECA 1J0XO 3LQFA 1XQ6A 4FQ8A 3U0BA 4ZU3A 1Y8RA 3LVFO 1HDRA 2O2SA 1U4OA 2J3IA 3X2EA 4AICA 2DAPA 2DVMA 4IQGA 3DZGA 1BMDA 1R66A 4OYRA 5HA5A 3W6UA 4E31A 1GQ2A 4XJSA 5JDCC 3FNFA 4MKZA 5A05A 3ZV5A 2ZIZA 4N18A 2Y67A 4NFYA 4BGVA 1ISGA 3DBRA 4FB5A 2IXBA 1LTHR 1Q7CA 1IULA 3ZNOA 1QV7A 2PGLA 1P33A 3VH1A 4L4XA 4FCCA 2WMDA 5EJ2A 4NNJA 2QZZA 1BXGB 1DLJA 1WDLA 5GZ3A 2Q46A 3ST7A 5CP8A 3ZV6A 2OP0A 2X22A 3OJOA 4R1TA 2BH9A 3T4XA 4EJ6A 5FI5A 5U4QA 3ZV3A 2X86A 3RUFA 4GX0A 3ZZNA 4ALNA 1Y7TA 5KKAA 3C7AA 5I7EA 2B4TO 1QYCA 3SC6A 4J6FA 4EUFA 1N7HA 1K6JA 3MJTA 4EUHA 2OFPA 1S7CA 1KOLA 4WOKA 4QQRA 1UH5A 3WFJA 1T2AA 2GDZA 3DMTA 2UVDA 1EUZA 1EQUA 1T26A 1C1XB 1XA0A 2CD9A 3PIIA 4CR8A 2PK3A 4D45A 2Y68A 3WGOA 2NVWA 4E33A 3CMCO 5B37A 4K28A 3GDGA 1UUFA 3ZU3A 2EXXA 2WSBA 3UAGA 4GQAA 4Y6SA 4Z3KA 1DLIA 1KYQA 2PH5A 1DDOA 3OA2A 3PHHA 2BMAA 4J7XA 4NK5A 4CLOB 3JQAD 4BB6A 4DIOA 1EBUA 1GD1O 1NM5A 4BO0A 5FYDA 3JQBA 2I67A 2NADA 1NP3A 1F06A 4RDIA 3ZNPA 1PZFA 3UICA 1NNUA 1MG5A 1V3UA 3FNGA 1Q0HA 3S55A 4MVJE 2B69A 3Q3CA 2DBZA 3W8DA 2ZTMA 4PN3A 3DFUA 2AQ8A 1FK8A 2GN9A 4A26A 2ILTA 2C2YA 3KO8A 4LCJA 1HF3A 3L6DA 1CRWG 4UVHA 1L7DA 2W98A 2IZ0A 1V3TA 1A72A 1F17A 2FPGA 2UV8A 2CFCA 3K2EA 3KEOA 4RGBA 1JWBB 2DUUA 4GH5A 3WGQA 1SO8A 3GUYA 4B3IA 2JD2A 3GLQA 2R6JA 3U4HA 3OQ1A 3ZN2A 4E5MA 3JYPA 4YEDA 2VRCA 1PL8A 3AUTA 5TJ9A 3C85A 1O89A 2Q45A 3AY6A 2AQHA 5EESA 3E5RA 1DHTA 5KJEA 1TT5B 4BO1A 3CTMA 4LVUA 2P4QA 1DPGA 4LW8A 3L6OO 2ZYGA 3JD4A 5BNTA 5JY6A 4L8VA 3S1LA 2OHXA 3D3WA 1D3AA 4BNMA 1GL3A 1PQUA 2A35A 4E3ZA 1H5QA 4XQGA 1Q7BA 2J3HA 4ND2A 3BMNA 4E5PA 4TKMA 2PY6A 2Q2VA 4I9HA 5BNFA 1PR3A 1YS4A 4GGOA 1FDUA 2POQX 5DCUA 3UFXA 1P1KA 2DLDA 2V65A 2VHYA 5TT0A 2D1YA 2PTGA 2NLOA 3EGOA 3JQ9A 4CM9A 3I1JA 2EG9A 4ZICA 2G76A 3MJ4A 4DYDA 1RWBA 3BMNB 4ZQBA 2FP4A 3RUEA 4ZQEA 5TNXA 3DBLA 4PLZA 2IE0A 4JCOA 5IDXA 2VT2A 5DBGA 2Y1DA 3UVEA 2QX7A 3H5RA 1QORA 1KEPA 1RYEA 2UYYA 3CKYA 4FJ0A 1GCUA 1I8TA 2ZB8A 3NEPX 2Y1OA 4YJGA 2IXAA 1I5RA 3NYWA 4I9UA 3G3EA 4W9NC 4B8ZA 4A7PA 1GQQA 2OUIA 3ZWOA 3PYMA 5F21A 3VVCA 1LLDA 4NBRA 3HDYA 3C1TA 4PLCA 1LI4A 1A4UA 1YXMA 3TWOA 1HDZA 1ZEMA 2GUGA 2VWPA 4CLRB 5L4LA 5FEUA 3INGA 3KYCB 5IXYA 2B4QA 4MKXA 4GPD1 3CXRA 3OH8A 4YJGB 1HLDA 2BFPA 1Z6ZA 4BGIA 7ADHA 3IUPA 3JQBC 2DTEA 3MCVA 4PIVA 1LQTA 2VNAA 3NT4A 4UVDA 5B4UA 2GNAA 5TX7A 4BHTA 3NJ8A 4PG8A 5B4TA 5T64A 1XHLA 4LISA 3KM0A 1AXEA 1FXSA 1U5AA 1U7HA 4TSKA 4PZDA 3D4OA 1O5IA 4GWKA 4JJIA 1MC5A 2ET6A 2VRBA 4CODB 2I6TA 3DOJA 1E0DA 5FI3A 3H5AA 4A2CA 4WASA 1TI7A 4CV0A 2WYWA 1E1MA 3A06A 4WOJA 1VE9A 1E3EA 4GWGA 1PGNA 3ONDA 3E03A 1U8XX 1EMDA 2GO1A 2FR0A 4CLOA 5CG1A 2DPHA 4WKGA 3KTDA 4RVSA 3IIEA 3LT2A 4CMEC 1HKUA 3WQQA 3QVXA 2WDZA 4HKTA 5F1KA 5H81A 4CMAA 3GF4A 4J91A 3F5QA 2VOEA 4MDHA 3IC5A 4ALJA 3DAFA 4A10A 1HYHA 5HBRA 4PZCA 4HFJA 1ZIDA 4OGWA 2V6GA 4I5DA 3I83A 1ULSA 4B4OA 4DIFA 3RUCA 2IEDA 1LC3A 1TLTA 3G0OA 2P9EA 3N7UA 1ULUA 2AQKA 4YTEA 5KJFA 3BTUA 3L4BC 4FDAA 3OMLA 4CM8A 4E21A 1LDEA 1MFZA 3ORFA 3MJCA 3WMWA 3I3OA 4A5OA 4XRRA 4DUPA 1O6ZA 2X5JO 4MPDA 2VZ0A 4CQLA 4ZVVA 3GHHA 3D5QA 4GSKA 3JQCA 2C07A 5IDWA 1YJ8A 4OXYA 2NU8A 5A5EA 3NAQA 4OKIA 3GMSA 4FFNA 4E12A 1X0VA 1A4IA 4CM3A 1YVEI 3EYWA 3RBVA 1PZEA 3AOGA 3PTZA 4BNUA 1IOLA 2VHWA 3GEGA 5KKCA 4OKNA 1GUYA 4OJNA 2PH3A 1RM0A 3WB9A 5T6BA 1D7OA 1YKFA 4RVDA 1NQTA 4LRSB 3LF2A 4M54A 4XR9A 2OL4A 4C7KA 1LX6A 4Q3AA 1GUFA 4ND3A 4C7JA 4DBZA 1ZFNA 2Q1UA 2Q1WA 3AUUA 4B7CA 1QV6A 2Z1NA 4YT4A 4FS3A 3TN7A 1IL0A 1LEHA 3QWFA 1W6UA 3OEWA 2YFHA 1JDJA 3KUXA 4IQ8A 1ZKMA 2YV2A 3SLKA 1IYZA 4XDZA 4Q3EA 3G1TA 4FR5A 2Q1SA 3PQDA 4BO6A 1IZ9A 3ZWMA 3HJAA 3WS7A 3X2FA 1IB6A 3H7AA 4IZIA 1U5CA 2DUWA 2J3JA 4IXWA 1XKQA 3W6ZA 1G0NA 3H65A 1Y1PA 1LBEA 3E9NA 3K96A 3QY9A 4CM9D 4EUEA 1OMOA 1G1AA 2E37A 4O5OA 3H9QA 3HNPA 3JQEA 5L9AA 4YAEA 4GX2A 3A1NA 3JTMA 4HNHA 4DIBA 1OZAA 4WCFB 2CNBA 2X23A 3IQDB 5L95A 3M2TA 4RPJA 3ON5A 5G4KA 3HB5X 3GC6A 3C1AA 1ONOA 4CM5A 3M1AA 4YVFA 4EEXA 5BSEA 3GUCA 3IP3A 4IDDA 2HMSA 2PA3A 4PCVA 1DIRA 4RV9A 3LC1O 4H15A 1EVIA 4IINA 3E5MA 3BMOB 2WYUA 3H2SA 4HV4A 2C20A 3QJ5A 2GPTA 5KOIA 3AI3A 4UEOA 1ZSNA 4P8RA 3DAGA 1C0KA 3BMCA 4FJ2A 2YY7A 3CPSA 2I66A 1SPXA 3QWHA 2O4CA 1WWKA 2E48A 3AOEC 3HADA 1DO8A 1FDSA 1BSVA 1ZK0A 3PDJA 5I7FA 1DAOA 2BGKA 1I3LA 3RFXA 2X7HA 3ZWBA 4DPMA 4EGFA 4R3WA 4RVHA 3F4LA 4JBGA 5TLSA 2OZPA 2DBQA 2YUTA 4RF5A 3GG2A 3ZWPA 4RCVA 4AJJA 4ZN6A 1ZBQA 1BVRA 1NWHA 1RPNA 4YJFA 3JQGA 4WLFA 1KEVA 3ZGYA 2CDCA 3O38A 2C82A 4RLSA 3WSVA 1HLPA 3NDRA 1H6DA 3GHYA 3QVTA 4RZHA 3FD8A 5EQFA 1RYDA 3ETEA 4KWHA 2DPGA 1XR3A 2RIRA 3RU7A 1SBYA 4CUKA 1LLUA 1JLLA 4WLEA 4Q9NA 3C24A 4YR9A 4QSMA 2JAHA 3I23A 3VTZA 3RC1A 4CUZA 3I4CA 3UCEA 2GASA 4IDEA 4QFCA 5H82A 4NBWA 3ZWAA 3GEMA 3NKLA 3PGJA 3CZMA 3DC2A 2RCYA 2QG4A 5COQA 5I9LA 2FMUA 1GZ4A 3JD1A 1F12A 4JLWA 4EZBA 3A4VA 1IHYA 4ZHSA 1PGJA 3K6JA 4G2NA 3ZWVA 1NPTO 3PZRA 4XDYA 1PGPA 1GZ3A 3EZYA 1C0IA 1HYEA 4CLDA 1BRMA 1GTMA 3RBZA 4RORA 4I08A 5A3VA 4H7PA 3ZHZA 2I76A 1MA0A 4BVAA 3H2ZA 4P38A 1PL6A 3DZKA 3WNVA 2V6BA 1OI7A 1DRVA 2YW9A 3BTSA 4UUPA 5JO0A 3I9NA 5ADHA 4GSLA 1PJ3A 4BQRA 2J3KA 3P2OA 3QHAA 4Y9DA 5CEFA 1JVBA 5L7WA 3F6YA 3BTVA 4FFLA 1E3IA 3D0OA 1EZ4A 3KZVA 2P2SA 3RFTA 2FY8A 1B26A 2HMVA 4M55A 3DO5A 4RL6A 4PLGA 4WK6A 1NTOA 2C5AA 2NVUB 3LF1A 4OMUA 3H9EO 3UHAA 3OICA 4Z9XA 3JQ8A 1HZZA 2WD7A 3PHJA 1N1EA 3C7CB 4QO8A 1IPFA 1JA9A 1E3WA 2X9VA 1SEVA 3FBGA 2PZLA 2HSDA 2JCYA 4BO8A 4INAA 4A27A 1ENOA 3VZRA 3RVDA 1W4ZA 2O3TA 4QT0A 4KWIA 1WDMA 2P68A 1EE9A 3VZPA 3FI9A 2CSUA 2Y93A 1V0JA 4U0JA 4DGSA 2Y99A 2YZ7A 2WD7B 4Q3DA 3D5TA 4J4TA 3QLJA 1ZNQO 2F1KA 4BNFA 1MP0A 4BGUA 2FR1A 5TS3A 1U3UA 2WEKA 4XB1A 4UEJA 1K89A 5J23A 3CINA 5B4VA 1SB9A 2IYPA 5DF1A 3JQAB 3OP4A 5EERA 2IZZA 5G0TA 5IZCA 4ID9A 5C7LO 5L51A 1W73A 2O3RA 3PIDA 4YJHB 5F5LA 5JFOA 2YFQA 3VDQA 3LSYA 4BKOA 3BMOA 1UXKA 3DBHA 3NDIA 5JCJA 2O7SA 1DC5A 1G6KA 4BNZA 4U8GA 5G2OA 2V7PA 4BO9A 3HN2A 3H9JA 5DP2A 4M87A
chains in the Genus database with same CATH superfamily
1BEZA 1L5WA 1JI0A 1T2DA 2Q2QA 2RBEA 2VTEA 3MS7A 2IYFA 3AM4A 4RKWA 1P0CA 2NSJA 1O94A 2AXQA 2GN6A 3H9QA 3PFBA 4IDFA 3QX7A 3BH7A 4K9SA 2P5YA 3MUFA 4LSWA 3ABRB 5HWSA 1OFUX 3OUZA 1OH8A 3SP1A 3NJ4A 3QVOA 1U0FA 4IWXA 1HDOA 4W5WA 3EAQA 4FOSA 2ZU6A 4TT3A 5DIZA 1MXHA 2E4XA 5GVRA 3O1JC 1SCUA 1Z0IA 4H77A 1NVGA 1QB8A 5A06A 3NMUF 2VTDA 1PVOA 1N1MA 2BRUC 3UPDA 5KS2A 4M22A 1M1YA 1F6BA 3LGSA 5C34B 1RWNA 4L73A 4EDFA 2NO0A 1YL5A 4IFEA 3FIUA 3V4SA 4K86A 2QP4A 4EG8A 4EY8A 1PZNA 1E5LA 1OX6A 1X15A 1GGVA 2QSYA 3KXIA 3U7IA 1PAUA 4OXKA 4OYYA 3Q5GA 2ZIVB 1S1MA 2PA0A 3RRNA 2ZCJA 4N5IX 4X5OA 1MJGM 2W4QA 2X1HA 1CW2B 1DEXA 3DZBA 1M33A 1AA9A 5JAHA 4M9SA 3QFHA 1GRCA 3DNPA 3T38A 3DE0X 3DKKA 4WCVA 1BG6A 3CLTD 5IW8A 3HGMA 4DQUA 2FW0A 1WE2A 2EP7A 5DLYA 2QDKA 2AB0A 5F5XA 3RGWS 2PRSA 1OYVA 4OHPA 4LJ5A 3DE2X 5IH7A 1IG3A 4RSMA 2ZI6A 4YQEA 1IDN1 2V7VA 3G8YA 3W3ZB 2XUQA 3IGFA 2HWYA 3MCTA 2QTZA 1VFNA 3SX2A 1L7OA 4DPKA 1JALA 3PVCA 4RVUA 1W59A 3CLTC 1IBLB 1FMLA 2FQ1A 2PVCA 3CE6A 4EB6A 3DNMA 2CLOB 1FSPA 2BFWA 3AIIA 1PDVA 1E89A 4NONA 3VR3D 3V2UA 5ALEA 4F2WA 3MZ0A 3TOZA 4BCBA 1GCIA 2J33A 1YDGA 3C43A 4A8JB 1JHXA 2B82A 2VQ3A 2P9TA 3D8NA 3KP1A 2OD9A 2IF2A 4HDSB 3UG7A 3UJ9A 2D06A 2PT9A 2ZP1A 1XMVA 1HSZA 1NXWA 1YNOA 2DBYA 2IPMA 3CEJA 4ZYTA 5HUQA 3AEKA 4TYNA 3QG5A 2GI4A 2XF8A 2OBNA 2R62A 2XSZA 4NPCA 4HGNA 4TMZA 4RPKA 1Q11A 1Z8HA 2RK3A 3TE6A 1SOMA 4EW6A 5C51B 3CGGA 1U7UA 5FWYA 2BFMA 1FJHA 2FN8A 3QU9A 2K7FA 3LO5A 1JAYA 1YRBA 4TZTA 4CMGA 3BSYA 4AM8A 4LAFA 1OZFA 3EXFA 4M86A 1IY9A 3ET5A 2IOHA 1Q3KA 2R7AA 3R5TA 5SZKB 3T0GA 2C4VA 4QDJA 1WSAA 4M83A 3GY0A 2IKSA 3RIXA 3EHDA 3GV0A 4L0MA 3QPCA 3U4MA 3IDZA 3BHJA 3KYBA 3ZCTA 3FCAA 4G81A 1JLLB 5K3FA 5DCYA 2W8BA 1V5IA 1DG3A 2KX7A 2NV2B 2QRVB 4PC3A 1NATA 1YZYA 2IY9A 4KNWA 2I65A 4L9SA 4AZ3A 1P5JA 1LVHA 3WLHA 1FTWA 3LX6A 3GT0A 1Z4QA 2QVZX 4GG1A 1MO3A 4MP8A 5KQGA 3C4VA 1KY4A 2UZ1A 2W2VA 1A9QA 4NBSA 1W30A 4XFJA 1KRWA 3O7WA 4WK2B 5COBA 2AG1A 1NQOA 4IJUA 1H8EA 3W8NA 4K6KA 4EBBA 1O96A 4FN5A 1C7JA 1ZXBA 1X1TA 2GD0A 1TT5A 3PFNA 3VR3A 3S7ZA 2XUOA 2Q8PA 2H5JA 4BB9A 4ZAVA 4C7XA 3QFFA 3GJRA 3KWLA 4TRNA 2VBFA 4UE2A 4AI6A 3CW9A 4KDRA 4LFCB 1T4MA 2TSYB 4RMIA 2IHUA 5CVUA 3MS2A 3BRWD 2G06A 4JLBA 2G36A 4DCUA 4BRZA 4PYKA 2PZJA 1OPRA 2JCXA 2JFHA 4PZUA 5TQ0B 3QXXA 4NABA 1VLQA 1OLXB 1VI6A 5FUVA 2WIAA 2YVKA 3F4BA 1U4NA 2BZ0A 3M7IA 3GGDA 1SXIA 4YAWA 5FLXA 1UBSB 4HGOA 1VYVA 2D13A 4LNUA 4ZCTA 2YXPX 3KRTA 3W6OA 4JZKA 3LMKA 4ND1A 3CG4A 1Z08A 1DOZA 3NPMA 1ODCA 3IEMA 2OGTA 1WRBA 1A5AB 4IRMA 2R8EA 2YY6A 2B0JA 5HRUA 3B78A 4JJ7A 1EIWA 1YB6A 2H4ZA 1BEEA 1M34B 2YJZA 4EFLA 1GKLA 1XD2B 3BDIA 4FMCF 1U2GA 4OQPA 3HJRA 5CK4A 2Q9AA 3SWWA 3OQIA 1ZL2A 2CDAA 3PT5A 4TLLB 1RCFA 2QEQA 4MV3A 4X61A 5F2EA 3M6AA 3WDSA 1TFRA 3IKMB 1JB1A 3GFVA 4V39A 2ZWAA 2P5SA 3IUQA 2XYHA 4MR8A 1TM3E 1ODJA 1XZBA 3GD7A 1PR4A 4X7MA 2FWBA 2VHUA 1JR6A 1C7ZA 2H4FA 1QSGA 3HHEA 3VC7A 1KXJA 4MA0A 1ZD8A 1A9PA 2XTAA 5AHKA 3CUTA 1WV1A 5DMXA 4L5YA 2BD0A 4G3XA 2ZQ5A 4GP7A 2ZRMA 3FNEA 4M8KA 5TQ2A 1QUFA 1Z6PA 2FR8C 3HMKA 4HDNA 1TLFA 4QOFA 4JJFA 1NRWA 3J81A 2Z1DA 4FMBB 3RS5A 3OA0A 1N57A 3LBNA 4R8RA 4P4SB 4DNXA 5BUQA 5A0TA 4M1TA 1NYRA 2BGJA 3SNHA 4G6ZA 1JKJA 3UA4A 4OX9Y 3RT9A 4ZKDA 1A88A 2V8OA 3VZDA 5IT9A 3OQNA 3R6WA 2D5CA 4EFNA 4WKBA 4E4YA 3O8DA 5K6AC 3RT7A 1DC8A 3FHCB 4H27A 5FAXA 5FR2A 1E96A 4ZHQB 3AL0C 2RCNA 1CJVC 2I4TA 3I9KA 2OCGA 2ODAA 4DDKA 4ER3A 1RVDA 4OFZA 3B53X 1G21E 1KOFA 3RKUA 1EXVA 2ZRAA 3RSLA 5I4CA 5E0KB 2HPVA 3HWRA 5AH0A 1L2TA 4L28A 2ZKIA 3UAWA 4L07A 1Y6JA 3KDPA 3BQNB 3BD6A 1ZMTA 4ZVUA 1I9GA 2Z08A 3E5HA 3FSGA 3L7LA 5GWXA 3K0SA 1SXQA 2FI1A 1V26A 5LWQA 3HA2A 1EP1B 2R60A 5IKPA 1GPKA 2Z95A 2VP9A 4HF7A 4YRAA 1SC9A 3GZNB 2A59A 4MVJA 2ONJA 3WR5A 2NZYA 1KO4A 3B2QA 4G89A 4R6WA 1ZOIA 3RVNA 3TIXB 4CMKA 2QZJA 1XZEA 2X0EA 2FEPA 1II9A 5CNJA 4HRYA 1X87A 2IY8A 3OX1A 1HE2A 1ZRSA 3JQ6A 1NE2A 3MUNA 2DU8A 4RUKA 1ZGHA 2VF2A 4A92A 2EJTA 1XJ0A 2V6JA 3D3KA 3CZPA 4TV9B 5JAOA 5JH7A 2WWGA 5L3SB 2Q3CA 1XFDA 2OUKA 4KLCA 4G25A 5EZYB 1ATIA 1KAQA 1V5WA 2ZLBA 5ALHA 4JGBA 1U9IC 4ZEWA 4ZT5A 2VYFA 1CR4A 1W1IA 2H9AA 1YMQA 4XSGA 4YN3A 3UXEA 4TTSA 3RAFC 5J59A 1UMBB 2C88A 3QBTA 4J3NA 4XARA 1QGAA 3UJ3X 4GI1A 4YRQA 5IRCD 3DSRA 2A84A 1HK7A 3LC7O 4FXPA 4X44A 4DLSA 2O3JA 3M5CA 4C3OB 2AS0A 1QVVA 1LS1A 2RHBA 3U3MA 3GN2A 3C3WA 1FOEB 2P62A 2PHZA 3T7DA 4O4LB 1Z83A 3AY7A 3IO5A 4WOPA 4D02A 3L1IA 1BE1A 2QTNA 2YR0A 4O2BA 3I1YA 3RO7A 3RVPA 4D9FA 3GJZA 1W5FA 4UZFA 1JJVA 1U04A 4NU5A 4AXBA 5DYIA 4E2YA 2WF9A 4MWGA 2R1TB 3KJEA 4ZV9A 3R7DA 3W90A 4RE6A 5CG2A 1TM4E 1NI3A 3H2YA 4MWZA 1XLTA 2B4KA 4ZRNA 3BEDA 5P8WA 1L7AA 3QFRA 1W5TA 2OXIA 1RJWA 1EE2A 4NEQA 5AOCA 1UK8A 2IP1A 1EFDN 4NJEB 3BHIA 2O2ZA 5G4LA 3V8RA 3W7BA 4DWVA 3A9TA 2WU8A 3O4IA 2O5RA 2Y0EA 4HQ0A 2HO4A 3CPEA 4ENQA 2HHJA 4XRGA 4YT5A 4Z0PA 4DV4B 2C2GA 2EU8A 3DDUA 5C5EA 3I76A 2AQIA 1O95A 5AI6A 1P2BA 4PO9A 1V7PC 1P6QA 1FS5A 2G9ZA 3NYQA 1DFGA 3B2NA 2CV2A 2J8ZA 1KBZA 2RH9B 4NPHA 4DW8A 2FSVA 2A9KA 5I7OA 1X7HA 3K8QA 1KE2A 5JXGA 1YDEA 4CM1A 2XIJA 3GH1A 3E15A 3N2KA 2AOUA 3MOGA 2XXAB 4H3VA 1B41A 2VQ6A 2X42A 4K2AA 1DKLA 2B8EA 3E58A 3RREA 1CEYA 2KWIA 1Q95A 4NH4A 2GFQA 3QW2A 1FIUA 1T35A 1ULHA 1J42A 2QRLA 1UWLA 2FPIB 4PSDA 1BHJA 3WMEA 5C1BA 1NURA 2HK6A 3ASUA 2J30A 2JFNA 5ENDA 3W9SA 5BW5A 2E55A 2IUSA 1OH5A 3QWBA 4IG4A 4BFVA 3KKZA 4YRBA 2UU9B 1JFVA 5HK8A 1FMJA 2AL7A 4JR2A 2ORYA 5CXSA 3VDMA 1Q1QA 1JKFA 1U0GA 2BSAA 4G8JA 3G8DA 3LFUA 1NLUA 1Z82A 2C2BA 4HAYA 3WGYA 2ATEA 1HNNA 2C9CA 2TMDA 2ZYDA 3RYFB 1DUSA 1WKCA 1IN6A 4IXTA 1P1CA 3S0JA 2ZJYA 2A30A 5CXQA 4HNSA 2KS6A 4XGIA 4AZTA 5K3OA 3A9RA 1E5QA 1I6MA 1RPTA 2ZJZA 3OEEA 3B3AA 3GAFA 4RF4A 5E6SB 3UUGA 4BQOA 4GKBA 4DXHA 3H97A 4QM7A 3NGLA 4J16C 8LDHA 3I9V1 4AF6A 1DEAA 4UU0A 1IK4A 1YI8A 4LXYA 4CU2A 4YAKA 1VPWA 2GEDA 3FHTA 2WYOA 1K92A 4KXYA 2X40A 1YB5A 2GPAA 2ZSBA 5JU6A 2GAAA 4KVZA 4Z7OB 4GICA 2VDJA 5IN5A 2QORA 3FETA 2HBQA 3JYHA 4LTNA 3VJKA 3EWNA 5CNIA 1GQSA 2O7VA 2Q2WA 4JJEA 2MYTA 5H3CA 3REQB 3DDHA 2DFLA 2C77A 2JFWA 2JJQA 4AJNA 1RZUA 2C58A 4DG5A 4N7BA 1GQFA 4GXQA 3FBTA 3WRXC 3KYDB 3LPDA 3EBOA 1JAZA 1XZMA 3H8VA 1Q50A 5IUJC 1VIAA 4V0KA 4CFYA 4RTMA 1RCUA 4F46A 2XLBA 1XNHA 5TY0A 4OYHA 4MVJH 3ERCA 4GZ6A 2NXJA 2WVJA 5AUOB 2O8FB 2IHJA 3ORYA 2BP7B 1YB2A 3VU9B 2RB4A 1B15A 4Q4AA 5LMCA 1I51A 2WHRA 5KYUB 3HUUA 4NCXA 1AXGA 1IQPA 1VJCA 3QE0A 1BXKA 3TXXA 1HX7A 1SXJD 3ZIDA 4OUKX 3OCWA 5JPCA 3DGFC 4XCQA 5CM9C 2PD4A 3F6RA 1TD9A 1VIVA 5AHXA 4HRVA 3QLUA 1QDEA 5E3IA 4B79A 4H1HA 5K3AA 3KV3O 1D2RA 1HDYA 4X3CA 4HDMA 3KT6A 2A14A 3MHTA 3I09A 2WSIA 1JHYA 1F8FA 1FA9A 2AZTA 4N3BA 4NH0A 1MMFB 2VSQA 2FPPB 2ONKA 3F98A 2BR4A 3KCQA 1MIHA 1GU7A 1T10A 1FS6A 2FHSA 2J6HA 3FDZA 4MB0A 4E30A 3E84A 4UTRA 1F4VA 5CDTA 3ZGOA 2IBSA 1KETA 2ZJBA 4D4KA 5HM6A 3FOZA 4G0VA 4R7ZA 2P90A 1NI4A 5EG5A 3IS3A 4H4DA 2X3FA 1RVV1 2AOXA 1I1OA 1TEVA 4PSKA 5KNLA 3GDFA 2H65A 2QT1A 3FWPA 3HB0A 2VUIB 1PNTA 1RAHA 2P77A 3KALA 4J0JA 4MAMA 2NZXA 3E2IA 1LPBB 3I12A 4UNPA 2AE1A 3M5PA 3RHTA 5CD1A 3FYCA 3T9CA 2EZ4A 2NV6A 3CT6A 4QVKA 5KTNA 4JWTA 2QPLA 3EDCA 3LLCA 4OB6A 1E1LA 1P9RA 5AJVB 2DKFA 2FPKA 4BEJA 3MWLA 5HG0A 2CFSA 3SI7A 3HXOA 3A6FA 1NFQA 2HFKA 3L92A 1FXWA 4NFSA 2RBGA 4DA7A 4E2FA 1ZH6A 3OQJA 5FWNA 3T0IA 4BZZA 2ZIFA 4RK1A 3TTUA 4TLBA 4JOSA 4BIMA 4CMCA 2J0UA 4D97A 5JD4A 5K0TA 4FD2A 4PZEA 3G5MA 2HW8A 1M1XB 5K3EA 3GZTB 1VLJA 4TSRA 3HDQA 3TK1A 4DJ5X 2DJ5A 2YUIA 3PU6A 3AEQA 3ZE9A 4QECA 5KC9A 4HZUA 5LIRA 1BWRA 3I04M 1GZ6A 1GWNA 1NQ5A 1U2ZA 3OZVA 3T3HA 3LBYA 2XZTA 1V1MA 1XEWX 5AXBA 3SHQA 2B4YA 1HY3A 4XM2A 1KF0A 1UIMA 2Q1TA 2ZUBA 3BT7A 1OJ7A 4QYWA 3HKCA 2PSFA 3M9WA 2O50A 1W5SA 3C14C 4Q47A 1SHUX 1ZD5A 4RJJA 1Y3HA 4KODA 5KJ1A 4X3OA 1RAEA 3NWOA 1D07A 2Z0MA 4YB8A 4ZT7A 5NULA 4AIRA 4YT2A 4CCWA 4LBZA 1FX1A 5REQA 2NUPA 5FHQA 4BQIA 3NV7A 3LH5A 3ZK9A 1W88A 2H92A 3OE7D 1KSHA 1RLJA 2XCTB 3CZRA 3AWDA 1PT9A 2VQSA 4YV7A 3V7UA 3GARA 3AP3A 3N39C 1E2NA 4U7WA 3PNBA 1IXZA 4PFKA 3H2HA 1B8PA 5HBGA 1JBQA 2RGCA 3FPFA 5M3BA 4P3KA 4ZIRA 3QITA 1GILA 1FTNA 2QX9A 2Z9BA 4DMKA 5CB4A 4LI0A 1VJRA 3LUDA 5C4IA 5HEKA 3RWOA 3KFLA 1GPJA 2RFLA 1CUXA 2FSUA 3SBDA 4D44A 3FSJX 4AY6A 1ZVQA 4I1OA 2LBPA 4C89A 1DIBA 1FNMA 5CDSA 2ZPTX 2Y1WA 1JG7A 3R7NA 3R8FA 2YJTD 3GUZA 1P3DA 4CXMA 4RMHA 2EZ8A 2RBKA 1R8QA 4ND5A 3FFTA 2EOAA 4PU0A 1C29B 4L4RA 1T5SA 1XKXA 3PKJA 5JSFA 5LP6A 1SG9A 2WMOB 2VYNA 4MUFA 3UJ6A 1XD9A 3H5IA 4INPA 4XPIA 4QUHA 4BQNA 3RBXA 4CF3A 2XUFA 3BFPA 3L1UA 1ZN7A 3MRVA 4OA8A 5I9BA 2VSFA 2G72A 1QGYA 2UVPB 1A7UA 2VHCA 3DOCA 1BGVA 2G5CA 4QJ5A 3K72B 4BWGA 3WQRA 5KVCA 1SVWA 2Y4NA 1DCFA 3ZDZB 5EC8A 2B8WA 2FE1A 4ALKA 2DERA 1LA2A 4NQZA 3QWAA 4BPBA 3EJ6A 1SUPA 3QMPA 4HS9A 4R1NA 4OLAA 4EZEA 1Q5PA 1RU3A 4KIUA 3L4BA 1BHSA 3HU2A 3F5DA 1GPMA 3DONA 1WU8A 4OAPA 4PGHA 2AF4C 3K92A 4L6CA 4LF5B 1YCGA 3MJSA 3OJFA 4X97A 5SZIA 3X2SA 1QCYA 1KGSA 1UIRA 1X94A 1LC0A 5K8TA 2IUTA 1CZUA 2EYUA 3DEAA 2ZUUA 1KEKA 4P6VF 1C81A 4DB2A 2B1QA 1X42A 3L6RA 2W2PA 1KI6B 1NXVA 1G59A 1X7WA 3UHFA 4TZKA 4J16A 2Q3DA 1DU4A 1EB8A 1SCNE 2B4AA 3ETHA 2NO9A 1CR2A 3DT9A 2GEVA 4D8YA 3NBKA 3RC3A 2GLUA 4XA8A 4ESOA 1R0BA 2O0HA 3BB1A 3TLGB 3E27A 4KIJA 3R0VA 4MUXA 3B5IA 4WN9B 4O3MA 4RENA 1L5VA 3CH6A 4TRMA 1U8TA 5JLAA 1TE2A 2QA5A 4KJXA 2QX4A 4U7FA 3EDRA 4UM8B 4F04A 1DZ3A 1GL7A 1XBTA 1VBNA 2QF7A 1T0UA 3G8CA 1FRZA 3NCHA 4HNGA 2ZIAA 1GT91 3DHNA 1XG5A 5BSUA 3VKUA 4LECA 5BRJA 3DMNA 3OPYB 3GFFA 3DXXA 4I55A 4MROA 3V9PA 3IA2A 4FQ7A 3V7FA 1F2TA 1YH3A 1RYBA 3G5LA 1SOWA 5FNVA 2BDTA 2D3TA 3AU8A 3W9BA 5EHQA 3WLRA 2FMTA 3FNBA 3ANXA 4DLUA 1JIIA 4JP2A 1A95A 4RFSA 1SBQA 3SX4A 2PLAA 1EFPB 3W8EA 4ZGWA 2X8JA 2XNKA 3VV3A 3U7FB 2PM8A 1JSCA 1XDBA 1XIVA 2B78A 4D1YA 5LLTA 4HCJA 5TVKA 4BMDA 4IJWA 3QOWA 5CBPB 1PZGA 1MV8A 3EQ8A 5C4GB 3R0IA 2M32A 4ZVMA 1KR2A 4REMA 4H6VA 3PNYA 1NRJB 1SWVA 3HZHA 4ONEA 4UJ5A 4GEKA 3BJZA 3ZGNA 3SBXA 3E2MA 2Z58A 1X9HA 1SD2A 2WT4A 1QHEA 4YAGA 1BVYF 1EWRA 4FYKA 4W9RA 3B51X 4R8SA 4Q1AA 2NTNA 2X8BA 3LGAA 2NXWA 4MXDA 3WYAA 4DLKA 3DDWA 5FX2A 4A8HA 1KS9A 1GPUA 3SQLA 3TQQA 3M3HA 1LDMA 1VM6A 3CLUD 5DN6D 1ORIA 1QG4A 1ZCJA 5KYYB 4ZODA 4F71A 3W34A 4E15A 5KYXA 3RSSA 3D2CA 1D6NA 4OHOA 3QXSA 4RK6A 2C98A 2O23A 3M4ZA 1RYHA 5DEIA 5EZQA 3UFBA 1TO1E 3V48A 4E2ZA 3F1LA 1NU8A 3GVCA 4P36A 3IR7A 4BOYA 3OUUA 3IA7A 4P5DA 1UPAA 3E9QA 3KOWA 5TRTA 2C5EA 2PL3A 2VYVD 1XVUA 3T5PA 2VFAA 3IAEA 4CKCA 2WI8A 3P0IA 1B0ZA 4F1KA 1OFVA 2Q4EA 2R6R1 4QSHA 4P80A 3IBFA 1KJNA 3D2BA 3I04A 3LP8A 1KDYA 1ZWKA 5LYJB 2V6FA 1BVUA 4JGGA 3KELA 1QFZA 3JYLA 3NHSA 2ZS9A 3OCJA 3T3IA 1GDDA 1EJ0A 4PSVA 5ALDA 4K9RA 3EE6A 2I87A 2NU9B 5INTA 3D31A 3QF4B 1PJ8A 2IEAA 2NZJA 4FLEA 3TAHA 5EGNA 4JMPA 2WB2A 3VU3A 3K4HA 3MGBA 2OC9A 2Z4TA 1NVUQ 2SKEA 2ZXEA 4OKSA 3C4JA 1EVJA 4AZ0B 3BERA 5AR1A 1ORRA 3HSKA 2IVZA 1AZWA 2QS9A 4YJHA 4M3NA 4MMYB 1KK3A 4RVFA 2DFDA 4BGEA 2WAYA 3GLUA 4D4MA 2Y92A 2J59A 1J9EA 3DGEC 4UAUA 4D6YA 3H9BA 2JZOA 3SZRA 3K31A 4FMCB 3CRMA 4JX9A 4TQGA 3F3YA 2DX7A 4Y6RA 4E22A 1T6ZA 4WVFA 3E1KA 1I01A 1KOJA 5AVSA 3PGA1 4H3HB 4O59O 3ZI0A 1VDZA 3A2MA 5FBRB 2GBPA 3GCDA 4MPJA 5E8JA 2VYCA 1HFKA 4QUIA 3C2QA 1FSFA 2HTEA 5BSTA 4EM6A 3G7NA 4PS0A 1FRQA 2P9BA 2PX3A 3NWPA 3OM8A 4Q9LA 2QQFA 5AO9A 1O97C 1RWPA 4YJDA 4F8JA 3ZLAA 1FZQA 5C7IO 5JAQA 2D1FA 1Q0ZA 1OKKD 1SULA 2QJRA 2VSYA 5GP1A 4C76A 4ZXFA 3FYHA 5KYVA 2ZU0C 3VA7A 1T9KA 1UKCA 1ZI6A 3NC0C 3OE5A 9MHTA 4QU9A 5AOVA 2XHEA 2QN1A 3FMFA 1MX3A 2FPXA 1BRTA 2K6GA 4P4NA 4OBXA 3HJBA 3T5CA 2GK4A 1K9SA 1G5FA 4NIMA 5JSZB 2L42A 2WAXA 2WKQA 3AF4A 3QX8A 1QHIA 5EJ9A 4LWOA 5BVGA 1YRLA 1E6WA 2XB6A 2XGMA 4J9UE 4NNOA 5HTOA 2PXXA 1WCIA 1N7IA 1L7VC 2E1RA 3SNKA 3W2FA 1KYZA 1CY7A 1KA9H 1ODSA 2IHBA 3M1YA 3W8RA 3GCWA 1F38A 1Z38A 2BHTA 4HJXA 2F43A 4YFYA 3ROEA 3HXKA 1B8UA 4BBAA 1CJCA 2R3SA 1WP4A 4G9EA 4J3FA 4TMTA 1B3RA 3PRKE 3P5BA 4JI2B 4PNPA 1R8YA 3OWOA 3C5EA 4MVJI 1TDJA 2I80A 2Q29A 1VLLA 2FXVA 3GR6A 3IIKA 4KEAA 4YWJA 5FA5A 4TYYA 4EMBA 2GHQA 3HABA 1KMQA 2P79A 4EG3A 1PBNA 5JNUA 2CXOA 3LDUA 5TMEA 3G0DA 4Y2PA 2HA7A 1RBYA 2X8WA 4KO8A 3M2PA 1JPUA 3JU3A 1U80A 2NM0A 3C41J 1CQIB 3PQ5A 4FTWA 4J9VA 4LZWA 2X58A 4MMZB 2C7VA 2NXNA 5E1OA 2G8NA 1KVUA 1OIVA 3ZLJA 4Z4EA 1VLHA 1ZJYA 4MGHA 4LVOA 1OC4A 4NDNE 5E2AA 2CF6A 1P5ZB 3Q7PA 1UQRA 4YCLA 1GNRA 3PLRA 2XDAA 3GGCA 3NORA 2A4KA 4KQMA 2OILA 1EFKA 3JD2A 2WMNB 1LBSA 3K3PA 1U2DA 3QLTA 2J09A 3DT8A 4RPGA 5HJ7A 1V25A 5E9WA 1XU4A 3KWJA 4K9MA 4IQ4A 4X20A 4BU1A 1YRQA 4KO2S 1Q1GA 2HUNA 5KNDD 3RJ5A 1VSTA 3U4IA 2RI1A 4Y6PA 3I1IA 4YCMA 2W11A 2QU7A 2V9ZA 1BN6A 4B3DA 1NI5A 2CV1A 2E85A 2ZYRA 4JLOA 1XLVA 3LNCA 3VKFA 2CYAA 1DKNA 5EPEA 5CDFE 1KFEB 1REQA 2D7CA 2C7GA 2LP4Y 3O4RA 3HR4A 1TB4A 3MN1A 3USCS 4AUEA 2AR7A 3P94A 2LE0A 2FPWA 1ZI8A 1XHFA 2MMGA 4CLEA 2EF1A 1WMEA 2QTBA 1D1PA 2BLLA 4IS2A 4Y6GB 1XL1A 3PXGA 4ENRA 3IV9A 5EJ7A 3FDIA 3OZXA 4YRKA 4XIYA 2VF4X 4WX2B 1BJRE 3ND7A 2ZRJA 3U5TA 2ZZNA 3BM5A 4WNCA 4GT1A 3JQ7A 2Y2VA 3QW4B 4IFBA 3OX2A 4KWTA 1F20A 3GNQA 1HETA 4RH0A 4UEQA 1Q7GA 1WVGA 4FX2A 1KY5A 1PS8A 1NQAO 2W42A 1H9AA 1JQDA 5A5DA 1M2JA 3V6MA 3OIGA 5KNBA 3IULA 2D4HA 2XNSA 1G8FA 3DB2A 3GJ8A 3QWIA 4N6GA 4EB3A 5BPHA 3HC7A 3R5HA 3GH3A 1F51E 4MLZA 4YAJA 5CIQA 3TLYA 1GFZA 3M8KA 4BLSA 4QEDA 1FDRA 4A2PA 2YWRA 3ZD7A 1LPSA 3B82A 5C35A 4OLBA 4IJSA 2FDXA 3OQBA 1B3BA 4W8OA 1K98A 2F3SA 1POXA 2D2FA 3TRFA 1PFUA 1WBJB 2CFOA 2FHPA 2FQQA 4XYLA 2RGUA 3OKPA 1BFKA 3TTWA 1VRWA 4DCJA 1FFXB 3ZEIA 3C6KA 4G5FA 3NW9A 4OHWA 1G8MA 4I1VA 4AJLA 5BVHB 4PQGA 4ZMRA 2NVOA 3ZLUA 2ZSFA 1J00A 2DUNA 1NJ8A 3L9WA 1H85A 1I4EB 4EVIA 3DHEA 3L41A 2B36A 3WIUA 2GZHA 5JDIC 4MYUA 1FMCA 5AMXA 1E1RA 3EPHA 3SJUA 4EI7A 2F1OA 4JDPA 4L5BA 2P2YA 4DRYA 2K7ZA 2A5YB 1LV8A 4MHOA 5B2EA 2FPGB 1OREA 1YJ5A 4DQXA 4BATA 1FRFS 1KH1A 4MCIA 4B40A 1LUAA 1XMOB 3NYRA 4IIJA 1W85B 1EQAA 4PBTA 4RVOA 4ND6A 2FMKA 3MLEA 3QFCA 4JC0A 3ZIUA 4UUOA 2OHFA 4X84A 5D3MB 1Q77A 5C46F 3G2MA 1LBHA 3UMBA 2RE8A 3GPCA 1Q1AA 3UV3A 1CEEA 3JSXA 4F7WA 1RJ9B 1N8TA 3GLRA 3RD5A 5EMNA 3UWSA 2I7TA 1P73A 1YUNA 2AFRA 4QXMA 3SE0A 5CLJA 1DTEA 1PW7A 5CH5A 4KQXA 3LCVB 5IKMA 5JFTA 1PG2A 2JLXA 1LY1A 1KOGA 3GVXA 3UUWA 8ABPA 4DG8A 1MD9A 1PWXA 5FAKA 4QJIA 2FSSA 3QENA 1XQVA 4YDRA 1S2GA 3TSAA 4L2IB 2HYIC 4H0NA 1L3IA 3PGXA 3RWMB 1LBQA 4O6VA 1DQPA 2AMYA 1K3TA 3D3WB 1F3LA 2C61A 3ZK8A 2PFSA 3DXFA 3PGKA 1FYVA 3HQ4O 4HWKA 4KB5A 4P08A 2BTQB 4LGCA 2WU0A 2EKLA 2IT1A 1X7YA 1NFFA 2DUMA 5IAKA 3DPIA 4EGQA 1IPEA 1UT5A 1ADYA 5AI5A 1GPDG 2N47A 2ZVJA 4AX8A 8OHMA 5AVZA 3ILVA 3T3OA 1EP9A 3KZMA 4B3GA 1PFGA 5D3KA 5ECGC 3L0BA 3ZV4A 1YHYA 4HATA 3A6ZA 4YO7A 5K8CA 2M6LA 3CNHA 3AJRA 1ZX1A 1P7CA 2YVLA 1E7SA 3IUEA 1TYEB 3SF8B 4ZCMA 3V8PA 5B1YA 1G5RA 4MWBA 4AJPA 3U37A 1ZO8A 4ZFNA 5FP0A 4OATA 4EKDA 1ZM9A 4B34A 1E94E 2YBDA 1U7WA 5JMPA 3OAAD 1GAWA 2QPAA 4BY9E 2BI4A 1GDTA 3B1WA 3S6JA 1GZ7A 3Q3GE 3QELA 4V0ME 1LLQA 2WF5A 1IHXA 1K0UA 2DWQA 4JIGA 4YCDA 1H93A 1SNYA 3SN6A 4KSBA 1UR5A 1XALA 1I3CA 3OZTA 1AHNA 2WC1A 1ZEJA 3F2IA 1AQIA 4RSRA 5I9MA 3SX0A 3AVWA 1MG0A 3LCRA 4FHFA 5A4MS 1WBDA 4RNCA 3D3EA 2CXXA 1ZCFA 1AS2A 1P17A 4MQFB 2EQBA 2XAUA 1Z16A 1CF2O 3FDFA 3B7PA 1D2CA 3ZY6A 2BH2A 2G04A 5KSYA 2VT7A 1NP6A 2XQFA 1SHKA 3AEZA 3KCNA 2ZCUA 4IH4A 6REQA 3L77A 4ZO8A 4TKUB 1O77A 3KTFA 4B4VA 1NFRA 4GLJA 1QIIA 3EGEA 3FOWA 3IQEA 3LZCA 3CJRA 3QE9Y 1FW8A 5FPKA 5FTLA 3B6JA 5T8KA 4AY2A 2QV0A 1GEEA 3D1LA 3FR8A 2DM6A 4ZK2A 2PUFA 1T5BA 1KAHA 4EBFA 3MOIA 1AUPA 3GQBB 3NVMB 1R3UA 3LV8A 3N2IA 1Q2UA 1OAAA 1USWA 2IP4A 3B13B 1GNVA 3F3SA 4K26A 4RQAA 4BEVA 1PEDA 1SURA 2IXDA 1GUDA 1UXHA 2OBBA 4WOCA 3JRXA 5JNWA 3SPXA 4BNWA 1Z75A 2L69A 3RS0A 5CGZA 1FP7A 2QQEA 2ZSKA 4GI5A 2YRFA 4ITUA 1E58A 2BE9A 3W4IA 1W96A 2CHUA 3GQVA 3Q5EA 4Y9SA 1CG6A 3HJHA 2PUTA 2PEYA 1G2QA 1SQFA 2XMPA 3DZJA 4G56A 4YI5A 2X0KA 4KFRA 1MEEA 1O94C 3AY3A 2WNIA 3AJ8A 3FAKA 4DIEA 3RI3A 4CIBA 5LC1A 1U99A 3IEIA 3QKRB 5EXXA 4P7KA 1RTKA 1YU9A 4B76A 2D5LA 1UDAA 3AT1A 4MS1A 4TV8A 5ALXA 3VC2A 3WYNA 2PG3A 2Q2NA 4JBLA 3TZKA 2VG8A 3CZ4A 4BN4A 5GMOA 4MQEB 1OZGA 5AVWA 1H9BA 4BMSA 1M8GA 1T8SA 3I4FA 5A5GA 5EKTA 1ZXXA 4DL9A 2JGMA 1C1DB 5CX1B 4KFTA 1SOVA 2WZDA 4A16A 1S8FA 4HX9A 1G8PA 3N0TA 2NYVA 4GDFA 5FOUA 3G2KA 1C8LA 1YZQA 3DQPA 2IPAB 4MKFA 4JT9A 4XH9B 5CDYA 5ICGA 1L1FA 4N76A 3N0WA 2ZRQA 3C6MA 4IX9A 1DAEA 5F5NA 1B6SA 1U5BB 4D3DA 5AHWA 2I54A 2HF2A 2C7RA 3I5UA 1WZIA 1R6BX 1U0RA 2R48A 4I5GA 5FBLB 3KEQA 2BKVA 1MGOA 3BWEA 4D74A 1QR6A 3ONEA 3IDAA 3X1KA 1XSEA 2YHSA 4G4SP 4JL8A 4ZAYA 3PFIA 2CLHB 3I9V6 5B1HA 4UPEA 3HKDB 2X6TA 1K7SN 2IGTA 3L7DA 5EWJA 2ISQA 4QLAA 3WBKA 4O2LA 5GIOE 4HDKB 1ZVMA 5GGXA 2IYVA 2ANCA 1LLFA 3EDYA 2OOSA 4ZEXA 2I1LA 5KCMA 3CUWA 3VNAA 4B7UA 2Y6UA 2HA2A 1LRLA 1E8MA 1JMVA 1OHHA 1TIKA 3PL1A 3R0XA 2PRIA 3LPLA 4OLJA 1QH1B 5EEGA 5FJJA 2CHQA 1W9MA 2WD8A 4MGIR 3MF4A 3H9CA 1JZTA 3DL0A 5LLSA 1RM5A 2QP3A 1QHHB 3ENNA 4A2WA 1ADGA 4XGRA 3QF7A 4DREA 4F4IA 1XYGA 2QAGB 4QGHA 4V2IA 4H59A 3ESYA 3DOOA 4JBIA 5EMJA 1EVKA 2OXRA 1UDXA 4IDAA 5IX8A 4BLOA 5FL7A 1KWGA 3LA6A 4XGQA 2B2XA 1QVWA 3OI7A 4P84A 2Q1XA 1OA1A 1XVIA 3PEVA 4OP2A 2QY6A 4MA4A 1SBNE 3FBWA 1COWA 4MW5A 3KJIA 4E70A 5MFZA 4NXMB 3ZQJA 2P6OA 4INJA 2REQB 4X62B 4XX0B 2P2GA 3GYGA 1FFSA 5JAMA 4JKIA 3UM9A 2XOXA 4NG4A 2H1LA 2V0CA 1WZUA 2P9FA 3KPWA 3EWSA 1MUUA 1R64A 5BW6B 1AVTA 3PF9A 2EJCA 1ZZEA 3I1FA 5CRIA 2VJBA 4LFBB 1T5OA 4JVSB 1JT9A 2FMFA 1CCWA 1JG4A 3GXOA 4KQHA 1YGPA 2WJVA 2OZLA 2GJ9A 4WSOA 5SY9A 5BOSB 5I4BA 1P2TA 1SU7A 5BSFA 1N0IA 1LJLA 4UUMA 4EG6A 1RLMA 2AEJA 2R2GA 1IMJA 2IHKA 3L49A 5J2TB 1W87A 1X1EA 4MYSA 4ZV7A 3DBHB 4RM2A 4TLDA 1P1RA 3ESZA 2P9QA 5JRJA 4G5HA 4HN4B 1ZH8A 3CX8A 3TI9A 4UU8A 5TIIA 1QF9A 1E1CB 2YVUA 1LS6A 2QL6A 2LKCA 3EAFA 5HFAA 1GTRA 2LIPA 4WDRA 3TFQA 1UXIA 4JC8A 2R4TA 5IDYA 3FPBA 1Q0RA 4Z3DA 3O03A 3TMAA 1NZJA 2BFEB 4AKHA 1ORVA 2NVUA 3MWGA 3KJZA 1CT9A 5FYQA 4BX0A 2ECKA 3YASA 2O0LA 4A3SA 2HKIA 3OZCA 1O6CA 2PMWB 3BCUA 3CCFA 3NHLA 3QM1A 2JLCA 2ODQA 2GPSA 4MV4A 4M0KA 1JVSA 2OCKA 5YASA 3V4FA 3GA7A 3FFXA 4JC5A 4EQ6A 1D0SA 3Q41A 4GXTA 2CXSA 3MOSA 1R6VA 3A4MA 5AKHA 2R751 1G6Q1 2RAUA 1HE1C 16PKA 3KKNA 1A8UA 2ZSIA 3LUPA 3PD1A 4MYDA 4NZ9A 1KE1A 4N5NA 4WESA 4E5KA 2X0NA 1Y5LA 2C5GA 4URUR 5AK4A 1PD1A 1KJJA 4FGSA 4MRPA 1TJ5A 1YIOA 4J6EA 1JG3A 4HL6A 4MWSA 3I9JA 5LBIA 4JGIA 2BYTA 1DFIA 4MWCA 5THXA 2ZAOA 1TVCA 3WIDA 1HC7A 4PNHA 3HEMA 3I0ZA 3EIFA 3LKVA 3Q6IA 4UDNA 1QE3A 2XDYA 3JQAA 5HHTA 1USGA 1V43A 1IUPA 4EJSA 4UE3S 4UVGA 5HJ2A 2WFLB 2EAUA 1UPTA 4N5DA 2ECOA 5FXMA 2JG3A 2X4DA 1Z4MA 5HW0A 2IHNA 3PC2A 1N6OA 5LQAA 3N2ZB 1ZGJA 2P41A 3NT2A 1JECA 1YZHA 2FSHA 3GLSA 4CQMB 4ZO7A 4D80A 6YASA 1EWTA 1E9SA 3QV2A 5FBWB 4QBHA 3PEUA 5AKIA 3HYCA 3CXUA 4X64B 3L05A 4PZAA 4Z6KA 1BA2A 1X9GA 3Q12A 3HVUA 3SOPA 1N5IA 4DV0B 4X8LA 1Z5VA 1CETA 5JAZA 3LM8A 4B3SB 4TROA 4HPJB 1JF8A 5EYPA 3U4CA 3D3QA 1TUBA 3JARA 4UVIA 1WW8A 4BQFA 1L4GA 3QI7A 4R98A 4HH0A 1VKJA 1PYGA 1FYFA 4M21A 4CUJA 1L1QA 2RGNC 2FWMX 3ICOA 1Z22A 3MVEA 1T3GA 1FFCA 4PO3X 4RZ3A 1TU0A 4ALMA 4DRZA 5H4GA 5JBIA 1QCCA 3EY4A 2O0MA 3K0AB 3WNQA 8ATCA 4HB3A 1AMOA 3HP1A 2OC4A 5A4DA 1VA5A 2ZIGA 3R8CA 1G5PA 1NUSA 1JHRA 1VKRA 1OLUA 2JGDA 4JJGA 3RS3A 1E6LA 1KI1A 2VJLA 4HWTA 3DOIA 4YXWD 3F4KA 2VPQA 4MUBA 1L6RA 1Y1LA 2E4ZA 3A9SA 3P52A 5ECWA 3LIPA 1QZTA 4B9AA 3K15A 3VV2A 1NVVQ 1FDTA 1GV0A 2JDIA 5KIAA 4LF9B 2XPCA 4DJEC 4F6LA 5BN3B 2IWHA 3ZS9A 4EGAA 4Q05A 3DUFB 1JXQA 4OJTA 1EESA 2O2HA 4B3FX 4B2PA 4E5DA 5EWLA 1IJBA 1MOZA 4WK0B 4B3XA 3ORHA 1O3YA 1OLOA 1TIPA 3AKEA 3IVMA 4NZNA 1HE5A 3UUEA 5K6AA 3SBEA 3COSA 2A58A 6AT1A 2JIBA 1US8A 3GK3A 1V35A 2GZMA 1Y9AA 3HCBA 4EHDA