4WOKA

Crystal structure of udp-glucose 4-epimerase from brucella ovis in complex with nad
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
325
structure length
325
Chain Sequence
ANNVLVVGGAGFIGSHTAKLLAGQGYAPVVYDNLSTGHQSAVRWGDFVEGDILDQARLVETMEKYAPVAVIHFAASAYVGESVEDPAKYYRNNVGGTQSLLDACRLTRTQNVIFSSSCATYGVPSRLPIGEGEAQNPINPYGRTKLIAEHMLADYAVAYGLRYVALRYFNASGADIDGELGEKHDPETHLIPRAMMAAAGRLDVLEVYGDDYETPDGTCIRDYIHVTDLARAHVLAVEHLKEAGGNLAVNLGTGRGTSIREIVQSIGRLTGRSVPVAMRARRAGDPPALYADPALAAEKLGFHTVYSDLDTIIRTAAPHFGLEVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of UDP-glucose 4-epimerase from Brucella ovis in complex with NAD
rcsb
source organism Brucella ovis
molecule tags Isomerase
molecule keywords UDP-glucose 4-epimerase
total genus 117
structure length 325
sequence length 325
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wokA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4wokA02
1G1AA 2BD0A 3EHEA 3BXXA 3JV7A 3OBBA 3JYPA 3S2GA 3H2SA 4BGEA 2OP0A 2BGKA 1ARZA 4LGVA 3E1KA 1HYGA 2X22A 3BMOA 3DZJA 3G1UA 4FJ2A 2Z95A 4ZRNA 3JQ8B 3KV3O 3PP8A 5JYDA 2DC1A 2Y05A 1C0LA 2I99A 2H6EA 4XJTA 4B4UA 2X5OA 1O95A 4ZICA 4KQWA 5C37A 4NU5A 5IJZA 4RCVA 1NM5A 1GYRA 3JQBA 1IPEA 4LVUA 3DZIA 4YJFA 2NUAA 3TOXA 5CEFA 4GKVA 5I8ZA 5COQA 3OICA 1ZSYA 2RH4A 3AY7A 3R3JA 1X0VA 4NJMA 3MEQA 4OM8A 1ZEJA 3H9GA 4WLVA 1YBAA 4I5GA 5JE8A 4BO3A 1B8VA 3IKVA 1MG0A 4NR0A 1NQOA 4QUKA 5ENVA 4NI5A 5A3VA 4FS3A 4DVJA 3S55A 5L7WA 2IE0A 3DDNA 4M1QA 1LQUA 1LDMA 4IJVA 2F00A 1SBYA 3NGLA 3I6IA 4IDEA 3TOZA 2B36A 3ANNA 1PX0A 3AU9A 1F8GA 2NTJA 4EUHA 1IYZA 5K9ZA 5L3ZA 5I9MA 1XYGA 3FBTA 2Y1FA 1P31A 3E18A 2CSUA 2X7HA 2J5RA 1Y8RA 4B7CA 3BA1A 3DB2A 4OYRA 1XQ6A 3ENNA 1DLIA 3ZU2A 2VTDA 3ZU3A 1H6BA 2CUKA 2JD1A 3DONA 3WYBA 5BSEA 3QVWA 1YWGO 1LRJA 4FC6A 4XYBA 1ZJZA 4ZQHA 3RASA 1FK8A 3LK7A 1K2WA 5B4TA 4H16A 4PVDA 1LX6A 3QIVA 1GYQA 2IODA 3ABIA 4IIVA 1VC2A 4RF3A 4DQVA 2X4GA 3CPSA 3X2FA 3GG9A 4CM8A 2HLPA 3AWDA 4YVFA 5B1YA 3KYCA 1YL5A 4CMJA 1HF3A 1GUYA 3CXRA 1WPQA 1TT5A 2W90A 3F5QA 3OIGA 4ZQGA 1U3VA 3LZ6A 3RU7A 1JAYA 4OH1A 4MIOA 3WS7A 4AJPA 4YB8A 5EN4A 4EEZA 4TVOA 5GMOA 3UKOA 4YAKA 3JQ7A 1ISGA 2E4AA 3OQBA 3ROPA 1K89A 5A02A 3I6QA 1R37A 2FOIA 1N9GA 1LBEA 3E82A 2X0RA 3PLRA 5A5FA 3VPXA 4J7UA 2HUNA 2WDZA 2W2KA 5GZ3A 1ISFA 1HDXA 1TT5B 2X5JO 3I9KA 4XCVA 5TT0A 3VHRA 1DFIA 2VYNA 1Y1PA 4FFLA 5EQFA 2PKQO 5CDYA 4QFDA 3FD8A 3NYWA 4F45A 4KUEA 1VJ0A 2B35A 1E1LA 1E77A 3G0OA 2NV6A 4DTIA 3GG2A 4R51A 2VHVA 3IS3A 4E2YA 1DJNA 2NTNA 1FDWA 1T2AA 3GK3A 4PG7A 1U4SA 4D41A 3MJCA 3GVHA 1PS8A 4BNKA 3GEMA 2OZPA 1LXCA 5FWNA 3P7MA 4BV8A 1N92A 1FMCA 1E6WA 2VHYA 4IMPA 2A92A 4W9NA 4E33A 2G76A 3BIOA 1YVEI 1YH3A 4HNHA 3WFIA 4BO8A 5JSFA 1PQUA 3JQEA 4HP8A 1E3IA 5JCJA 5JDIA 1IE3A 3TQHA 4ZQFA 4TRJA 5EL0A 3UAGA 1PJ3A 4PFJA 3EUWA 3RAJA 2PV7A 4YT8A 4RVFA 2HSDA 2VHWA 1NFQA 3C8MA 3ZNNA 5L4LA 4HFMA 1N7HA 3FNGA 3W4JA 1EQUA 1DSSG 5L45A 5EJ2A 3IKTA 4J4BA 3PJEA 1E7SA 1VSUA 2PR2A 1DHTA 3K96A 2FHSA 3PJFA 3GOHA 2J8ZA 4L0QA 2SCUA 4N18A 1BDMA 3OQ6A 4Q3NA 1YONA 2BI8A 2VNAA 3NTOA 1F8FA 3LC2O 2QZZA 3M1LA 4EUEA 2G17A 2I67A 5ER6A 4HADA 2VOJA 4CV0A 4IS2A 2Q1TA 3KZVA 4QECA 4CM5A 5L95A 5DNAA 3PJGA 2AQHA 2EHDA 1R4MA 3RUIA 3PDUA 1VI2A 5EINA 5KKCA 3HDHA 3DHNA 4AFNA 2W4QA 2O3JA 3PHGA 3ZWOA 1I3KA 3AUSA 4KUGA 3H7AA 4R1SA 2PZLA 3ETEA 5AVOA 3G1TA 4KP7A 2C5AA 2O3UA 2PLAA 4XZ3A 3ZNPA 4Z0TA 5JDIC 2GNAA 1DOHA 4Z0HO 5HS4A 1IB6A 1HRDA 3KM0A 4BNTA 3B1JA 3NDRA 1QYVA 4KDFA 3WQRA 4NFHA 3DBRB 5ER9A 3UCXA 5CFZA 1EUZA 1M2WA 1RWBA 1E3EA 4MINA 3AFNA 1Z75A 4Z9XA 4J43A 1GUZA 2C5EA 2JD2A 2UUPA 2PKRA 3BMNA 4QT0A 3WMWA 2VYVA 1K6JA 2YV3A 4WOJA 3UHAA 5TIIA 2YFQA 1J6UA 4BO4A 5G0SA 3WLEA 3KOUA 3W6ZA 3ZHYA 5ADHA 4J3FA 2CY0A 3TPCA 2WE7A 5JCXA 2Y1OA 3U4CA 2WJPA 3GEGA 2NTVA 3D3WB 2OUIA 4DL9A 4E2XA 3DBVO 1HDZA 4UUNA 1PQWA 4BKQA 5K6AA 3JQBC 3DQPA 2LDXA 1NP3A 4E2ZA 9LDTA 1SZJG 4KDEA 1HYEA 2ZB7A 5A3JA 1V9LA 5JO0A 1E5QA 4W82A 2I3GA 4JGBA 5CHEA 1UXIA 2GYYA 1K6XA 2B69A 3ROMA 4AJOA 1MXHA 4YEDA 2GF2A 4AJNA 3K2BA 4CM4B 2A35A 4WLFA 5BNTA 3NT4A 3MWEB 4ZU3A 5HBRA 4IGFA 5DCUA 2WWRA 4M87A 4O59O 2OP1A 1C1XB 3C24A 2B4QA 1A7AA 1I32A 4RDIA 1R0SA 4CLDA 3CIFA 3LC1O 2E49A 3ORFA 1R0LA 1X0XA 1UXJA 3JQDA 2IYPA 1GZ6A 1YBVA 1WMAA 5L4SA 1Y8QA 4BGVA 2JFFA 1Y5MA 2PWZA 4W7IA 2VYVD 3HHPA 3ZDFA 2RHCA 1H2BA 2EF1A 1TT7A 1CETA 1C1XA 1X1EA 3GGGA 4IDCA 1HDCA 3DOJA 4RZIA 2BLLA 1BW9B 2FPPA 1O94A 3KLPX 2RBEA 4JN6B 1OAAA 4J7CA 5THQA 2I6TA 4YJHA 1NVGA 3OJEA 3PFFA 3K30A 1BXGA 1V3UA 2O3RA 5EQDA 4MKZA 5TSDA 1PGJA 1KEWA 2R00C 4XDYA 1GPDG 4FOOA 1I8TA 4XX0A 3JD4A 2Q99A 4CUKA 1LSOA 4FDAA 2BFAA 4FIZA 4IDDA 4LCJA 4IMRA 4YRAA 1EFKA 3U9LA 2DPGA 1XGKA 4ZRMA 1WDLA 4YTEA 2OOSA 2VT2A 1V3VA 4BB5A 1YB1A 4E4YA 1M75A 4M86A 4YJHB 2H63A 2CD9A 4JP2A 1RM3A 5A06A 4FW8A 3NEPX 3GNSA 4A03A 2X5KO 4ZN6A 1E92A 3WGYA 4DWVA 5GZ1A 2NU6A 1YL7A 4R69A 5G0VA 7ADHA 4XIYA 4GAEA 3D4OA 4M55A 3TZQA 4XRGA 2CVOA 2PGLA 5A05A 1P45A 1S7CA 4W6ZA 4ZHSA 4CR7A 4MVJA 3HFSA 2DBQA 3L0DA 1JLLA 1O9BA 2HJSA 4JLWA 3GVIA 3PDJA 1MFZA 5B4VA 5BSGA 1Z7EA 1E5LA 1DFGA 3RWBA 3QSGA 5JAQA 1Y9EA 4GPD1 3ROQA 5JMWA 1ZK4A 3PXXA 4PLWA 3ZWYA 1TA4A 1ULSA 3OJOA 1IHXA 2Y66A 3O26A 1BVRA 3JQ9C 1XEAA 4R01A 3Q2KA 4LCEA 1RJWA 3F6YA 2CDCA 1QLJA 2FR8A 2F1KA 1LLCA 4IDFA 3L4BC 1A4IA 1U3TA 4JJIA 3FTNA 3FSRA 1T4DA 1Z45A 4DQUA 2DBVO 4RVUA 3B6ZA 3WMXA 2GERA 5DULA 2DT5A 1XA0A 1OC2A 3BTOA 1UAYA 4CMKA 1GADO 1ZK0A 1QV7A 5CDGA 3PIIA 2HKIA 3HADA 4XYMA 1EDZA 1MX3A 3IL2A 1W4ZA 1GQYA 3FNHA 3PYXA 4U6SA 4AJHA 3RKUA 1LC0A 5CP8A 2X0IA 4ALLA 3L6OO 4I9HA 4ND2A 3NAQA 4DPKA 3VVCA 2DM6A 2I5PO 4M89A 2GD1O 5JC1A 1R0KA 5AXDA 3QP9A 4RORA 2EXXA 4I9UA 3OA0A 1B14A 4CUJA 1UDAA 1WXDA 1YOVB 2A9FA 3KBOA 4JK3A 1PWZA 4OKNA 1VL8A 4XQCA 3B1FA 4BGIA 3UICA 3U4DA 4CPDA 1ENYA 4GX1A 5CPFA 3GHHA 1PJCA 4J4HA 1LSUA 2HDHA 2HMUA 5KTKA 2OFPA 4MDHA 3F46A 2J3KA 2CVQA 5CG2A 5IDQA 4PZCA 1DRVA 2C7GA 5ICMA 2R2GA 2HCTA 2Y99A 3RJ9A 3ZWNA 1YOVA 3LT0A 3RC1A 1NPYA 3VH1A 1PR9A 4PRKA 1IZ9A 1YE3A 4BV9A 4U5QA 1GY8A 1A27A 5I7EA 1NNUA 3EZLA 4YQYA 4BKRA 3I3OA 1E1NA 4WASA 1PJQA 3QVSA 3RU9A 2X58A 3D5QA 4RPHA 4R68A 3PQFA 4PLGA 5F21A 1U8XX 3HNPA 1NASA 4ZA2A 1ZXBA 3ETDA 1EK6A 1I10A 2DLDA 2PD4A 3GZNB 1OOEA 4OXKA 4J9UE 1KYQA 5C5IA 3AFMA 4J49A 3TL3A 1Q7BA 4YACA 3GY0A 4IINA 1GU7A 4IZHA 5KJ6A 1BSVA 2D59A 1ID1A 3U62A 2AXQA 3SLKA 5KVSA 3MWDB 5TC4A 3A28A 1I3NA 2WD8A 1IL0A 4J6FA 4D43A 1HKUA 1MGOA 1OFGA 4J0FA 4WCFA 1HDRA 5EERA 5CDUA 1WLYA 1EUDA 2FR1A 1ONPA 4CLOA 3MJTA 1G6KA 1I5RA 3AY3A 4B4WA 1SO8A 1NFRA 1ZW1A 2AA3A 1VL6A 4OQYA 1UDBA 2FR0A 1QSGA 5TJHA 3AOGA 1I33A 4QO8A 3GVCA 1JWAB 5BSFA 3GRPA 2GN8A 1NFFA 3LLSA 3FTPA 4R1UA 3EK2A 3OMLA 4B4VA 4YT4A 1YB4A 1OBFO 4TZKA 1ZK1A 6LDHA 4OMUA 1Z6ZA 2AG8A 2UV8A 2EGGA 5A9SB 4DGSA 4A2CA 1QLHA 3V1TC 2IXAA 3FN4A 4BB6A 3WB9A 4BO9A 1PJ4A 3IIEA 3ZU5A 5A03A 5KJ1A 3FF4A 4GX5A 4U0KA 3RUEA 1OZAA 4BNYA 1AE1A 2BGMA 4BO0A 2C29D 2GZ3A 2Q50A 2O3TA 2EKLA 4RLHA 4CL3A 1HYHA 4UUOA 3Q3CA 2YUTA 2VZ9A 3QVXA 2E48A 3GNQA 4BIIA 4GGPA 5F1OA 2OXIA 1DIAA 3Q6IA 2B4RO 3NRCA 4RQTA 3FWZA 3WGQA 2PGDA 2FZWA 1Z74A 4IY1A 4Q9NA 4CUZA 5L9AA 1LSSA 4EZBA 2AEMA 3FPLA 3H2ZA 2VQ3A 3CZRA 4NJOA 1MLDA 2CVZA 3CMMA 4CM3A 4BNLA 2BMAA 3ZHZA 2EJWA 2XXJA 3V2HA 1NX6A 3F47A 5L4NA 2Y0EA 3OM9A 4Q3BA 2G1UA 2VZ0A 1H6AA 3H4VA 3PWSA 3STHA 3SXPA 5ENDA 4MVJP 2NVWA 3HB5X 3AU8A 4CMHA 1D8AA 2VT3A 1X7DA 3EYWA 4FR5A 4EDFA 2ZTUA 2GCGA 1ZNQO 1XSEA 4RF4A 4Y6PA 1Z73A 3S2FA 5KOIA 1MFPA 3KYDB 2JHFA 4LN1A 3E9MA 1ENZA 4PRLA 3S2IA 4R5HA 1IHYA 3N58A 3QWAA 3TJRA 4YPOA 1IZ0A 2NSDA 2XXBA 5CEEA 3IOYA 3V2UA 3DBHB 5IN4A 3VZRA 4NZ9A 1B0AA 3KYDA 3INGA 4C4OA 4EI2A 5IDWA 3JD2A 4FGWA 2QX7A 2IZZA 5KVQA 5BNFA 4IBOA 1I24A 4R1TA 4CMEA 5TT1A 2NM0A 1BMDA 3DTYA 4OKIA 1I0ZA 4ZD6A 3FR8A 3S8MA 4AJ4A 3VPFA 3PYLA 2JCXA 4R1NA 4E5KA 3CUKA 1AUPA 4UULA 4K6FA 4BL5A 5A9RA 3QVOA 4WCFC 5GZ6A 2D1YA 4A10A 1DB3A 3VH3A 1ISIA 3MCVA 5FF9A 3W8DA 1HSZA 2HMSA 4YAIA 4NBRA 4M49A 4YT2A 3ZWXA 3EAGA 3L4SO 3K73O 2GRAA 2EG9A 3L6EA 4MVJE 3Q0EA 4LVCA 2B4TO 3DOCA 4F46A 2YQ5A 3C1TA 5L53A 2UDPA 4L74A 5DP2A 4W4TA 2ZYAA 1HTBA 3JQ6A 4Z3KA 1HEUA 3TFOA 1H9BA 4HXYA 1EVIA 1M67A 4PZEA 4PLFA 4AVYA 3QW2A 3JQGA 2DU8A 5JO9A 3VZQA 4DYVA 1OC4A 4BMSA 4J2OA 4KUHA 4E21A 2DKNA 5KIAA 1GEGA 2P5UA 3RUFA 1FXSA 2J3JA 4MVJI 4Z9YA 5C7IO 2VOEA 5JMPA 3GDGA 1BVUA 4PG6A 2O7SA 3JQFC 3RBVA 1KETA 4GSKA 4ALIA 3DMTC 2GZ1A 2ZATA 4L75A 4HY3A 1XKQA 4ND3A 5G4LA 1D1SA 3VPHA 4YYZA 1QP8A 3CTMA 2JAPA 3DMTA 3DAFA 1KVUA 2O3SA 4IPTA 1OI7A 4Q3CA 3FNEA 2ILTA 4J16A 2OMEA 4XQ9A 3TSCA 1MA0A 1NAHA 2Y93A 4K26A 3ZI0A 4E13A 3OFSA 4A26A 4MPDA 1NAIA 3RI3A 1Y9AA 1GDHA 2EP5A 4GVXA 4RF5A 4GH5A 4U6QA 5F1KA 3IC5A 3DFZA 1HZJA 4DYDA 1IOLA 1XU9A 2WYWA 4R3NA 3E5RA 3JQCA 3WDSA 3I52A 3GNTA 4NU6A 5DT9A 2TMGA 2UVDA 1C0KA 3L9WA 2ZIZA 5L7TA 1NPDA 3HFGA 3FR7A 3ASUA 4BNFA 3M6IA 4IDAA 3M1AA 5TX7A 3HN2A 1GPJA 4UUPA 3RUAA 1PGPA 4BOYA 1BDBA 4DQXA 3MJVA 2ZYGA 3DZFA 2QIOA 1EE2A 3RUDA 1T25A 4CR6A 2GPTA 4BS9A 1O8CA 2IEBA 4PLTA 1FDUA 4HWKA 3F1LA 3HQ4O 4PGFA 4S3MA 5AXBA 3INRA 3OETA 3GHYA 4RPLA 4DIBA 3TL2A 1P44A 3OP4A 1U8FO 3Q9UA 5JY1A 4BQPA 1KEUA 1X14A 4J1NA 4CMAA 3WGIA 2D2IA 3LT1A 3O8QA 4YWJA 2W98A 4BO2A 4OQZA 4CQMD 1GD1O 4Z9FA 4NQZA 4MOWA 1ZVMA 3GMDA 2H9IA 1K3TA 2WTBA 2IYOA 5G0UA 4RZHA 3A4VA 3PHLA 2G5CA 3DTTA 1LLUA 3AK4A 3A14A 4I8XA 5IZ4A 1L7EA 2X9VA 4Q3DA 4NBTA 4MIYA 1EK5A 3AI3A 2B83A 3ETGA 1YRLA 3CEAA 4I9NA 5DCWA 4IGEA 4B3HA 4D45A 1I2ZA 3BMCA 1RYEA 2V7PA 3Q1LA 4ID9A 1TI7A 1D7OA 1EVYA 1UZNA 4IJWA 4QEDA 3PIDA 2Q4BA 1MXFA 1XIVA 2X86A 3C1AA 1ZO8A 4GVLA 4S1VA 4D3DA 2YJZA 3BMOB 3DR3A 2GN9A 1WMBA 4DIFA 5DBFA 5G4KA 1S6YA 1AHIA 4IXTA 3DBLB 3QRWA 2Z5LA 2ZB3A 3GAFA 3LT2A 3SJUA 1VLLA 1QYCA 5AXCA 4G5HA 5A1TA 4MKXA 3WYCA 4GBJA 2OGUA 1YDWA 1NVTA 2W2LD 2O2YA 1DAPA 1CERA 1P0CA 3BYZA 4FJ0A 4R3WA 3LYLA 5JAMA 5G4KB 2ZCUA 1YQGA 1JKIA 3A1NA 3RKRA 1WP4A 2JAHA 4YDRA 3WNVA 4BVAA 4Y67A 1PGQA 3BMQA 3DBHA 3K2EA 1DAOA 3RBZA 3FRJA 5CAEA 1GV1A 3O4RA 3W6UA 1DIBA 5H81A 1JW9B 4W7HA 1BG6A 1VM6A 2NVBA 3VC7A 4G2NA 5KJCA 4B3JA 3UOGA 4UUMA 3GGOA 1QKIA 4CR8A 1J0XO 1WDKA 4YBZA 3K5PA 4I5FA 4LSMA 2BELA 4B8WA 4CMGA 4FB5A 1NYTA 1ZJYA 1A9YA 2ZKLA 5JLAA 4BO5A 3QWHA 1CQJA 4K9DA 4MP3A 1JDJA 2NACA 3RD5A 4EBFA 3QE3A 2Q4EA 2DAPA 1J4AA 1EE9A 2AW5A 4M54A 1E3LA 2Z1NA 3GGPA 2ZCVA 4MVJF 2ZK7A 1I30A 1BHSA 4RPGA 1DRWA 1YBMA 4BNWA 4BO1A 4E30A 4BNVA 3KLMX 3P2YA 3WGGA 3IUPA 1JKFA 2I76A 2BH9A 3JQGB 4YAJA 3V8BA 1LUAA 2O3QA 1A7KA 1AGNA 2V6MA 4XQEA 5DF1A 3LC7O 3WGHA 2JL1A 4HV4A 2O50A 2WD7A 2Y1DA 2GN4A 3JD3A 4OO3A 1FJHA 3GAZA 2ZQYA 3OIDA 2DQ4A 3D3EA 1WWKA 5FI3A 5HRUA 4Y9DA 4XD2A 4N5NA 4CM8B 1P77A 3W1VA 1HDOA 1SB9A 3AOEC 2AHRA 2O4UX 1GZ3A 1EBFA 3GRKA 5IAAA 1U1IA 2X1HA 3LDHA 5KKAA 3CH6A 2J3HA 1NWHA 2VRCD 2C20A 1U3WA 2YDXA 4ALMA 1X7HA 4DMLA 3WXBA 3VKVA 4EJ0A 5JY6A 4TZTA 2QRKA 1N9GB 1QRRA 3VTZA 4AICA 3RFTA 4TRNA 2X9NA 4O63O 5CEJA 4D42A 1UZMA 2CDBA 3LF2A 4XGIA 3TZHA 2Z1MA 4NFYA 4GLLA 5JDCA 4FCCA 1DO8A 1VPDA 4XR9A 4FGSA 2V6FA 4YXFA 4WECA 5IDYA 3WGZA 4LSWA 3V1YA 4FFNA 1V8BA 2JJYA 5DN9A 4Y98A 1CWUA 3B20A 4RF2A 1EVZA 1YXMA 1UP4A 4GWKA 3RIHA 1JU9A 4IIUA 2B5VA 2P91A 3JQFA 1P0FA 1ZEMA 4XWYA 3V2GA 3ULKA 1GV0A 4XGNA 1YJQA 1A72A 5TQVA 3PHHA 4R9RA 3FHLA 3E8XA 2VNSA 2ZYDA 4JCOA 2VZ8A 5TF4A 1B16A 9LDBA 1BWSA 2EERA 1YO6A 4QX6A 3AM5A 2Q2WA 1N2SA 1TVEA 4R54A 1A9ZA 2V6GA 1UXKA 2AQIA 2FSVA 1MG5A 3LF1A 3RUHA 3VOSA 3O8QB 3GQVA 4B7UA 4ND5A 3IP3A 4MP8A 4HFNA 5TRTA 1H9AA 3HUDA 4K6CA 3ADPA 4U7WA 3F5SA 2BFOA 4FSHA 4YQZA 5AOVA 8ADHA 1K0UA 4YA6A 5L40A 1ISHA 1T1RA 2GLXA 3D7LA 3MJEA 3PGXA 4LK3A 4P4GA 4RDHA 1JVBA 5EPOA 2YDYA 2WYUA 2QHXA 2DVMA 4B3IA 4CV2A 3ZHXA 1PQPA 4UVIA 1T24A 2WE8A 2XF8A 1C0PA 1C14A 4GMFA 4CLHA 4ESOA 1R12A 1LLDA 4AJKA 1E7WA 2AG5A 2I3AA 3WTCA 3P2OA 3PI7A 4WJZA 3ONDA 3QWFA 2X6TA 4BNJA 4R9SA 1JTVA 2EKPA 1PJTA 3GPIA 1IUKA 4KTTE 4RO0A 4PCVA 3TF5A 4CLRB 3WIDA 3TWOA 3I4FA 4I08A 4LRTB 1DEHA 5IZCC 2Q1SA 3IAHA 4NK4A 7MDHA 2RAFA 4J0EA 2RHRA 3CKYA 3T4EA 3ZV5A 1QYXA 1W6UA 4KTVE 1SNYA 4QXMA 4BO7A 3O9ZA 1XQ1A 4Q39A 4CLEA 3BZUA 3PZBA 1PL8A 4DLBA 4HBGA 4DPLA 1WZIA 3GDFA 3H9EO 1QV6A 3QQPA 3VVBA 2P4HX 2ET6A 4GX0A 1KOLA 4PVCA 4FQ8A 4ZVVA 4P4NA 4TKMA 1M6HA 1VKOA 4L76A 1PZFA 2JKVA 4MKRA 4R16A 5DDIP 5B12A 4U0JA 3BTSA 3DZBA 3GMSA 2HK9A 2WM3A 3RSHA 1HWYA 5JCJD 2V65A 2CMDA 3EVNA 1DC3A 5KWEA 1SOWA 3UGKA 4OOFA 3PLNA 2CF5A 2ZQZA 4PLPA 4OJNA 5HS6A 1Q0QA 1N5DA 5H82A 3NDJA 1Y5RA 2IXBA 4JJGA 1B7GO 1NXQA 1DIRA 1ONNA 5LDHA 3C7DB 2G0TA 1EMDA 3COSA 2BF7A 3PQDA 4XR4A 4D46A 3K31A 4P4LA 5AXAA 1UUFA 3GUCA 3VZPA 5JAZA 4FFMA 3MOGA 1ISMA 5JBIA 5L7YA 1U2DA 1E7YA 4G65A 3BAZA 3WR5A 1KVSA 2LDBA 3DL2A 4NBUA 4AJ1A 3D3WA 3VDQA 3N7UA 4L4SA 4HX5A 4CQLA 3HSKA 2O23A 2DFDA 2WYVA 2YYYA 1QXSA 1N7GA 1H6DA 4YRBA 1ZMTA 2Y1CA 2D5AA 1I2BA 1J5PA 3RFXA 3WJ7A 4BNGA 5EESA 1C3VA 4AJEA 1QYDA 2J6IA 4DUPA 4WLUA 3ASVA 4CODB 2C2YA 3WFJA 4BMNA 3EC7A 1SPXA 2ZJ0A 4U8GA 1PWXA 2X23A 1PEDA 3IP1A 4OXNA 1EUCA 3OEYA 4MVJH 4NBWA 4OHUA 1P3DA 1EDOA 3L4BA 3RBXA 1E3SA 3ZCXA 2Y0CA 1YL6A 3ZW8A 3GZNA 4CMIB 1YQXA 2X8LA 1DFHA 3PHJA 1CIVA 1KVRA 1ZCJA 3HG7A 3K6JA 1WAMA 5DCYA 1QG6A 3U3XA 3T7EA 5DOVA 4F6CA 2BHLA 1OMOA 4GSLA 1KC3A 5FFFA 4EUFA 4DLLA 4CLOB 2H1SA 4OGWA 5LCXA 5JNLA 4TMFA 5ITWA 1R4NA 4H15A 4A73A 3E9NA 2JFGA 4CMIA 2DBZA 1ZBQA 2BFMA 1BW9A 1U3UA 3JQ8A 1BXGB 4FD3A 4HNGA 1HT0A 2FRDA 4P8RA 4BKUA 2VCYA 5BR7A 4CM7A 1TXGA 2DTXA 1WNTA 2PK3A 3R6DA 4KWHA 5IDXA 5KJFA 4WLOA 3KO8A 1VRWA 1A71A 2G82A 4PLCA 2NU8A 3G17A 1ADGA 4YAGA 3U4HA 1R4NB 3HWRA 3GZ4A 2PD3A 1F12A 1YB5A 3LLVA 1LDEA 1ZFNA 3JD1A 4DREA 3DEYX 3E6AA 5KJEA 4CQMB 2C82A 2BKAA 2YY7A 4TSKA 3OA2A 2EV9A 2PGJA 3CMCO 1PZEA 1DPGA 4RVDA 3AUTA 2PZKA 3HB4X 1RM4A 4JBIA 5CDTA 5T67A 2NQTA 4IJUA 5I7FA 3QJ5A 5CDSA 3OEWA 3ZNQA 1HZZA 3ADOA 2FPGA 4BNHA 1UXGA 5B37A 3GVXA 5BSHA 1E3JA 3GFGA 3KTDA 1ZK2A 1F06A 2Q2VA 5KNLA 1K6IA 1P1KA 4WGGA 4GMGA 4E5MA 1R16A 1NBOA 2HJRA 2QW8A 3ZN2A 1SOVA 1U5AA 4RGBA 2PZJA 8LDHA 2R6JA 3H5RA 3UCEA 3GT0A 3K8ZA 3RCBA 1Y8RB 4ZQBA 3FWNA 4EYEA 4UVGA 1H5QA 3D5TA 4ITUA 3GH3A 4INAA 5G0WA 4J2HA 1T4BA 1P1RA 4J1QA 1TLTA 3DMYA 4AG3A 2I66A 4ALNA 3HE3A 2CNBA 1GTMA 1KVTA 1YDEA 4XKJA 2VUTA 2NVUA 4JQCA 4UEJA 1F17A 3AI2A 4JBGA 1LEHA 3AOEA 1JN0A 1YS4A 5TGDA 5IF3A 3A06A 3SJ7A 1PZGA 2CZCA 1NVMB 1CRWG 5THKA 5K0ZA 4O6VA 4QQRA 4ALKA 2EW2A 3T4XA 2YV1A 3WBFA 1MP0A 4E12A 4N5LA 1I36A 1GQ2A 4A0SA 3PPIA 4EITA 1DIGA 1ADCA 1DJQA 3ICCA 4M8SA 2NVUB 1SEPA 2AQKA 5I9NA 2B0JA 1AN9A 1PTJA 4CMEC 2YW9A 4DPMA 3DC2A 1U2GA 1C1DB 3TZKA 3F3SA 3A9WA 2RH8A 4LISA 3CINA 1PGNA 5TNXA 3DHYA 4D79A 2EW8A 2RIRA 3SLGA 2ZTMA 1PJSA 1AXGA 3TDKA 2Q1UA 3JQ7B 3KEOA 3F1KA 4FJ1A 5JC8A 2DFVA 1K5HA 5DBIA 3PWZA 3KB6A 1BRMA 1Q0LA 2VHZA 1LDYA 4FBGA 4EW6A 1DBVO 4BUCA 1E7QA 3GN2A 4K28A 4IQ0A 1KERA 3T7CA 4UAGA 5HA5A 2ZTVA 1CEQA 3E9QA 4NG5A 3RJ5A 1PZHA 2O4CA 3RUCA 1H0KA 1ZXLA 4ND4A 3W4KA 4B8ZA 2IZ0A 1E0DA 2QRJA 1MC5A 3H65A 4D7AA 1KIFA 3PJDA 1SC6A 1ISJA 4DRYA 5ILOA 5KCZA 1O5IA 3ZV4A 1U5CA 4CQLB 4ONEA 2UUOA 2O48X 3HDJA 4GKBA 2JCVA 2VRBA 4RPKA 3H5AA 3I9OA 4YRDA 4BNXA 2R00A 3V5NA 4E5NA 2B37A 4LRSB 3ZH2A 3BTVA 3WTBA 5MGBA 2YV2A 3I9JA 1ZSVA 3KUXA 3TFQA 2CFCA 1CQIA 3DOOA 2B5WA 2EWMA 4GL4A 4WLNA 3L07A 1SEVA 4NNJA 4LMRA 4TRRA 2P9CA 3R3SA 4WCFB 1LSJA 4Z6KA 4KWIA 1VJ1A 1VKNA 2HAEA 4KOAA 4UREA 1V3TA 1EFLA 3ANLA 4O1MA 4XYLA 5CPBA 2Y1EA 1HDGO 4IS3A 3EW7A 3WJAA 2QG4A 1HXHA 1MB4A 3LSYA 3PFWO 4D3FA 5I7VA 4HUJA 3NTQA 5FEUA 5J23A 3UW3A 4PN3A 4QTZA 3GEDA 1KVQA 2FPIA 3HN7A 2P4QA 5JAIA 4TQGA 2CDAA 1GUFA 3OJLA 4MO2A 3RC9A 4UVHA 4F6LA 1PSDA 1A5ZA 1KY4A 3VAZA 4Z3DA 4UEKA 3UH1A 4CLXA 1MV8A 3JD0A 2D3TA 3WSWA 4WEQA 1B3BA 4DLAA 4YJFB 4DIOA 1LU9A 1DC6A 3P5SA 4WKGA 3BHIA 4RL6A 1UJMA 1ZZEA 4NJMB 4WNIA 2BRUA 3PEFA 4J90A 4XYGA 3DO5A 4W9NC 2PA3A 2O7QA 3GPDG 4XYEA 1GR0A 4WCDA 3W4IA 3ZWVA 2IRWA 3KRTA 4FOSA 1X7GA 4OSPA 1X1TA 3D64A 1Z82A 4P38A 5ILGA 1JVSA 4CJXA 2P5YA 5U1PA 2BFPA 2GASA 2Q1WA 2EJVA 3JYNA 4MVJG 1NHGA 4BKPA 1HL3A 1HDYA 4RQUA 1N1GA 2GSDA 4II3A 5DP1A 4BKOA 5T57A 2HO5A 2VWGA 4OIMA 1XELA 3C85A 3LVFO 1VSVA 3NTRA 5FYDA 3RFVA 5TJ9A 3NJ4A 4TROA 3ZWWA 4G81A 1HLPA 4XB1A 3TNLA 1NQ5A 4K1LA 5LDGA 4XA8A 1HLDA 3IMFA 4P22A 3DBRA 1Q0HA 3K92A 1AHHA 4CM1A 4EJMA 3BMCB 4AJ2A 4PLYA 2W8ZA 3EDMA 1GFSA 3WSVA 4L4RA 2AMFA 4FC7A 3BMNB 4IUYA 1KBZA 1X13A 1H6CA 1T1SA 5BT9A 2DUWA 3KYBA 4E32A 1WZEA 5F5LA 3EY4A 1P9LA 3F4BA 3DFUA 5A5EA 1UP7A 4IJKA 4RJTA 3L9XA 1BTOA 4NBVA 3JYLA 1EEHA 2FZEA 4YAEA 3OQ1A 1UR5A 1GQQA 4JXKA 5JDCC 2WEKA 1GYPA 1TB4A 3AUAA 1NHWA 1T2FA 5DZSA 2PH5A 2XOXA 2PTGA 2BI7A 1GCUA 3QY9A 1Q7CA 4MP6A 2QZ9A 4JIGA 4N5MA 4NIMA 4NPCA 3UCFA 4BNZA 1DRUA 5KVCA 4L9RA 1IY8A 3R1IA 4NHEA 5JS6A 1CDOA 3C7CB 3DZGA 4J9VA 2VTEA 4GGOA 5F5NA 1KEVA 4GLOA 4JBHA 5C3MA 3PHIA 2EGHA 4J1SA 4MJLA 1B26A 3FCOA 4XIJA 1UZLA 1LTHR 2PFGA 2OHXA 5C7OO 3P19A 4W99A 3NT5A 1ADFA 3E03A 3SEFA 1PGOA 4PZDA 2NLOA 1JQBA 3QHAA 1O0SA 1ZKMA 1NTOA 4EEXA 4E0BA 3ZV3A 3O38A 2QRLA 3PVZA 5JYEA 1Y8QB 1CJCA 1LQTA 1PIWA 3U0BA 1R6DA 1EZ4A 2AE1A 4Y8VA 2FMUA 3RC7A 2NU7A 1JKJA 1F14A 1I3LA 2X9GA 2IZ1A 2TMDA 3ZWMA 3SX2A 1YJ8A 1Z7BA 3JQAA 1GCOA 4WEOA 4XJSA 1VE9A 4N7RA 1IPFA 3WG9A 4R4JA 1M6WA 2QQ5A 2NADA 1PJ2A 4ZGWA 1P74A 1O6ZA 5A4DA 2GN6A 3WOHA 2DPHA 3AI1A 5KVVA 3G79A 3U49A 2PKQP 3H9UA 4JX8A 4BNNA 2AQ8A 4DBVO 3WGOA 4CM9D 3ONEA 4BNUA 1D1TA 3JQAB 4WLEA 2E82A 2JD0A 4IQGA 4URFA 4YJDA 4BMVA 2UYYA 3ENKA 3JTMA 1DC5A 3QA9A 4FFPA 2WD7B 2HK7A 2J5QA 4B79A 4UVDA 1GL3A 1A4UA 2A4KA 2VUUA 2OO5A 2POQX 3NJ8A 1SAYA 2V6BA 1YQDA 4IZIA 5T8KA 1UH5A 4XRRA 1MUUA 2GUGA 2WMDA 4UVEA 3ZGYA 3WWZA 1U7TA 4BHTA 4TRMA 3C3XA 4C7KA 4XB2A 2P9EA 1GAEO 2FSSA 3G3EA 1LDGA 3B70A 2VYND 4BQRA 1GZ4A 1PL6A 1W8DA 1E6UA 3QWIA 1ZK3A 5GY7A 3GDOA 1E7RA 4ND1A 3ICPA 1LLQA 4H3VA 3OJ0A 4E31A 4NDNE 2QYTA 4YR9A 3H8VA 1UDCA 4I5DA 4DC0A 3I9LA 2IEDA 1NR7A 3H9QA 2NQ8A 3AW9A 3I83A 1DDOA 3CSDA 2E37A 3KVOA 4I5EA 1GEEA 4HKTA 4L73A 4Q3EA 1HSOA 1R4MB 4XGKA 2ZB4A 5ITVA 1PL7A 3RROA 4N54A 4GQAA 3DAGA 1XR3A 1E3WA 2AE2A 4MVJD 2XPCA 1JA9A 1PU2A 2OL4A 3FBGA 3JYQA 3RVDA 3VDRA 3S2EA 3AM4A 3NDIA 3D1LA 1HETA 3ITDA 2W2LA 3GF4A 4YT5A 3INTA 3Q9NA 2EIHA 2OBNA 4PLVA 1VJTA 3MJ4A 1EQ2A 1SMKA 4OXYA 2EP7A 3WYEA 1E7MA 2OORA 1AXEA 1H2HA 1E3WB 4L8VA 3ZHBA 5U9CA 3H3JA 2Q46A 2C59A 2D4AA 3I9NA 4RVSA 3NV9A 4GX2A 3W8EA 4CL8A 3NGXA 3SVTA 3FI9A 3C1OA 4L4XA 3AJRA 4BNMA 4CMBA 1EBUA 2ZJ1A 3JSAA 5G2OA 3OSUA 1L1FA 2PZMA 3BTUA 4FFRA 3KSZO 5MDHA 3DBLA 4IDBA 2HK8A 1R15A 5IXSA 1W73A 3LU1A 3PZRA 4CM6A 4A5OA 3OF2A 2YQ4A 4KMSA 3OH8A 1ZMOA 4OL9A 3WNQA 1E1KA 4E5YA 4TKLA 3OIFA 1F0YA 4FPXA 1ZH8A 1T26A 3M2PA 4R5MA 4A27A 4X54A 2HRZA 2C07A 4D3SA 1LC3A 2FY8A 3WQSB 2FP4A 1I2CA 1NQAO 1XLTA 3SBOA 1XHLA 4AJJA 3Q11A 2XAAA 5ES3A 1BXZA 1VL0A 3AM3A 2H5LA 4ZJUA 3UFXA 4CM4A 1NQTA 3BMQB 1E1MA 2O2SA 2Y0DA 5I8WA 2VHXA 3DWFA 4CLRA 3WBBA 4EGFA 5IXYA 3M2TA 4OSOA 2Q3EA 3ROKA 4PG5A 4YCAA 5F3RA 1HE3A 3FNFA 3H9JA 4RLSA 3VZSA 1FDVA 2VWPA 4R41A 1WDMA 1L7DA 2IDZA 5JPIA 3KSUA 1DXYA 1I01A 5U4QA 1NPTO 4NFSA 1FDSA 2GDZA 4ALJA 1P1FA 1T2DA 4CV1A 2YHIA 1RPNA 3E48A 1KEPA 3KSDO 3MZ0A 4IQ8A 2DTDA 1BGVA 3OECA 1QORA 4JP3A 4E3ZA 3PRJA 3UF0A 3WICA 3JYOA 2E6UX 5COAA 1KC1A 1XDWA 3TZCA 3ZWAA 2WSBA 1LJ8A 3KXDA 1FDTA 2C2XA 4HFJA 1ENOA 3F9IA 4XQGA 3MTGA 1RM5A 5HWSA 4PIVA 4AJIA 4Q3AA 1RM0A 4WNCA 3GC6A 5T6BA 3JQAD 5T5QA 3EZYA 4RVHA 2FN7A 3GN1A 3ZWBA 4DMMA 3IUSA 4MVJM 4PG4A 1B15A 1NR1A 3IJRA 3UUWA 2PH3A 5AYVA 5T8KC 1QMGA 3H3FA 1SB8A 2BGLA 4A7PA 3ANMA 4DXHA 5IG2A 1DHRA 4E6PA 3HDYA 4IM7A 2Y68A 1Y7TA 3G49A 2GO1A 1YGYA 1ZSNA 5IZCA 2D0IA 1G0NA 3LQFA 3EVTA 3HJAA 3U4IA 1C0IA 4PLZA 3I23A 3D4PA 3QWBA 2C0CA 4J91A 4RV9A 3IDSA 4NK5A 4B4OA 1P1JA 1U28A 2X0JA 5DOZA 3ZZNA 5DBGA 5H83A 3IJPA 3TRIA 2YZ7A 4JROA 3ZWCA 3VH2A 1U9JA 5C7LO 1D4FA 1HE5A 3DZHA 2VWHA 1T2EA 5JW6A 3RQSA 5B4UA 3WIEA 3VKUA 5IN5A 4Z0PA 3R0IA 2NNLD 2Q49A 1B8UA 1DIHA 3PYMA 3PTZA 2Y1GA 3NX4A 3ZWPA 1RKXA 5HM8A 1M76A 4IXWA 2I65A 3QLJA 4Y6SA 4RVGA 1NWCA 4ZQEA 2P2SA 3NKLA 5A9TA 1PR3A 2HMTA 3GR6A 4WPGA 3DAPA 1M66A 3VTFA 1ONOA 3FPCA 1PJLA 3SC4A 5CG1A 5JFOA 1ML3A 2EKQA 4FN4A 2UAGA 3QV1A 3I1JA 4E2WA 3CE6A 2FWMX 3SC6A 3CZMA 2YFHA 1U4OA 3UXYA 4WOKA 4XDZA 4AJLA 1SCUA 3UN1A 4NH4A 3WX0A 4IDGA 2P68A 1ORRA 4CM9A 1B3RA 5JXWA 3E5MA 1P1HA 2Y67A 3HZZA 3WWYA 1XU7A 3I9MA 3O03A 3N74A 5TLSA 1LRLA 4J1TA 1JWBB 1B8PA 3BHMA 3ON5A 4OAQA 1UAGA 4CQMA 1X15A 3D0OA 2NU9A 1Q7GA 1YKFA 1ENPA 4YJGB 1W0CA 3KEQA 4WUVA 1EVJA 3ITKA 1P1IA 4I1IA 5HTOA 3AUUA 5G0TA 1ULUA 5L51A 3EMKA 1DLJA 4TVBA 2AEFA 1FF9A 1HE4A 3PK0A 3RC2A 3ST7A 4JNKA 5LC1A 5EMHA 5I9LA 1JAXA 4ROSA 2HU2A 3ONFA 3VH4A 5A04A 1PS9A 1LI4A 4CV3A 1LDNA 3S1LA 1Q2XA 3NT2A 3L77A 4YJGA 3GUYA 3KETA 5BNIA 5EIOA 1H93A 2I9PA 4DC1A 4DA9A 4GI2A 2DUUA 1PS0A 2DTEA 1U7HA 4O0LA 4QSMA 1UXHA 1O89A 2ZB8A 1V0JA 1DC4A 1XWFA 1Y6JA 3W8FA 1LRKA 4GWGA 4LMPA 4BNIA 2OBYA 1T2CA 1LA2A 4OOEA 1CF2O 3VPGA 3QVTA 3WGTA 1HE2A 4QO7A 4D0SA 1V6AA 2YHUA 3KHUA 1XCBA 3ZV6A 4C7JA 1WVGA 1CYDA 2C7VA 3JQ9A 3ZU4A 4F3YA 4BGUA 3DZKA 2P9GA 3I5MA 2HRBA 1N1EA 3KYCB 3PGJA 3U5TA 3VPSA 2JFHA 5K6AC 1IULA 3LT4A 4H7PA 4PLHA 3ZNOA 4BO6A 1BXKA 3TN7A 4D44A 1V35A 2PY6A 3I4CA 4TWRA 4B7XA 4QFCA 2GZ2A 2PNFA 3GA0A 3HDQA 5AQ1A 4II2A 5T64A 4HFRA 5F1PA 3DHEA 4WE3A 2CF6A 3UVEA 1LNQA 1ZUD1 5A9SA 2YHIB 3H6KA 3PQEA 4RPJA 5TS3A 4ILKA 3NUGA 2W2KB 3C7AA 3B1KA 6ADHA 4D0RA 1C1DA 1LDBA 4FFOA 3GVPA 4Y6RA 4MIEA 1PJBA 5I7SA 1H94A 3DXFA 2AEJA 2JHGA 2PD6A 1QYWA 2Q2QA 4JJFA 5FI5A 2DBRA 1KS9A 3F4LA 1WW8A 3EGOA 1XG5A 3BHJA 3V1UA 4PG8A 4CMCA 4J4TA 3GFBA 3OHSX 5ICSA 2A94A 2D8AA 3U09A 4UEOA 3PWKA 3AY6A 3L6DA 1ZIDA 2VN8A 3MTJA 1Y81A 2D5CA 1G0OA 4NMHA 1KY5A 4J7XA 2HMVA 3IQDB 2GR9A 1E6EA 2HQ1A 3Q2IA 4E5PA 2RCYA 2JCYA 1ADBA 1RYDA 3ZW9A 1I3MA 2VUSA 1N8KA 2EEZA 3MJSA 3WQQA 4O5OA 2QYSA 4AL4A 2Q45A 3OJFA 3MOIA 5COBA 1UP6A 3JCZA 1Q1NA 2VRCA 4KQXA 4XEHA 3WLFA 2J5KA 3H5NA 2C54A 2X0NA 2VWQA 1B2LA 2J3IA 3K9QO 4LW8A 4KZPA 2HMWA 3D4NA 4WK6A 4EJ6A 1MC4A 1R66A 3TZ6A 5BQFA 2GGSA 1D3AA 4DBZA 1J49A 1QR6A 1TEHA 2NWQA 1P33A 3GLQA 3X2EA 5IFLA 2ZTLA
chains in the Genus database with same CATH superfamily
3MUOA 3N2NA 4OHOA 2ZRGA 1Z6QA 4KMRA 3GU3A 5AKLA 4QDTA 1M34B 3IEXA 3H2SA 4KC0A 4OQQA 4BGEA 3CUEF 1N5MA 1ARZA 3HBLA 1ZU4A 3KHTA 3SYMA 3ZE7A 3PPXA 2ISCA 4FJ2A 3ZD8A 3GP3A 4ZRNA 4BQIA 2IELA 3NYIA 1TUIA 4EF5A 4R7GA 1K63A 5C53B 4MR9A 3HCDA 3OZTA 2C0QA 3EEIA 2ZDQA 5KNDH 4GI3A 2QEQA 2I99A 3RB8A 3K8OE 1TQ2A 4JITA 4XJTA 2ZSHA 2R6ZA 4PYQA 7REQA 1XQWA 2P2NA 4UNNA 1YVPA 3EEYA 4AY2A 1OA1A 1RU3A 1ETHA 5KYGA 4RCVA 5LB4A 1GYRA 4JAVC 5CEFA 3TOXA 4AS3A 5I8ZA 1PCXA 5DXFA 5FUVA 1G9SA 3BFVA 5COQA 1OQAA 4KEAA 1Q14A 4RVCA 1AKNA 4OM8A 2IXDA 2G0AA 2R8PA 4WLVA 1YBAA 3D4IA 1PDOA 4YJ3F 1YBHA 2XUKA 3BJEA 2A3RA 3I1IA 3MMSA 2C9MA 4P08A 3IEVA 3DEZA 1JQ3A 1T8YA 1JXAA 2WJVA 2BEVA 4NR0A 4QNNA 4Q3KA 5ENVA 4QT4A 2P30A 3KLBA 4FS3A 2OBLA 4BUJA 3KT8A 2EC5A 4ILEA 4LDRA 2ZSKA 2HO4A 2HRDA 1LQUA 3BH6A 3C3JA 2Q8PA 2QJOA 1OGIA 4O4JF 3SJBA 4EOGA 3PD7A 4IW3B 3IVXA 4Q4JA 4MUBA 4IDEA 1Y3FE 4HWSA 5HFAA 1KI6A 3KP1A 4FKMA 2I7TA 3N7TA 3W34A 4CT4B 3KDSE 4DA0A 4KXQA 1OLUA 1ESZA 3C5VA 5IMSA 4PHGA 1WQ4A 1SKQA 3EIHA 5A71A 1NW6A 2I54A 3CJQA 5TEWA 2Y1FA 1W30A 2G25A 3E18A 3GJ6A 3FROA 2WKWA 2D7DA 3AJAA 121PA 1J8FA 4I3GA 4QDJA 4WY2A 1F5SA 3TNJA 3V3KA 5TQ0A 5LD2B 4PHCA 4CQNA 4ARCA 3ZU3A 1JIXA 4M0UA 2EJBA 3DONA 2VBCA 1BCSA 1FYDA 2QNIA 2G4VA 2D2VA 3GDHA 3IAEA 4X3CA 3NTXA 3RGGA 5D5PA 4TWJA 1N9ZA 2X2PA 4H16A 5AKXA 5DHTA 5IVHA 3BQNB 3EF1A 4BVKA 1J9GA 1WUYA 2Y4OA 3JWEA 4EJFA 4XVUA 5AM4A 3QEMA 1G3UA 2A0FA 1CUFA 3H1GA 3ABIA 4DADA 5E7IA 3AWDA 3RUPA 3L8FA 3L05A 3QKWA 2J08A 4L3VA 3UK0A 2F1JA 2ONJA 3STWA 2C9BA 1WPQA 2WIGA 3IO3A 4F9EA 5IRCD 2HFJA 4H18A 4PZAA 4GD3Q 4DLRA 2CLOB 3QXHA 1U3VA 4BEWA 3LZ6A 3RU7A 3WS7A 3AW8A 1W5BA 1CR0A 3EXEB 5HE8A 4GQIA 2GBCA 2XUGA 5EN4A 2A1UB 1U11A 3TXAA 5I4KA 4OMDA 2F90A 3HKEA 4UM8B 3AG6A 3K72B 3TI9A 2X8AA 4KLAA 2ONCA 1AUXA 4PHTA 5A02A 3CR7A 2BI4A 5EZ5A 3M5DA 4OHFA 5FDFA 4M38A 1BZYA 2Q3MA 1DX6A 2Z4TA 4QUJA 3UUFA 5GZ3A 1HDXA 1BO6A 3EPRA 4EO7A 2P65A 3ORYA 5A4JA 2VHQA 1Q0SA 2RONA 4JC0A 4NE9A 4JA2A 4UAVA 1UDRA 2IX3A 4ZPJA 3SZOA 3EVFA 3WJ2A 5IFKA 1XTJA 2V7VA 1Z63A 1GGMA 3EQ7A 2DHDA 4RSGA 5EJEA 2IBSA 3MHTA 2HLDA 4AO8A 3ZIUA 2OBXA 3IS3A 3PNSA 3CEJA 3GX1A 2R6HA 4M9SA 1TM3E 3WYGA 2NTNA 1FDWA 5JNSA 4ZQCB 1T2AA 2B3DA 5AVRA 4CI0B 5F2NA 4KO4S 1U4SA 1UBNA 1PS8A 3GEMA 2W4MA 4FEGA 4ZOLB 2WZDA 1GU0A 3HJNA 4BV8A 1N92A 4UXJA 1XVIA 3GD5A 4MVXA 2UZ3A 2HRRA 1KXZA 4AX8A 4IMPA 2P7HA 2R87A 4G41A 5D8DA 3SE0A 3PQCA 2C7RA 1CJSA 4IH1A 3I6ZA 4PO3X 3EDCA 4NBKA 1V9CA 3V97A 1GPYA 2J67A 4HNHA 4BO8A 1PQUA 3ITEA 4DJ5X 4DG9A 4YY3B 3EIQA 5GVSA 5ALMA 5JCJA 3ANTA 5CD1A 1IE3A 1VL1A 3TQHA 3KPVA 4LSZA 1QIEA 5BWMA 1ZJ5A 2AB0A 3SCZA 4WESA 1T0BA 4YT8A 4Q5IA 3L4JA 2O8NA 5EIHA 2VHWA 5DMHA 5L4LA 4JR0A 3VJKA 5AW3A 1KDRA 1KBOA 4JJZA 1UOEA 3W4JA 1IEQA 1OBVA 3WMEA 4C07A 1C4OA 3ENZA 3GLRA 3JASB 1E7SA 1MIHA 1VSUA 4HTAA 3LY5A 3QTBA 4O4HA 5KS2A 4LXUA 5FQNA 3BKWA 4BLVA 5MGNA 3ROZA 4MLPA 4GM1A 4GXQA 5BNZA 3LUDA 2FHSA 5I4IA 1F4PA 1X42A 3K9CA 4NV0A 1I4WA 1XV5A 4B85A 1AF4A 1WUKS 2DY1A 2IITA 2SCUA 1DRJA 3KJFA 4MW4A 3QFRA 3USZA 4LRWA 1UJCA 4N7JA 3EXFA 5JZ9A 4YXWA 1BDMA 4Q3NA 4CGYA 1YONA 2BI8A 1RXIA 1UJ2A 2QLFA 1F8FA 2VNAA 3EZXA 3LC2O 1QGUA 4K7JA 3FHCB 3KK0A 3M1LA 2PNJA 1JHXA 4NP6A 1XJ5A 4EUEA 2AK3A 2C3YA 2PSFA 4YI5A 3IULA 4UAJA 2XJ9A 4GL2A 1NBHA 3IPAA 1MJGA 3M70A 4WZAE 2IF2A 4ZO9A 4DQ0A 3W05A 4WXRA 2WWFA 5DNAA 4B7ZA 3U44B 5K3FB 3IDOA 2ADFA 1AGYA 2H5IA 2AQHA 1K4MA 2JGKA 4CRWB 2HDNB 3FETA 3FVTA 4OM7A 3D3QA 3INYA 3EDYA 3T7AA 3HDHA 4EG5A 5B55A 4CEHB 4AFNA 5ADVA 2O6LA 1BD4A 4LTDA 1SHLA 4KN6A 5LWQA 3AUSA 3AV3A 4R1SA 1G6HA 3GEIA 5KPDA 1FYFA 1ULTA 4YGXB 1E2NA 2GFIA 2QM7A 2QT0A 4FFSA 4XZ3A 5JAUA 1WTCA 1RLUA 1P9NA 3P94A 1FFXA 3ZNPA 3ZVKA 5SYAA 2CC2A 2VQEB 2GNAA 2WF7A 4Z0HO 1ZNWA 1IB6A 3CCFA 4JYCA 2RAUA 2W70A 1QRSA 3CWZA 4OQDA 3U4QB 5K3DA 5KTPA 1E2LA 4ZEVA 4BNTA 4YPVA 3SSOA 3NDRA 2AFIE 1T8SA 4L1KA 4B3SB 1POWA 5ER9A 2X1MA 2GAJA 3UAVA 3CPEA 4DRXA 1QHEA 2PPVA 4LJ7A 2PCJA 4QXAA 4YV0A 2I2CA 4E08A 2V7GA 1E3EA 3DH0A 1YMQA 1AMOA 5GJVC 1VBFA 1SXJD 1H2FA 2WTAA 5F5XA 4J43A 3WMWA 2RFLA 1TK3A 3T9EA 2O7NA 2YV3A 3SQLA 3ESBA 2HFKA 3QI2A 1U81A 1YIDA 2QSJA 1E69A 4TTJA 1E98A 4DN6A 1O96A 1P29A 3B53X 1QFJA 4KX5A 3V1LA 3IPRA 1ICIA 4KBGA 3W6ZA 4IVPA 2VP9A 2D0PB 2BBOA 2XNKA 2ANBA 5TVGA 1C9KA 5LP6F 3TPCA 2FWIA 2WE7A 3LX5A 3KQHA 2FZCA 3E53A 1XEWY 4TL6A 1GPKA 1D6MA 3D3WB 2OUIA 3NR2A 1EPUA 1TK9A 3DBVO 4Q9KA 4C76A 1A76A 1HDZA 4ND8B 4I50B 2QTLA 5A5GA 5K6AA 3F49S 3ZBQA 2JHAA 3DQPA 3OT1A 2D7CA 5D3QA 5KSWB 1XZGA 1R5OA 3DAHA 1MABB 3CFYA 5CB6A 4YUAA 1T29A 2ZB7A 1V9LA 2CHGA 1E5QA 3NVDA 5E0OA 3NBMA 1XTZA 5A3JA 5EVJA 2F9LA 4JGBA 5CHEA 1L4GA 1N6RA 1CQXA 2D1RA 4LWZA 3LP8A 3D31A 3UJPA 2JARA 1GVHA 4LXGA 2A35A 4P5PA 5LD2C 4WLFA 5I8PA 3NT4A 1HE8B 2ZETA 4NENA 4KQIA 4ZU3A 3IAS6 3BXGA 3QMPA 3CF4G 3FJOA 5DCUA 1OU0A 2H1IA 4ND7A 3IVRA 4O59O 2OP1A 4ZWNA 1X9IA 5DX1A 4BBZA 5J4YA 3ZJTA 1DJPA 2IUEA 1UCFA 4MS1B 1A7AA 1I32A 1NV9A 2GAIA 3WA6A 1VBNA 1R0SA 5HGJA 2FN8A 3CIFA 3FCCA 3VSBA 2VT7A 3ORFA 4RTRA 1X0XA 1V39A 5D3MA 4AZSA 5JZBA 4ZYXA 4L95C 2RHLA 3G5AA 1U9ZA 3LWBA 4FKZA 4LYGA 4M1TA 1ZOOA 5LL6P 1Y8QA 3NIFB 1Y5MA 1Z6AA 2NN3C 2PWZA 1FTQA 4MKFA 3LFUA 5JMTA 1JHDA 2AMLA 5IKEA 1CRQA 1T34A 1BS2A 4NICA 2FSHA 1T15A 2NPOA 3EF3A 3GLIA 1C1XA 1XTUA 3DOJA 3OMWA 4MR8A 4OKSA 1BW9B 5JSQA 4X97A 2FPPA 5MFPA 1O94A 4J7CA 4WACA 4BN4A 4YJHA 2IDKA 2EBHX 2XKBA 3OJEA 1QIFA 2B92A 2CE7A 3PFFA 4KRXA 4PX2A 3TQQA 3W2IA 1HUQA 3G1WA 2O3RA 4KB5A 3ZHQA 1FYVA 4MKZA 3UXEA 5A4IS 1S3FA 4HUQA 1OREA 1EWRA 3BEOA 4FOOA 5FPKA 5BT8A 4YREA 3TQOA 1L6IA 4FDAA 1X9GA 3UPDA 4N41A 3V8VA 5EE9A 4LCJA 4IMRA 3RODA 4DLNA 4C21A 5BN5A 2JI7A 1PR2A 2XZTA 2W8BB 1XO1A 2VZLA 1GRVA 4J7AA 5B1DA 3FTDA 4CHGA 2RMKA 1YKSA 1TZMA 1BA2A 2P8SA 2C9CA 1V3VA 2VT2A 1YB1A 1PT8A 5EQJB 1EDDA 1XALA 3TLGB 4BB5A 2FEKA 4CF7A 1K6MA 2R97A 4JC8A 1E6KA 1RM3A 2Q7DA 2IYWA 4HQ0A 5CIQA 3W2EA 1LB1B 1DS6A 4JFRA 5FAXA 2FPXA 1E92A 1N2CB 2OV4A 3MA0A 4ZU6X 1GLGA 3UJBA 4DWVA 2R5FA 2P3QA 1YL7A 4IIBA 4QODA 5G0VA 3RVRA 5DN6D 7ADHA 2Q41A 5FAKA 1WMSA 3L7NA 3D4OA 2VDQB 4IUBS 1IJFA 3TZQA 2I4OA 4NL4H 2JBWA 3AF4A 3DKIA 1P45A 1W5EA 3THOA 1GPMA 1S7CA 2DFLA 2FLWA 1KA9H 2WSSD 2GUWA 2GPBA 2WF6A 5B2FA 3B5IA 4K0RA 4KQGA 2I29A 5FBHA 3TB4A 3T5DA 1IXKA 3L0DA 2XTMA 2NZJA 5KNBD 4PY2A 2Q2NA 4HT3B 3PDJA 1Y3IA 4R81A 5BSGA 2R48A 1Z7EA 1E5LA 1GL6A 3E81A 5EY5B 1P1BA 4QD3A 2EDCA 4Z3OA 2QMYA 2Q07A 1JTEA 3HBFA 1Z18A 2GLTA 5JMWA 1ZK4A 3LFTA 3HL4A 3PXXA 3ZWYA 4N49A 2BZGA 2X0KA 3EODA 3OJOA 4HS9A 1PZMA 2XMPA 2Y66A 3FZEA 4U5XA 1CQPA 1QIJA 3JQ9C 3LGXA 1XEAA 3P0HA 4R01A 4IV0A 4Q1VA 3Q2KA 1YZYA 2FEWB 4MW6A 5BOVA 3ZYCA 5C46F 2FR8A 2F1KA 1RLIA 4QPCA 3CO0S 3L4BC 5T4EA 1KR5A 4CG2A 3MJFA 2IBTA 1A4IA 2R1TB 1Y1LA 1J7KA 1JBEA 2AOTA 3FSRA 1ODJA 2QU8A 3FPFA 3FTNA 1E8NA 4HLCA 3IILA 4DQUA 1SQ5A 3WMXA 2R8YA 2WW8A 1XA0A 2A9OA 1UAYA 3U9SA 4GP9A 5BW6B 4C7OB 1QV7A 3Q7TA 4TWZA 4KMOA 2O2HA 4OLFA 1CS0A 1RJEA 4QASA 4RIHA 3SM9A 3TQCA 4W8OA 3BFXA 4QYMA 4DBLE 4ZI7F 5A62A 3RAEC 3T3EA 1MX3A 1P7WA 4UFPA 4AJHA 1YGPA 2WWHA 4P58A 4U6SA 2FW7A 4XDGA 2C77A 2QE6A 4Y7CA 5A4AA 4L27A 2FWNA 1KQNA 5IANA 3O94A 3R3UA 1XZEA 4PO8A 5JC1A 5AHXA 1R0KA 3ABRB 3ELWA 5ITZB 1P4AA 2EXXA 4BP1A 4BNDB 1DAEA 4RBNA 4EENA 1B14A 2RGBA 1W96A 2YHSA 1GSHA 3IQXA 4K1XA 2QYHA 4OKNA 4XQCA 5GONF 4CUJA 1ECCA 1UWLA 2YJ5A 2NXNA 4JVLA 3E4CA 4L4YA 5K4GA 4KLCA 2F8LA 2BTQA 2ZDHA 4KPGA 2PLNA 4FYHA 1VI5A 2YW2A 4Z7JA 1PJCA 4R3UC 1LSUA 3EIFA 2OFPA 3IALA 3TNDA 3PDWA 3C6XA 1ZM2A 3F46A 4L02A 4D4IA 1WD5A 1Y4DE 3P5BA 1P9RA 3DVQX 3RPEA 4O4IA 1PI3A 1DRVA 3HYSA 3NPAA 4GZ3A 3D5EA 4NPAA 2R2GA 4G0YA 5C1DA 1Y3DE 1YOVA 3RC1A 5BUZA 1PR9A 3LKVA 5HMMA 4EZIA 6YASA 1DUVG 3PF8A 2J3LA 2F3RA 3TPFA 3EZLA 4YQYA 4DR7B 1QGED 1Y82A 2QLTA 5DNVA 1J2JA 1NURA 4BKRA 4DKXA 4UTNA 4GDFA 5C8XA 2X58A 1XVTA 3D5QA 5KKCA 3WGUA 3QYFA 1GPNA 3I01M 4R68A 3PQFA 1WCYA 3HDGA 3WL4A 4NYIR 4KQ2A 3AKYA 2JBAB 4MUNA 3W78A 5CK4A 4ZA2A 3RH0A 1V95A 2CNLA 1QQ7A 3NHBA 3MUFA 2HIGA 1GGEA 2EU8A 2PD4A 3LDUA 4MMXB 2ZLBA 1SU6A 3BK1A 1ZCZA 2HBYA 2IIVA 1HEYA 2QX9A 5E95A 4GE0A 3IMGA 5FNVF 5C5IA 3TL3A 5H8WA 4YACA 2AJTA 1DNPA 2R6AA 4IZHA 3ZHOA 4YLGA 3B51X 1BSVA 2D59A 2N9UA 3DF9A 5KJ6A 2R7LA 4RIEA 2IYTA 3LO5A 3A28A 3H16A 1I3NA 1UBRS 2O05A 5DISB 1IL0A 4Y2QA 3E22B 4D43A 1B73A 1MGOA 2QJWA 3U19A 3WA7A 2ZI6A 1U2TA 1VE5A 1HDRA 4J0FA 5EERA 3KAQA 1E2EA 4C3VA 4O33A 3A6ZA 4Y2HA 2FR1A 4NMXB 4LV5B 1BHJA 3MJTA 5DN6A 4ZVRA 4EGCB 1MH1A 4K0KB 1X6VA 1SO8A 1XI2A 2OZVA 1X38A 2A0WA 3ES9A 1UQTA 1UDBA 3KC2A 3RF6A 2FR0A 1QSGA 1N78A 4DMGA 4YBRA 5JYCA 4J1JA 5EFZA 4EKYA 1MOQA 3E61A 1Z6TA 4LEIA 4D3ZA 4HDRA 1KTVA 4LJAA 3GRPA 2GN8A 1NFFA 2A8YA 1BC5A 3QV2A 4R1UA 1YA8A 4UW9A 2R68A 2I6QA 4EF4A 4XVRA 1ZK1A 4Z9BA 3FYDA 1WDTA 3EJWA 3WKCA 4DSAA 6LDHA 2Q5EA 3FTQA 3DE6X 1SXHA 1GRQA 1U3DA 5A6SB 2CEAA 1YTUA 2ID9A 3N2KA 3O4HA 4TV8B 4BO9A 4FWTA 4AKHA 1II9A 3E5HA 5A03A 2V3CC 1Z29A 3KQNA 3FF4A 3G2MA 1FYXA 4NEQA 3L0YA 5GM2A 5C8YB 2UXCB 1X70A 3WL5A 2EKLA 2CXRA 3NCHA 1NQUA 4Q0MA 1Z7GA 1KAQA 2YUTA 3DE5X 3R0VA 3O95A 3GT4A 4G07A 4HD8A 4MKIA 4AUNA 4W5JA 1Z08A 2E48A 4H35A 2Z5VA 3GNQA 3OX4A 4R1PA 1BE6A 4M1YA 4ZYUA 3T38A 3OX1A 2EKBA 5CVVA 1C3OB 2FZWA 2IU0A 5KQPA 3O93A 5K0NA 1LSSA 5L9AA 3HCOA 2AEMA 3COZA 3FWKA 5FWXA 3H2ZA 2I2XB 2ZIVB 2Y1LA 1RLMA 2Q27A 1RQXA 1MLDA 1M0WA 1VHTA 3CMMA 3K9HA 4HDMA 5DYNA 5TPZA 4G01B 2PGXA 4O4JB 3SN6A 2DQKA 4GM4A 2EJWA 1F38A 4XLTA 3JYHA 1E9FA 4OHYA 3V2HA 3F47A 1CFZA 2RCNA 3DKPA 3DOFA 5KHAA 3VNAA 2G1UA 3BF7A 4IXNA 2AOVA 1H6AA 4R8SA 5FIUA 4DQDA 4F97A 1B93A 1XZDA 3CY6A 4MO9A 2AF3C 3SXPA 3ID6C 3AR4A 1W19A 1ZN9A 4I4TF 1NXSA 4FUTA 1SHZA 3MS2A 2F62A 1YACA 1Z39A 2VT3A 3EYAA 1IN5A 4ZCTA 5D01A 1MPTA 4KL8S 1ZNQO 4DEYA 1RYNA 5AVJA 3WNCA 1WW2A 2I1QA 5LP6A 5KOIA 4D4LA 2V8OA 2RH5A 3TSYA 1BIFA 2XUHA 5DM1A 5F64A 5A7GA 2ARKA 3L6RA 2MHCA 1JDBC 3OI7A 1IHYA 3RIEA 5A2GA 3RTCA 2OCLA 1DL5A 5GONB 1SXJE 1ZD4A 3Q41A 2XTNA 5BY2A 2RGEA 4XCXA 5LZ7A 2PAFA 4TT8A 4X3PA 3CO5A 3OLVA 4DM4A 1BN6A 2AOXA 1NVXQ 1D5WA 5IN4A 3VZRA 4NZ9A 2M6RA 2X4IA 3IHWA 2GD0A 3KYDA 3THXA 3AVVA 1FJXA 1FUUA 4I4TA 4LCBA 1EFCA 3TTWA 5LYJA 2JGJA 1U0FA 3ILSA 3N2IA 4R7TA 4G25A 4R1TA 2NM0A 4NMLA 1BMDA 2DJ5A 4OKIA 1I0ZA 2ORVA 4RHUA 4A6PA 5J2TB 3UEOA 3NHWA 4AJ4A 1KK3A 3FH0A 1P2VA 1I2AA 2YR0A 2VHEA 2JCXA 2BFEA 2BEUA 3D81A 3PYLA 1D2CA 4HTFA 3SNHA 2H2HA 1AUPA 1SHJA 3QVOA 1GRNA 3EHDA 3NFYA 4OQFA 2AXNA 3MCVA 3ADCA 3T15A 3QOWA 4Q4LA 1HSZA 2XKJE 3IB3A 1RHUA 4X61A 4M49A 2OHOA 4TZ6A 1NG9A 5E4FA 3ZY4A 5CVDA 1B1AA 4EW1A 5K0EA 3L4SO 1RYBA 2GRAA 2VPQA 3P2KA 3ZKWA 3L6EA 4BPRA 1JI3A 1QWOA 3GCDA 3Q0EA 1VHDA 3DOCA 4F46A 2W93A 2CXSA 2BM8A 3LZDA 2YVQA 3H9BA 4MARA 5C8VA 3T3PB 4L6IA 2ZYAA 5KNCD 4Z3KA 3UB3A 4HXYA 2R6CA 4OXQA 5EZYB 2UUCB 4AVYA 3ROGA 3IEMA 4D9IA 1SWWA 4DYVA 2G77B 4RD1A 3T9CA 3RUFA 4E21A 3NC1C 1FXSA 3OIWA 4UM5A 1AUQA 4ZQIA 3GDGA 3VO9A 3P26A 3DDWA 3JQFC 1IHDA 1ZITA 4UTXA 1GZ5A 4X1YB 4Y9SA 4B6OA 5KYNA 3AYZB 4EGQA 1KFEB 4BEVA 1XKQA 1E0KA 3O2NA 4NS1A 3U3OA 5J4VA 3NHZA 2XT0A 4H6VA 4D9GA 3FX2A 2CJFA 5D86A 2JAPA 3SSMA 3L79A 3FZGA 1T5TA 4NX2A 4ECAA 1WV0A 2IXEA 3KXLA 5JU6A 3MRVA 1CRLA 2O3SA 5HZGA 3DE3X 5ESWA 2OMEA 3EUEA 6Q21A 1UKVY 3HWX1 1MA0A 4MYSA 3V42A 3ZI0A 3N70A 2FW1A 2QIPA 1ZL0A 5FTMA 4MPDA 3CRVA 3VR6A 1JDZA 5FUMA 1XEXA 5DKFA 4EYOA 4RF5A 2H00A 4U6QA 3CF2A 5JXJA 3DFZA 1DXHA 3I1YA 4B73A 2WYWA 4R3NA 3CUSA 3IEKA 4ZV4A 3PQ6A 3AEZA 3EGCA 1C1YA 3GNTA 1D8TA 1SIBE 3DJYA 1IAVA 3EUAA 2QAGB 1NXWA 2OR3A 2I6UA 4I9FA 1MAWA 4H1UA 3REQA 4OU5A 2R84A 2YWJA 1D9XA 2I22A 3M1AA 4C14A 4CDNA 4KXWA 4V3CA 3TQSA 2JGMA 2ZRLA 2REOA 4EW3A 1NW8A 4KN5A 5E8RA 4F3KA 2ZRPA 1FX1A 3V1MA 4CR6A 4GU5A 4S1TA 1M8PA 3LPLA 2IEBA 4JLUA 4PLTA 5LOVF 5CDFA 3QKSA 4RZ2A 4S3MA 3INRA 4XPZA 2GCPA 4OYYA 5M7EA 2JFVA 3ZTYA 1Y1QA 4IF4A 2ZRNA 2AWOA 3GJ0A 5JS8A 3UJCA 5ECDA 3TL2A 4ARIA 2DGDA 1GCAA 4M1MA 5HRAA 4XOIA 4WVLA 4BQPA 2HPZA 1Z0FA 2JG3A 4BO2A 1ST2A 2W98A 2Y3IA 3JAWA 3C5HA 1JG7A 2WZBA 2PMWB 4ZP1A 1Q0TA 1MO3A 1ZVMA 3B1WA 3F97A 3NBFA 4MOWA 1DBSA 4UHCA 4XUDA 3X2SA 4EX6A 4L5IA 1L6RA 1K3TA 2HF8A 5EE3A 1HV8A 3EGXA 1RC1A 4WNAA 5EZSA 5H1YA 4X1KA 3S5JA 2M6SA 3SEZA 1GXSB 2FK8A 4P0TA 3LL4A 4B5KA 5ALRA 4I8XA 4BQEA 1MB3A 4IMIB 4ZHQF 3BIFA 1W1WA 2Q3DA 1L7EA 2HT6A 4Q3DA 3B78A 3SZMA 3AI3A 4ZOBA 3KTFA 3O91A 3DM9B 5E2BA 3U1TA 2FETA 1ZGCA 5DCWA 5K8UA 2CZQA 4UDXX 1I2ZA 1AF7A 1RYEA 2V7PA 3Q1LA 4V02A 1UDXA 1O58A 4Y9TA 1YFZA 2LBPA 1CDDA 4RC9A 3TEJA 3PQ3A 4WQMA 4B2IA 3S0JA 2D5LA 3U3ZA 2I7CA 4H2DA 1STOA 2PJDA 4S1VA 2AFIA 2VXOA 4QU0A 5D87A 4RZQA 3DR3A 4DIFA 1BFDA 2X8JA 4RHTA 3GEBA 2FEAA 4US0R 3V4PB 4GDMA 2VDMB 1YRYE 5J63A 3GAFA 3LT2A 5CA0A 1W1UA 3W7VA 4G2TA 4PQYA 1L7RA 1J0EA 4D8UA 1GJRA 1L5MA 2X9LA 3MVEA 3RS8A 1YDWA 3F8WA 1S2DA 4G5OA 1NVTA 2O2YA 1DAPA 2ZULA 5HZKA 1FFBA 2XLBA 4R3WA 3PUVA 2PYDA 4EBBA 1F4LA 3FIUA 2ZCUA 4DIEA 3A1NA 1B6RA 1GKKA 1W59A 1X1BA 1XL1A 3Q7IA 1WP4A 5HIMA 3ICEA 4QPZA 2JAHA 3DEFA 5KTRA 3OU7A 4Y67A 3DBHA 3BMQA 5AVVA 3EMBA 3FRJA 4EX7A 3DPUA 3IOMA 3B38A 3O4RA 4G97A 3CRW1 2CHUA 5H81A 4QOSA 4G6ZA 1AUOA 1BG6A 1FTGA 1EGHA 1KOGA 4I55F 1E2IA 3R9WA 2Y1WA 3A6FA 5EZYF 3EUFA 3L0SA 5JSYA 4UUMA 3GGOA 4CR8A 1EZZA 3C97A 1N7IA 3IMEA 3PCRB 4HEA1 4DNFA 2PS0A 4LSMA 2BELA 1I1OA 3EPKA 3G5LA 3HFRA 4Q4JB 5J1TB 2D6FA 3V8PA 1A9YA 1E61A 2J5BA 4AT1A 2QM0A 3HUTA 3SSAA 1CQJA 3DNPA 3HXQA 1LZKA 4RH1A 3ZIDA 3AKDA 1DIOB 3HV2A 3RD5A 5KB3A 3AM1A 2ZI9A 3EY9A 5IS2A 4IHJA 2F59A 4NFLA 2Q4EA 5DM2A 3DL4A 5B3JC 2HPVA 2HY7A 2Z1NA 3R4VA 4M54A 3FXAA 1R5NA 4DMUB 1IJEA 1C7QA 4MVJF 4XIFA 4ZT3A 3QU5A 1SOAA 4KGXA 5LZ9A 5CFQA 3W04A 1CNEA 1ZIPA 2FUEA 4Q6WA 4BNVA 3KLMX 3KR0A 2PZAA 1VCIA 1SU4A 4B3MB 4O3MA 5AT1A 2EFEB 3KB8A 4JYBA 2I76A 2BH9A 4AIRA 3EQ8A 3WXMA 4ZZIA 2ZJ7A 1HC7A 1JWLA 1A7KA 4H1VA 2V6MA 3E0QA 3FSJX 4RLQA 4UNQA 1D2RA 3N8IA 4XQEA 5DF1A 4EUKA 1TF5A 2Q1XA 5EJ8A 2WD7A 2GN4A 3VISA 2FSGA 3NVMB 1P9OA 4LS3A 4OO3A 1J22A 3OIDA 3D1VA 1CHNA 2JIOA 5HRUA 1UBTS 4Y9DA 2CGEA 1U1EA 4JFAA 4N5NA 5KSOA 2XHEA 3TOCA 2UZ1B 2Y2VA 4RCZA 1U9IC 1Z0ZA 5JS7A 1EBFA 1XUOA 4PSUA 4QPPA 5MN6A 5IAAA 1U1IA 1Q1AA 3BAFA 3N0RA 5ENZA 3FOCA 1NKTA 1OYVA 2PEZA 5LZ8A 2UXBB 1YFKA 3ZQ6A 1N33B 4Z86A 1NWHA 2Q6LA 3OPMA 3OAAD 2YDXA 4R8MA 4BMDA 4ALMA 3B5EA 4DMLA 2XB6A 3CZ5A 4V3BA 3WMFA 5JY6A 1DKNA 3IA2A 3HUFA 3G7NA 1QG0A 2JLQA 1QPBA 4UM9B 2HR1A 3VGPA 1P6QA 4LHYA 3U7QA 4F5WA 4TRNA 2BLNA 4HVCA 2AG1A 1KI7A 3TZHA 2Z1MA 4GLLA 3WLHA 1P8AA 3O47A 3FPGA 4UD6A 2ADMA 4XR9A 3M3PA 5BSKA 1JHZA 2I2DA 3DO6A 3EDRA 3RSLA 3V1YA 5C1OA 4FFNA 1EP1B 3PX2A 4L8YA 3B20A 1G21A 1UP4A 4NBLA 1JU9A 2B5VA 4YAFA 3V2GA 1CP2A 3ULKA 4C78A 4CVNA 4N47A 3K1ZA 3ZD9A 3W2TA 1AIPA 2ZRKA 4C0SA 4XGNA 1YJQA 4MWDA 1O6GA 2E89A 3Q6NA 4R9RA 1N2HA 5B36A 2ZYDA 4AROA 5MN4A 1B16A 3TW4A 1C7RA 3ACCA 3WBJA 1KIAA 1XTTA 2Q2WA 2ECPA 1XXHB 4DCUA 1U8TA 4M0PA 5AM0A 3O8QB 2IV7A 4IQFA 2ZKIA 2VKQA 4ND5A 1XP8A 4HFNA 4URWR 2C7OA 4P93A 2ZAGA 3CLHA 1RAHA 3HUDA 4U7WA 3GQBA 1H2YA 2BFOA 3FSGD 4EFDA 1DXOA 4IHAA 4D92A 1K0UA 4ZEWA 3DBIA 4FLFA 1ISHA 1T1RA 2Y1KA 3D7LA 4RDHA 4RMGA 1JVBA 3IVGA 2ACVA 3ZOZA 4JI5B 3P4XA 3IVCA 1VIAA 1IIBA 1IONA 3DTVD 1I6KA 1KYWA 1UIRA 1TCVA 3FWHA 3G9ZA 3OOEA 4O2AA 4EB3A 2P9ZA 3VX4A 3ZHXA 3I8SA 4Y1GA 5H9VA 4QM6A 2YVAA 4H7JA 4L3WA 4S1NA 4AD8A 2K87A 4UPVA 2GTPA 3FPHA 1T3SA 4UFNA 2XBMA 1Q1EA 1FQJA 2JJ2A 3G7UA 3ZCUA 3I9FA 4P3OA 2MSWA 3HXMA 3HRKA 2SCUB 4YHHB 3IIKA 3PI7A 2Q1YA 2WM9B 4LQDA 1JALA 1YK1A 3A4MA 3EIEA 4JHLA 3EXFB 3V9AA 4DCCA 3K20A 1JSZA 2JGEA 4MRSA 3L82B 5DYGA 3P4UA 4DSTA 4DV2B 4N3NA 4E70A 4KTTE 2O0KA 3FGPA 4RO0A 2YKGA 4LJSA 3W5CA 4AKEA 3TWOA 5LVAA 4QDZA 1AG9A 4DV1B 4MTLA 1DEHA 2A1TS 1V5GA 1QO0D 3O21A 4IRXA 2BJWA 3WB1A 4O2AF 1GTSA 2RAFA 1JQAA 2PN1A 3W5AA 5G40A 3ZV5A 1JMYA 2YXPX 2V5AA 1SNYA 3SBDA 4A16A 1OWLA 3JPYA 3O9ZA 3SOZA 3IV7A 3SLRA 4R84A 4CLEA 1VIDA 2OC9A 3NW9A 3PZBA 2QJFA 3D0KA 3SI7A 3UJ8A 5FO0A 1AY0A 1Q3KA 4DPLA 1WZIA 1NN0A 2OCIA 3H87A 1M5TA 1ZOPA 3VVBA 3C3KA 2XADA 2ET6A 4LV6A 5TMEA 2HV9A 4K6KA 2W48A 4BP9A 2E4ZA 5AJTA 1KDPA 2JKVA 3ITNA 2ORYA 5ALGA 4KYTA 2YJNA 1AC5A 4U0JA 3S28A 3PNYA 4RENA 1LBHA 3DZBA 5PNTA 4FB4A 4MUJA 4B3FX 3K1JA 3RSHA 4F9FA 1JR6A 1HWYA 1UEXC 2C7PA 3F74A 3O8LA 3OCWA 1PKXA 1JVNA 3QLVA 3LTNC 2DFTA 3WO1A 1GGKA 2JAUA 2OG1A 3CLTC 2JLWA 2YJTD 1SOWA 2FQWA 1U8UA 1C8VB 1EFPA 2MWMA 3LIIA 4OOFA 3HVJA 2PZFA 3KEMA 4LRXA 2CF5A 2CEKA 2JGDA 1GTRA 3UHJA 1FVHA 1TM1E 1FRFS 3PFKA 4OJNA 5CX1A 5HS6A 1LS6A 4O4HF 1MHPA 5CLIA 5CFNA 2ZAOA 3PGMA 3VR5H 1ONNA 4WDQA 5LDHA 1DU4A 1IJBA 4CIWA 3COSA 4N76A 2QV7A 2KSQA 4D46A 3D6VA 1FW8A 3EFBA 5KYYB 4KU4A 4X0EA 1R7RA 3D6FA 4WBXC 1IN4A 5DGDA 1TA9A 1R0YA 2GAAA 3GUCA 4FFMA 4G4SO 1FFHA 3VZPA 1E2MA 5JAZA 1TUEA 1UINA 3KTOA 1NJ6A 3FTEA 1G21E 1V48A 4N8EA 1WF6A 4KYUA 2ID8A 3C3AA 4UEWA 1U2ZA 4BFVA 2I2BA 2H4YA 3B13B 3D3WA 1YSCA 4FOTA 4E94A 1YQ9A 3HSKA 2O23A 2EBUA 2DFDA 1DRKA 4HATA 4MPJA 4R0VA 1N7GA 3OT1B 2QU7A 2I7XA 1YD7A 2I0FA 3UJNA 3IE1A 1J5PA 5HBGA 3PCTA 3GBVA 1NXOA 3WJ7A 3BILA 4BNGA 1N36B 4LJ6A 4W1PA 1U0SY 1QYDA 2HPHA 2LIVA 3PNQA 3LIPA 3U7JA 4CODB 4GQBA 4UAUA 3EC7A 1SPXA 5FBKA 4OCZA 3TRDA 2BFDA 2JFYA 3IP1A 1J00A 2R8BA 1T0JB 1T8RA 4PC3A 4RCYA 3TTXA 4NBWA 2ADOA 3HBNA 3AKZA 1YRHA 3QITA 2G1PA 3R5FA 4PHHA 4C3OB 2AF4C 1P7CA 3RBXA 3RYIA 1IJKA 3DLBA 1YL6A 4HB0A 3ZW8A 3GZNA 4JLJA 3EWSA 3P9ZA 1YQXA 4RZXA 3C8DA 3SXJA 4DWOA 2DRIA 2XCUA 3W90A 4RWZA 5ELXA 2PZEA 1XRRA 3G2IA 1ZCJA 3K6JA 1A82A 2GWHA 3LVRE 3N05A 1F2UA 4RULA 4A8PA 4X1IB 3ZS9A 5A4KA 2ZSIA 4F6CA 2FPUA 4IEFB 1OMOA 2VNJA 3M4ZA 4GSLA 4QICA 4OHCA 1GQRA 1N2OA 2H1SA 4OGWA 1CTQA 1TZCA 3MOSA 2C9ZA 1R5BA 4ZJZA 4H15A 4A73A 4PTYA 5CNMA 3WVNA 4CF6A 2JFGA 4J0CA 1EESA 1YR1A 1BW9A 5TV2A 1QZ3A 1Z0AA 2FPPB 1T5LA 2C2OA 2QUAA 2WJIA 3T7JA 4Q1BA 3O2QB 4IOMA 4Y2SA 2FRDA 4OH7A 5KYXB 2VCYA 1EVLA 1YJCA 4G1CA 4NBSA 2I3ZA 3Q3VA 4N1AA 4WLOA 3T35A 3PR3A 2JHCA 2I8CA 3TD9A 1A71A 1K1EA 4L51A 3G17A 1ADGA 1Z4QA 2LZ0A 3E1GA 4EI8A 1NZDA 1PZNA 2HRQA 1R4NB 3U4HA 1B6SA 3LFHA 1ACJA 3JWPA 1CUAA 4L50A 3ZE8A 4G5GA 4GOLD 3HNRA 4BLOA 3DEYX 2XGMA 4HDSB 3HZHA 1I0LA 3NM6B 4NAUA 4O25A 3F7NA 1QH1B 3OT4A 5FULA 1UOOA 3R7DA 2QSYA 4OAOA 1J8DA 2EV9A 2PGJA 3ACDA 3GYBA 4A0FA 5JR3A 2BGGA 2PZKA 1H1DA 4JBIA 5KYUB 5LNK6 5T67A 4IJUA 5CDSA 1KU0A 3OEWA 4OHPA 4DLPA 5KUTA 2FUNB 2B4AA 3DVLA 1RXVA 2PKXA 1R0BA 2K5UA 4BNHA 1EXNA 4HPWA 2ETXA 1UXGA 1UWKA 3A2MA 3MWLA 1L7MA 2KPOA 3GA7A 3KOWA 1Z2PX 4UDOA 1O7JA 2ZT6A 2ZBFA 2K7ZA 2Q2VA 2IV3A 3S6JA 1SOUA 2AOWA 1SKAA 1P1KA 1SVUA 5GV7A 2CXNA 3UJDA 4GMGA 1XTQA 2PGOA 1R16A 1Y7IA 2QSZA 2OT3B 2QW8A 4GG1A 4BRSA 2ZITA 4GKJB 2PZJA 4FGZA 3N5CA 3V2IA 3V1KA 4BXOB 2YXEA 5LNK1 3UCEA 3OZIA 2V98A 3QBVA 3EVGA 1Y8RB 2GYWA 3HSYA 1W581 4M0FA 2DR2A 5J9FA 4EYEA 3UJ6A 1IC6A 3Q12A 3EXIB 3H8JA 4J2HA 1FSFA 1T4BA 4ASUA 3D8NA 5LOVB 4NCBA 3DMYA 1GPH1 4AG3A 4HQKA 2O59A 2OAEA 1AKMA 3AHCA 4M9UA 4LOAA 4P3XA 3CVWA 4JQCA 1F17A 4RW0A 5CA1B 1JN0A 1KFBB 1YS4A 2A84A 2VDPB 5TXGA 1YR3A 3SJ7A 1DEXA 1NQVA 2CZCA 4JL8A 3FVVA 1NVMB 1G41A 4MR7A 2WHPA 5F7OA 4MA0A 1G19A 4MV9A 2EHJA 4TLCA 1S8OA 4ALKA 1JXOA 2EW2A 3D6TB 4N8DA 4C03A 3LI2A 1MP0A 1YZUA 1FX0B 3PENA 2VJAA 3SGLA 3QBDA 1Z37A 4X41A 3IMCA 1I7DA 4ZOEA 2NVUB 3QPBA 5I9NA 4LE0A 3IQIX 1M1YE 2B0JA 2H4HA 3PXAA 4HYTA 4CMEC 5C52B 1S3GA 2Q0QA 3AETB 4C0BA 1U2GA 3TZKA 5B6IA 3OO0A 4HGYA 4D8TA 2LW7A 1PGNA 1L9XA 2XD9A 4OQNA 2QTAA 3G23A 1V41E 2RIRA 4P7GA 3O9VA 4MYTA 1PJSA 1AXGA 3D4LA 2Q1UA 3GCXA 1CULC 2WWXA 1V7PC 2AR0A 1K5HA 4DA4A 3PWZA 1ULBA 2GCIA 3SMQA 1WZNA 2WUFA 2FYTA 3HCBA 4FBGA 1XE3A 3GN2A 2A9KA