4WORA

Staphylococcal nuclease in complex with ca2+ and thymidine-3'-5'-diphosphate (pdtp) at room temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Three-dimensional diffuse x-ray scattering from crystals of Staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase/hydrolase inhibitor
total genus 35
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4worA00
3DMUA 3D8GA 2O4XA 2EYLA 2EY6A 1A3TA 3TP7A 4F8MA 1JORA 1ENCA 1KABA 3NP8A 4NMZA 1SYFA 1EY4A 2PYKA 4DU9A 2F0NA 3TMEA 4N9PA 1EYAA 1F2YA 5KGUA 3OSOA 3R3OA 2SOBA 1JOOA 3D4DA 4NP5A 4E6IA 3LX0A 1SNOA 2EY1A 2F0HA 3MVVA 3P1HA 3QOJA 2EXZA 4KTAA 2OF1A 5IIFA 2PZTA 4HTHA 3RUZA 5K5PA 5I6WA 1SNPA 1EY8A 3QOLA 2M00A 2PZWA 4EQOA 4PMCA 1SYBA 1SNMA 2PZUA 2SNMA 5IODA 2EYMA 2EYFA 4K5WA 4S3SA 1SNDA 5KRUA 1SYEA 1A2UA 1KDAA 3H6MA 1EY7A 2F0MA 2F3VA 4J6HA 4N9TA 3U9OA 4PMBA 5I9PA 3TP5A 4QMGA 4LAAA 5KYIA 3SK6A 1EY0A 3HEJA 4IZ8A 4G57A 5E1FA 5EKKA 3NHHA 1KDCA 3S9WA 4QF4A 1STGA 2PW7A 4K6DA 2F0WA 5DEHA 2HQEA 3QB3A 5F2DA 4ZUIA 5JOBA 2F0GA 5CR3A 4DFAA 1STHA 3OWFA 1SYCA 5EGTA 4ZUJA 5IGBA 3T16A 5I6YA 1F2ZA 5C5MA 4EVOA 3OMCA 1SYGA 5CV5A 3NUCA 1F2MA 3TP6A 5IGEA 3NXWA 5CV8A 5HGTA 1ENAA 4HMIA 5IOCA 4K8JA 2KQ3A 4K14A 5E3FA 5KYLA 1A2TA 4ZQ3A 2KHSA 2F0FA 3ITPA 2RDFA 5ISRA 3C1FA 2F3WA 4KY5A 1EY6A 2RKSA 5CGKA 2F0IA 1TQOA 3EVQA 4KY7A 1STNA 4KY6A 2WACA 5C4HA 3BDCA 1A3VA 1STAA 2OEOA 3DHQA 1IHZA 1U9RA 3E5SA 4K5VA 5HURA 5IGFA 4KD3A 5J39A 4IUNA 3BDLA 4WORA 2F0EA 3SXHA 5CV4A 2QDBA 3ERQA 2F0TA 4HMJA 2F0VA 2F0OA 1NSNS 1SNCA 4KD4A 2EYOA 3HZXA 2LKVA 4ODGA 5CV7A 4IALA 1EY9A 1EYCA 5C3XA 3D4WA 3NK9A 4KJOA 4PNYA 2ENBA 3V2TA 1EQVA 5CC4A 4K8IA 4K2KA 4DF7A 3MZ5A 1EYDA 3TP8A 1TT2A 5M9OA 1JOKA 5C4ZA 4B9WA 4QB4A 3EJIA 4I65A 3SK4A 2F0SA 5NUCA 2F0LA 2EYPA 2F0KA 3SK8A 5I9OA 4YIJA 4ID6A 3VA5A 4R8NA 4J1MA 1EZ6A 4KJNA 2F0DA 4KV6A 1EZ8A 2EY2A 4NKLA 4RKBA 1RKNA 4WRDA 5IGDA 4KHVA 5IGCA 5JAVA 2F0QA 1SYDA 1A3UA 1II3A 3P75A 4ME5A 1STBA 1JOQA 3SHLA 5KEEA 4OL7A 4EQPA 4NDXA 2F0JA 1TR5A 2NUCA 2SNSA 5C6AA 2PQEA 4K5XA 5EKLA 5C5LA 4DGZA 2RBMA 5KIXA 1SNQA 3PMFA 4MIUA 1AEXA 5CV9A 3OMGA 2EYHA 5DAUA 3EROA 2EY5A 1NUCA 5J22A 4TRDA 1STYA 1EY5A 3NQTA 4H7BA 3MHBA 3SR1A 3T13A 4RKLA 4B9XA 5IGGA 2F0UA 3SK5A 2EYJA 5C3WA 3D6CA 3MEHA 1KDBA 4EQNA 5CV6A 5J1ZA 3C1EA 4K2LA 2OXPA 2PW5A 4F7XA 1KAAA 2F0PA 3MXPA
chains in the Genus database with same CATH superfamily
1QB5D 4A93H 1YNJC 3BVMA 1Y1VH 3WDNA 1Y8OB 4IFDI 3U4ZA 1F2YA 1S3OA 3A7LA 3HKZG 5KGUA 3WOEA 3MVVA 1NY4A 4KTAA 1XNRQ 4IUTA 1B1ZA 1KXLA 2VUMH 2HIXA 2YTXA 1IYJB 2ZTCA 3VYTA 4GKKL 1T5EA 1HQMC 1PYSB 1BBUA 3NEMA 2IPKD 1SBBB 3I70A 1RJTA 5IYCH 4LUVA 4IURA 4LAAA 2JA5H 1CSPA 1A0IA 1CZGA 3NHHA 4DUZQ 3M9BA 1HNWQ 1BXTA 3T4AC 1VQOA 3OIPA 3MEFA 4O1NA 2A74C 4A3CG 3I4MG 4HCEA 1XMOL 1AZPA 2KEDA 5G3LF 3JAMc 3H0GG 4HCSA 2QGQA 2HDLA 2WINB 4XTCS 5C4XB 2Q8TA 1P16A 4JG2A 2UU9L 3EVQA 3AFQA 2KBNA 3BZKA 1W6JA 4APVA 1EIGA 1TS3A 2L4NA 2N55A 3L3OC 4RCNA 2B2UA 5J39A 3CPFA 3VR2A 2IWHA 1G6PA 2F0OA 2N3SA 1Y8NB 4JOIC 1FNUA 4O0AA 3PUWA 4K8IA 4IFDG 1TY2A 1KD1C 1FJGQ 2Q2HA 1IXRA 3PO2G 1QILA 4DV0Q 3TN2A 2OT2A 1HR0W 4NKLA 1C7YA 5C4XH 5CORA 3FVQA 1RTNA 4LF9L 1XMQL 4KN7C 2HIVA 1VMCA 4FF4A 1SEBD 5JJKA 1MGSA 1AEXA 3OMGA 1X56A 2RQXA 3OTOQ 3A56A 1HXYD 3NWSA 2XRQD 2WB1B 1VCIA 2R7DA 4EQNA 1WD0A 5T1GA 4YWLA 2F0PA 4KHZA 4IOAA 3GQBA 4AQYL 1KAWA 1EY4A 4A3FB 1L1OB 4A3LH 3C3LA 1YNNC 2MQHA 4DR5L 4OWXB 3BYYB 3KBGA 2F0HA 4C3IG 5EPKA 1S4ZA 3HKSA 4IN3A 4R4CA 2B2WA 3KF6A 3RUZA 2B8GA 4HIDA 1BQQT 1YBYA 1JJ2A 1JQYD 3FHWA 4R4TA 1HNZL 3KYHC 2Z8LA 1I4QA 1BCPC 3J81i 3GD7A 1PH3A 1I5FA 5L37A 3FKIB 3S9WA 3S17B 4OEMB 4QIWB 5EJWA 3V96A 3MC0B 3QB3A 2A6HC 4V190 3MXNA 1RD9D 2JA7B 5FJ8G 4A3FH 3JAME 3TP6A 1PH1A 1FYCA 1UAPA 3KLRA 3ZYYX 3RLNA 3LGJA 2UXCL 1EEID 2NVYB 1TKWB 1LTID 2RKSA 2E2HB 5C0XH 2HT1A 1A3VA 1D6EC 2ZXOA 1WTWA 3SE0A 1CKMA 3E5SA 5JEAH 1SMYC 4JI7Q 2F0EA 4NPSA 2NZ1D 2QDBA 1EIYB 3FKIH 5GADC 3S17H 2EYOA 2IHEA 2NZHA 1IBLQ 1IZ6A 2I5HA 1H9SA 5M9OA 2JA7H 2F1MA 4B9WA 4DPGA 4IPDA 3EJIA 1DCZA 3I3CA 5ELEA 4DV3Q 2JE6I 4R8NA 4B3MQ 2NVYH 2A6EC 5IYDG 2OTLA 1V1PA 4LWCA 1II3A 2MO0A 4DR7L 3J81j 4IPHA 2E2HH 1J6QA 2PQEA 1CI3M 4XIGS 2VQEQ 1Z7TA 3KF8B 5CV9A 2EYHA 5JEAJ 3PUYA 1EOTA 3CXCA 1B3QA 4EGVA 3I4NG 1QCBD 3AYHB 2EYJA 4R4OA 1VQKA 1EQTA 3MEHA 4A76A 1N34Q 4A3GB 1ZKOA 3ERSX 3TSSA 3MXPA 1RCVD 3TP7A 4OX9Q 3NP8A 2L12A 4DV4L 1S5FD 3UE0A 1W6KA 1SRUA 2XWJB 5ELCA 4DK1A 5EPJA 1YHAA 3Q0AA 3CC7A 2HUGA 1XNQQ 2VS1A 3A54A 3L0OA 1XNRL 5FLXL 1SSOA 3GTGB 4Y52H 4FF2A 2M00A 3CRKC 1SNMA 2IJ0A 2PCFB 4GLVB 4DXFA 1VQBA 3RLFA 3K81C 1PRTB 4DUZL 5DM73 4Y7NB 4A3GH 1FNWA 4RFBA 1M90C 4A3DB 5C44B 2B63G 4WJ3M 5C5MA 1CQFA 1SAPA 1N33L 3QG1A 3A8JE 5E3FA 3J7AV 2KHSA 3ITPA 5IP7G 4IQZA 3GTGH 1LTAD 4P75A 3FDTA 5KNCA 2CHBD 3W2DA 1JE4A 5EAYA 3KK7A 3DLLA 3HKZB 3SGIA 1O78A 3CMAA 1FGBD 4KD4A 1PZKD 2NVTB 4Y7NH 1EY9A 1IBKQ 1G91A 4HAEA 4A3DH 5C44H 1NE3A 1FJGL 4KKUA 3HOVG 1QNKA 1EWIA 1AW7A 2L11A 5COYA 1LABA 2UXBQ 2WIIB 1L1OC 2FFKB 4DV0L 2WV6D 2ZXPA 1RIPA 4KV6A 1D1IA 2CWPA 1V9PA 3NE5B 1BOSA 1TWGB 4EQPA 3M7NA 2SNSA 4CJ2C 4DV1Q 1KLUD 3I4MB 2Y0SE 1STYA 3H0GB 1CHPD 2K50A 3K7AB 1PHJA 1WJJA 2O2LD 2NVTH 2EOTA 4DUYQ 3NBHB 1CKNA 4O2DA 1O7YA 3CCSA 5LMNL 4HJ7A 3D8GA 3G48A 3H91A 4DU9A 1QVFA 1Q46A 1VF7A 1GUSA 3UI2A 4I7AA 1SNOA 4P74A 5IIFA 2AUKA 1HA6A 1EY8A 4A3CH 2EDGA 3I4MH 2PNRC 1C4QA 4DAPA 4JW0A 3PO2B 1SYEA 1A2UA 3H0GH 4J6HA 1UUPA 1TS2A 3K7AH 1UE6A 4XYOA 1EY0A 3NELA 4ALPA 1IBMQ 2AQ2B 3R2IA 3Q8DA 2YTYA 2WAQE 2HQEA 5IGBA 1XTDA 2BA0A 4HR7B 3T16A 1J5EQ 1VQAA 4KHPQ 4Q5VA 4EVOA 3OMCA 2PQAA 4DR1L 4X3KA 3KF6B 4IPGA 4N8FA 4DAMA 3F2CA 3KUPA 1K8OA 2CQOA 3HOWG 1JB3A 4K14A 1I6VC 3PIO3 1SE8A 2DUDA 4C3HG 4IFDH 2XN9C 1G6ZA 4K0KQ 5I2YA 2OTJA 2E75C 3PO2H 4UP9A 4JI7L 2P5ZX 1E7ZA 4AYBE 4P71A 3BDLA 3MXNB 1PH6A 4X66Q 3ERQA 1LT4D 2B3GA 4C3IB 1ILQA 1NSNS 1TWHB 2HD3A 1EYCA 4HJ8A 4KJOA 1EQVA 3PF4A 4XT1B 2EPBA 2A69D 2CQAA 3SK4A 4DV3L 4LF8Q 1PH2A 2CW0D 4B3ML 4G4KA 1FNVA 1SROA 3VA5A 4RKBA 2A68C 4KI0A 1UE5A 3H3VC 4BA2I 4GS3A 2JJQA 4IFDJ 1STBA 5IYBG 1WTOA 4OL7A 3H09A 2QEJC 4G7HC 2VQEL 1BO0A 2E8GA 4XQQA 3PMFA 1SR3A 5J22A 3BZCA 1MD2D 4TRDA 1H9SB 1FL0A 3NQTA 3I72A 1LTSD 4C3IH 3F2BA 2C5CA 2FXQA 1QG7A 1LTGD 1STEA 2JEBI 1UE1A 1P8LA 1V1PB 2KCTA 3HOUG 4C1NK 5GAEC 2G5DA 2K5HA 4ZKBB 2PYKA 1HPCA 4LF7Q 1EYAA 1A62A 4LF9Q 3A5ZB 1B4OA 4CDEC 1XNQL 2NVXB 3P20A 2SOBA 4DN4M 1PYWD 4E6IA 3PIOA 2EY1A 4DV5Q 1GUWA 2PNHA 4A4IA 3CAMA 1IYVA 1X9NA 5FJ8H 2AUJD 1X32A 4BXXG 1PYBA 4CKBA 3CKIB 2QDLA 2NBFA 2D5DA 1HNXL 4MTKA 1GM5A 1FD7D 3S16B 1KDCA 1PMRA 3GTPB 4ZRZA 4ZUIA 2HHHL 1Q81C 1K8MA 4GKJQ 2B29A 2VL6A 3GTMB 4WFN3 1W3SA 5EPLA 4DR5Q 5FOBB 4QJFA 4HMIA 1IW7C 4RG1A 3I4NB 2NVXH 4B08A 2B2UC 3PIP3 1QOHA 5BN3A 3L2PA 2F0FA 3AB9A 2OWOA 3C1FA 1DOLA 3ER0A 3SVMA 4KY7A 2ASBA 4KY6A 5C4HA 1K0RA 5A2QE 1MHWC 3HG9A 4OGQC 1PLFA 3CW2C 1Y14B 4A3EG 3ULPA 1ESRA 4KD3A 4RGMA 4A75A 4DR2Q 5DM63 1RF2D 4JK1C 1IBKL 3S16H 2F4IA 2XNAC 1VMPA 1TY0A 4FDBA 4A3IG 4UP7A 4JCVE 2UXBL 4DF7A 1DOMA 3GTMH 2RHQB 3Q24A 4M1UB 4C3JG 1N32Q 1M1KC 2B39A 3JC66 2L55A 4OO1I 3CC4A 2RSOA 2D62A 5FO9B 2NTTA 1TWFB 2K28A 2SEBD 1EZ8A 5IGDA 2BH8A 5LMNW 3M4OB 4JI2Q 1JOQA 2BE5C 3A74A 3AQQA 1XWEA 2B63B 1HZ9A 3FMCA 2L1BA 4A3JG 5KIXA 5IE8A 1C48A 1ZXTA 2NZOA 1Y69U 1BBXC 1PTOC 4ZKCB 4DUYL 1KL9A 3D6CA 5AJ3L 1JWMD 4R9WA 1ESFA 2VNUD 4BS9A 3SXHA 1MJCA 3S14B 4F8MA 3S15B 4LK1C 1TWFH 1KQSA 3M4PA 2HCCA 1VQJA 2MFIA 3TZDA 3M4OH 4RWSC 3PIPA 1EU3A 3QR8A 4DNRB 4WJWA 2B63H 4KLKA 3KBXA 5I6WA 3HOVB 5E4WC 2SNMA 2QCPX 3KLSX 3BYTB 4LF4Q 1SNDA 1CKNB 4N9TA 1X3QA 1SXTA 1IBML 3D4RA 3J80c 1WYDA 5IP7H 1GOZA 1I4GA 3K0XA 4K6DA 1I3QB 4GLXA 2BCOA 3BJUA 4FO2A 3SEBA 1I4PA 5M5XB 1J5EL 4H13C 2R92G 4KHPL 2K5DA 4ZUJA 1XJVA 4DV4Q 1HFGA 1S40A 3S14H 3S15H 1ILPA 2F03A 1ICWA 2E2DC 3S1QH 1VDZA 1SYGA 2PMZE 2E74C 4GOPC 5GQOA 2D2CC 1JR0D 1GUNA 1Z9FA 2XIWA 2RHSB 4MHEA 1O7LA 1PH4A 1PVOA 3UDIA 4K0KL 3HOVH 2IY5B 1WTRA 4JC0A 2DNCA 2VB2X 3RN2A 1K83B 3J80L 4X66L 3DEPA 3QWNA 4FXKC 5JJLA 1D1KA 1TVXA 5CV4A 1NJIC 2FMCA 1PZID 2K14A 2PQAB 1I4XA 1I3QH 1WOCA 4I7ZC 4TVAB 5M5XH 5CC4A 1VQEA 4ILWA 1YNJD 1N33Q 3MZ5A 3CCJA 3DM1A 4LF8L 4JPBW 4WJ4A 1B2TA 3UE1A 2F0KA 2UUBQ 4AH6A 3LNNA 2QW7A 1ZYRC 2F0DA 2RVLA 2ZTEA 4KHVA 1E2VA 2JK8A 1H9KA 2F0JA 5C6AA 1VS0A 2NVQB 3I56A 1KNAA 1K83H 4CKCA 3T1HQ 1SE2A 3EN2A 1PTOF 1M8AA 4DAYA 3HOWB 2LS01 1ASZA 1HJPA 2D9UA 1Q12A 2R7FA 1WTHA 4C3HB 1VQMA 4OONA 1LM0A 4JI4Q 1TS4A 4GNXB 2GVBA 5ELBA 3J7A5 3D0FA 1EQQA 2I5LX 1RODA 4IUPA 3NBHA 2AKWB 4RH6A 1E0BA 3NENA 1CA5A 1TIID 4LF7L 4NMZA 1R9TB 3AU7A 1JJGA 3PF5A 4LFCL 2LXJA 2F0NA 2ICEC 4RHRA 2ZM6Q 4JI0Q 4DV5L 3I7FA 1JOOA 3D4DA 3J7AF 4TQUS 2PZTA 3QOLA 2NVQH 4EQOA 3G6EA 1A8VA 1AN8A 1SE4A 4ZCKA 3J80E 3HOWH 1Q86C 4B3SL 4K6LA 4NB3A 1L0WA 1E3PA 4C3HH 1Q82C 4OWTB 3C46A 4LFBL 5LMNQ 1CT1D 1F9RA 4DK3C 1S5BD 5JVH3 4GKJL 1KRTA 1STGA 4J15A 3TDQA 5E7NA 1VQCA 5JJZA 3ND9A 3VYSA 4BBRG 2M2LA 1GUOA 3ULLA 1R9TH 2N8NA 1F2MA 3HS0C 1V1OA 3TS2A 2IX3A 2RDFA 1XX8A 4R8IA 3HOUB 1OXVA 4LMQD 2MUYA 3AMUA 4DR2L 5HURA 4K5VA 1GKHA 2F0VA 5IYBH 1QWYA 4HEDA 4YWKA 1UNSA 4DR6Q 3K80C 1O80A 2ENBA 1N32L 4OWWB 4DR1Q 4LF5L 3F8TA 2PI2E 3QIAA 4I65A 4G7OC 2VB3X 1EQRA 4L5TA 1EZ6A 4JI2L 3K7UC 3HOXG 4X6AH 2ATWA 4GOPA 3P75A 4ME5A 2M9VA 5A35A 3HOUH 1G51A 5EKLA 2A1AA 5C5LA 4NXNQ 3M85A 2Z0SA 4IUQA 5EBDA 1EUJA 5JPMC 2K32A 1EWCA 2BA1A 2WKCA 1TWAB 4DR3Q 4B9XA 3D6WA 3IKJA 1LUZA 2Y0SG 1LV9A 3NWTA 4BY1G 2RCFA 3A55A 1BUVT 2LXKA 4BXXH 1NBWA 3E0EA 2K52A 4POGA 4A3EB 4CBVA 1A15A 3F2DA 1Q8IA 4L8JA 2YU9B 5FLXc 1JE5A 3LX0A 5FLMG 1LLRD 5K5PA 4A3IB 4KK7A 2A8VA 4BBSG 2B2YC 2MO1A 4P2CB 4PMCA 4C3JB 4LF4L 3SDZA 3RZDB 2Z1CA 2EYFA 1F9PA 1Z6HA 3U9OA 1N8RC 4QQBX 5D3IB 4L63B 5KYIA 4DNTB 3BVGA 3J7YW 3S1NB 5EKKA 3C2PA 4DA2A 2PW7A 3D31A 5F2DA 1I6HB 2KA7A 3OWFA 2CH4A 4A3JB 4A3EH 5IGEA 2YU9H 4RMFA 3RN5A 2WAQG 1L2FA 4A3IH 1BR9A 5IP9G 4C3JH 1STNA 3RZDH 4JI8L 3A5UA 2ES2A 3TRZA 3OPOA 5M3MG 1RTOA 3FRPB 2E5LQ 3KJOA 1HNXQ 3S1MB 3IFDA 5CMDA 4IUNA 2FMMA 3S1NH 1C9OA 1PH8A 4GNXC 2HHHQ 3SK6A 1FR3A 4UPAA 2TSSA 1EFID 2XVSA 1I6HH 2B2TA 4AYBG 4A3JH 3TP8A 1TT2A 3IRBA 2UUBL 1JC7A 2F0LA 3H3VH 4JYAQ 1K28A 2YTVA 1XYIA 4DV7Q 2ID0A 2ZTDA 1A3UA 2R92B 2LY7A 3MTSA 3W3AA 1CSQA 4Z9CB 1BF4A 3T1HL 2KOLA 2NWGA 5KNBA 1SNQA 3UDFA 3S1MH 2QEXA 1SLJA 1JCKB 1B8AA 1GHJA 3PV0A 4P73A 2VZAA 1I4RA 4JI4L 1QZGA 1JJCB 2AQ3B 3J81L 1PFBA 2F3IA 4OELB 1LTTD 4L5QA 4QUCA 4UAIA 3L7ZC 1SDFA 1JORA 3T51B 2ZM6L 5FLXE 1PXUA 4JI0L 2EJGC 2KCNA 1VQGA 4QCLA 2IHFA 2R92H 3OOCA 4DAYB 2DJFC 2UUCQ 2PZWA 4LJZC 2VY3A 2RCNA 3TREA 5IODA 4A3MG 1HRJA 2JA5G 4YCWA 4S3SA 2K1BA 2QILA 2WFWA 5I9PA 5BN4A 5ELDA 5AJ3Q 1C8CA 4F88A 1V1QA 3B6YA 1LT6D 5JOBA 2F0WA 5ELOA 4H0LC 3EIVA 1HFNA 2KVMA 1STHA 1SN8A 3PGZA 1EU4A 3RR5A 4ME3A 4HJ5A 3BS1A 3R2TA 1TWGH 4FP5D 2KUMA 5CV8A 5HY6A 3PCOB 3IFTA 4DV2Q 4ZQ3A 1E1OA 3W1BA 2GVAA 1H9MA 1NNXA 3S24A 1G291 1YI2A 1YVCA 1PTOB 4HIOA 1GD7A 2K5NA 2B2YA 1F9QA 4IPCA 5GROA 2FINB 4JBJA 2OQ0A 4DR6L 5DEHA 3HZXA 4IALA 2R7ZG 3GV6A 1LTRD 2D0PA 2ZXRA 2IX1A 1IKLA 1JOKA 2VXWA 3G6JB 4QB4A 3U4VA 4DV6Q 1D2BA 2EJFC 1NCVA 1AZQA 5E4XA 2A69C 1E2ZA 4C2MB 4ZYSA 1E2WA 1J9OA 2I5MX 4NXNL 1KLGD 4BBRB 4Q0FA 5C0XI 1PTOH 4PV1C 2RBMA 3F1ZA 2B2VC 4GLAC 1HZAA 3MA2B 3EROA 5DAUA 5TSSA 4DR3L 3MHBA 1CKOA 3T13A 2L9HA 4FYDA 4MNOA 3HFZB 1VQNA 2BDNA 5CV6A 4HJAA 2OXPA 4GNXA 2AWNA 2Z6KA 4FF3A 3TS0A 2R3ZA 4KKTA 2EY6A 3CRLC 4GOPB 1VQ5A 1CFMA 1E22A 2G9DA 4NW2A 3ND8A 5JPNC 2EE1A 3Q23A 4QL5A 1PH7A 3W5OA 4PMWA 4C2MH 4UHVA 3P1HA 4GN4B 4BBRH 1CTMA 2D0OA 1YHBA 5H1SE 5I4DA 4F87A 3A8KE 2EYMA 1S5CD 1TWHH 1YZ6A 3PUXA 3GV3A 2Q2IA 4BWGB 1MKHA 4PMBA 2DJGC 1WCMG 3HOXB 3I55A 5ELNA 3UDGA 1OXUA 1Q7YC 3CCRA 5CR3A 3BDOA 4R4IA 4QY7A 4LFCQ 1NTGA 1F2ZA 2SDFA 2BOSA 3K59A 1YJ9A 3CCQA 1O7IA 3RMHA 3DWAA 5IOCA 4IUVA 2KQ3A 3A8IE 5C0XG 2Y0SB 1BNZA 4BY1B 5ISRA 2F3WA 2ZJRA 2KHJA 1VQDA 1A6XA 2E5LL 4B3SQ 2H4OA 3K6OA 1PRTD 3DHQA 1IHZA 1E24A 3NPPA 3CF5A 2BH2A 3EQLC 1M4VA 4A3KG 1XTCD 4LFBQ 2HDMA 2L5TA 3HOXH 4FXDA 4L5RC 2JA9A 4BBSB 3D4WA 4PNYA 4FXGC 1OTCA 1S5DD 4X65Q 3CPWA 2QF7A 2L0CA 3ONAB 1AE2A 1FVIA 1CK1A 4JYAL 1UWVA 5CBEE 4DV7L 1EWHA 1ICFB 4ID6A 1HUNA 1Z47A 4KJNA 4WRDA 5IGCA 4CDFC 1RL2A 4BY1H 1LYLA 4LW1A 2F0QA 1CZWA 4C1NI 4LUZA 3DUZA 2NUCA 1D5XC 4CKEA 5IYDH 5JVG3 4X3SA 5LMUL 2EXDA 4UDUC 2VW9A 3GTPH 4JI1Q 1R4QB 1EY5A 2WAQB 1Y1WG 2K5VA 1TU2B 1WI5A 1K8GA 5FLMH 4BBSH 1KDBA 3URYA 3S1RB 2KCCA 4PQXA 4LF5Q 1BBWA 4U68A 1T5XD 1TXYA 3I4NH 1NMGA 2N49A 5M3MB 1HTLD 2O4XA 1X55A 4IJHA 3JAMi 4LNQA 1KABA 3VDYA 3FP9A 5DNFA 4CJ1B 4B3RL 1IW7D 1NMFA 2G9HD 2E76C 3EBEA 2WP8J 3D3RA 2I07B 1Q1EA 3PO3G 1L0XB 2UUCL 1N36Q 3V05A 4AYBB 2QA4A 1D5ZC 4EX5A 5BN5A 1F77A 1LTBD 2EQSA 3VYRA 1IKMA 2B2VA 3MXGA 4HIMA 4G7ZC 4G57A 5IP9H 2AQ1B 2Q8RE 3S1RH 2DGYA 4QF4A 4RAUC 3HOYG 1B70B 4DFAA 3K5OA 1SYCA 2WB1E 4RGOS 2Q8IB 5G3LD 1PFMA 4JV5L 1GXDC 1DD2A 1U4LA 3DWPA 1J8IA 2C9OA 4DV2L 1B9NA 3CCVA 5KYLA 4IJLA 4X62Q 4EQ5A 4KY5A 1HQRD 2KHIA 3FPUB 1QUQA 2WACA 1DONA 1RHPA 2OEOA 2K03A 4HSVA 5D65A 2CFMA 3UDXA 1D8LA 4OO1G 3W1GA 3KOJA 1SFOB 5CV7A 3CU7A 3KFUA 1B50A 4JI5L 4DV6L 4A3MB 4PG3A 2JA5B 2AMCB 5IWAQ 3X3MA 3GTLB 3PQIA 2CKZB 4QIWE 4TSSA 1NR2A 4FNFA 3T1YQ 4J1MA 2UUAL 4YWMA 3STBD 4UP8A 5JAVA 1AE3A 1KNEA 4JI8Q 1GHKA 4ZAIA 5KEEA 3U9SA 3VR5A 2J7ZA 3I8ZA 3GO5A 1VQPA 1N9WA 2Z9HA 2RSNA 2EY5A 3N6RA 4H7BA 5M3FG 2F4VQ 1YJNA 5M5YB 3H94A 1GO3E 4H02A 3HOZG 1SFOH 5KNDA 4CGYB 3HGBA 4V0BA 1VQ7A 4POFA 2A19A 4A3MH 4OIKA 1WTPA 3GTLH 1UE7A 3MAQA 2EYLA 3KDFA 4JI3L 1S5ED 4FF1A 2PI2A 2JSOA 3CMEA 4RGNA 4R4QA 1U5KA 2R7ZB 3QOJA 4TKOB 2UXDL 4LFAQ 4HTHA 5C3EG 1ONLA 4NXML 3FPPA 3I91A 3Q6SA 3K5LA 1CUKA 5M5YH 3HEJA 5E1FA 3E9HA 5ELFA 4JVZA 1OXXK 1CA6A 5J3BA 1V43A 1O7ZA 1NR4A 3CHBD 5EGTA 4JI6L 5I6YA 2V1CC 3EFXD 3PSIA 2KECA 4YY3Q 3H15A 3I90A 4PZ8A 1ZYRD 4IO9A 4P72A 4JBMA 3VA7A 2R7ZH 3JAML 1U0LA 4B3TL 1XXGA 1EL0A 1X3GA 4GZYC 4C56C 2K5QA 1TQOA 4M8AA 1F9SA 2B2TC 1HA5A 2X69A 3DXJC 5FO7B 3S2HB 5IT9c 1ZEQX 5IGFA 2JA6G 4WORA 2DY8A 1MSGA 2F0TA 1SNCA 4ODGA 4X65L 2LMCB 1K8AC 2K4KA 5BR8Q 4PZ7A 3BZDB 2NN6I 2ALYB 1MIUA 4CHTB 2R93G 2WKDA 2RDHA 1WCMB 1YHQA 5FO8B 2ICIA 1PZJD 2H5XA 1SYDA 1I94L 3SHLA 2Z6BA 3S2HH 3I4OA 1VQIA 5IT9L 1YNXA 3NBIA 1T9HA 4JI1L 2I46A 4LF6Q 3KLWA 1X3EA 1X54A 5C4JB 4RKLA 2JN4A 5C3WA 2K7VA 5M5WB 1PH9A 2PMZB 1B7YB 1Q3LA 2DY7A 4RGTA 1C0AA 3U58A 2PW5A 2E2JB 3HKZE 1YNND 2K6AA 4DKAC 3KLSA 3DMUA 4QGUA 1A3TA 5T1IA 1WCMH 4A3KB 3BG3A 3CCUA 2CCZA 1ASYA 1N36L 2OF1A 2MNAA 1XPOA 3OWEB 2DNEA 1JMCA 1BCPD 5D14A 4ZLTF 1K3RA 2PZUA 5I2XA 4OHJA 3HRZC 1H95A 3NQIA 1HZCA 3CCEA 3P7JA 3RNUA 5C4JH 2F0MA 3M7GA 1JWUD 2RDGA 2A6HD 4OIJA 5M5WH 2I0QA 4A3BG 3GTQB 2NN6G 2E2JH 3RZOB 2HQLA 2F0GA 1JB7A 2ZJQA 4BA1I 3OW2A 4YCVA 1ET6A 3MWYW 4A3KH 5K36G 3NUCA 4X64L 1KHIA 1Y1WB 3PUZA 1G2SA 1PDQA 2EIFA 4X62L 4KMUC 1EEFD 1I4HA 2B8FA 1ET9A 1SMYD 2F0IA 5LHY1 3K58A 1TWAH 2F52A 1S72A 1WTQA 5IT9E 1YEZA 3I4LA 4HSPA 4XT3B 3E9IA 1LT5D 2K01A 3M3YB 2RA4A 3LWUA 5C0XJ 1JWSD 1QVCA 3PO3B 4HMJA 3GTQH 1KTKA 3RZOH 2PO4A 3NK9A 5GAGC 1X3PA 5IWAL 2A6ED 1HTPA 4XXEA 4CJ0B 4BY7G 3OW7A 1BVSA 3NSWA 2F0SA 3DM3A 4CDDC 2EJMA 1Y1WH 3T1YL 1QUQB 2EVBA 2L15A 4YIJA 4JOIA 3AFPA 1Q8KA 2N78A 2KCMA 3HOYB 1XPUA 3S2DB 1B53A 3RD4A 1HCZA 1K73C 2HCIA 2J0TD 2JYOA 2V4DA 2Z6KC 3M3YH 3I73A 2F4VL 4QUFA 4YCUA 3L9AX 3J81c 1IYUA 3PO3H 5CBAE 2X6LA 1CM9A 2JA8G 1BCPF 3R8BA 4ZK9B 4HJ9A 1HR0Q 1KAAA 3DWQA 3ZJYC 1HNWL 2N88A 3NTIA 1DGSA 1CQVA 2FJ2A 3TMEA 4N9PA 1DJRD 2H1EA 3OSOA 1VQ9A 3HOYH 1X3FA 4LFAL 1F2LA 4JBKA 3S2DH 4ABNA 3ULJA 5LMUQ 2KJXA 4DAVA 4OXPA 1DZ1A 2K05A 4A93G 1EY7A 1Y1VG 2F3VA 2JP1A 3KDFB 4HN7A 4IZ8A 3R93A 1BDOA 1A63A 1ML0D 1PFSA 3EA6A 4B3RQ 4RA8A 4YY3L 2Z4HA 2E2IB 2KEEA 4OO1H 5HGQA 5CV5A 2VUMG 3NXWA 5M3FB 3VR6A 2KENA 1MSHA 1ENAA 3CD6A 3HOZB 1VF5C 2IW3A 2XRSD 5DLQE 5IYCG 2NB0A 1H9JA 3VR4A 1WFQA 1EY6A 1WTVA 4RCOA 5CGKA 5GAHC 1MBYA 2NTSA 1LACA 3BDCA 1JT8A 2XSCA 1G2TA 2K33A 3LWEA 2BDOA 1U9RA 1HHVA 1KRSA 1IL8A 2RF4A 1U4RA 3IAYA 3OTOL 1GUTA 2OCEA 3CC2A 2LKVA 5C3XA 5C3EB 3V2TA 5BR8L 1EIFA 4O42A 4JV5Q 3RLOA 4K2KA 2K04A 1EYDA 1W2BA 2E2IH 5C4ZA 4XQNA 5LL6S 5NUCA 5M3FH 3HOZH 3QJYA 4DR4Q 1AFPA 1RKNA 1QNUA 4KKSA 1YJWA 1CHQD 2JQOA 5EQ0A 3TQYA 1PFNA 4DXGA 4KN4C 3BU2A 2IL8A 1VQ8A 3FEWX 3TEHB 4LF6L 4R1JA 3GP7A 4MIUA 3CCLA 5FKAC 3KJPA 3J81E 1KC8C 3SR1A 1PA6A 1TS5A 5C3EH 4YHHQ 3HP3A 1UEBA 4JI5Q 4MTNA 2PPBC 3M4YA 4U673 5C4XG 3C1EA 2C35B 3MXUA 2VQFQ 3K5NA 3T56B 1YITA 1NAPA 1ENCA 3NTHA 2UUAQ 2JA6B 1SYFA 4XDXA 3WOFA 2CW0C 1EIHA 2LSSA 3N52A 2NYZD 2IT1A 3I2ZA 1K3BC 1I50B 1SE3A 2X6GA 2MJ8A 2R93B 1K9MC 3DEOA 5KRUA 3H6MA 4GKKQ 4QMGA 4X3TA 4A3LG 3T53B 1AH9A 4PZ6A 1QE6A 1D7QA 3IL8A 4FVMA 1VQ4A 4JI3Q 4DK0A 1IBLL 1GJXA 3VR3A 2JA6H 1K0SA 1OO9B 1QJOA 1OXSC 1KIXA 1VQFA 5HGTA 1EYGA 4XYQA 1XMOQ 2UXDQ 3J7ZC 2WB1G 3K57A 4L6TB 1I50H 1DOKA 4N8X1 4NXMQ 2QKIC 3A7AB 2UU9Q 2R93H 3E0JA 5LL6X 3GTKB 2R6GA 3CP0A 1G8ZD 4A3FG 5A2QL 1EOVA 1DXMA 3OHXC 4RHSA 1OXTA 1PRTC 4JI6Q 1SJHD 3MFYA 4XQJA 1XPRA 1U4MA 2A68D 2K5WA 1N34L 1BKBA 2A73B 2CWAA 2EYPA 1JICA 1WTXA 5I9OA 1EFWA 4B3TQ 4OX9L 5JEAG 5EKIA 2EY2A 4A3BB 4GN3B 1QZHA 3FKIG 1VQHA 1LT3D 1Q90A 2MPMA 3E3XA 4NDXA 3GTOB 4ULLA 1YIJA 4MN3A 1L1OA 2CH4W 2O5JC 3GTKH 1XMQQ 3U50C 3J80i 1WVLA 2JA7G 2JEAI 1HH2P 2MHVA 2MP1A 2F0UA 2YV5A 3MFGA 3SK5A 5IGGA 2EZVA 1DYQA 1VQ6A 3ICEA 2XGTA 1Y8PB 1HR0L 3CQZB 3TZUA 4K2LA 1GUGA 5AFWA 1D5MC 3BVZA 4IOCA 1LTLA 2LFNA 3G71A 3GDEA 2J4XA 4DNIA 2Z4IA 3H3VI 4AQYQ 2YYZA 1U4PA 4HIKA 4A3BH 1I94Q 3R3OA 2NN6H 2Q2UA 4UY8C 4NP5A 2R61A 3F2UA 1E1TA 2EXZA 3GTOH 4H44C 1SNPA 5EBCA 3NTKA 1SYBA 2OQKA 1HZBA 5K36H 4BY7B 1L0YB 2CVRA 3QO2A 4K5WA 1KDAA 1R4PB 1PV4A 1HNZQ 3TP5A 1RDPD 2IX0A 2ZJPA 3TBIB 1X6OA 3AEVA 4DK6C 2AHOB 3OIQA 3CQZH 4J8QA 3WWVA 5JJIA 2K75A 1SMXA 2O5IC 2GA4B 4K8JA 1A2TA 1H9RA 4JBWA 3VYUA 2JA8B 2Q2TA 5D3DA 2UXCQ 1VQLA 1Q1BA 1X65A 1V8QA 2JXMB 4BY7H 4A3GG 1UEAB 1STAA 3OYYA 1DM0B 1TWCB 3PUVA 4DV1L 4MZ9A 3G4SA 5M3MH 4IUUA 1PRTF 2XWBB 1BCPB 1FGUA 1B3AA 4LUOA 1WD1A 3GTJB 3KF8A 4X64Q 1B44D 2DN8A 1QVGA 4A93B 5IY0A 1Y1VB 2BE5D 4DR4L 3M4QA 2FHTA 3X3NA 2ZT9C 3SK8A 1HUMA 1B9MA 3K5MA 2B2WC 2JA8H 3S1QB 3E6ZX 1AP0A 4GN5A 5FK9C 1PTOD 1TR5A 4DR7Q 1MI2A 3CCMA 1MJEA 4K5XA 3Q22A 4A3DG 5C44G 4DGZA 3STBC 3K0YA 5CYUA 4X3UA 2VUMB 1TWCH 2GN5A 1IL2A 1LO5D 1NUCA 3K8AA 1GVPA 3G7LA 4YHHL 2TMPA 3O13A 2AWOA 3A0JA 3GTJH 4CDCC 4AIMA 2XTIA 5J1ZA 2VQFL 1ENFA 2MGSA 4F7XA 1SJED 4L5SA 1PH5A 2A5HA
chains in the Genus database with same CATH topology
1QB5D 1YNJC 3BVMA 3WDNA 1Y8OB 4IFDI 1F2YA 3A7LA 5KGUA 3WOEA 3MVVA 4KTAA 4IUTA 1B1ZA 3VYTA 1T5EA 1HQMC 2IPKD 1SBBB 3I70A 1RJTA 4IURA 4LAAA 1CZGA 3NHHA 1BXTA 3T4AC 3OIPA 4O1NA 2A74C 4HCEA 1AZPA 2KEDA 5G3LF 4HCSA 2HDLA 2WINB 4XTCS 5C4XB 2Q8TA 3EVQA 1W6JA 1EIGA 1TS3A 2L4NA 2N55A 3L3OC 4RCNA 2B2UA 5J39A 3VR2A 2IWHA 2F0OA 1Y8NB 1FNUA 3PUWA 4K8IA 4IFDG 1TY2A 1QILA 3TN2A 2OT2A 4NKLA 5CORA 3FVQA 1RTNA 4KN7C 1VMCA 4FF4A 1SEBD 1MGSA 1AEXA 3OMGA 2RQXA 3A56A 1HXYD 3NWSA 2XRQD 2WB1B 1VCIA 4EQNA 1WD0A 5T1GA 2F0PA 4KHZA 3GQBA 1EY4A 4A3FB 3C3LA 1YNNC 3BYYB 3KBGA 2F0HA 4C3IG 5EPKA 1S4ZA 4IN3A 3RUZA 2B2WA 2B8GA 1BQQT 1JQYD 2Z8LA 1I4QA 1BCPC 3GD7A 3FKIB 3S9WA 3S17B 4QIWB 5EJWA 3V96A 3MC0B 3QB3A 2A6HC 4V190 3MXNA 1RD9D 2JA7B 3JAME 3TP6A 1FYCA 1UAPA 3KLRA 3ZYYX 1EEID 2NVYB 1TKWB 1LTID 2RKSA 2E2HB 5C0XH 1A3VA 1D6EC 2ZXOA 1WTWA 3SE0A 3E5SA 5JEAH 1SMYC 2F0EA 2NZ1D 2QDBA 2EYOA 1H9SA 5M9OA 2F1MA 4B9WA 3EJIA 1DCZA 3I3CA 5ELEA 2JE6I 4R8NA 2A6EC 1V1PA 1II3A 2PQEA 1CI3M 4XIGS 1Z7TA 5CV9A 5JEAJ 2EYHA 3PUYA 1EOTA 4EGVA 1QCBD 2EYJA 1EQTA 3MEHA 4A3GB 1ZKOA 3TSSA 3MXPA 1RCVD 3TP7A 3NP8A 2L12A 1S5FD 1W6KA 2XWJB 5ELCA 4DK1A 5EPJA 3Q0AA 2HUGA 3A54A 5FLXL 1SSOA 3GTGB 4FF2A 2M00A 3CRKC 1SNMA 2IJ0A 2PCFB 4DXFA 3RLFA 1PRTB 5DM73 4Y7NB 1FNWA 4RFBA 4A3DB 5C44B 5C5MA 1CQFA 1SAPA 3QG1A 3A8JE 5E3FA 3J7AV 2KHSA 3ITPA 4IQZA 1LTAD 3FDTA 5KNCA 2CHBD 3W2DA 1JE4A 3KK7A 3HKZB 1O78A 1FGBD 4KD4A 1PZKD 2NVTB 1EY9A 1G91A 4HAEA 4KKUA 1QNKA 1AW7A 2L11A 5COYA 1LABA 2WIIB 2FFKB 2WV6D 2ZXPA 4KV6A 1D1IA 3NE5B 1BOSA 1TWGB 4EQPA 3M7NA 2SNSA 4CJ2C 1KLUD 3I4MB 1STYA 3H0GB 1CHPD 3K7AB 2O2LD 2EOTA 1O7YA 3D8GA 3H91A 4DU9A 1VF7A 1GUSA 3UI2A 1SNOA 5IIFA 2AUKA 1HA6A 1EY8A 2EDGA 2PNRC 1C4QA 4DAPA 3PO2B 1SYEA 1A2UA 4J6HA 1UUPA 1TS2A 4XYOA 1EY0A 2AQ2B 3R2IA 2HQEA 5IGBA 2BA0A 4HR7B 3T16A 4Q5VA 4EVOA 3OMCA 4X3KA 3KUPA 1K8OA 1JB3A 4K14A 1I6VC 3PIO3 4C3HG 4IFDH 2XN9C 1G6ZA 5I2YA 2E75C 3BDLA 3ERQA 1LT4D 4C3IB 1ILQA 1NSNS 1TWHB 1EYCA 4KJOA 1EQVA 4XT1B 2EPBA 2A69D 2CQAA 3SK4A 2CW0D 4G4KA 1FNVA 3VA5A 4RKBA 2A68C 4KI0A 3H3VC 4BA2I 4IFDJ 1STBA 1WTOA 4OL7A 3H09A 2QEJC 4G7HC 1BO0A 4XQQA 3PMFA 5J22A 1MD2D 4TRDA 1H9SB 3NQTA 3I72A 1LTSD 2C5CA 1QG7A 1LTGD 1STEA 2JEBI 1V1PB 4C1NK 4ZKBB 2PYKA 1HPCA 1EYAA 1B4OA 2NVXB 3P20A 2SOBA 4DN4M 1PYWD 4E6IA 2EY1A 1GUWA 1IYVA 2AUJD 1X32A 4CKBA 3CKIB 2NBFA 2D5DA 1FD7D 3S16B 1KDCA 1PMRA 3GTPB 4ZRZA 4ZUIA 1K8MA 3GTMB 4WFN3 5EPLA 5FOBB 4HMIA 1IW7C 3I4NB 4B08A 2B2UC 3PIP3 1QOHA 5BN3A 2F0FA 3AB9A 3C1FA 1DOLA 3SVMA 4KY7A 4KY6A 5C4HA 5A2QE 3HG9A 4OGQC 1PLFA 1ESRA 4KD3A 4RGMA 5DM63 1RF2D 4JK1C 2F4IA 2XNAC 1VMPA 1TY0A 4DF7A 1DOMA 3Q24A 4M1UB 4C3JG 2B39A 2L55A 4OO1I 2RSOA 2D62A 5FO9B 2NTTA 1TWFB 2K28A 2SEBD 1EZ8A 5IGDA 3M4OB 1JOQA 2BE5C 1XWEA 2B63B 3FMCA 2L1BA 5KIXA 1C48A 1ZXTA 1Y69U 1BBXC 1PTOC 4ZKCB 3D6CA 1JWMD 4R9WA 1ESFA 2VNUD 4BS9A 3SXHA 3S14B 4F8MA 3S15B 4LK1C 2HCCA 3TZDA 4RWSC 1EU3A 4DNRB 4WJWA 5I6WA 3KBXA 3HOVB 5E4WC 2SNMA 2QCPX 3KLSX 3BYTB 1SNDA 4N9TA 1X3QA 1SXTA 3D4RA 1GOZA 1I4GA 4K6DA 1I3QB 2BCOA 4FO2A 3SEBA 1I4PA 5M5XB 4H13C 2K5DA 4ZUJA 1HFGA 1ILPA 2F03A 1ICWA 2E2DC 1VDZA 1SYGA 2E74C 2D2CC 1JR0D 1GUNA 2XIWA 4MHEA 1O7LA 1WTRA 2DNCA 2VB2X 1K83B 3J80L 3DEPA 3QWNA 4FXKC 1D1KA 1TVXA 5CV4A 2FMCA 1PZID 1I4XA 4I7ZC 5CC4A 4ILWA 1YNJD 3MZ5A 3DM1A 1B2TA 2F0KA 3LNNA 1ZYRC 2F0DA 2RVLA 4KHVA 1E2VA 1H9KA 2F0JA 5C6AA 2NVQB 1KNAA 4CKCA 1SE2A 1PTOF 1M8AA 4DAYA 3HOWB 2LS01 2D9UA 1Q12A 4C3HB 1TS4A 5ELBA 1RODA 4IUPA 3NBHA 4RH6A 1E0BA 1CA5A 1TIID 4NMZA 1R9TB 3AU7A 4RHRA 2F0NA 2ICEC 1JOOA 3D4DA 3J7AF 4TQUS 2PZTA 3QOLA 4EQOA 1AN8A 1SE4A 3J80E 4K6LA 3C46A 1CT1D 1F9RA 1S5BD 5JVH3 3TDQA 1STGA 5JJZA 3ND9A 3VYSA 2M2LA 1GUOA 1F2MA 3HS0C 1V1OA 2IX3A 2RDFA 1XX8A 4R8IA 3HOUB 1OXVA 4LMQD 2MUYA 3AMUA 5HURA 4K5VA 2F0VA 1QWYA 4HEDA 1UNSA 1O80A 2ENBA 3QIAA 4I65A 4G7OC 2VB3X 1EZ6A 3P75A 4ME5A 2M9VA 5A35A 5EKLA 5C5LA 3M85A 4IUQA 5EBDA 5JPMC 2K32A 1EWCA 2BA1A 2WKCA 1TWAB 4B9XA 3D6WA 3IKJA 1LV9A 3NWTA 3A55A 1BUVT 4A3EB 4CBVA 1A15A 1Q8IA 4L8JA 2YU9B 3LX0A 1LLRD 5K5PA 4A3IB 4KK7A 2B2YC 4P2CB 4PMCA 4C3JB 3SDZA 3RZDB 2Z1CA 2EYFA 1F9PA 1Z6HA 3U9OA 5D3IB 4L63B 5KYIA 4DNTB 3BVGA 3J7YW 3S1NB 5EKKA 3C2PA 4DA2A 2PW7A 3D31A 5F2DA 1I6HB 2KA7A 3OWFA 4A3JB 5IGEA 1BR9A 1STNA 3OPOA 1RTOA 3FRPB 3S1MB 3IFDA 5CMDA 4IUNA 2FMMA 3SK6A 1FR3A 2TSSA 1EFID 2XVSA 2B2TA 3TP8A 1TT2A 1JC7A 2F0LA 1XYIA 2ID0A 1A3UA 2R92B 2LY7A 3MTSA 3W3AA 4Z9CB 1BF4A 2KOLA 2NWGA 5KNBA 1SNQA 1JCKB 1GHJA 3PV0A 1I4RA 2AQ3B 3J81L 1PFBA 1LTTD 4QUCA 4UAIA 3L7ZC 1SDFA 1JORA 3T51B 5FLXE 1PXUA 2EJGC 2KCNA 4QCLA 3OOCA 2PZWA 4LJZC 5IODA 1HRJA 4S3SA 2K1BA 2QILA 5I9PA 5BN4A 5ELDA 1C8CA 4F88A 1LT6D 5JOBA 2F0WA 4H0LC 1HFNA 2KVMA 1STHA 1EU4A 3BS1A 3R2TA 4FP5D 2KUMA 5CV8A 3IFTA 4ZQ3A 1H9MA 1G291 1PTOB 2B2YA 1F9QA 2FINB 5DEHA 3HZXA 4IALA 3GV6A 1LTRD 2ZXRA 2IX1A 1IKLA 1JOKA 2VXWA 3G6JB 4QB4A 1D2BA 2EJFC 1NCVA 1AZQA 5E4XA 2A69C 1E2ZA 4C2MB 4ZYSA 1E2WA 1J9OA 1KLGD 4BBRB 4Q0FA 5C0XI 1PTOH 4PV1C 2RBMA 2B2VC 5DAUA 3MA2B 3EROA 5TSSA 3MHBA 3T13A 2L9HA 4FYDA 2BDNA 5CV6A 2OXPA 2AWNA 4FF3A 2R3ZA 4KKTA 2EY6A 3CRLC 1CFMA 2G9DA 4NW2A 3ND8A 5JPNC 2EE1A 3Q23A 4PMWA 3P1HA 1CTMA 5I4DA 4F87A 3A8KE 2EYMA 1S5CD 3PUXA 3GV3A 4BWGB 4PMBA 3HOXB 1OXUA 5CR3A 3BDOA 2SDFA 1F2ZA 2BOSA 3K59A 3RMHA 3DWAA 5IOCA 4IUVA 2KQ3A 3A8IE 5C0XG 2Y0SB 1BNZA 4BY1B 5ISRA 2F3WA 1A6XA 2H4OA 3K6OA 1PRTD 3DHQA 1IHZA 3NPPA 3EQLC 1M4VA 1XTCD 2HDMA 2L5TA 4FXDA 4BBSB 3D4WA 4PNYA 4FXGC 1S5DD 2QF7A 2L0CA 3ONAB 1CK1A 5CBEE 1EWHA 4ID6A 1HUNA 1Z47A 4KJNA 4WRDA 5IGCA 2F0QA 1CZWA 4C1NI 3DUZA 2NUCA 1D5XC 4CKEA 5JVG3 4X3SA 4UDUC 1R4QB 1EY5A 2WAQB 1TU2B 1KDBA 3URYA 3S1RB 2KCCA 4PQXA 4U68A 1T5XD 5M3MB 1HTLD 2O4XA 1KABA 5DNFA 4CJ1B 1IW7D 2G9HD 2E76C 2WP8J 3D3RA 2I07B 1Q1EA 1L0XB 3V05A 4AYBB 1D5ZC 5BN5A 1F77A 1LTBD 3VYRA 1IKMA 2B2VA 3MXGA 4G7ZC 4G57A 2AQ1B 2Q8RE 4QF4A 4RAUC 4DFAA 3K5OA 1SYCA 4RGOS 2Q8IB 5G3LD 1PFMA 1GXDC 1DD2A 1U4LA 3DWPA 1J8IA 2C9OA 1B9NA 5KYLA 4KY5A 1HQRD 3FPUB 2WACA 1DONA 1RHPA 2OEOA 2K03A 4HSVA 5D65A 4OO1G 1SFOB 5CV7A 3CU7A 1B50A 4A3MB 2JA5B 3X3MA 3GTLB 4TSSA 1NR2A 4FNFA 4J1MA 5JAVA 1KNEA 1GHKA 4ZAIA 5KEEA 3U9SA 3VR5A 2J7ZA 3I8ZA 3GO5A 2RSNA 2EY5A 3N6RA 4H7BA 5M5YB 3H94A 5KNDA 4CGYB 3HGBA 4V0BA 4OIKA 1WTPA 3MAQA 2EYLA 4FF1A 1S5ED 2JSOA 4RGNA 2R7ZB 3QOJA 4TKOB 4HTHA 1ONLA 3FPPA 3I91A 3Q6SA 3K5LA 3HEJA 5E1FA 5ELFA 1OXXK 1CA6A 1V43A 1O7ZA 1NR4A 3CHBD 5EGTA 5I6YA 3EFXD 2KECA 3I90A 1ZYRD 3VA7A 3JAML 1XXGA 1EL0A 4GZYC 4C56C 2K5QA 1TQOA 4M8AA 1F9SA 2B2TC 1HA5A 2X69A 3DXJC 5FO7B 3S2HB 1ZEQX 5IGFA 4WORA 2DY8A 1MSGA 2F0TA 1SNCA 4ODGA 2LMCB 3BZDB 2NN6I 4CHTB 2WKDA 2RDHA 1WCMB 5FO8B 2ICIA 1PZJD 1SYDA 3SHLA 5IT9L 3NBIA 2I46A 5C4JB 4RKLA 5C3WA 2K7VA 5M5WB 2PMZB 1Q3LA 2DY7A 4RGTA 2PW5A 2E2JB 1YNND 2K6AA 3KLSA 3DMUA 1A3TA 5T1IA 4A3KB 3BG3A 2OF1A 3OWEB 2DNEA 1BCPD 5D14A 4ZLTF 2PZUA 5I2XA 4OHJA 3HRZC 3NQIA 3P7JA 2F0MA 3M7GA 1JWUD 2RDGA 2A6HD 4OIJA 3GTQB 2NN6G 3RZOB 2F0GA 4BA1I 1ET6A 3MWYW 5K36G 3NUCA 1Y1WB 3PUZA 1G2SA 1PDQA 4KMUC 1EEFD 1I4HA 2B8FA 1ET9A 1SMYD 2F0IA 5LHY1 3K58A 1WTQA 5IT9E 3I4LA 4HSPA 4XT3B 1LT5D 2K01A 3M3YB 2RA4A 3LWUA 5C0XJ 1JWSD 3PO3B 4HMJA 1KTKA 2PO4A 3NK9A 1X3PA 2A6ED 1HTPA 4XXEA 4CJ0B 3OW7A 3NSWA 2F0SA 2EJMA 2EVBA 4YIJA 3HOYB 3S2DB 1B53A 3RD4A 1HCZA 2HCIA 2J0TD 2JYOA 2V4DA 3I73A 4QUFA 3L9AX 1IYUA 5CBAE 2X6LA 1CM9A 1BCPF 3R8BA 4ZK9B 1KAAA 3DWQA 2N88A 3NTIA 1CQVA 2FJ2A 3TMEA 4N9PA 1DJRD 2H1EA 3OSOA 1F2LA 4ABNA 2KJXA 4DAVA 1DZ1A 2K05A 1EY7A 2F3VA 2JP1A 4HN7A 3R93A 4IZ8A 1BDOA 1ML0D 3EA6A 4RA8A 2Z4HA 2E2IB 2KEEA 4OO1H 5CV5A 3NXWA 5M3FB 3VR6A 1MSHA 1ENAA 3HOZB 1VF5C 2IW3A 2XRSD 2NB0A 1H9JA 3VR4A 1EY6A 1WTVA 4RCOA 5CGKA 1MBYA 2NTSA 1LACA 3BDCA 2XSCA 1G2TA 2K33A 3LWEA 2BDOA 1U9RA 1HHVA 1IL8A 1U4RA 3IAYA 1GUTA 2LKVA 5C3XA 5C3EB 3V2TA 4O42A 4K2KA 2K04A 1EYDA 5C4ZA 4XQNA 5LL6S 5NUCA 3QJYA 1AFPA 1RKNA 1QNUA 4KKSA 1CHQD 5EQ0A 1PFNA 4DXGA 4KN4C 2IL8A 3FEWX 3GP7A 4MIUA 5FKAC 3J81E 3SR1A 1TS5A 3HP3A 2PPBC 3M4YA 4U673 3C1EA 3MXUA 3K5NA 3T56B 1NAPA 1ENCA 3NTHA 2JA6B 1SYFA 4XDXA 3WOFA 2CW0C 1EIHA 3N52A 2NYZD 2IT1A 1I50B 1SE3A 2X6GA 2MJ8A 2R93B 3DEOA 5KRUA 3H6MA 4QMGA 4X3TA 3T53B 1QE6A 3IL8A 4FVMA 4DK0A 1GJXA 3VR3A 1OO9B 1QJOA 1OXSC 5HGTA 4XYQA 3K57A 4L6TB 1DOKA 2QKIC 3A7AB 3E0JA 5LL6X 3GTKB 2R6GA 1G8ZD 5A2QL 1DXMA 3OHXC 4RHSA 1OXTA 1PRTC 1SJHD 3MFYA 4XQJA 1U4MA 2A68D 2K5WA 2A73B 2EYPA 1JICA 1WTXA 5I9OA 5JEAG 5EKIA 2EY2A 4A3BB 1LT3D 1Q90A 2MPMA 4NDXA 3GTOB 4ULLA 4MN3A 2O5JC 1WVLA 2JEAI 2MHVA 2MP1A 2F0UA 3MFGA 5IGGA 3SK5A 2EZVA 1DYQA 1Y8PB 3CQZB 3TZUA 4K2LA 1GUGA 5AFWA 1D5MC 3BVZA 2LFNA 2J4XA 2Z4IA 2YYZA 1U4PA 3R3OA 2NN6H 4NP5A 2R61A 3F2UA 2EXZA 4H44C 1SNPA 5EBCA 3NTKA 1SYBA 5K36H 4BY7B 1L0YB 2CVRA 3QO2A 4K5WA 1KDAA 1R4PB 3TP5A 1RDPD 2IX0A 3TBIB 3OIQA 4J8QA 2O5IC 2GA4B 4K8JA 1A2TA 1H9RA 4JBWA 3VYUA 2JA8B 5D3DA 1Q1BA 1V8QA 2JXMB 1UEAB 1STAA 1DM0B 1TWCB 3PUVA 4IUUA 1PRTF 1BCPB 2XWBB 1B3AA 1WD1A 3GTJB 3KF8A 1B44D 2DN8A 4A93B 1Y1VB 2BE5D 2FHTA 3X3NA 2ZT9C 3SK8A 1HUMA 1B9MA 3K5MA 2B2WC 3S1QB 3E6ZX 1AP0A 5FK9C 1PTOD 1TR5A 1MI2A 4K5XA 3Q22A 4DGZA 3K0YA 5CYUA 4X3UA 2VUMB 1LO5D 1NUCA 3G7LA 2TMPA 3O13A 2AWOA 5J1ZA 1ENFA 2MGSA 4F7XA 1SJED 2A5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DMU A;  3D8G A;  2O4X A;  2EYL A;  2EY6 A;  1A3T A;  3TP7 A;  4F8M A;  1JOR A;  1ENC A;  1KAB A;  3NP8 A;  4NMZ A;  1SYF A;  1EY4 A;  2PYK A;  4DU9 A;  2F0N A;  3TME A;  4N9P A;  1EYA A;  1F2Y A;  5KGU A;  3OSO A;  3R3O A;  2SOB A;  1JOO A;  3D4D A;  4NP5 A;  4E6I A;  3LX0 A;  1SNO A;  2EY1 A;  2F0H A;  3MVV A;  3P1H A;  3QOJ A;  2EXZ A;  4KTA A;  2OF1 A;  5IIF A;  2PZT A;  4HTH A;  3RUZ A;  5K5P A;  5I6W A;  1SNP A;  1EY8 A;  3QOL A;  2M00 A;  2PZW A;  4EQO A;  4PMC A;  1SYB A;  1SNM A;  2PZU A;  2SNM A;  5IOD A;  2EYM A;  2EYF A;  4K5W A;  4S3S A;  1SND A;  5KRU A;  1SYE A;  1A2U A;  1KDA A;  3H6M A;  1EY7 A;  2F0M A;  2F3V A;  4J6H A;  4N9T A;  3U9O A;  4PMB A;  5I9P A;  3TP5 A;  4QMG A;  4LAA A;  5KYI A;  3SK6 A;  1EY0 A;  3HEJ A;  4IZ8 A;  4G57 A;  5E1F A;  5EKK A;  3NHH A;  1KDC A;  3S9W A;  4QF4 A;  1STG A;  2PW7 A;  4K6D A;  2F0W A;  5DEH A;  2HQE A;  3QB3 A;  5F2D A;  4ZUI A;  5JOB A;  2F0G A;  5CR3 A;  4DFA A;  1STH A;  3OWF A;  1SYC A;  5EGT A;  4ZUJ A;  5IGB A;  3T16 A;  5I6Y A;  1F2Z A;  5C5M A;  4EVO A;  3OMC A;  1SYG A;  5CV5 A;  3NUC A;  1F2M A;  3TP6 A;  5IGE A;  3NXW A;  5CV8 A;  5HGT A;  1ENA A;  4HMI A;  5IOC A;  4K8J A;  2KQ3 A;  4K14 A;  5E3F A;  5KYL A;  1A2T A;  4ZQ3 A;  2KHS A;  2F0F A;  3ITP A;  2RDF A;  5ISR A;  3C1F A;  2F3W A;  4KY5 A;  1EY6 A;  2RKS A;  5CGK A;  2F0I A;  1TQO A;  3EVQ A;  4KY7 A;  1STN A;  4KY6 A;  2WAC A;  5C4H A;  3BDC A;  1A3V A;  1STA A;  2OEO A;  3DHQ A;  1IHZ A;  1U9R A;  3E5S A;  4K5V A;  5HUR A;  5IGF A;  4KD3 A;  5J39 A;  4IUN A;  3BDL A;  4WOR A;  2F0E A;  3SXH A;  5CV4 A;  2QDB A;  3ERQ A;  2F0T A;  4HMJ A;  2F0V A;  2F0O A;  1NSN S;  1SNC A;  4KD4 A;  2EYO A;  3HZX A;  2LKV A;  4ODG A;  5CV7 A;  4IAL A;  1EY9 A;  1EYC A;  5C3X A;  3D4W A;  3NK9 A;  4KJO A;  4PNY A;  2ENB A;  3V2T A;  1EQV A;  5CC4 A;  4K8I A;  4K2K A;  4DF7 A;  3MZ5 A;  1EYD A;  3TP8 A;  1TT2 A;  5M9O A;  1JOK A;  5C4Z A;  4B9W A;  4QB4 A;  3EJI A;  4I65 A;  3SK4 A;  2F0S A;  5NUC A;  2F0L A;  2EYP A;  2F0K A;  3SK8 A;  5I9O A;  4YIJ A;  4ID6 A;  3VA5 A;  4R8N A;  4J1M A;  1EZ6 A;  4KJN A;  2F0D A;  4KV6 A;  1EZ8 A;  2EY2 A;  4NKL A;  4RKB A;  1RKN A;  4WRD A;  5IGD A;  4KHV A;  5IGC A;  5JAV A;  2F0Q A;  1SYD A;  1A3U A;  1II3 A;  3P75 A;  4ME5 A;  1STB A;  1JOQ A;  3SHL A;  5KEE A;  4OL7 A;  4EQP A;  4NDX A;  2F0J A;  1TR5 A;  2NUC A;  2SNS A;  5C6A A;  2PQE A;  4K5X A;  5EKL A;  5C5L A;  4DGZ A;  2RBM A;  5KIX A;  1SNQ A;  3PMF A;  4MIU A;  1AEX A;  5CV9 A;  3OMG A;  2EYH A;  5DAU A;  3ERO A;  2EY5 A;  1NUC A;  5J22 A;  4TRD A;  1STY A;  1EY5 A;  3NQT A;  4H7B A;  3MHB A;  3SR1 A;  3T13 A;  4RKL A;  4B9X A;  5IGG A;  2F0U A;  3SK5 A;  2EYJ A;  5C3W A;  3D6C A;  3MEH A;  1KDB A;  4EQN A;  5CV6 A;  5J1Z A;  3C1E A;  4K2L A;  2OXP A;  2PW5 A;  4F7X A;  1KAA A;  2F0P A;  3MXP A; 
#chains in the Genus database with same CATH topology
 1QB5 D;  4A93 H;  1YNJ C;  3BVM A;  1Y1V H;  3WDN A;  1Y8O B;  4IFD I;  3U4Z A;  1F2Y A;  1S3O A;  3A7L A;  3HKZ G;  5KGU A;  3WOE A;  3MVV A;  1NY4 A;  4KTA A;  1XNR Q;  4IUT A;  1B1Z A;  1KXL A;  2VUM H;  2HIX A;  2YTX A;  1IYJ B;  2ZTC A;  3VYT A;  4GKK L;  1T5E A;  1HQM C;  1PYS B;  1BBU A;  3NEM A;  2IPK D;  1SBB B;  3I70 A;  1RJT A;  5IYC H;  4LUV A;  4IUR A;  4LAA A;  2JA5 H;  1CSP A;  1A0I A;  1CZG A;  3NHH A;  4DUZ Q;  3M9B A;  1HNW Q;  1BXT A;  3T4A C;  1VQO A;  3OIP A;  3MEF A;  4O1N A;  2A74 C;  4A3C G;  3I4M G;  4HCE A;  1XMO L;  1AZP A;  2KED A;  5G3L F;  3JAM c;  3H0G G;  4HCS A;  2QGQ A;  2HDL A;  2WIN B;  4XTC S;  5C4X B;  2Q8T A;  1P16 A;  4JG2 A;  2UU9 L;  3EVQ A;  3AFQ A;  2KBN A;  3BZK A;  1W6J A;  4APV A;  1EIG A;  1TS3 A;  2L4N A;  2N55 A;  3L3O C;  4RCN A;  2B2U A;  5J39 A;  3CPF A;  3VR2 A;  2IWH A;  1G6P A;  2F0O A;  2N3S A;  1Y8N B;  4JOI C;  1FNU A;  4O0A A;  3PUW A;  4K8I A;  4IFD G;  1TY2 A;  1KD1 C;  1FJG Q;  2Q2H A;  1IXR A;  3PO2 G;  1QIL A;  4DV0 Q;  3TN2 A;  2OT2 A;  1HR0 W;  4NKL A;  1C7Y A;  5C4X H;  5COR A;  3FVQ A;  1RTN A;  4LF9 L;  1XMQ L;  4KN7 C;  2HIV A;  1VMC A;  4FF4 A;  1SEB D;  5JJK A;  1MGS A;  1AEX A;  3OMG A;  1X56 A;  2RQX A;  3OTO Q;  3A56 A;  1HXY D;  3NWS A;  2XRQ D;  2WB1 B;  1VCI A;  2R7D A;  4EQN A;  1WD0 A;  5T1G A;  4YWL A;  2F0P A;  4KHZ A;  4IOA A;  3GQB A;  4AQY L;  1KAW A;  1EY4 A;  4A3F B;  1L1O B;  4A3L H;  3C3L A;  1YNN C;  2MQH A;  4DR5 L;  4OWX B;  3BYY B;  3KBG A;  2F0H A;  4C3I G;  5EPK A;  1S4Z A;  3HKS A;  4IN3 A;  4R4C A;  2B2W A;  3KF6 A;  3RUZ A;  2B8G A;  4HID A;  1BQQ T;  1YBY A;  1JJ2 A;  1JQY D;  3FHW A;  4R4T A;  1HNZ L;  3KYH C;  2Z8L A;  1I4Q A;  1BCP C;  3J81 i;  3GD7 A;  1PH3 A;  1I5F A;  5L37 A;  3FKI B;  3S9W A;  3S17 B;  4OEM B;  4QIW B;  5EJW A;  3V96 A;  3MC0 B;  3QB3 A;  2A6H C;  4V19 0;  3MXN A;  1RD9 D;  2JA7 B;  5FJ8 G;  4A3F H;  3JAM E;  3TP6 A;  1PH1 A;  1FYC A;  1UAP A;  3KLR A;  3ZYY X;  3RLN A;  3LGJ A;  2UXC L;  1EEI D;  2NVY B;  1TKW B;  1LTI D;  2RKS A;  2E2H B;  5C0X H;  2HT1 A;  1A3V A;  1D6E C;  2ZXO A;  1WTW A;  3SE0 A;  1CKM A;  3E5S A;  5JEA H;  1SMY C;  4JI7 Q;  2F0E A;  4NPS A;  2NZ1 D;  2QDB A;  1EIY B;  3FKI H;  5GAD C;  3S17 H;  2EYO A;  2IHE A;  2NZH A;  1IBL Q;  1IZ6 A;  2I5H A;  1H9S A;  5M9O A;  2JA7 H;  2F1M A;  4B9W A;  4DPG A;  4IPD A;  3EJI A;  1DCZ A;  3I3C A;  5ELE A;  4DV3 Q;  2JE6 I;  4R8N A;  4B3M Q;  2NVY H;  2A6E C;  5IYD G;  2OTL A;  1V1P A;  4LWC A;  1II3 A;  2MO0 A;  4DR7 L;  3J81 j;  4IPH A;  2E2H H;  1J6Q A;  2PQE A;  1CI3 M;  4XIG S;  2VQE Q;  1Z7T A;  3KF8 B;  5CV9 A;  2EYH A;  5JEA J;  3PUY A;  1EOT A;  3CXC A;  1B3Q A;  4EGV A;  3I4N G;  1QCB D;  3AYH B;  2EYJ A;  4R4O A;  1VQK A;  1EQT A;  3MEH A;  4A76 A;  1N34 Q;  4A3G B;  1ZKO A;  3ERS X;  3TSS A;  3MXP A;  1RCV D;  3TP7 A;  4OX9 Q;  3NP8 A;  2L12 A;  4DV4 L;  1S5F D;  3UE0 A;  1W6K A;  1SRU A;  2XWJ B;  5ELC A;  4DK1 A;  5EPJ A;  1YHA A;  3Q0A A;  3CC7 A;  2HUG A;  1XNQ Q;  2VS1 A;  3A54 A;  3L0O A;  1XNR L;  5FLX L;  1SSO A;  3GTG B;  4Y52 H;  4FF2 A;  2M00 A;  3CRK C;  1SNM A;  2IJ0 A;  2PCF B;  4GLV B;  4DXF A;  1VQB A;  3RLF A;  3K81 C;  1PRT B;  4DUZ L;  5DM7 3;  4Y7N B;  4A3G H;  1FNW A;  4RFB A;  1M90 C;  4A3D B;  5C44 B;  2B63 G;  4WJ3 M;  5C5M A;  1CQF A;  1SAP A;  1N33 L;  3QG1 A;  3A8J E;  5E3F A;  3J7A V;  2KHS A;  3ITP A;  5IP7 G;  4IQZ A;  3GTG H;  1LTA D;  4P75 A;  3FDT A;  5KNC A;  2CHB D;  3W2D A;  1JE4 A;  5EAY A;  3KK7 A;  3DLL A;  3HKZ B;  3SGI A;  1O78 A;  3CMA A;  1FGB D;  4KD4 A;  1PZK D;  2NVT B;  4Y7N H;  1EY9 A;  1IBK Q;  1G91 A;  4HAE A;  4A3D H;  5C44 H;  1NE3 A;  1FJG L;  4KKU A;  3HOV G;  1QNK A;  1EWI A;  1AW7 A;  2L11 A;  5COY A;  1LAB A;  2UXB Q;  2WII B;  1L1O C;  2FFK B;  4DV0 L;  2WV6 D;  2ZXP A;  1RIP A;  4KV6 A;  1D1I A;  2CWP A;  1V9P A;  3NE5 B;  1BOS A;  1TWG B;  4EQP A;  3M7N A;  2SNS A;  4CJ2 C;  4DV1 Q;  1KLU D;  3I4M B;  2Y0S E;  1STY A;  3H0G B;  1CHP D;  2K50 A;  3K7A B;  1PHJ A;  1WJJ A;  2O2L D;  2NVT H;  2EOT A;  4DUY Q;  3NBH B;  1CKN A;  4O2D A;  1O7Y A;  3CCS A;  5LMN L;  4HJ7 A;  3D8G A;  3G48 A;  3H91 A;  4DU9 A;  1QVF A;  1Q46 A;  1VF7 A;  1GUS A;  3UI2 A;  4I7A A;  1SNO A;  4P74 A;  5IIF A;  2AUK A;  1HA6 A;  1EY8 A;  4A3C H;  2EDG A;  3I4M H;  2PNR C;  1C4Q A;  4DAP A;  4JW0 A;  3PO2 B;  1SYE A;  1A2U A;  3H0G H;  4J6H A;  1UUP A;  1TS2 A;  3K7A H;  1UE6 A;  4XYO A;  1EY0 A;  3NEL A;  4ALP A;  1IBM Q;  2AQ2 B;  3R2I A;  3Q8D A;  2YTY A;  2WAQ E;  2HQE A;  5IGB A;  1XTD A;  2BA0 A;  4HR7 B;  3T16 A;  1J5E Q;  1VQA A;  4KHP Q;  4Q5V A;  4EVO A;  3OMC A;  2PQA A;  4DR1 L;  4X3K A;  3KF6 B;  4IPG A;  4N8F A;  4DAM A;  3F2C A;  3KUP A;  1K8O A;  2CQO A;  3HOW G;  1JB3 A;  4K14 A;  1I6V C;  3PIO 3;  1SE8 A;  2DUD A;  4C3H G;  4IFD H;  2XN9 C;  1G6Z A;  4K0K Q;  5I2Y A;  2OTJ A;  2E75 C;  3PO2 H;  4UP9 A;  4JI7 L;  2P5Z X;  1E7Z A;  4AYB E;  4P71 A;  3BDL A;  3MXN B;  1PH6 A;  4X66 Q;  3ERQ A;  1LT4 D;  2B3G A;  4C3I B;  1ILQ A;  1NSN S;  1TWH B;  2HD3 A;  1EYC A;  4HJ8 A;  4KJO A;  1EQV A;  3PF4 A;  4XT1 B;  2EPB A;  2A69 D;  2CQA A;  3SK4 A;  4DV3 L;  4LF8 Q;  1PH2 A;  2CW0 D;  4B3M L;  4G4K A;  1FNV A;  1SRO A;  3VA5 A;  4RKB A;  2A68 C;  4KI0 A;  1UE5 A;  3H3V C;  4BA2 I;  4GS3 A;  2JJQ A;  4IFD J;  1STB A;  5IYB G;  1WTO A;  4OL7 A;  3H09 A;  2QEJ C;  4G7H C;  2VQE L;  1BO0 A;  2E8G A;  4XQQ A;  3PMF A;  1SR3 A;  5J22 A;  3BZC A;  1MD2 D;  4TRD A;  1H9S B;  1FL0 A;  3NQT A;  3I72 A;  1LTS D;  4C3I H;  3F2B A;  2C5C A;  2FXQ A;  1QG7 A;  1LTG D;  1STE A;  2JEB I;  1UE1 A;  1P8L A;  1V1P B;  2KCT A;  3HOU G;  4C1N K;  5GAE C;  2G5D A;  2K5H A;  4ZKB B;  2PYK A;  1HPC A;  4LF7 Q;  1EYA A;  1A62 A;  4LF9 Q;  3A5Z B;  1B4O A;  4CDE C;  1XNQ L;  2NVX B;  3P20 A;  2SOB A;  4DN4 M;  1PYW D;  4E6I A;  3PIO A;  2EY1 A;  4DV5 Q;  1GUW A;  2PNH A;  4A4I A;  3CAM A;  1IYV A;  1X9N A;  5FJ8 H;  2AUJ D;  1X32 A;  4BXX G;  1PYB A;  4CKB A;  3CKI B;  2QDL A;  2NBF A;  2D5D A;  1HNX L;  4MTK A;  1GM5 A;  1FD7 D;  3S16 B;  1KDC A;  1PMR A;  3GTP B;  4ZRZ A;  4ZUI A;  2HHH L;  1Q81 C;  1K8M A;  4GKJ Q;  2B29 A;  2VL6 A;  3GTM B;  4WFN 3;  1W3S A;  5EPL A;  4DR5 Q;  5FOB B;  4QJF A;  4HMI A;  1IW7 C;  4RG1 A;  3I4N B;  2NVX H;  4B08 A;  2B2U C;  3PIP 3;  1QOH A;  5BN3 A;  3L2P A;  2F0F A;  3AB9 A;  2OWO A;  3C1F A;  1DOL A;  3ER0 A;  3SVM A;  4KY7 A;  2ASB A;  4KY6 A;  5C4H A;  1K0R A;  5A2Q E;  1MHW C;  3HG9 A;  4OGQ C;  1PLF A;  3CW2 C;  1Y14 B;  4A3E G;  3ULP A;  1ESR A;  4KD3 A;  4RGM A;  4A75 A;  4DR2 Q;  5DM6 3;  1RF2 D;  4JK1 C;  1IBK L;  3S16 H;  2F4I A;  2XNA C;  1VMP A;  1TY0 A;  4FDB A;  4A3I G;  4UP7 A;  4JCV E;  2UXB L;  4DF7 A;  1DOM A;  3GTM H;  2RHQ B;  3Q24 A;  4M1U B;  4C3J G;  1N32 Q;  1M1K C;  2B39 A;  3JC6 6;  2L55 A;  4OO1 I;  3CC4 A;  2RSO A;  2D62 A;  5FO9 B;  2NTT A;  1TWF B;  2K28 A;  2SEB D;  1EZ8 A;  5IGD A;  2BH8 A;  5LMN W;  3M4O B;  4JI2 Q;  1JOQ A;  2BE5 C;  3A74 A;  3AQQ A;  1XWE A;  2B63 B;  1HZ9 A;  3FMC A;  2L1B A;  4A3J G;  5KIX A;  5IE8 A;  1C48 A;  1ZXT A;  2NZO A;  1Y69 U;  1BBX C;  1PTO C;  4ZKC B;  4DUY L;  1KL9 A;  3D6C A;  5AJ3 L;  1JWM D;  4R9W A;  1ESF A;  2VNU D;  4BS9 A;  3SXH A;  1MJC A;  3S14 B;  4F8M A;  3S15 B;  4LK1 C;  1TWF H;  1KQS A;  3M4P A;  2HCC A;  1VQJ A;  2MFI A;  3TZD A;  3M4O H;  4RWS C;  3PIP A;  1EU3 A;  3QR8 A;  4DNR B;  4WJW A;  2B63 H;  4KLK A;  3KBX A;  5I6W A;  3HOV B;  5E4W C;  2SNM A;  2QCP X;  3KLS X;  3BYT B;  4LF4 Q;  1SND A;  1CKN B;  4N9T A;  1X3Q A;  1SXT A;  1IBM L;  3D4R A;  3J80 c;  1WYD A;  5IP7 H;  1GOZ A;  1I4G A;  3K0X A;  4K6D A;  1I3Q B;  4GLX A;  2BCO A;  3BJU A;  4FO2 A;  3SEB A;  1I4P A;  5M5X B;  1J5E L;  4H13 C;  2R92 G;  4KHP L;  2K5D A;  4ZUJ A;  1XJV A;  4DV4 Q;  1HFG A;  1S40 A;  3S14 H;  3S15 H;  1ILP A;  2F03 A;  1ICW A;  2E2D C;  3S1Q H;  1VDZ A;  1SYG A;  2PMZ E;  2E74 C;  4GOP C;  5GQO A;  2D2C C;  1JR0 D;  1GUN A;  1Z9F A;  2XIW A;  2RHS B;  4MHE A;  1O7L A;  1PH4 A;  1PVO A;  3UDI A;  4K0K L;  3HOV H;  2IY5 B;  1WTR A;  4JC0 A;  2DNC A;  2VB2 X;  3RN2 A;  1K83 B;  3J80 L;  4X66 L;  3DEP A;  3QWN A;  4FXK C;  5JJL A;  1D1K A;  1TVX A;  5CV4 A;  1NJI C;  2FMC A;  1PZI D;  2K14 A;  2PQA B;  1I4X A;  1I3Q H;  1WOC A;  4I7Z C;  4TVA B;  5M5X H;  5CC4 A;  1VQE A;  4ILW A;  1YNJ D;  1N33 Q;  3MZ5 A;  3CCJ A;  3DM1 A;  4LF8 L;  4JPB W;  4WJ4 A;  1B2T A;  3UE1 A;  2F0K A;  2UUB Q;  4AH6 A;  3LNN A;  2QW7 A;  1ZYR C;  2F0D A;  2RVL A;  2ZTE A;  4KHV A;  1E2V A;  2JK8 A;  1H9K A;  2F0J A;  5C6A A;  1VS0 A;  2NVQ B;  3I56 A;  1KNA A;  1K83 H;  4CKC A;  3T1H Q;  1SE2 A;  3EN2 A;  1PTO F;  1M8A A;  4DAY A;  3HOW B;  2LS0 1;  1ASZ A;  1HJP A;  2D9U A;  1Q12 A;  2R7F A;  1WTH A;  4C3H B;  1VQM A;  4OON A;  1LM0 A;  4JI4 Q;  1TS4 A;  4GNX B;  2GVB A;  5ELB A;  3J7A 5;  3D0F A;  1EQQ A;  2I5L X;  1ROD A;  4IUP A;  3NBH A;  2AKW B;  4RH6 A;  1E0B A;  3NEN A;  1CA5 A;  1TII D;  4LF7 L;  4NMZ A;  1R9T B;  3AU7 A;  1JJG A;  3PF5 A;  4LFC L;  2LXJ A;  2F0N A;  2ICE C;  4RHR A;  2ZM6 Q;  4JI0 Q;  4DV5 L;  3I7F A;  1JOO A;  3D4D A;  3J7A F;  4TQU S;  2PZT A;  3QOL A;  2NVQ H;  4EQO A;  3G6E A;  1A8V A;  1AN8 A;  1SE4 A;  4ZCK A;  3J80 E;  3HOW H;  1Q86 C;  4B3S L;  4K6L A;  4NB3 A;  1L0W A;  1E3P A;  4C3H H;  1Q82 C;  4OWT B;  3C46 A;  4LFB L;  5LMN Q;  1CT1 D;  1F9R A;  4DK3 C;  1S5B D;  5JVH 3;  4GKJ L;  1KRT A;  1STG A;  4J15 A;  3TDQ A;  5E7N A;  1VQC A;  5JJZ A;  3ND9 A;  3VYS A;  4BBR G;  2M2L A;  1GUO A;  3ULL A;  1R9T H;  2N8N A;  1F2M A;  3HS0 C;  1V1O A;  3TS2 A;  2IX3 A;  2RDF A;  1XX8 A;  4R8I A;  3HOU B;  1OXV A;  4LMQ D;  2MUY A;  3AMU A;  4DR2 L;  5HUR A;  4K5V A;  1GKH A;  2F0V A;  5IYB H;  1QWY A;  4HED A;  4YWK A;  1UNS A;  4DR6 Q;  3K80 C;  1O80 A;  2ENB A;  1N32 L;  4OWW B;  4DR1 Q;  4LF5 L;  3F8T A;  2PI2 E;  3QIA A;  4I65 A;  4G7O C;  2VB3 X;  1EQR A;  4L5T A;  1EZ6 A;  4JI2 L;  3K7U C;  3HOX G;  4X6A H;  2ATW A;  4GOP A;  3P75 A;  4ME5 A;  2M9V A;  5A35 A;  3HOU H;  1G51 A;  5EKL A;  2A1A A;  5C5L A;  4NXN Q;  3M85 A;  2Z0S A;  4IUQ A;  5EBD A;  1EUJ A;  5JPM C;  2K32 A;  1EWC A;  2BA1 A;  2WKC A;  1TWA B;  4DR3 Q;  4B9X A;  3D6W A;  3IKJ A;  1LUZ A;  2Y0S G;  1LV9 A;  3NWT A;  4BY1 G;  2RCF A;  3A55 A;  1BUV T;  2LXK A;  4BXX H;  1NBW A;  3E0E A;  2K52 A;  4POG A;  4A3E B;  4CBV A;  1A15 A;  3F2D A;  1Q8I A;  4L8J A;  2YU9 B;  5FLX c;  1JE5 A;  3LX0 A;  5FLM G;  1LLR D;  5K5P A;  4A3I B;  4KK7 A;  2A8V A;  4BBS G;  2B2Y C;  2MO1 A;  4P2C B;  4PMC A;  4C3J B;  4LF4 L;  3SDZ A;  3RZD B;  2Z1C A;  2EYF A;  1F9P A;  1Z6H A;  3U9O A;  1N8R C;  4QQB X;  5D3I B;  4L63 B;  5KYI A;  4DNT B;  3BVG A;  3J7Y W;  3S1N B;  5EKK A;  3C2P A;  4DA2 A;  2PW7 A;  3D31 A;  5F2D A;  1I6H B;  2KA7 A;  3OWF A;  2CH4 A;  4A3J B;  4A3E H;  5IGE A;  2YU9 H;  4RMF A;  3RN5 A;  2WAQ G;  1L2F A;  4A3I H;  1BR9 A;  5IP9 G;  4C3J H;  1STN A;  3RZD H;  4JI8 L;  3A5U A;  2ES2 A;  3TRZ A;  3OPO A;  5M3M G;  1RTO A;  3FRP B;  2E5L Q;  3KJO A;  1HNX Q;  3S1M B;  3IFD A;  5CMD A;  4IUN A;  2FMM A;  3S1N H;  1C9O A;  1PH8 A;  4GNX C;  2HHH Q;  3SK6 A;  1FR3 A;  4UPA A;  2TSS A;  1EFI D;  2XVS A;  1I6H H;  2B2T A;  4AYB G;  4A3J H;  3TP8 A;  1TT2 A;  3IRB A;  2UUB L;  1JC7 A;  2F0L A;  3H3V H;  4JYA Q;  1K28 A;  2YTV A;  1XYI A;  4DV7 Q;  2ID0 A;  2ZTD A;  1A3U A;  2R92 B;  2LY7 A;  3MTS A;  3W3A A;  1CSQ A;  4Z9C B;  1BF4 A;  3T1H L;  2KOL A;  2NWG A;  5KNB A;  1SNQ A;  3UDF A;  3S1M H;  2QEX A;  1SLJ A;  1JCK B;  1B8A A;  1GHJ A;  3PV0 A;  4P73 A;  2VZA A;  1I4R A;  4JI4 L;  1QZG A;  1JJC B;  2AQ3 B;  3J81 L;  1PFB A;  2F3I A;  4OEL B;  1LTT D;  4L5Q A;  4QUC A;  4UAI A;  3L7Z C;  1SDF A;  1JOR A;  3T51 B;  2ZM6 L;  5FLX E;  1PXU A;  4JI0 L;  2EJG C;  2KCN A;  1VQG A;  4QCL A;  2IHF A;  2R92 H;  3OOC A;  4DAY B;  2DJF C;  2UUC Q;  2PZW A;  4LJZ C;  2VY3 A;  2RCN A;  3TRE A;  5IOD A;  4A3M G;  1HRJ A;  2JA5 G;  4YCW A;  4S3S A;  2K1B A;  2QIL A;  2WFW A;  5I9P A;  5BN4 A;  5ELD A;  5AJ3 Q;  1C8C A;  4F88 A;  1V1Q A;  3B6Y A;  1LT6 D;  5JOB A;  2F0W A;  5ELO A;  4H0L C;  3EIV A;  1HFN A;  2KVM A;  1STH A;  1SN8 A;  3PGZ A;  1EU4 A;  3RR5 A;  4ME3 A;  4HJ5 A;  3BS1 A;  3R2T A;  1TWG H;  4FP5 D;  2KUM A;  5CV8 A;  5HY6 A;  3PCO B;  3IFT A;  4DV2 Q;  4ZQ3 A;  1E1O A;  3W1B A;  2GVA A;  1H9M A;  1NNX A;  3S24 A;  1G29 1;  1YI2 A;  1YVC A;  1PTO B;  4HIO A;  1GD7 A;  2K5N A;  2B2Y A;  1F9Q A;  4IPC A;  5GRO A;  2FIN B;  4JBJ A;  2OQ0 A;  4DR6 L;  5DEH A;  3HZX A;  4IAL A;  2R7Z G;  3GV6 A;  1LTR D;  2D0P A;  2ZXR A;  2IX1 A;  1IKL A;  1JOK A;  2VXW A;  3G6J B;  4QB4 A;  3U4V A;  4DV6 Q;  1D2B A;  2EJF C;  1NCV A;  1AZQ A;  5E4X A;  2A69 C;  1E2Z A;  4C2M B;  4ZYS A;  1E2W A;  1J9O A;  2I5M X;  4NXN L;  1KLG D;  4BBR B;  4Q0F A;  5C0X I;  1PTO H;  4PV1 C;  2RBM A;  3F1Z A;  2B2V C;  4GLA C;  1HZA A;  3MA2 B;  3ERO A;  5DAU A;  5TSS A;  4DR3 L;  3MHB A;  1CKO A;  3T13 A;  2L9H A;  4FYD A;  4MNO A;  3HFZ B;  1VQN A;  2BDN A;  5CV6 A;  4HJA A;  2OXP A;  4GNX A;  2AWN A;  2Z6K A;  4FF3 A;  3TS0 A;  2R3Z A;  4KKT A;  2EY6 A;  3CRL C;  4GOP B;  1VQ5 A;  1CFM A;  1E22 A;  2G9D A;  4NW2 A;  3ND8 A;  5JPN C;  2EE1 A;  3Q23 A;  4QL5 A;  1PH7 A;  3W5O A;  4PMW A;  4C2M H;  4UHV A;  3P1H A;  4GN4 B;  4BBR H;  1CTM A;  2D0O A;  1YHB A;  5H1S E;  5I4D A;  4F87 A;  3A8K E;  2EYM A;  1S5C D;  1TWH H;  1YZ6 A;  3PUX A;  3GV3 A;  2Q2I A;  4BWG B;  1MKH A;  4PMB A;  2DJG C;  1WCM G;  3HOX B;  3I55 A;  5ELN A;  3UDG A;  1OXU A;  1Q7Y C;  3CCR A;  5CR3 A;  3BDO A;  4R4I A;  4QY7 A;  4LFC Q;  1NTG A;  1F2Z A;  2SDF A;  2BOS A;  3K59 A;  1YJ9 A;  3CCQ A;  1O7I A;  3RMH A;  3DWA A;  5IOC A;  4IUV A;  2KQ3 A;  3A8I E;  5C0X G;  2Y0S B;  1BNZ A;  4BY1 B;  5ISR A;  2F3W A;  2ZJR A;  2KHJ A;  1VQD A;  1A6X A;  2E5L L;  4B3S Q;  2H4O A;  3K6O A;  1PRT D;  3DHQ A;  1IHZ A;  1E24 A;  3NPP A;  3CF5 A;  2BH2 A;  3EQL C;  1M4V A;  4A3K G;  1XTC D;  4LFB Q;  2HDM A;  2L5T A;  3HOX H;  4FXD A;  4L5R C;  2JA9 A;  4BBS B;  3D4W A;  4PNY A;  4FXG C;  1OTC A;  1S5D D;  4X65 Q;  3CPW A;  2QF7 A;  2L0C A;  3ONA B;  1AE2 A;  1FVI A;  1CK1 A;  4JYA L;  1UWV A;  5CBE E;  4DV7 L;  1EWH A;  1ICF B;  4ID6 A;  1HUN A;  1Z47 A;  4KJN A;  4WRD A;  5IGC A;  4CDF C;  1RL2 A;  4BY1 H;  1LYL A;  4LW1 A;  2F0Q A;  1CZW A;  4C1N I;  4LUZ A;  3DUZ A;  2NUC A;  1D5X C;  4CKE A;  5IYD H;  5JVG 3;  4X3S A;  5LMU L;  2EXD A;  4UDU C;  2VW9 A;  3GTP H;  4JI1 Q;  1R4Q B;  1EY5 A;  2WAQ B;  1Y1W G;  2K5V A;  1TU2 B;  1WI5 A;  1K8G A;  5FLM H;  4BBS H;  1KDB A;  3URY A;  3S1R B;  2KCC A;  4PQX A;  4LF5 Q;  1BBW A;  4U68 A;  1T5X D;  1TXY A;  3I4N H;  1NMG A;  2N49 A;  5M3M B;  1HTL D;  2O4X A;  1X55 A;  4IJH A;  3JAM i;  4LNQ A;  1KAB A;  3VDY A;  3FP9 A;  5DNF A;  4CJ1 B;  4B3R L;  1IW7 D;  1NMF A;  2G9H D;  2E76 C;  3EBE A;  2WP8 J;  3D3R A;  2I07 B;  1Q1E A;  3PO3 G;  1L0X B;  2UUC L;  1N36 Q;  3V05 A;  4AYB B;  2QA4 A;  1D5Z C;  4EX5 A;  5BN5 A;  1F77 A;  1LTB D;  2EQS A;  3VYR A;  1IKM A;  2B2V A;  3MXG A;  4HIM A;  4G7Z C;  4G57 A;  5IP9 H;  2AQ1 B;  2Q8R E;  3S1R H;  2DGY A;  4QF4 A;  4RAU C;  3HOY G;  1B70 B;  4DFA A;  3K5O A;  1SYC A;  2WB1 E;  4RGO S;  2Q8I B;  5G3L D;  1PFM A;  4JV5 L;  1GXD C;  1DD2 A;  1U4L A;  3DWP A;  1J8I A;  2C9O A;  4DV2 L;  1B9N A;  3CCV A;  5KYL A;  4IJL A;  4X62 Q;  4EQ5 A;  4KY5 A;  1HQR D;  2KHI A;  3FPU B;  1QUQ A;  2WAC A;  1DON A;  1RHP A;  2OEO A;  2K03 A;  4HSV A;  5D65 A;  2CFM A;  3UDX A;  1D8L A;  4OO1 G;  3W1G A;  3KOJ A;  1SFO B;  5CV7 A;  3CU7 A;  3KFU A;  1B50 A;  4JI5 L;  4DV6 L;  4A3M B;  4PG3 A;  2JA5 B;  2AMC B;  5IWA Q;  3X3M A;  3GTL B;  3PQI A;  2CKZ B;  4QIW E;  4TSS A;  1NR2 A;  4FNF A;  3T1Y Q;  4J1M A;  2UUA L;  4YWM A;  3STB D;  4UP8 A;  5JAV A;  1AE3 A;  1KNE A;  4JI8 Q;  1GHK A;  4ZAI A;  5KEE A;  3U9S A;  3VR5 A;  2J7Z A;  3I8Z A;  3GO5 A;  1VQP A;  1N9W A;  2Z9H A;  2RSN A;  2EY5 A;  3N6R A;  4H7B A;  5M3F G;  2F4V Q;  1YJN A;  5M5Y B;  3H94 A;  1GO3 E;  4H02 A;  3HOZ G;  1SFO H;  5KND A;  4CGY B;  3HGB A;  4V0B A;  1VQ7 A;  4POF A;  2A19 A;  4A3M H;  4OIK A;  1WTP A;  3GTL H;  1UE7 A;  3MAQ A;  2EYL A;  3KDF A;  4JI3 L;  1S5E D;  4FF1 A;  2PI2 A;  2JSO A;  3CME A;  4RGN A;  4R4Q A;  1U5K A;  2R7Z B;  3QOJ A;  4TKO B;  2UXD L;  4LFA Q;  4HTH A;  5C3E G;  1ONL A;  4NXM L;  3FPP A;  3I91 A;  3Q6S A;  3K5L A;  1CUK A;  5M5Y H;  3HEJ A;  5E1F A;  3E9H A;  5ELF A;  4JVZ A;  1OXX K;  1CA6 A;  5J3B A;  1V43 A;  1O7Z A;  1NR4 A;  3CHB D;  5EGT A;  4JI6 L;  5I6Y A;  2V1C C;  3EFX D;  3PSI A;  2KEC A;  4YY3 Q;  3H15 A;  3I90 A;  4PZ8 A;  1ZYR D;  4IO9 A;  4P72 A;  4JBM A;  3VA7 A;  2R7Z H;  3JAM L;  1U0L A;  4B3T L;  1XXG A;  1EL0 A;  1X3G A;  4GZY C;  4C56 C;  2K5Q A;  1TQO A;  4M8A A;  1F9S A;  2B2T C;  1HA5 A;  2X69 A;  3DXJ C;  5FO7 B;  3S2H B;  5IT9 c;  1ZEQ X;  5IGF A;  2JA6 G;  4WOR A;  2DY8 A;  1MSG A;  2F0T A;  1SNC A;  4ODG A;  4X65 L;  2LMC B;  1K8A C;  2K4K A;  5BR8 Q;  4PZ7 A;  3BZD B;  2NN6 I;  2ALY B;  1MIU A;  4CHT B;  2R93 G;  2WKD A;  2RDH A;  1WCM B;  1YHQ A;  5FO8 B;  2ICI A;  1PZJ D;  2H5X A;  1SYD A;  1I94 L;  3SHL A;  2Z6B A;  3S2H H;  3I4O A;  1VQI A;  5IT9 L;  1YNX A;  3NBI A;  1T9H A;  4JI1 L;  2I46 A;  4LF6 Q;  3KLW A;  1X3E A;  1X54 A;  5C4J B;  4RKL A;  2JN4 A;  5C3W A;  2K7V A;  5M5W B;  1PH9 A;  2PMZ B;  1B7Y B;  1Q3L A;  2DY7 A;  4RGT A;  1C0A A;  3U58 A;  2PW5 A;  2E2J B;  3HKZ E;  1YNN D;  2K6A A;  4DKA C;  3KLS A;  3DMU A;  4QGU A;  1A3T A;  5T1I A;  1WCM H;  4A3K B;  3BG3 A;  3CCU A;  2CCZ A;  1ASY A;  1N36 L;  2OF1 A;  2MNA A;  1XPO A;  3OWE B;  2DNE A;  1JMC A;  1BCP D;  5D14 A;  4ZLT F;  1K3R A;  2PZU A;  5I2X A;  4OHJ A;  3HRZ C;  1H95 A;  3NQI A;  1HZC A;  3CCE A;  3P7J A;  3RNU A;  5C4J H;  2F0M A;  3M7G A;  1JWU D;  2RDG A;  2A6H D;  4OIJ A;  5M5W H;  2I0Q A;  4A3B G;  3GTQ B;  2NN6 G;  2E2J H;  3RZO B;  2HQL A;  2F0G A;  1JB7 A;  2ZJQ A;  4BA1 I;  3OW2 A;  4YCV A;  1ET6 A;  3MWY W;  4A3K H;  5K36 G;  3NUC A;  4X64 L;  1KHI A;  1Y1W B;  3PUZ A;  1G2S A;  1PDQ A;  2EIF A;  4X62 L;  4KMU C;  1EEF D;  1I4H A;  2B8F A;  1ET9 A;  1SMY D;  2F0I A;  5LHY 1;  3K58 A;  1TWA H;  2F52 A;  1S72 A;  1WTQ A;  5IT9 E;  1YEZ A;  3I4L A;  4HSP A;  4XT3 B;  3E9I A;  1LT5 D;  2K01 A;  3M3Y B;  2RA4 A;  3LWU A;  5C0X J;  1JWS D;  1QVC A;  3PO3 B;  4HMJ A;  3GTQ H;  1KTK A;  3RZO H;  2PO4 A;  3NK9 A;  5GAG C;  1X3P A;  5IWA L;  2A6E D;  1HTP A;  4XXE A;  4CJ0 B;  4BY7 G;  3OW7 A;  1BVS A;  3NSW A;  2F0S A;  3DM3 A;  4CDD C;  2EJM A;  1Y1W H;  3T1Y L;  1QUQ B;  2EVB A;  2L15 A;  4YIJ A;  4JOI A;  3AFP A;  1Q8K A;  2N78 A;  2KCM A;  3HOY B;  1XPU A;  3S2D B;  1B53 A;  3RD4 A;  1HCZ A;  1K73 C;  2HCI A;  2J0T D;  2JYO A;  2V4D A;  2Z6K C;  3M3Y H;  3I73 A;  2F4V L;  4QUF A;  4YCU A;  3L9A X;  3J81 c;  1IYU A;  3PO3 H;  5CBA E;  2X6L A;  1CM9 A;  2JA8 G;  1BCP F;  3R8B A;  4ZK9 B;  4HJ9 A;  1HR0 Q;  1KAA A;  3DWQ A;  3ZJY C;  1HNW L;  2N88 A;  3NTI A;  1DGS A;  1CQV A;  2FJ2 A;  3TME A;  4N9P A;  1DJR D;  2H1E A;  3OSO A;  1VQ9 A;  3HOY H;  1X3F A;  4LFA L;  1F2L A;  4JBK A;  3S2D H;  4ABN A;  3ULJ A;  5LMU Q;  2KJX A;  4DAV A;  4OXP A;  1DZ1 A;  2K05 A;  4A93 G;  1EY7 A;  1Y1V G;  2F3V A;  2JP1 A;  3KDF B;  4HN7 A;  4IZ8 A;  3R93 A;  1BDO A;  1A63 A;  1ML0 D;  1PFS A;  3EA6 A;  4B3R Q;  4RA8 A;  4YY3 L;  2Z4H A;  2E2I B;  2KEE A;  4OO1 H;  5HGQ A;  5CV5 A;  2VUM G;  3NXW A;  5M3F B;  3VR6 A;  2KEN A;  1MSH A;  1ENA A;  3CD6 A;  3HOZ B;  1VF5 C;  2IW3 A;  2XRS D;  5DLQ E;  5IYC G;  2NB0 A;  1H9J A;  3VR4 A;  1WFQ A;  1EY6 A;  1WTV A;  4RCO A;  5CGK A;  5GAH C;  1MBY A;  2NTS A;  1LAC A;  3BDC A;  1JT8 A;  2XSC A;  1G2T A;  2K33 A;  3LWE A;  2BDO A;  1U9R A;  1HHV A;  1KRS A;  1IL8 A;  2RF4 A;  1U4R A;  3IAY A;  3OTO L;  1GUT A;  2OCE A;  3CC2 A;  2LKV A;  5C3X A;  5C3E B;  3V2T A;  5BR8 L;  1EIF A;  4O42 A;  4JV5 Q;  3RLO A;  4K2K A;  2K04 A;  1EYD A;  1W2B A;  2E2I H;  5C4Z A;  4XQN A;  5LL6 S;  5NUC A;  5M3F H;  3HOZ H;  3QJY A;  4DR4 Q;  1AFP A;  1RKN A;  1QNU A;  4KKS A;  1YJW A;  1CHQ D;  2JQO A;  5EQ0 A;  3TQY A;  1PFN A;  4DXG A;  4KN4 C;  3BU2 A;  2IL8 A;  1VQ8 A;  3FEW X;  3TEH B;  4LF6 L;  4R1J A;  3GP7 A;  4MIU A;  3CCL A;  5FKA C;  3KJP A;  3J81 E;  1KC8 C;  3SR1 A;  1PA6 A;  1TS5 A;  5C3E H;  4YHH Q;  3HP3 A;  1UEB A;  4JI5 Q;  4MTN A;  2PPB C;  3M4Y A;  4U67 3;  5C4X G;  3C1E A;  2C35 B;  3MXU A;  2VQF Q;  3K5N A;  3T56 B;  1YIT A;  1NAP A;  1ENC A;  3NTH A;  2UUA Q;  2JA6 B;  1SYF A;  4XDX A;  3WOF A;  2CW0 C;  1EIH A;  2LSS A;  3N52 A;  2NYZ D;  2IT1 A;  3I2Z A;  1K3B C;  1I50 B;  1SE3 A;  2X6G A;  2MJ8 A;  2R93 B;  1K9M C;  3DEO A;  5KRU A;  3H6M A;  4GKK Q;  4QMG A;  4X3T A;  4A3L G;  3T53 B;  1AH9 A;  4PZ6 A;  1QE6 A;  1D7Q A;  3IL8 A;  4FVM A;  1VQ4 A;  4JI3 Q;  4DK0 A;  1IBL L;  1GJX A;  3VR3 A;  2JA6 H;  1K0S A;  1OO9 B;  1QJO A;  1OXS C;  1KIX A;  1VQF A;  5HGT A;  1EYG A;  4XYQ A;  1XMO Q;  2UXD Q;  3J7Z C;  2WB1 G;  3K57 A;  4L6T B;  1I50 H;  1DOK A;  4N8X 1;  4NXM Q;  2QKI C;  3A7A B;  2UU9 Q;  2R93 H;  3E0J A;  5LL6 X;  3GTK B;  2R6G A;  3CP0 A;  1G8Z D;  4A3F G;  5A2Q L;  1EOV A;  1DXM A;  3OHX C;  4RHS A;  1OXT A;  1PRT C;  4JI6 Q;  1SJH D;  3MFY A;  4XQJ A;  1XPR A;  1U4M A;  2A68 D;  2K5W A;  1N34 L;  1BKB A;  2A73 B;  2CWA A;  2EYP A;  1JIC A;  1WTX A;  5I9O A;  1EFW A;  4B3T Q;  4OX9 L;  5JEA G;  5EKI A;  2EY2 A;  4A3B B;  4GN3 B;  1QZH A;  3FKI G;  1VQH A;  1LT3 D;  1Q90 A;  2MPM A;  3E3X A;  4NDX A;  3GTO B;  4ULL A;  1YIJ A;  4MN3 A;  1L1O A;  2CH4 W;  2O5J C;  3GTK H;  1XMQ Q;  3U50 C;  3J80 i;  1WVL A;  2JA7 G;  2JEA I;  1HH2 P;  2MHV A;  2MP1 A;  2F0U A;  2YV5 A;  3MFG A;  3SK5 A;  5IGG A;  2EZV A;  1DYQ A;  1VQ6 A;  3ICE A;  2XGT A;  1Y8P B;  1HR0 L;  3CQZ B;  3TZU A;  4K2L A;  1GUG A;  5AFW A;  1D5M C;  3BVZ A;  4IOC A;  1LTL A;  2LFN A;  3G71 A;  3GDE A;  2J4X A;  4DNI A;  2Z4I A;  3H3V I;  4AQY Q;  2YYZ A;  1U4P A;  4HIK A;  4A3B H;  1I94 Q;  3R3O A;  2NN6 H;  2Q2U A;  4UY8 C;  4NP5 A;  2R61 A;  3F2U A;  1E1T A;  2EXZ A;  3GTO H;  4H44 C;  1SNP A;  5EBC A;  3NTK A;  1SYB A;  2OQK A;  1HZB A;  5K36 H;  4BY7 B;  1L0Y B;  2CVR A;  3QO2 A;  4K5W A;  1KDA A;  1R4P B;  1PV4 A;  1HNZ Q;  3TP5 A;  1RDP D;  2IX0 A;  2ZJP A;  3TBI B;  1X6O A;  3AEV A;  4DK6 C;  2AHO B;  3OIQ A;  3CQZ H;  4J8Q A;  3WWV A;  5JJI A;  2K75 A;  1SMX A;  2O5I C;  2GA4 B;  4K8J A;  1A2T A;  1H9R A;  4JBW A;  3VYU A;  2JA8 B;  2Q2T A;  5D3D A;  2UXC Q;  1VQL A;  1Q1B A;  1X65 A;  1V8Q A;  2JXM B;  4BY7 H;  4A3G G;  1UEA B;  1STA A;  3OYY A;  1DM0 B;  1TWC B;  3PUV A;  4DV1 L;  4MZ9 A;  3G4S A;  5M3M H;  4IUU A;  1PRT F;  2XWB B;  1BCP B;  1FGU A;  1B3A A;  4LUO A;  1WD1 A;  3GTJ B;  3KF8 A;  4X64 Q;  1B44 D;  2DN8 A;  1QVG A;  4A93 B;  5IY0 A;  1Y1V B;  2BE5 D;  4DR4 L;  3M4Q A;  2FHT A;  3X3N A;  2ZT9 C;  3SK8 A;  1HUM A;  1B9M A;  3K5M A;  2B2W C;  2JA8 H;  3S1Q B;  3E6Z X;  1AP0 A;  4GN5 A;  5FK9 C;  1PTO D;  1TR5 A;  4DR7 Q;  1MI2 A;  3CCM A;  1MJE A;  4K5X A;  3Q22 A;  4A3D G;  5C44 G;  4DGZ A;  3STB C;  3K0Y A;  5CYU A;  4X3U A;  2VUM B;  1TWC H;  2GN5 A;  1IL2 A;  1LO5 D;  1NUC A;  3K8A A;  1GVP A;  3G7L A;  4YHH L;  2TMP A;  3O13 A;  2AWO A;  3A0J A;  3GTJ H;  4CDC C;  4AIM A;  2XTI A;  5J1Z A;  2VQF L;  1ENF A;  2MGS A;  4F7X A;  1SJE D;  4L5S A;  1PH5 A;  2A5H A; 
#chains in the Genus database with same CATH homology
 1QB5 D;  1YNJ C;  3BVM A;  3WDN A;  1Y8O B;  4IFD I;  1F2Y A;  3A7L A;  5KGU A;  3WOE A;  3MVV A;  4KTA A;  4IUT A;  1B1Z A;  3VYT A;  1T5E A;  1HQM C;  2IPK D;  1SBB B;  3I70 A;  1RJT A;  4IUR A;  4LAA A;  1CZG A;  3NHH A;  1BXT A;  3T4A C;  3OIP A;  4O1N A;  2A74 C;  4HCE A;  1AZP A;  2KED A;  5G3L F;  4HCS A;  2HDL A;  2WIN B;  4XTC S;  5C4X B;  2Q8T A;  3EVQ A;  1W6J A;  1EIG A;  1TS3 A;  2L4N A;  2N55 A;  3L3O C;  4RCN A;  2B2U A;  5J39 A;  3VR2 A;  2IWH A;  2F0O A;  1Y8N B;  1FNU A;  3PUW A;  4K8I A;  4IFD G;  1TY2 A;  1QIL A;  3TN2 A;  2OT2 A;  4NKL A;  5COR A;  3FVQ A;  1RTN A;  4KN7 C;  1VMC A;  4FF4 A;  1SEB D;  1MGS A;  1AEX A;  3OMG A;  2RQX A;  3A56 A;  1HXY D;  3NWS A;  2XRQ D;  2WB1 B;  1VCI A;  4EQN A;  1WD0 A;  5T1G A;  2F0P A;  4KHZ A;  3GQB A;  1EY4 A;  4A3F B;  3C3L A;  1YNN C;  3BYY B;  3KBG A;  2F0H A;  4C3I G;  5EPK A;  1S4Z A;  4IN3 A;  3RUZ A;  2B2W A;  2B8G A;  1BQQ T;  1JQY D;  2Z8L A;  1I4Q A;  1BCP C;  3GD7 A;  3FKI B;  3S9W A;  3S17 B;  4QIW B;  5EJW A;  3V96 A;  3MC0 B;  3QB3 A;  2A6H C;  4V19 0;  3MXN A;  1RD9 D;  2JA7 B;  3JAM E;  3TP6 A;  1FYC A;  1UAP A;  3KLR A;  3ZYY X;  1EEI D;  2NVY B;  1TKW B;  1LTI D;  2RKS A;  2E2H B;  5C0X H;  1A3V A;  1D6E C;  2ZXO A;  1WTW A;  3SE0 A;  3E5S A;  5JEA H;  1SMY C;  2F0E A;  2NZ1 D;  2QDB A;  2EYO A;  1H9S A;  5M9O A;  2F1M A;  4B9W A;  3EJI A;  1DCZ A;  3I3C A;  5ELE A;  2JE6 I;  4R8N A;  2A6E C;  1V1P A;  1II3 A;  2PQE A;  1CI3 M;  4XIG S;  1Z7T A;  5CV9 A;  5JEA J;  2EYH A;  3PUY A;  1EOT A;  4EGV A;  1QCB D;  2EYJ A;  1EQT A;  3MEH A;  4A3G B;  1ZKO A;  3TSS A;  3MXP A;  1RCV D;  3TP7 A;  3NP8 A;  2L12 A;  1S5F D;  1W6K A;  2XWJ B;  5ELC A;  4DK1 A;  5EPJ A;  3Q0A A;  2HUG A;  3A54 A;  5FLX L;  1SSO A;  3GTG B;  4FF2 A;  2M00 A;  3CRK C;  1SNM A;  2IJ0 A;  2PCF B;  4DXF A;  3RLF A;  1PRT B;  5DM7 3;  4Y7N B;  1FNW A;  4RFB A;  4A3D B;  5C44 B;  5C5M A;  1CQF A;  1SAP A;  3QG1 A;  3A8J E;  5E3F A;  3J7A V;  2KHS A;  3ITP A;  4IQZ A;  1LTA D;  3FDT A;  5KNC A;  2CHB D;  3W2D A;  1JE4 A;  3KK7 A;  3HKZ B;  1O78 A;  1FGB D;  4KD4 A;  1PZK D;  2NVT B;  1EY9 A;  1G91 A;  4HAE A;  4KKU A;  1QNK A;  1AW7 A;  2L11 A;  5COY A;  1LAB A;  2WII B;  2FFK B;  2WV6 D;  2ZXP A;  4KV6 A;  1D1I A;  3NE5 B;  1BOS A;  1TWG B;  4EQP A;  3M7N A;  2SNS A;  4CJ2 C;  1KLU D;  3I4M B;  1STY A;  3H0G B;  1CHP D;  3K7A B;  2O2L D;  2EOT A;  1O7Y A;  3D8G A;  3H91 A;  4DU9 A;  1VF7 A;  1GUS A;  3UI2 A;  1SNO A;  5IIF A;  2AUK A;  1HA6 A;  1EY8 A;  2EDG A;  2PNR C;  1C4Q A;  4DAP A;  3PO2 B;  1SYE A;  1A2U A;  4J6H A;  1UUP A;  1TS2 A;  4XYO A;  1EY0 A;  2AQ2 B;  3R2I A;  2HQE A;  5IGB A;  2BA0 A;  4HR7 B;  3T16 A;  4Q5V A;  4EVO A;  3OMC A;  4X3K A;  3KUP A;  1K8O A;  1JB3 A;  4K14 A;  1I6V C;  3PIO 3;  4C3H G;  4IFD H;  2XN9 C;  1G6Z A;  5I2Y A;  2E75 C;  3BDL A;  3ERQ A;  1LT4 D;  4C3I B;  1ILQ A;  1NSN S;  1TWH B;  1EYC A;  4KJO A;  1EQV A;  4XT1 B;  2EPB A;  2A69 D;  2CQA A;  3SK4 A;  2CW0 D;  4G4K A;  1FNV A;  3VA5 A;  4RKB A;  2A68 C;  4KI0 A;  3H3V C;  4BA2 I;  4IFD J;  1STB A;  1WTO A;  4OL7 A;  3H09 A;  2QEJ C;  4G7H C;  1BO0 A;  4XQQ A;  3PMF A;  5J22 A;  1MD2 D;  4TRD A;  1H9S B;  3NQT A;  3I72 A;  1LTS D;  2C5C A;  1QG7 A;  1LTG D;  1STE A;  2JEB I;  1V1P B;  4C1N K;  4ZKB B;  2PYK A;  1HPC A;  1EYA A;  1B4O A;  2NVX B;  3P20 A;  2SOB A;  4DN4 M;  1PYW D;  4E6I A;  2EY1 A;  1GUW A;  1IYV A;  2AUJ D;  1X32 A;  4CKB A;  3CKI B;  2NBF A;  2D5D A;  1FD7 D;  3S16 B;  1KDC A;  1PMR A;  3GTP B;  4ZRZ A;  4ZUI A;  1K8M A;  3GTM B;  4WFN 3;  5EPL A;  5FOB B;  4HMI A;  1IW7 C;  3I4N B;  4B08 A;  2B2U C;  3PIP 3;  1QOH A;  5BN3 A;  2F0F A;  3AB9 A;  3C1F A;  1DOL A;  3SVM A;  4KY7 A;  4KY6 A;  5C4H A;  5A2Q E;  3HG9 A;  4OGQ C;  1PLF A;  1ESR A;  4KD3 A;  4RGM A;  5DM6 3;  1RF2 D;  4JK1 C;  2F4I A;  2XNA C;  1VMP A;  1TY0 A;  4DF7 A;  1DOM A;  3Q24 A;  4M1U B;  4C3J G;  2B39 A;  2L55 A;  4OO1 I;  2RSO A;  2D62 A;  5FO9 B;  2NTT A;  1TWF B;  2K28 A;  2SEB D;  1EZ8 A;  5IGD A;  3M4O B;  1JOQ A;  2BE5 C;  1XWE A;  2B63 B;  3FMC A;  2L1B A;  5KIX A;  1C48 A;  1ZXT A;  1Y69 U;  1BBX C;  1PTO C;  4ZKC B;  3D6C A;  1JWM D;  4R9W A;  1ESF A;  2VNU D;  4BS9 A;  3SXH A;  3S14 B;  4F8M A;  3S15 B;  4LK1 C;  2HCC A;  3TZD A;  4RWS C;  1EU3 A;  4DNR B;  4WJW A;  5I6W A;  3KBX A;  3HOV B;  5E4W C;  2SNM A;  2QCP X;  3KLS X;  3BYT B;  1SND A;  4N9T A;  1X3Q A;  1SXT A;  3D4R A;  1GOZ A;  1I4G A;  4K6D A;  1I3Q B;  2BCO A;  4FO2 A;  3SEB A;  1I4P A;  5M5X B;  4H13 C;  2K5D A;  4ZUJ A;  1HFG A;  1ILP A;  2F03 A;  1ICW A;  2E2D C;  1VDZ A;  1SYG A;  2E74 C;  2D2C C;  1JR0 D;  1GUN A;  2XIW A;  4MHE A;  1O7L A;  1WTR A;  2DNC A;  2VB2 X;  1K83 B;  3J80 L;  3DEP A;  3QWN A;  4FXK C;  1D1K A;  1TVX A;  5CV4 A;  2FMC A;  1PZI D;  1I4X A;  4I7Z C;  5CC4 A;  4ILW A;  1YNJ D;  3MZ5 A;  3DM1 A;  1B2T A;  2F0K A;  3LNN A;  1ZYR C;  2F0D A;  2RVL A;  4KHV A;  1E2V A;  1H9K A;  2F0J A;  5C6A A;  2NVQ B;  1KNA A;  4CKC A;  1SE2 A;  1PTO F;  1M8A A;  4DAY A;  3HOW B;  2LS0 1;  2D9U A;  1Q12 A;  4C3H B;  1TS4 A;  5ELB A;  1ROD A;  4IUP A;  3NBH A;  4RH6 A;  1E0B A;  1CA5 A;  1TII D;  4NMZ A;  1R9T B;  3AU7 A;  4RHR A;  2F0N A;  2ICE C;  1JOO A;  3D4D A;  3J7A F;  4TQU S;  2PZT A;  3QOL A;  4EQO A;  1AN8 A;  1SE4 A;  3J80 E;  4K6L A;  3C46 A;  1CT1 D;  1F9R A;  1S5B D;  5JVH 3;  3TDQ A;  1STG A;  5JJZ A;  3ND9 A;  3VYS A;  2M2L A;  1GUO A;  1F2M A;  3HS0 C;  1V1O A;  2IX3 A;  2RDF A;  1XX8 A;  4R8I A;  3HOU B;  1OXV A;  4LMQ D;  2MUY A;  3AMU A;  5HUR A;  4K5V A;  2F0V A;  1QWY A;  4HED A;  1UNS A;  1O80 A;  2ENB A;  3QIA A;  4I65 A;  4G7O C;  2VB3 X;  1EZ6 A;  3P75 A;  4ME5 A;  2M9V A;  5A35 A;  5EKL A;  5C5L A;  3M85 A;  4IUQ A;  5EBD A;  5JPM C;  2K32 A;  1EWC A;  2BA1 A;  2WKC A;  1TWA B;  4B9X A;  3D6W A;  3IKJ A;  1LV9 A;  3NWT A;  3A55 A;  1BUV T;  4A3E B;  4CBV A;  1A15 A;  1Q8I A;  4L8J A;  2YU9 B;  3LX0 A;  1LLR D;  5K5P A;  4A3I B;  4KK7 A;  2B2Y C;  4P2C B;  4PMC A;  4C3J B;  3SDZ A;  3RZD B;  2Z1C A;  2EYF A;  1F9P A;  1Z6H A;  3U9O A;  5D3I B;  4L63 B;  5KYI A;  4DNT B;  3BVG A;  3J7Y W;  3S1N B;  5EKK A;  3C2P A;  4DA2 A;  2PW7 A;  3D31 A;  5F2D A;  1I6H B;  2KA7 A;  3OWF A;  4A3J B;  5IGE A;  1BR9 A;  1STN A;  3OPO A;  1RTO A;  3FRP B;  3S1M B;  3IFD A;  5CMD A;  4IUN A;  2FMM A;  3SK6 A;  1FR3 A;  2TSS A;  1EFI D;  2XVS A;  2B2T A;  3TP8 A;  1TT2 A;  1JC7 A;  2F0L A;  1XYI A;  2ID0 A;  1A3U A;  2R92 B;  2LY7 A;  3MTS A;  3W3A A;  4Z9C B;  1BF4 A;  2KOL A;  2NWG A;  5KNB A;  1SNQ A;  1JCK B;  1GHJ A;  3PV0 A;  1I4R A;  2AQ3 B;  3J81 L;  1PFB A;  1LTT D;  4QUC A;  4UAI A;  3L7Z C;  1SDF A;  1JOR A;  3T51 B;  5FLX E;  1PXU A;  2EJG C;  2KCN A;  4QCL A;  3OOC A;  2PZW A;  4LJZ C;  5IOD A;  1HRJ A;  4S3S A;  2K1B A;  2QIL A;  5I9P A;  5BN4 A;  5ELD A;  1C8C A;  4F88 A;  1LT6 D;  5JOB A;  2F0W A;  4H0L C;  1HFN A;  2KVM A;  1STH A;  1EU4 A;  3BS1 A;  3R2T A;  4FP5 D;  2KUM A;  5CV8 A;  3IFT A;  4ZQ3 A;  1H9M A;  1G29 1;  1PTO B;  2B2Y A;  1F9Q A;  2FIN B;  5DEH A;  3HZX A;  4IAL A;  3GV6 A;  1LTR D;  2ZXR A;  2IX1 A;  1IKL A;  1JOK A;  2VXW A;  3G6J B;  4QB4 A;  1D2B A;  2EJF C;  1NCV A;  1AZQ A;  5E4X A;  2A69 C;  1E2Z A;  4C2M B;  4ZYS A;  1E2W A;  1J9O A;  1KLG D;  4BBR B;  4Q0F A;  5C0X I;  1PTO H;  4PV1 C;  2RBM A;  2B2V C;  5DAU A;  3MA2 B;  3ERO A;  5TSS A;  3MHB A;  3T13 A;  2L9H A;  4FYD A;  2BDN A;  5CV6 A;  2OXP A;  2AWN A;  4FF3 A;  2R3Z A;  4KKT A;  2EY6 A;  3CRL C;  1CFM A;  2G9D A;  4NW2 A;  3ND8 A;  5JPN C;  2EE1 A;  3Q23 A;  4PMW A;  3P1H A;  1CTM A;  5I4D A;  4F87 A;  3A8K E;  2EYM A;  1S5C D;  3PUX A;  3GV3 A;  4BWG B;  4PMB A;  3HOX B;  1OXU A;  5CR3 A;  3BDO A;  2SDF A;  1F2Z A;  2BOS A;  3K59 A;  3RMH A;  3DWA A;  5IOC A;  4IUV A;  2KQ3 A;  3A8I E;  5C0X G;  2Y0S B;  1BNZ A;  4BY1 B;  5ISR A;  2F3W A;  1A6X A;  2H4O A;  3K6O A;  1PRT D;  3DHQ A;  1IHZ A;  3NPP A;  3EQL C;  1M4V A;  1XTC D;  2HDM A;  2L5T A;  4FXD A;  4BBS B;  3D4W A;  4PNY A;  4FXG C;  1S5D D;  2QF7 A;  2L0C A;  3ONA B;  1CK1 A;  5CBE E;  1EWH A;  4ID6 A;  1HUN A;  1Z47 A;  4KJN A;  4WRD A;  5IGC A;  2F0Q A;  1CZW A;  4C1N I;  3DUZ A;  2NUC A;  1D5X C;  4CKE A;  5JVG 3;  4X3S A;  4UDU C;  1R4Q B;  1EY5 A;  2WAQ B;  1TU2 B;  1KDB A;  3URY A;  3S1R B;  2KCC A;  4PQX A;  4U68 A;  1T5X D;  5M3M B;  1HTL D;  2O4X A;  1KAB A;  5DNF A;  4CJ1 B;  1IW7 D;  2G9H D;  2E76 C;  2WP8 J;  3D3R A;  2I07 B;  1Q1E A;  1L0X B;  3V05 A;  4AYB B;  1D5Z C;  5BN5 A;  1F77 A;  1LTB D;  3VYR A;  1IKM A;  2B2V A;  3MXG A;  4G7Z C;  4G57 A;  2AQ1 B;  2Q8R E;  4QF4 A;  4RAU C;  4DFA A;  3K5O A;  1SYC A;  4RGO S;  2Q8I B;  5G3L D;  1PFM A;  1GXD C;  1DD2 A;  1U4L A;  3DWP A;  1J8I A;  2C9O A;  1B9N A;  5KYL A;  4KY5 A;  1HQR D;  3FPU B;  2WAC A;  1DON A;  1RHP A;  2OEO A;  2K03 A;  4HSV A;  5D65 A;  4OO1 G;  1SFO B;  5CV7 A;  3CU7 A;  1B50 A;  4A3M B;  2JA5 B;  3X3M A;  3GTL B;  4TSS A;  1NR2 A;  4FNF A;  4J1M A;  5JAV A;  1KNE A;  1GHK A;  4ZAI A;  5KEE A;  3U9S A;  3VR5 A;  2J7Z A;  3I8Z A;  3GO5 A;  2RSN A;  2EY5 A;  3N6R A;  4H7B A;  5M5Y B;  3H94 A;  5KND A;  4CGY B;  3HGB A;  4V0B A;  4OIK A;  1WTP A;  3MAQ A;  2EYL A;  4FF1 A;  1S5E D;  2JSO A;  4RGN A;  2R7Z B;  3QOJ A;  4TKO B;  4HTH A;  1ONL A;  3FPP A;  3I91 A;  3Q6S A;  3K5L A;  3HEJ A;  5E1F A;  5ELF A;  1OXX K;  1CA6 A;  1V43 A;  1O7Z A;  1NR4 A;  3CHB D;  5EGT A;  5I6Y A;  3EFX D;  2KEC A;  3I90 A;  1ZYR D;  3VA7 A;  3JAM L;  1XXG A;  1EL0 A;  4GZY C;  4C56 C;  2K5Q A;  1TQO A;  4M8A A;  1F9S A;  2B2T C;  1HA5 A;  2X69 A;  3DXJ C;  5FO7 B;  3S2H B;  1ZEQ X;  5IGF A;  4WOR A;  2DY8 A;  1MSG A;  2F0T A;  1SNC A;  4ODG A;  2LMC B;  3BZD B;  2NN6 I;  4CHT B;  2WKD A;  2RDH A;  1WCM B;  5FO8 B;  2ICI A;  1PZJ D;  1SYD A;  3SHL A;  5IT9 L;  3NBI A;  2I46 A;  5C4J B;  4RKL A;  5C3W A;  2K7V A;  5M5W B;  2PMZ B;  1Q3L A;  2DY7 A;  4RGT A;  2PW5 A;  2E2J B;  1YNN D;  2K6A A;  3KLS A;  3DMU A;  1A3T A;  5T1I A;  4A3K B;  3BG3 A;  2OF1 A;  3OWE B;  2DNE A;  1BCP D;  5D14 A;  4ZLT F;  2PZU A;  5I2X A;  4OHJ A;  3HRZ C;  3NQI A;  3P7J A;  2F0M A;  3M7G A;  1JWU D;  2RDG A;  2A6H D;  4OIJ A;  3GTQ B;  2NN6 G;  3RZO B;  2F0G A;  4BA1 I;  1ET6 A;  3MWY W;  5K36 G;  3NUC A;  1Y1W B;  3PUZ A;  1G2S A;  1PDQ A;  4KMU C;  1EEF D;  1I4H A;  2B8F A;  1ET9 A;  1SMY D;  2F0I A;  5LHY 1;  3K58 A;  1WTQ A;  5IT9 E;  3I4L A;  4HSP A;  4XT3 B;  1LT5 D;  2K01 A;  3M3Y B;  2RA4 A;  3LWU A;  5C0X J;  1JWS D;  3PO3 B;  4HMJ A;  1KTK A;  2PO4 A;  3NK9 A;  1X3P A;  2A6E D;  1HTP A;  4XXE A;  4CJ0 B;  3OW7 A;  3NSW A;  2F0S A;  2EJM A;  2EVB A;  4YIJ A;  3HOY B;  3S2D B;  1B53 A;  3RD4 A;  1HCZ A;  2HCI A;  2J0T D;  2JYO A;  2V4D A;  3I73 A;  4QUF A;  3L9A X;  1IYU A;  5CBA E;  2X6L A;  1CM9 A;  1BCP F;  3R8B A;  4ZK9 B;  1KAA A;  3DWQ A;  2N88 A;  3NTI A;  1CQV A;  2FJ2 A;  3TME A;  4N9P A;  1DJR D;  2H1E A;  3OSO A;  1F2L A;  4ABN A;  2KJX A;  4DAV A;  1DZ1 A;  2K05 A;  1EY7 A;  2F3V A;  2JP1 A;  4HN7 A;  3R93 A;  4IZ8 A;  1BDO A;  1ML0 D;  3EA6 A;  4RA8 A;  2Z4H A;  2E2I B;  2KEE A;  4OO1 H;  5CV5 A;  3NXW A;  5M3F B;  3VR6 A;  1MSH A;  1ENA A;  3HOZ B;  1VF5 C;  2IW3 A;  2XRS D;  2NB0 A;  1H9J A;  3VR4 A;  1EY6 A;  1WTV A;  4RCO A;  5CGK A;  1MBY A;  2NTS A;  1LAC A;  3BDC A;  2XSC A;  1G2T A;  2K33 A;  3LWE A;  2BDO A;  1U9R A;  1HHV A;  1IL8 A;  1U4R A;  3IAY A;  1GUT A;  2LKV A;  5C3X A;  5C3E B;  3V2T A;  4O42 A;  4K2K A;  2K04 A;  1EYD A;  5C4Z A;  4XQN A;  5LL6 S;  5NUC A;  3QJY A;  1AFP A;  1RKN A;  1QNU A;  4KKS A;  1CHQ D;  5EQ0 A;  1PFN A;  4DXG A;  4KN4 C;  2IL8 A;  3FEW X;  3GP7 A;  4MIU A;  5FKA C;  3J81 E;  3SR1 A;  1TS5 A;  3HP3 A;  2PPB C;  3M4Y A;  4U67 3;  3C1E A;  3MXU A;  3K5N A;  3T56 B;  1NAP A;  1ENC A;  3NTH A;  2JA6 B;  1SYF A;  4XDX A;  3WOF A;  2CW0 C;  1EIH A;  3N52 A;  2NYZ D;  2IT1 A;  1I50 B;  1SE3 A;  2X6G A;  2MJ8 A;  2R93 B;  3DEO A;  5KRU A;  3H6M A;  4QMG A;  4X3T A;  3T53 B;  1QE6 A;  3IL8 A;  4FVM A;  4DK0 A;  1GJX A;  3VR3 A;  1OO9 B;  1QJO A;  1OXS C;  5HGT A;  4XYQ A;  3K57 A;  4L6T B;  1DOK A;  2QKI C;  3A7A B;  3E0J A;  5LL6 X;  3GTK B;  2R6G A;  1G8Z D;  5A2Q L;  1DXM A;  3OHX C;  4RHS A;  1OXT A;  1PRT C;  1SJH D;  3MFY A;  4XQJ A;  1U4M A;  2A68 D;  2K5W A;  2A73 B;  2EYP A;  1JIC A;  1WTX A;  5I9O A;  5JEA G;  5EKI A;  2EY2 A;  4A3B B;  1LT3 D;  1Q90 A;  2MPM A;  4NDX A;  3GTO B;  4ULL A;  4MN3 A;  2O5J C;  1WVL A;  2JEA I;  2MHV A;  2MP1 A;  2F0U A;  3MFG A;  5IGG A;  3SK5 A;  2EZV A;  1DYQ A;  1Y8P B;  3CQZ B;  3TZU A;  4K2L A;  1GUG A;  5AFW A;  1D5M C;  3BVZ A;  2LFN A;  2J4X A;  2Z4I A;  2YYZ A;  1U4P A;  3R3O A;  2NN6 H;  4NP5 A;  2R61 A;  3F2U A;  2EXZ A;  4H44 C;  1SNP A;  5EBC A;  3NTK A;  1SYB A;  5K36 H;  4BY7 B;  1L0Y B;  2CVR A;  3QO2 A;  4K5W A;  1KDA A;  1R4P B;  3TP5 A;  1RDP D;  2IX0 A;  3TBI B;  3OIQ A;  4J8Q A;  2O5I C;  2GA4 B;  4K8J A;  1A2T A;  1H9R A;  4JBW A;  3VYU A;  2JA8 B;  5D3D A;  1Q1B A;  1V8Q A;  2JXM B;  1UEA B;  1STA A;  1DM0 B;  1TWC B;  3PUV A;  4IUU A;  1PRT F;  1BCP B;  2XWB B;  1B3A A;  1WD1 A;  3GTJ B;  3KF8 A;  1B44 D;  2DN8 A;  4A93 B;  1Y1V B;  2BE5 D;  2FHT A;  3X3N A;  2ZT9 C;  3SK8 A;  1HUM A;  1B9M A;  3K5M A;  2B2W C;  3S1Q B;  3E6Z X;  1AP0 A;  5FK9 C;  1PTO D;  1TR5 A;  1MI2 A;  4K5X A;  3Q22 A;  4DGZ A;  3K0Y A;  5CYU A;  4X3U A;  2VUM B;  1LO5 D;  1NUC A;  3G7L A;  2TMP A;  3O13 A;  2AWO A;  5J1Z A;  1ENF A;  2MGS A;  4F7X A;  1SJE D;  2A5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...