4WORA

Staphylococcal nuclease in complex with ca2+ and thymidine-3'-5'-diphosphate (pdtp) at room temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Three-dimensional diffuse x-ray scattering from crystals of Staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase/hydrolase inhibitor
total genus 35
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4worA00
4J6HA 5IIFA 1SNOA 4ZUJA 3C1FA 3D4WA 5CV9A 5IGDA 5C4ZA 1RKNA 4ODGA 1SYDA 3EJIA 4QMGA 4DU9A 1EYAA 2F0DA 5CV6A 5IGEA 5IGCA 2F0TA 2EYPA 3ITPA 2F0VA 1SNDA 3MVVA 4ID6A 1KDCA 4KJNA 5I9OA 3EVQA 3VA5A 4B9WA 2M00A 4DGZA 2EYHA 2F3WA 4G57A 4IZ8A 4NKLA 4EQPA 1JORA 4K6DA 4NDXA 1STGA 3OMGA 4DF7A 5ISRA 4KV6A 3OWFA 1ENCA 5NUCA 5KYIA 2KHSA 4ZQ3A 4K5WA 5C6AA 4KY6A 5CV5A 1F2YA 1A3TA 4K14A 1KDBA 3U9OA 4B9XA 1EZ6A 5C3WA 3P75A 2F0HA 4K8JA 1TR5A 3E5SA 1F2MA 4HMJA 3SK8A 1NUCA 4K5VA 4NP5A 5DAUA 5C4HA 1EYCA 2EY6A 2F3VA 4IALA 3MHBA 2HQEA 4HMIA 4TRDA 3NXWA 1KABA 5DEHA 5EGTA 5CC4A 1A2TA 1SYCA 5J1ZA 2O4XA 1STYA 2OEOA 3T16A 4EQOA 5HGTA 2WACA 3NUCA 4LAAA 4DFAA 3BDLA 4PMCA 5F2DA 5IGBA 5KRUA 4HTHA 1NSNS 3D4DA 3MZ5A 3NQTA 4WORA 5IGGA 2PZUA 2F0SA 3P1HA 3SK5A 1SYEA 4J1MA 4K8IA 1ENAA 4QF4A 2F0KA 3SHLA 5CV7A 3RUZA 1AEXA 2F0UA 2PQEA 4H7BA 3NK9A 1STAA 3DMUA 3ERQA 5JOBA 1KAAA 1U9RA 1EY0A 2EY5A 3NP8A 1JOKA 5CR3A 2ENBA 5EKLA 3HEJA 4IUNA 5KIXA 2PZTA 1TQOA 1EY5A 3SR1A 2PW5A 3V2TA 3OSOA 4QB4A 4KD3A 2F0LA 4KJOA 5E1FA 3DHQA 3TP5A 2QDBA 2F0OA 1EYDA 4KTAA 5KYLA 1JOOA 2EYMA 4KY7A 4KD4A 4N9TA 4EVOA 1EY8A 2EY2A 2PZWA 3T13A 3BDCA 5I9PA 4K2LA 4EQNA 3S9WA 4I65A 5J39A 2F0MA 1EQVA 3C1EA 1EY7A 3QOLA 4KY5A 1EZ8A 2F0EA 2OF1A 2NUCA 1SYBA 2RDFA 5JAVA 4RKLA 5HURA 5J22A 4MIUA 5C5MA 3TP7A 3MXPA 4ME5A 5IODA 2F0FA 1EY4A 3HZXA 3H6MA 5C5LA 5I6WA 3SK6A 1KDAA 4RKBA 1JOQA 2SNSA 3QB3A 2SOBA 2EYJA 1SYFA 2KQ3A 2EXZA 1EY6A 4NMZA 5CV4A 2F0WA 4PMBA 5CV8A 5KGUA 5KEEA 3LX0A 2PW7A 2EYFA 1A2UA 3SXHA 2RKSA 4ZUIA 3SK4A 2F0NA 3TMEA 4YIJA 3EROA 5I6YA 1II3A 4S3SA 2LKVA 5EKKA 2F0GA 3D8GA 3TP6A 4PNYA 1A3VA 2F0PA 2F0IA 2PYKA 1SNCA 1SYGA 5C3XA 2EYLA 2EY1A 2OXPA 4E6IA 3R3OA 5IGFA 5K5PA 4OL7A 3D6CA 4F8MA 3NHHA 1TT2A 1EY9A 1F2ZA 3MEHA 4K2KA 4R8NA 1STBA 2EYOA 2F0QA 5E3FA 4F7XA 3PMFA 1SNMA 1SNQA 5IOCA 4N9PA 1A3UA 1STNA 3QOJA 3TP8A 3OMCA 1STHA 4K5XA 5M9OA 5CGKA 1IHZA 4KHVA 1SNPA 4WRDA 2F0JA 2RBMA 2SNMA
chains in the Genus database with same CATH superfamily
4DV6Q 4LF4Q 3I90A 3T1HQ 3AYHB 3RZOH 4GZYC 4DU9A 5CV6A 3EIVA 3JAMc 4B3TQ 1I4PA 2CKZB 2CCZA 4BY7B 1H9SA 1AFPA 3MXNA 1ILQA 1F9SA 4DXFA 5C3EB 4ZQ3A 1C9OA 1PFNA 2E75C 3HOWB 2B63G 1K8MA 4HSVA 1VQLA 1WOCA 3UDXA 1EIFA 3PCOB 4FF1A 4B9XA 3P75A 2F0HA 1IYJB 3E5SA 4LUVA 3BYTB 3G6EA 1BBXC 4BY7H 4NXNL 3K8AA 4DR7L 2BH8A 2EPBA 5C3EH 3NUCA 1K0RA 3HOWH 4X3SA 2NVTB 1LABA 3A56A 1QVCA 1HA5A 1X56A 5D14A 4J1MA 2BDNA 5K36G 4KHZA 3HRZC 4OX9Q 3CCLA 5KNCA 1VQNA 4LFCL 2NVTH 1DOLA 2GVAA 3TP5A 4B3MQ 5T1GA 1FGBD 1D1IA 2Q2HA 3CCSA 1NJIC 3DUZA 3JAMi 4DPGA 1PFMA 1QWYA 1YNJD 2QKIC 1SXTA 4OO1H 1E2WA 1WTWA 2R3ZA 1O80A 1L1OC 2F0FA 1Q7YC 3HZXA 1AP0A 3LWUA 4QL5A 3J80L 1O7YA 1SFOB 4ZK9B 3A8JE 4XDXA 4Y52H 2IL8A 2EXZA 2PMZE 1EEID 1LTTD 2EJGC 2PW7A 1GXDC 1G91A 1DYQA 1XPOA 1K8GA 1II3A 5FJ8H 4XQQA 3HKZE 4G4KA 2K14A 1I4QA 2PYKA 2N8NA 1SFOH 2JJQA 1EIYB 3CF5A 5CYUA 3PMFA 2X6LA 1A3UA 3OMCA 2PI2A 2CHBD 1HNZL 3TBIB 1SNOA 5IGDA 1W2BA 5EJWA 2EYPA 4BY1G 3NTHA 1RTNA 4QQBX 5IP7H 1W6KA 2NN6G 2XVSA 3M7GA 1VQ6A 2YTVA 4J15A 2DN8A 1JWSD 1GUOA 1IBKQ 1ET6A 1TIID 1KRSA 3PUWA 4ULLA 4BXXH 2HIXA 3RMHA 1XMOQ 4YWKA 4LF7L 2VNUD 1KDBA 1NR4A 1OO9B 1ZEQX 3N6RA 1XMQL 1FVIA 2E2HB 3GTPB 5EGTA 4R1JA 1HTLD 3M85A 4HIMA 2K7VA 1HR0L 3ZJYC 2ZXPA 3CQZB 1YNJC 3K81C 1B2TA 2UU9Q 3SGIA 2UUBL 1KNAA 4IURA 3RUZA 2RQXA 2K50A 2E2HH 1XNRL 4Z9CB 3RNUA 3C46A 3GTPH 1HCZA 3IKJA 1JOKA 2Z6KC 1TY0A 3PUVA 4DV2L 3CQZH 4PZ7A 4KD3A 5CMDA 1KC8C 3FPUB 5IYDH 4OELB 2QDBA 2EIFA 2MQHA 3TS0A 1KIXA 2I07B 4KD4A 4LF5Q 4TVAB 4K2LA 3S9WA 1BO0A 5KNDA 3KYHC 1IKMA 2EOTA 2Q2UA 1E0BA 1EOTA 2VQEL 3E3XA 4I7AA 3PV0A 2FXQA 4EX5A 4UP9A 1JJ2A 2IW3A 2RCFA 2VB3X 2VQFQ 4QGUA 1JT8A 2M2LA 1A2UA 1HR0W 2CQOA 1X3GA 2EJFC 4S3SA 3K5OA 1A15A 2HDMA 1V8QA 2K52A 5JPNC 1VQ4A 1JJGA 4JI6Q 3RLNA 3I4NB 4NXMQ 1RIPA 2SEBD 2K33A 4GKJQ 5C0XG 4DR3L 2WB1E 4ZUJA 2ZTEA 3WDNA 3CPFA 4YHHL 1PFBA 1PH4A 4K0KL 3I70A 4DR1Q 4QMGA 2WV6D 3I4NH 3W1GA 2UUCQ 1HQRD 1RDPD 2NTTA 1KDCA 2NWGA 3VA5A 3KBGA 2F3WA 2VW9A 1ASZA 2XTIA 3V05A 1STGA 2R93B 5JEAH 5NUCA 1S40A 1RD9D 3PSIA 4L5SA 4YCWA 3H0GB 4N8FA 4ZLTF 1EZ6A 4A3LG 4DKAC 1EQTA 3KLRA 4HMJA 4NP5A 1XWEA 4IALA 3HOYB 4HMIA 4TRDA 3PO2G 3Q0AA 4LF9L 1EL0A 2HHHL 2R93H 1Q3LA 1V1PA 4LAAA 4LWCA 2AWNA 3H09A 4PMCA 4RGMA 1MBYA 1T5EA 2PNHA 1CFMA 3H0GH 5D3IB 4YWMA 4LFAL 4DK1A 1I6VC 1J5EQ 3HOYH 2JP1A 3FKIG 4A3FH 1C0AA 2QEXA 5D65A 5JJZA 2R7FA 1TQOA 2KCTA 3I4OA 1SE3A 1KLGD 1YI2A 1UEBA 4GOPA 4A3JG 4JI5L 3I56A 2RHQB 2YYZA 3BZKA 4QUFA 3I91A 1UEAB 4QJFA 1V43A 1Z7TA 5FO8B 3TQYA 5HURA 3BJUA 4CBVA 4B3SL 1G291 1PTOH 4R4OA 2HUGA 2AQ1B 4H13C 4FVMA 1LTGD 1B53A 2G9DA 1KTKA 1G2TA 4JPBW 4L8JA 3TZDA 2DGYA 3QG1A 1CHPD 5ELNA 3MFYA 2I5MX 2B3GA 3GTKB 4YIJA 3FVQA 4PNYA 1I4XA 2Z9HA 5C3XA 4IUUA 1BCPF 3JC66 1PZKD 3H3VH 5M5YB 1FGUA 3BDOA 1H9JA 2EZVA 5E3FA 3GTKH 3RD4A 4R4QA 3S16B 3KF6A 1O7IA 3CCRA 1SNPA 2IWHA 1CKMA 4G7ZC 2A6HD 2PCFB 3SEBA 1Y1VG 3E9IA 1EOVA 3T1YL 1YJNA 5FLMG 1BCPD 5M5YH 5CORA 1R4PB 4F87A 3UE0A 4A93G 4AYBE 4DR5Q 2F0TA 2JA6B 1SNDA 3MVVA 1A63A 3A7AB 2RHSB 1UNSA 2HQLA 3A54A 4LFBL 4IZ8A 3A5ZB 3RR5A 5HGQA 3S16H 3N52A 4DAYB 2X6GA 2MO1A 4DR4Q 1G8ZD 3J80c 1LM0A 4FF3A 1QJOA 1JJCB 2ID0A 2JA6H 1D5MC 1TR5A 3D0FA 1X32A 1JQYD 4LF8L 2HQEA 5BR8Q 3M7NA 4FXGC 2I0QA 3IL8A 5TSSA 3VR3A 4P74A 3CHBD 5IWAL 3P7JA 1MKHA 3PO3H 2VZAA 4JBWA 1T9HA 4C1NK 2JK8A 4HCSA 4GN3B 1TS2A 1NMFA 1XX8A 3NP8A 3MEFA 4ZYSA 4FXDA 2ZTCA 2KCMA 2CH4W 4GNXA 1B44D 1TS3A 3I72A 1CZGA 1S5BD 3E0EA 1KQSA 3DHQA 1HTPA 4ZKCB 1YZ6A 3J7ZC 2OTJA 1NMGA 4X3KA 5E4XA 1G51A 3G71A 2N55A 2UXDQ 1YBYA 4LF6Q 2RDFA 5LMUQ 1NE3A 3MAQA 5JJKA 1PFSA 3A8IE 4H0LC 2B29A 3J80i 5IY0A 2K6AA 2K4KA 2PI2E 2A6HC 1SSOA 3S15H 3M4YA 1UE7A 1W6JA 3TREA 1BCPC 2FMCA 1N33L 3CMAA 2JA8G 2ZM6L 4DNRB 4R8IA 2MPMA 1YIJA 4X66L 4M1UB 4LMQD 2F0GA 4LUOA 3WOFA 2LXJA 1BQQT 4ZKBB 1WTRA 4A3DG 4JBKA 3F2CA 1VQOA 4N9PA 4HIDA 3PIP3 3OPOA 1PDQA 3D3RA 3G7LA 2F3IA 1WCMB 5G3LD 3DWQA 3VR4A 1S72A 3T56B 1P16A 2E5LQ 5IGEA 1B7YB 1R9TH 2Y0SG 3DM3A 2BDOA 4DUZL 4A3CG 1N32L 1JCKB 4PQXA 4AQYL 2L12A 4OWXB 2CWAA 3S1RB 1M1KC 1FYCA 2B39A 5ISRA 4LF4L 2WP8J 2A74C 2NZHA 1VQDA 2KHSA 1FR3A 2BCOA 3EFXD 4GN5A 3VYTA 2XWJB 3I55A 1F2YA 2NZOA 1B70B 3CPWA 4B3TL 2B63B 2L5TA 1HZCA 4HJ5A 1D7QA 1U4MA 2R6GA 4APVA 1SYCA 3S1RH 5FLXE 2C5CA 2QCPX 2P5ZX 2ALYB 2VXWA 3OTOQ 2Q2TA 1XNQL 3GP7A 3NQTA 5IGGA 2YTXA 1QOHA 2RDGA 3K0YA 3SHLA 2B63H 2F0UA 1STAA 2B2YA 3DMUA 3HEJA 3KJOA 2LY7A 2PW5A 4JYAL 2BA1A 2QILA 1B9NA 4KTAA 2Q8TA 2UXCL 4EVOA 3BDCA 4OX9L 4EQNA 4EQ5A 3F2BA 1VQEA 5J39A 1ASYA 1OTCA 1SDFA 4CHTB 2CH4A 2DNEA 2DY8A 4B3ML 4XQJA 5K36H 5IODA 4G7OC 3J81j 1EEFD 3K7UC 1PYWD 1Y1WG 4L63B 5KEEA 4YY3Q 4PZ6A 1PYBA 4C3IG 3I4MG 4A3KG 2G5DA 2R7DA 3TMEA 2DUDA 4DV7Q 4DV5Q 4XYQA 1X3QA 3TP6A 2H1EA 1WTOA 4UY8C 1G2SA 2F1MA 3QWNA 2UUAL 2EYLA 2HDLA 4XQNA 5K5PA 5GAEC 4HR7B 5JPMC 4IPHA 4NB3A 4IJLA 2DNCA 2EYOA 5I4DA 5M5WB 4DV1L 5IOCA 1STNA 5M9OA 1BKBA 1HNWQ 2G9HD 3ICEA 4MN3A 1KAWA 1SYDA 1YNNC 4A3EG 3EJIA 1PZID 3U9SA 1EYAA 2MNAA 3F2DA 1ZXTA 4FNFA 2E8GA 5M5WH 2LS01 4JCVE 5CBEE 4BA2I 4BY1B 1D5XC 5IP9G 2OT2A 2Z1CA 5LL6S 4UAIA 2ZJPA 3RN2A 1WVLA 2E76C 2A69D 4L5TA 2XRSD 1X65A 2KVMA 5FLXL 1WCMG 1PH9A 1B1ZA 5C4HA 2EY6A 3PUZA 2XN9C 4BY1H 1IBKL 3IRBA 5IT9L 4A3BG 4ALPA 3PIPA 5JVG3 1WTVA 2WKCA 3DEPA 1XMOL 1DJRD 5F2DA 2L9HA 2NN6H 1LTAD 1EWHA 1IL8A 3HKZG 1E22A 3MZ5A 1IXRA 1YJWA 1RTOA 2JYOA 1SROA 4R4IA 2D0OA 4QF4A 4K8IA 5EPLA 3KLSX 2BE5D 1C8CA 3TZUA 3TEHB 3FEWX 4HIOA 1BDOA 2PZTA 3MFGA 2UU9L 2MJ8A 1CSPA 4OWTB 1Z47A 3A55A 2MGSA 3ZYYX 1BBWA 5IE8A 2L1BA 4HJ8A 1PH5A 3ULPA 4U68A 1PV4A 2AUJD 1EQVA 5CBAE 1EY7A 2QA4A 4XTCS 3KLWA 1SEBD 2OF1A 5FOBB 1B8AA 4MIUA 1CK1A 3MWYW 4ME5A 3E0JA 1O7LA 2J4XA 1I4GA 4LF5L 1YVCA 2J0TD 3HFZB 2HD3A 1TWHB 1SYFA 5KGUA 5CV4A 4X65Q 3F1ZA 3ER0A 5GADC 3LX0A 1EUJA 2B2TA 3PF4A 2EE1A 2XGTA 3OW2A 1KXLA 4XXEA 2IPKD 3S24A 4KHPQ 3K58A 1Y14B 1FJGQ 1FD7D 3T4AC 2F0PA 4XIGS 1N8RC 5GAHC 4E6IA 2A6ED 2VQFL 1TWHH 4A3IB 1HA6A 4HEDA 1F2ZA 2A69C 1E2VA 2F0QA 4F7XA 2XNAC 1IL2A 3CU7A 1AN8A 4WJ3M 4RCNA 4WRDA 1FL0A 2SNMA 4IPGA 4JI6L 5LMNQ 4UHVA 2RA4A 4NXML 4DR6Q 4GKJL 1S5FD 4WJ4A 4IO9A 4BBRG 1N36Q 1SAPA 2L0CA 1S5DD 2BE5C 1WTHA 1CKNB 1VQHA 1EFWA 1SLJA 4CKBA 5C0XH 1HRJA 4WJWA 4BWGB 5LHY1 4J8QA 5C6AA 3HOVG 1UE6A 1ILPA 3QIAA 2M9VA 1S4ZA 4IJHA 5L37A 1PH6A 3SK8A 3K80C 1A2TA 2O4XA 2ZT9C 3IAYA 3PO2B 1HNXQ 1VQ7A 3AEVA 2D2CC 5KRUA 1WJJA 3A0JA 1QNUA 4CKCA 1V1QA 2JEAI 1L1OB 1CSQA 3PIOA 4OIJA 1LACA 3NK9A 1CUKA 4KK7A 4JI0Q 4TSSA 4A3LH 3NQIA 1CA6A 1PMRA 1WD1A 1TS5A 3PO2H 5I2YA 1NBWA 2L55A 3V2TA 3FKIB 3LWEA 4DXGA 1LO5D 1ONLA 3KF8B 5M3FB 2ZJRA 1EYDA 3ONAB 4TQUS 1LLRD 1O7ZA 4RHSA 1J5EL 1EQRA 4DK6C 4MHEA 1TVXA 4EGVA 4A3JB 2A6EC 3P20A 4GKKQ 1PTOF 4B08A 1LT6D 2NUCA 2NN6I 3R93A 3HOZG 3MXPA 2WKDA 3FKIH 5M3MG 3GTJB 2RVLA 1CI3M 1Q8KA 1R4QB 4BA1I 2EYJA 4L5QA 1GUGA 4A3JH 5AFWA 1Y8PB 3HOXG 2LKVA 2JA5G 2K5HA 1XXGA 3GTJH 3X3MA 2DJFC 3NHHA 1ICFB 1TT2A 4LNQA 4DV0L 3D6WA 4XT1B 3QOJA 3TP8A 4FF4A 5ELOA 2I46A 1CT1D 3A74A 2KHJA 4I7ZC 4J6HA 1AZPA 3G6JB 4X3TA 1CM9A 2K5QA 1PH8A 1Y1VB 3KOJA 3UDIA 4C1NI 4A3IG 4LFCQ 3EVQA 1J8IA 4X64Q 4CDFC 4A93B 2B2WA 3OWFA 1X3EA 2FFKB 4OO1I 4DR5L 3L9AX 3A8KE 1Y1VH 3R2IA 4KMUC 4A4IA 5FK9C 2HT1A 3W5OA 4K5VA 5FLMH 1NR2A 1EYCA 2FINB 3CCQA 4A93H 2UXBQ 2Z8LA 1B3AA 3IFDA 2N49A 5J1ZA 4DR4L 2JA9A 1AH9A 2OEOA 2SDFA 3T16A 4GLAC 3I73A 3TDQA 1PH2A 4PV1C 5FKAC 4PMWA 4HJAA 4CJ1B 3S1NB 1E24A 2EXDA 2F52A 5BR8L 1JWMD 3AU7A 5CR3A 2EY5A 4P73A 4IFDG 3A5UA 1MI2A 3F2UA 4BBSG 1VQGA 2R7ZG 3IFTA 1LTRD 3S1NH 3J7A5 2VUMG 4JV5Q 4AYBG 3C2PA 2QF7A 2WAQG 1E3PA 2ASBA 4HJ7A 2DY7A 2EJMA 2JA7G 4V0BA 2MP1A 1EY4A 2AQ2B 1SN8A 4UP7A 1ENFA 1Y69U 4HAEA 5FLXc 1K8AC 1JOQA 4A3GG 3E6ZX 1JE4A 5M3FG 1GUSA 2AWOA 2HCIA 2JN4A 1I4HA 2PPBC 3SK4A 3BZDB 2BH2A 2NB0A 3EROA 4O1NA 4LK1C 4BS9A 4DAYA 4DNIA 2K5WA 4F88A 3SVMA 2JA8B 2EQSA 5EKKA 2MUYA 3J7AF 2OXPA 5BN3A 1YITA 3OIPA 4PG3A 1HH2P 4K2KA 4JC0A 4F8MA 4DK3C 3CW2C 4HIKA 1Z6HA 3V96A 3K5LA 4CDEC 1B4OA 1JE5A 1STHA 4A3DB 3U58A 1JB7A 5EPJA 1X6OA 1XJVA 2JA8H 2R92B 1VF5C 2ZXOA 5BN4A 1CTMA 4MTKA 4P75A 1QZGA 2ICEC 1Q90A 4DV2Q 1QILA 1ZYRD 2EYHA 2Y0SB 1PZJD 4G57A 4HN7A 4NKLA 4A3DH 2A5HA 5A35A 3SDZA 2E5LL 3VYUA 2GA4B 3S2DB 5D3DA 1VCIA 1PH3A 1I6HB 2VQEQ 1M90C 3ERSX 3CCVA 4A3CH 5C4XG 2WACA 4C3JG 2PZUA 1JB3A 4C3HG 1PRTF 4CKEA 2F0KA 2FJ2A 3S2DH 2PQEA 4IUVA 4K6LA 1CA5A 3QR8A 1LT4D 1YNXA 1Y8NB 1I6HH 2NYZD 1K3BC 1ESRA 3OTOL 2PNRC 4KI0A 4IUNA 1ESFA 4JI2Q 3NBHB 4YWLA 3FDTA 2AQ3B 4OWWB 2YTYA 3KBXA 3I3CA 2KENA 2B2VA 4YHHQ 4U673 4YCUA 5C5LA 2Q8RE 1PHJA 4X62Q 1VDZA 4LUZA 4OGQC 1EU4A 2KCCA 2IHFA 4NMZA 2HCCA 1Y1WB 1SE4A 3K7AB 4XYOA 5I6YA 3QJYA 4UDUC 2NVXB 4C3IB 4JBMA 2KCNA 3I4MB 1ZYRC 3KJPA 4A3KB 5M5XB 2PQAB 1L0XB 4YY3L 5DLQE 1STBA 2HHHQ 4ZAIA 1Y1WH 3VDYA 4HJ9A 3RLFA 1ET9A 4DV5L 3RZDB 1F9RA 4KN7C 2NVXH 4C3IH 3KK7A 4R9WA 2F4IA 3I4MH 4A3KH 5IIFA 4LFAQ 5M5XH 4FDBA 1PH7A 1GUNA 2JXMB 1DXMA 5IGCA 4RA8A 2Q8IB 2IX0A 3GD7A 4A3EB 1UE1A 4JI1Q 2GVBA 1BF4A 4GNXC 3GV3A 1RCVD 4DAPA 1HNWL 3RZDH 2JE6I 3E9HA 1AE3A 4JI5Q 4JOIA 1VQCA 1IBLL 1EFID 1OXVA 1A3TA 1X3PA 3I8ZA 3U9OA 2XRQD 4DV3L 5C3WA 2R92G 4A3EH 1J6QA 3FPPA 3J81L 1VQAA 3MHBA 4H02A 3NXWA 3NTIA 3J7AV 1QVFA 2N3SA 3X3NA 1X55A 1HXYD 4R4TA 3BDLA 2N78A 1BBUA 4WORA 5IP9H 4A3BB 3M4PA 1NNXA 2MO0A 1GVPA 4DV6L 3HKZB 3T51B 1Q1BA 3T1HL 3H94A 1WCMH 2KECA 3H3VI 2ZJQA 3K59A 2XIWA 1QUQB 4QY7A 1X54A 1BCPB 4DAMA 4NW2A 2OQKA 4RGNA 4A3BH 4IUQA 1JOOA 2EYMA 4KY7A 1I94Q 1LTBD 1YNND 5I9PA 1CZWA 4I65A 4M8AA 4KY5A 3URYA 1CQFA 2DJGC 5LL6X 3U4ZA 4O42A 5J22A 1GHJA 5IT9E 4OXPA 1S5CD 3SK6A 1FNWA 1I50B 2ICIA 4FYDA 3OYYA 1U0LA 1NTGA 4RAUC 4JI4Q 4QUCA 5T1IA 2K03A 4A3MG 1SE8A 4OONA 1J9OA 3Q22A 5AJ3Q 5ELCA 4DUYQ 1A8VA 3NWSA 1K9MC 2F0IA 1I5FA 1Q86C 1MHWC 4X65L 1I50H 5EBDA 4JI7Q 3C3LA 2RCNA 1HUMA 4QIWB 5JEAJ 1WTQA 4KHPL 1FJGL 1U5KA 2HIVA 2KEEA 1TY2A 3D31A 1M4VA 1RKNA 1QB5D 1N34Q 5JJLA 5JJIA 4KJNA 1G6PA 2K04A 2K5NA 1SMYD 1K73C 4X3UA 4BBRB 5ELDA 4ZCKA 4IOAA 4P71A 2D9UA 1VQ5A 4DR6L 2NVYB 1MJCA 4JG2A 4RFBA 1N36L 4K8JA 2EDGA 3VR2A 5C44G 3HOVB 1XPUA 1DD2A 4MTNA 5DAUA 2F3VA 3S1MB 2AMCB 1B9MA 4HCEA 1D1KA 2F03A 4BBRH 1JMCA 3CP0A 3EBEA 4DFAA 1M8AA 5IGBA 3OOCA 1K8OA 2NVYH 1VMCA 1N33Q 4JI8Q 3GV6A 1LT3D 2QEJC 4RGOS 4XT3B 3HOVH 4X66Q 3S1MH 1TU2B 1EY0A 1VQIA 3BZCA 3OHXC 3CC4A 2E2JB 4GS3A 2GN5A 1LTSD 2B2UC 1OXTA 1C7YA 1ZKOA 2WB1B 4X6AH 3FHWA 1OXUA 1BVSA 5LMNW 3C1EA 1AZQA 1VQ8A 3L2PA 2KA7A 1VQFA 2EVBA 3MXUA 2E2JH 3HS0C 1DONA 3HOZB 3CCMA 3ULJA 1YHBA 2Z4IA 5M3MB 2R61A 2SOBA 4IOCA 4AQYQ 4PMBA 4O0AA 4GKKL 1K28A 2F4VQ 1EU3A 4FP5D 2RDHA 3FRPB 1CKNA 1Q12A 3K6OA 4MZ9A 3HOXB 4L6TB 3D4RA 1SMYC 3HOZH 1SYGA 4V190 2NZ1D 1B50A 5M3MH 2JA5B 5EPKA 1HZ9A 2OQ0A 1XNQQ 5C4JB 2RF4A 2K5DA 4KN4C 2RBMA 3HOXH 2O5JC 3C1FA 2VS1A 5CV9A 3M4OB 3TRZA 3GO5A 4ODGA 1L1OA 2JSOA 2JA5H 3GQBA 1TWFB 2OCEA 4ID6A 2OTLA 3U50C 3S1QB 4GLXA 1Q8IA 2M00A 4JYAQ 1JORA 5C4JH 1S3OA 4K6DA 3MC0B 1B3QA 2KEDA 3OMGA 4NDXA 4ZRZA 5IYBG 5DM63 2UXCQ 4FO2A 5FO7B 1U4RA 1RODA 5KYIA 3M4OH 3KF8A 1IBMQ 5IYCG 1RJTA 4KY6A 2CWPA 1MD2D 4K14A 3L0OA 1TWFH 3NTKA 4X64L 4IQZA 4B3RQ 3S1QH 2OWOA 1EYGA 2YU9B 4WFN3 3K5MA 4A3IH 4JI3Q 2NBFA 3FMCA 3VYSA 3CMEA 2H4OA 3K5NA 3D4DA 3GTQB 3BVZA 3HOUG 2B2TC 1ENAA 4KKSA 3R2TA 3EN2A 5CV7A 1AEXA 2UXBL 4CDDC 1HFNA 4DR1L 1X9NA 1JR0D 1YHAA 2YU9H 2JEBI 1H9SB 2ENBA 1W3SA 2UUCL 2UUAQ 3MXNB 1SJED 5EKIA 3OSOA 2IT1A 3GTQH 4YCVA 1OXXK 5E1FA 2A8VA 4RHRA 4DV1Q 4BBSB 2R7ZB 1EWCA 3Q23A 3UE1A 5JVH3 1EIHA 3S2HB 1MSHA 2K32A 2VUMB 4A76A 1Z9FA 4AYBB 1BXTA 3TP7A 1IKLA 2WAQB 5I6WA 4IFDH 1H95A 2BA0A 3PGZA 4RKBA 2JA7B 1DOKA 4BBSH 4JV5L 1SRUA 5CV8A 1HUNA 2R7ZH 3J81c 1HJPA 1YEZA 2EYFA 1VQMA 3B6YA 2KJXA 2WB1G 2RKSA 3G48A 3SXHA 4ZUIA 4A3GB 5EAYA 3S2HH 2VUMH 2NTSA 4DR2Q 1YJ9A 3D8GA 2Z6KA 1XTDA 4DV4Q 2JA7H 3ULLA 5E7NA 5GAGC 3UDGA 1VQBA 3PUYA 1WD0A 4IUTA 1QNKA 4OEMB 3PQIA 1GJXA 4A3GH 1A0IA 1SNQA 5M3FH 4FXKC 4DAVA 5CGKA 2F0JA 1PYSB 2Z4HA 1QVGA 1C48A 3D4WA 3NEMA 4P72A 5C4ZA 2K5VA 2E2DC 1PTOD 4ILWA 4QCLA 2CQAA 4BY7G 1LTID 1BOSA 4QIWE 1TXYA 3ITPA 1RL2A 5HY6A 1PLFA 5I9OA 3AFQA 4DGZA 5C3EG 1GUTA 4AH6A 3HOWG 3J7YW 1F9QA 1ENCA 3HG9A 4NXNQ 4DR7Q 3WOEA 1GOZA 3CKIB 1EQQA 5CV5A 4KLKA 2LFNA 3K57A 2MFIA 1Q46A 1K3RA 4OHJA 4ABNA 2QDLA 3Q6SA 3J81i 4JVZA 1IYVA 3NSWA 2K01A 1SE2A 4CGYB 3UI2A 2D5DA 3HKSA 3LNNA 1EIGA 1KD1C 5C4XB 2C35B 2ATWA 1VMPA 1WTPA 2A68D 1IYUA 2O2LD 4IN3A 4KKUA 4C3JB 1WTXA 2ZTDA 2VY3A 2WIIB 4DN4M 3EQLC 2VL6A 3GTGB 4OO1G 4C3HB 3RLOA 3ERQA 4JW0A 2K75A 3MXGA 2MHVA 1I3QB 1UWVA 2F0OA 4IPDA 5C4XH 5J3BA 4C3JH 1VQKA 3GTGH 4C3HH 2F0MA 3M3YB 4JK1C 3S14B 5FJ8G 2J7ZA 2CFMA 3G4SA 5JAVA 1QCBD 4RKLA 4DNTB 4JI2L 1I3QH 1LUZA 3NE5B 4UPAA 3JAME 3H6MA 1XYIA 1LT5D 5C0XI 3QB3A 4RG1A 1EY6A 1OXSC 2F0WA 2B2WC 1E2ZA 3M3YH 5KNBA 3S14H 4Q5VA 1PTOC 2K1BA 1L0YB 4ME3A 1H9MA 4X62L 1A3VA 2KUMA 1HNZQ 1BR9A 3ND8A 3I4LA 2AUKA 5IP7G 1TS4A 1U4LA 3FP9A 3EA6A 4UP8A 3NBIA 4CJ2C 2L15A 1RF2D 3DXJC 4K5XA 4BXXG 4IFDI 1Q82C 2QGQA 3CC2A 3H3VC 2UXDL 1JICA 1DGSA 3DWPA 4LF6L 3K0XA 4A3FB 1LTLA 5LMUL 5IT9c 2X69A 1NAPA 1S5ED 1A6XA 1P8LA 2FMMA 4LF7Q 4B9WA 1XMQQ 2A68C 3BYYB 3SE0A 2V4DA 3S17B 2XWBB 4DF7A 1XPRA 3OW7A 4C56C 3F8TA 3L3OC 1BNZA 2TMPA 3CCEA 2D0PA 3NBHA 3VYRA 1HR0Q 1MIUA 1L2FA 3VA7A 1PTOB 1E1OA 4JI1L 1F2MA 2UUBQ 3BS1A 1E1TA 1PVOA 4R4CA 5DEHA 1KABA 3LGJA 1NCVA 1TWCB 4RWSC 1XNRQ 4O2DA 4RH6A 3S17H 3HGBA 5IYDG 5HGTA 1CKOA 3Q8DA 2LSSA 3NPPA 1BUVT 1FNUA 1WFQA 4HTHA 5COYA 1QG7A 2Z6BA 2JQOA 1K83B 3P1HA 1KNEA 3VR5A 1IW7D 1CHQD 5I2XA 3NENA 4GOPC 1TKWB 2R92H 1U9RA 1TWCH 2IX1A 3TSSA 1ICWA 1SMXA 3SR1A 2CVRA 2B8GA 4POFA 2D62A 3CCJA 1VQ9A 4DV0Q 2PQAA 1K83H 5KYLA 1MSGA 3JAML 3WWVA 3DM1A 3UDFA 1SJHD 5A2QE 4OIKA 3H15A 3J81E 4A75A 3AQQA 5C5MA 3OIQA 1V1PB 5ELFA 1I94L 1KDAA 1VF7A 4GN4B 3BU2A 2O5IC 2E74C 1QZHA 3TN2A 4GLVB 3STBD 2K05A 1PA6A 2A19A 1JC7A 4DR3Q 1PRTD 4A3MB 2WAQE 3I4NG 4CDCC 2EY1A 4JI4L 1GO3E 4GOPB 4K0KQ 3MEHA 3PO3B 4R8NA 2RSOA 5C0XJ 3A7LA 2WINB 5AJ3L 2KBNA 1GD7A 4DUYL 5JEAG 3GTLB 1UUPA 4Q0FA 4A3MH 1NY4A 2LXKA 1H9RA 4JI7L 5FO9B 3KFUA 2Z0SA 3I2ZA 1FNVA 1AE2A 1DZ1A 3AFPA 1EWIA 2R93G 2IY5B 1F2LA 3GTLH 1IW7C 4EQPA 1QUQA 3H0GG 4KV6A 4LF9Q 2WFWA 1D5ZC 4IFDJ 4CJ0B 1DCZA 2CW0D 2ES2A 3K7AH 2XSCA 1VQJA 1N34L 4DV7L 1PXUA 1ML0D 1CQVA 3MA2B 3HOYG 1N9WA 2B2VC 1HPCA 4RCOA 4A3FG 2FHTA 1H9KA 1NUCA 3TS2A 5E4WC 5CC4A 5C44B 4H44C 3GTMB 1STYA 3KF6B 3L7ZC 4DK0A 3S15B 3O13A 1NSNS 3ND9A 3Q24A 2KOLA 3SK5A 1SYEA 5H1SE 1STEA 3GTOB 1V1OA 1F77A 4P2CB 2IHEA 5ELEA 1KHIA 5JOBA 1HHVA 1QE6A 5C44H 3GTMH 5EKLA 1G6ZA 1K0SA 3PUXA 4IUPA 3STBC 1Y8OB 2C9OA 1EY5A 1I4RA 5A2QL 4JI8L 4B3SQ 4KJOA 3M4QA 2LMCB 3DWAA 1PRTC 1EY8A 2EY2A 3T13A 3GTOH 2PMZB 3GDEA 5G3LF 3MTSA 1RHPA 1EZ8A 2F0EA 3CRLC 3KLSA 1R9TB 2YV5A 1GKHA 2NVQB 3CXCA 3T53B 3CC7A 1O78A 2AKWB 1VQPA 2SNSA 2E2IB 2KQ3A 4PZ8A 2L4NA 4RMFA 3W1BA 4MNOA 3M9BA 4KKTA 4JOIC 2NVQH 4GNXB 1PH1A 1SR3A 1C4QA 1SNCA 5IGFA 2BOSA 2E2IH 1A62A 2F4VL 1U4PA 3T1YQ 2AHOB 2CW0C 4G7HC 1TWGB 1SNMA 1WYDA 4KHVA 1GM5A 4LFBQ 3H91A 2TSSA 3OWEB 1PRTB 4IPCA 3BVGA 1UAPA 3CAMA 2JA6G 1HFGA 2F0DA 1MGSA 1KL9A 1UE5A 2A73B 2F0VA 3AMUA 1TWGH 3U4VA 3PO3G 3R8BA 1YHQA 1WI5A 4LF8Q 2IJ0A 3NELA 2RSNA 3W3AA 2L11A 4LW1A 4NPSA 4K5WA 5IWAQ 2K28A 3QO2A 2IX3A 4AIMA 1HZBA 1JWUD 4POGA 1LYLA 1LV9A 1AW7A 1Q1EA 1D8LA 3CRKC 3I7FA 1XTCD 2A1AA 4JBJA 5GQOA 1GUWA 2Q2IA 1IBML 2B2YC 4EQOA 1Q81C 3NWTA 3CD6A 2KHIA 1DOMA 3KDFA 5IYBH 2F0SA 2ZXRA 4B3RL 1IZ6A 5IYCH 5LMNL 1MJEA 4H7BA 3BG3A 4Y7NB 3HOUB 2PO4A 4JI3L 1KAAA 3HP3A 4RGTA 3CCUA 2I5HA 5KIXA 4QB4A 2VB2X 2F0LA 2H5XA 1GHKA 2Y0SE 1VS0A 4N9TA 2PZWA 1V9PA 5ELBA 4Y7NH 3HOUH 2N88A 5EQ0A 3QOLA 5GROA 4L5RC 1SYBA 4LJZC 1KLUD 2ZM6Q 2B2UA 1D2BA 3RN5A 5BN5A 4C2MB 1HNXL 1TWAB 5EBCA 4N8X1 1X3FA 1L0WA 3DEOA 1SBBB 3W2DA 3PIO3 3J80E 3AB9A 1IBLQ 2F0NA 4TKOB 5DM73 3DLLA 1HQMC 4DV3Q 4JI0L 4DA2A 1HZAA 2QW7A 1KRTA 5DNFA 3RZOB 3R3OA 4FF2A 4C2MH 4OL7A 1TWAH 3D6CA 2B8FA 1EY9A 4HSPA 3PF5A 3BVMA 2I5LX 3KUPA 1E7ZA 1D6EC 1F9PA 3VR6A 4DR2L 1DM0B 3KDFB 4DUZQ 1IHZA 2V1CC 1N32Q 1T5XD 4DV4L
chains in the Genus database with same CATH topology
3I90A 4GZYC 4DU9A 5CV6A 1I4PA 4BY7B 1AFPA 1H9SA 3MXNA 1ILQA 1F9SA 4DXFA 5C3EB 4ZQ3A 1PFNA 2E75C 3HOWB 1K8MA 4HSVA 4FF1A 4B9XA 3P75A 2F0HA 3E5SA 3BYTB 1BBXC 2EPBA 3NUCA 4X3SA 2NVTB 1LABA 3A56A 1HA5A 5D14A 4J1MA 2BDNA 5K36G 4KHZA 3HRZC 5KNCA 1DOLA 3TP5A 5T1GA 1FGBD 1D1IA 3DUZA 1PFMA 1QWYA 1YNJD 2QKIC 1SXTA 4OO1H 1E2WA 1WTWA 2R3ZA 1O80A 2F0FA 3HZXA 1AP0A 3LWUA 3J80L 1O7YA 1SFOB 4ZK9B 3A8JE 4XDXA 2IL8A 2EXZA 1EEID 1LTTD 2EJGC 2PW7A 1GXDC 1G91A 1DYQA 1II3A 4XQQA 4G4KA 1I4QA 2PYKA 5CYUA 3PMFA 2X6LA 1A3UA 3OMCA 2CHBD 3TBIB 1SNOA 5IGDA 5EJWA 2EYPA 3NTHA 1RTNA 1W6KA 2NN6G 2XVSA 3M7GA 2DN8A 1JWSD 1GUOA 1ET6A 1TIID 3PUWA 4ULLA 3RMHA 2VNUD 1KDBA 1NR4A 1OO9B 1ZEQX 3N6RA 2E2HB 3GTPB 5EGTA 3M85A 1HTLD 2K7VA 2ZXPA 3CQZB 1YNJC 1B2TA 1KNAA 4IURA 3RUZA 2RQXA 4Z9CB 3C46A 1HCZA 3IKJA 1JOKA 1TY0A 3PUVA 4KD3A 5CMDA 3FPUB 2QDBA 2I07B 4KD4A 4K2LA 3S9WA 1BO0A 5KNDA 1IKMA 2EOTA 1E0BA 1EOTA 3PV0A 2IW3A 2VB3X 2M2LA 1A2UA 2EJFC 4S3SA 3K5OA 1A15A 2HDMA 1V8QA 5JPNC 3I4NB 2SEBD 2K33A 5C0XG 4ZUJA 3WDNA 1PFBA 3I70A 4QMGA 2WV6D 1HQRD 1RDPD 2NTTA 1KDCA 2NWGA 3VA5A 3KBGA 2F3WA 3V05A 1STGA 2R93B 5JEAH 5NUCA 1RD9D 3H0GB 4ZLTF 1EZ6A 1EQTA 3KLRA 4HMJA 4NP5A 1XWEA 4IALA 3HOYB 4HMIA 4TRDA 3Q0AA 1EL0A 1Q3LA 1V1PA 4LAAA 2AWNA 3H09A 4PMCA 4RGMA 1MBYA 1T5EA 1CFMA 5D3IB 4DK1A 1I6VC 2JP1A 5D65A 5JJZA 1TQOA 1SE3A 1KLGD 2YYZA 4QUFA 3I91A 1UEAB 1V43A 1Z7TA 5FO8B 5HURA 4CBVA 1G291 1PTOH 2HUGA 2AQ1B 4H13C 4FVMA 1LTGD 1B53A 2G9DA 1KTKA 1G2TA 4L8JA 3TZDA 3QG1A 1CHPD 3MFYA 3GTKB 4YIJA 3FVQA 4PNYA 1I4XA 5C3XA 4IUUA 1BCPF 1PZKD 5M5YB 3BDOA 1H9JA 2EZVA 5E3FA 3RD4A 3S16B 1SNPA 2IWHA 4G7ZC 2A6HD 2PCFB 3SEBA 1BCPD 5CORA 1R4PB 4F87A 2F0TA 2JA6B 1SNDA 3MVVA 3A7AB 1UNSA 3A54A 4IZ8A 3N52A 2X6GA 1G8ZD 4FF3A 1QJOA 2ID0A 1D5MC 1TR5A 1X32A 1JQYD 2HQEA 3M7NA 4FXGC 3IL8A 5TSSA 3VR3A 3CHBD 3P7JA 4JBWA 4C1NK 4HCSA 1TS2A 1XX8A 3NP8A 4ZYSA 4FXDA 1B44D 1TS3A 3I72A 1CZGA 1S5BD 3DHQA 1HTPA 4ZKCB 4X3KA 5E4XA 2N55A 2RDFA 3MAQA 3A8IE 4H0LC 2K6AA 2A6HC 1SSOA 3M4YA 1W6JA 1BCPC 2FMCA 4DNRB 4R8IA 2MPMA 4M1UB 4LMQD 2F0GA 3WOFA 1BQQT 4ZKBB 1WTRA 4N9PA 3PIP3 3OPOA 1PDQA 3D3RA 3G7LA 1WCMB 5G3LD 3DWQA 3VR4A 3T56B 5IGEA 2BDOA 1JCKB 4PQXA 2L12A 3S1RB 1FYCA 2B39A 5ISRA 2WP8J 2A74C 2KHSA 1FR3A 2BCOA 3EFXD 3VYTA 2XWJB 1F2YA 2B63B 2L5TA 1U4MA 2R6GA 1SYCA 5FLXE 2C5CA 2QCPX 2VXWA 3GP7A 3NQTA 5IGGA 1QOHA 2RDGA 3K0YA 3SHLA 2F0UA 1STAA 2B2YA 3DMUA 3HEJA 2LY7A 2PW5A 2BA1A 2QILA 1B9NA 4KTAA 2Q8TA 4EVOA 3BDCA 4EQNA 5J39A 1SDFA 4CHTB 2DNEA 2DY8A 5K36H 4XQJA 5IODA 4G7OC 1EEFD 1PYWD 4L63B 5KEEA 4C3IG 3TMEA 4XYQA 1X3QA 3TP6A 2H1EA 1WTOA 1G2SA 2F1MA 3QWNA 2EYLA 2HDLA 4XQNA 5K5PA 4HR7B 5JPMC 2DNCA 2EYOA 5I4DA 5M5WB 5IOCA 1STNA 5M9OA 2G9HD 4MN3A 1SYDA 1YNNC 3EJIA 1PZID 3U9SA 1EYAA 1ZXTA 4FNFA 2LS01 5CBEE 4BA2I 4BY1B 1D5XC 2OT2A 2Z1CA 5LL6S 4UAIA 1WVLA 2E76C 2A69D 2XRSD 2KVMA 5FLXL 1B1ZA 5C4HA 2EY6A 3PUZA 2XN9C 5IT9L 1WTVA 5JVG3 2WKCA 3DEPA 5F2DA 1DJRD 2L9HA 2NN6H 1LTAD 1EWHA 1IL8A 3MZ5A 1RTOA 2JYOA 4QF4A 4K8IA 5EPLA 3KLSX 2BE5D 1C8CA 3TZUA 3FEWX 1BDOA 2PZTA 3MFGA 2MJ8A 1Z47A 3A55A 2MGSA 3ZYYX 2L1BA 4U68A 2AUJD 1EQVA 5CBAE 1EY7A 4XTCS 1SEBD 2OF1A 5FOBB 4MIUA 1CK1A 3MWYW 4ME5A 3E0JA 1O7LA 2J4XA 1I4GA 2J0TD 1TWHB 1SYFA 5KGUA 5CV4A 3LX0A 2B2TA 2EE1A 4XXEA 2IPKD 3K58A 1FD7D 3T4AC 2F0PA 4XIGS 4E6IA 2A6ED 4A3IB 1HA6A 4HEDA 1F2ZA 2A69C 1E2VA 2F0QA 4F7XA 2XNAC 3CU7A 1AN8A 4RCNA 4WRDA 2SNMA 2RA4A 1S5FD 1SAPA 2L0CA 1S5DD 2BE5C 4CKBA 5C0XH 1HRJA 4WJWA 4BWGB 5LHY1 4J8QA 5C6AA 1ILPA 3QIAA 2M9VA 1S4ZA 3SK8A 1A2TA 2O4XA 2ZT9C 3IAYA 3PO2B 2D2CC 5KRUA 1QNUA 4CKCA 2JEAI 4OIJA 1LACA 3NK9A 4KK7A 4TSSA 3NQIA 1CA6A 1PMRA 1WD1A 1TS5A 5I2YA 2L55A 3V2TA 3FKIB 3LWEA 4DXGA 1LO5D 1ONLA 5M3FB 4TQUS 1EYDA 3ONAB 1LLRD 1O7ZA 4RHSA 4MHEA 1TVXA 4EGVA 4A3JB 2A6EC 3P20A 1PTOF 4B08A 1LT6D 2NUCA 2NN6I 3R93A 3MXPA 2WKDA 3GTJB 2RVLA 1CI3M 1R4QB 4BA1I 2EYJA 1GUGA 5AFWA 1Y8PB 2LKVA 1XXGA 3X3MA 3NHHA 1TT2A 3D6WA 4XT1B 3QOJA 3TP8A 4FF4A 2I46A 1CT1D 4I7ZC 4J6HA 1AZPA 3G6JB 4X3TA 1CM9A 2K5QA 1Y1VB 4C1NI 3EVQA 1J8IA 4A93B 2B2WA 3OWFA 2FFKB 4OO1I 3L9AX 3A8KE 3R2IA 4KMUC 5FK9C 4K5VA 1NR2A 1EYCA 2FINB 2Z8LA 1B3AA 3IFDA 5J1ZA 2OEOA 2SDFA 3T16A 3I73A 3TDQA 4PV1C 5FKAC 4PMWA 4CJ1B 3S1NB 1JWMD 3AU7A 5CR3A 2EY5A 4IFDG 1MI2A 3F2UA 3IFTA 1LTRD 3C2PA 2QF7A 2DY7A 2EJMA 4V0BA 2MP1A 1EY4A 2AQ2B 1ENFA 1Y69U 4HAEA 1JOQA 3E6ZX 1JE4A 1GUSA 2AWOA 2HCIA 1I4HA 2PPBC 3SK4A 3BZDB 2NB0A 4F88A 3EROA 4O1NA 4LK1C 4BS9A 4DAYA 2K5WA 3SVMA 2JA8B 5EKKA 2MUYA 3J7AF 2OXPA 5BN3A 3OIPA 4F8MA 4K2KA 1Z6HA 3V96A 3K5LA 1B4OA 1STHA 4A3DB 5EPJA 2R92B 1VF5C 2ZXOA 5BN4A 1CTMA 2ICEC 1Q90A 1QILA 1ZYRD 2EYHA 2Y0SB 1PZJD 4G57A 4HN7A 4NKLA 2A5HA 5A35A 3SDZA 3VYUA 2GA4B 3S2DB 5D3DA 1VCIA 1I6HB 2WACA 4C3JG 2PZUA 1JB3A 4C3HG 1PRTF 4CKEA 2F0KA 2FJ2A 2PQEA 4IUVA 4K6LA 1CA5A 1LT4D 1Y8NB 2NYZD 1ESRA 2PNRC 4KI0A 4IUNA 1ESFA 3FDTA 2AQ3B 3KBXA 3I3CA 2B2VA 4U673 5C5LA 2Q8RE 1VDZA 4OGQC 1EU4A 2KCCA 4NMZA 2HCCA 1Y1WB 1SE4A 3K7AB 4XYOA 5I6YA 3QJYA 4UDUC 2NVXB 4C3IB 2KCNA 3I4MB 1ZYRC 4A3KB 5M5XB 1L0XB 1STBA 4ZAIA 3RLFA 1ET9A 3RZDB 1F9RA 4KN7C 3KK7A 4R9WA 2F4IA 5IIFA 1GUNA 2JXMB 1DXMA 5IGCA 4RA8A 2Q8IB 2IX0A 3GD7A 4A3EB 1BF4A 3GV3A 1RCVD 4DAPA 2JE6I 1EFID 1OXVA 1A3TA 1X3PA 3I8ZA 3U9OA 2XRQD 5C3WA 3FPPA 3J81L 3MHBA 3NXWA 3NTIA 3J7AV 3X3NA 1HXYD 3BDLA 4WORA 4A3BB 3HKZB 3T51B 1Q1BA 3H94A 2KECA 3K59A 2XIWA 1BCPB 4NW2A 4RGNA 4IUQA 1JOOA 2EYMA 4KY7A 1LTBD 1YNND 5I9PA 1CZWA 4I65A 4M8AA 4KY5A 3URYA 1CQFA 5LL6X 4O42A 5J22A 1GHJA 5IT9E 1S5CD 3SK6A 1FNWA 1I50B 2ICIA 4FYDA 4RAUC 4QUCA 5T1IA 2K03A 1J9OA 3Q22A 5ELCA 3NWSA 2F0IA 5EBDA 3C3LA 1HUMA 4QIWB 5JEAJ 1WTQA 2KEEA 1TY2A 3D31A 1M4VA 1RKNA 1QB5D 4KJNA 2K04A 1SMYD 4X3UA 4BBRB 5ELDA 2D9UA 2NVYB 4RFBA 4K8JA 2EDGA 3VR2A 3HOVB 1DD2A 5DAUA 2F3VA 3S1MB 1B9MA 4HCEA 1D1KA 2F03A 4DFAA 1M8AA 5IGBA 3OOCA 1K8OA 1VMCA 3GV6A 1LT3D 2QEJC 4RGOS 4XT3B 1TU2B 1EY0A 3OHXC 2E2JB 1LTSD 2B2UC 1OXTA 1ZKOA 2WB1B 1OXUA 1AZQA 3C1EA 2KA7A 2EVBA 3MXUA 3HS0C 1DONA 3HOZB 2Z4IA 5M3MB 2R61A 2SOBA 4PMBA 1EU3A 4FP5D 2RDHA 3FRPB 1Q12A 3K6OA 3HOXB 4L6TB 3D4RA 1SMYC 1SYGA 4V190 2NZ1D 1B50A 2JA5B 5EPKA 5C4JB 2K5DA 4KN4C 2RBMA 2O5JC 3C1FA 3M4OB 5CV9A 3GO5A 4ODGA 2JSOA 3GQBA 1TWFB 4ID6A 3S1QB 1Q8IA 2M00A 1JORA 4K6DA 3MC0B 4NDXA 2KEDA 3OMGA 4ZRZA 5DM63 4FO2A 5FO7B 1U4RA 1RODA 5KYIA 3KF8A 1RJTA 4KY6A 1MD2D 4K14A 3NTKA 4IQZA 2YU9B 4WFN3 3K5MA 2NBFA 3FMCA 3VYSA 2H4OA 3K5NA 3D4DA 3GTQB 3BVZA 2B2TC 1ENAA 4KKSA 3R2TA 5CV7A 1AEXA 1HFNA 1JR0D 2JEBI 1H9SB 2ENBA 1SJED 5EKIA 3OSOA 2IT1A 1OXXK 5E1FA 4RHRA 4BBSB 2R7ZB 1EWCA 3Q23A 5JVH3 1EIHA 3S2HB 1MSHA 2K32A 2VUMB 4AYBB 1BXTA 3TP7A 1IKLA 2WAQB 5I6WA 4IFDH 2BA0A 4RKBA 2JA7B 1DOKA 5CV8A 1HUNA 2EYFA 2KJXA 3SXHA 2RKSA 4A3GB 4ZUIA 2NTSA 3D8GA 3PUYA 1WD0A 4IUTA 1QNKA 1GJXA 1SNQA 4FXKC 4DAVA 5CGKA 2F0JA 2Z4HA 1C48A 3D4WA 5C4ZA 2E2DC 1PTOD 4ILWA 4QCLA 2CQAA 1LTID 1BOSA 3ITPA 1PLFA 5I9OA 4DGZA 1GUTA 3J7YW 1F9QA 1ENCA 3HG9A 3WOEA 1GOZA 3CKIB 5CV5A 3K57A 2LFNA 4OHJA 4ABNA 3Q6SA 1IYVA 3NSWA 2K01A 1SE2A 4CGYB 3UI2A 2D5DA 3LNNA 1EIGA 5C4XB 1VMPA 1WTPA 2A68D 1IYUA 4C3JB 2O2LD 4IN3A 4KKUA 1WTXA 4DN4M 2WIIB 3EQLC 3GTGB 4OO1G 4C3HB 3ERQA 3MXGA 2MHVA 1I3QB 2F0OA 2F0MA 3M3YB 4JK1C 3S14B 2J7ZA 5JAVA 1QCBD 4RKLA 4DNTB 3NE5B 3JAME 3H6MA 1XYIA 1LT5D 5C0XI 3QB3A 1EY6A 1OXSC 2F0WA 2B2WC 1E2ZA 5KNBA 4Q5VA 1PTOC 2K1BA 1L0YB 1H9MA 1A3VA 2KUMA 1BR9A 3ND8A 3I4LA 2AUKA 1TS4A 1U4LA 3EA6A 3NBIA 4CJ2C 1RF2D 3DXJC 4K5XA 4IFDI 3H3VC 1JICA 3DWPA 4A3FB 2X69A 1NAPA 1S5ED 1A6XA 2FMMA 4B9WA 2A68C 3BYYB 3SE0A 2V4DA 3S17B 2XWBB 4DF7A 3OW7A 4C56C 3L3OC 1BNZA 2TMPA 3NBHA 3VYRA 3VA7A 1PTOB 1F2MA 3BS1A 5DEHA 1KABA 1NCVA 1TWCB 4RWSC 4RH6A 3HGBA 5HGTA 1BUVT 1FNUA 3NPPA 4HTHA 5COYA 1QG7A 1K83B 3P1HA 1KNEA 3VR5A 1IW7D 1CHQD 5I2XA 1TKWB 1U9RA 2IX1A 3TSSA 1ICWA 3SR1A 2CVRA 2B8GA 2D62A 5KYLA 1MSGA 3JAML 3DM1A 1SJHD 5A2QE 4OIKA 3J81E 5C5MA 3OIQA 1V1PB 5ELFA 1KDAA 1VF7A 2O5IC 2E74C 3TN2A 2K05A 1JC7A 1PRTD 4A3MB 2EY1A 3MEHA 3PO3B 4R8NA 2RSOA 5C0XJ 3A7LA 2WINB 5JEAG 3GTLB 1UUPA 4Q0FA 1H9RA 5FO9B 1FNVA 1DZ1A 1F2LA 1IW7C 4EQPA 4KV6A 1D5ZC 4IFDJ 4CJ0B 1DCZA 2CW0D 2XSCA 1PXUA 1ML0D 1CQVA 3MA2B 2B2VC 1HPCA 4RCOA 2FHTA 1H9KA 1NUCA 5E4WC 5CC4A 5C44B 4H44C 3GTMB 1STYA 3L7ZC 4DK0A 3S15B 3O13A 1NSNS 3ND9A 3Q24A 2KOLA 3SK5A 1SYEA 1STEA 3GTOB 1V1OA 1F77A 4P2CB 5ELEA 5JOBA 1HHVA 1QE6A 5EKLA 1G6ZA 3PUXA 4IUPA 1Y8OB 2C9OA 1EY5A 1I4RA 5A2QL 4KJOA 2LMCB 3DWAA 1PRTC 1EY8A 2EY2A 3T13A 2PMZB 5G3LF 3MTSA 1RHPA 1EZ8A 2F0EA 3CRLC 3KLSA 1R9TB 2NVQB 3T53B 1O78A 2SNSA 2E2IB 2KQ3A 2L4NA 4KKTA 1C4QA 1SNCA 5IGFA 2BOSA 1U4PA 2CW0C 4G7HC 1TWGB 1SNMA 4KHVA 3H91A 2TSSA 3OWEB 1PRTB 3BVGA 1UAPA 1HFGA 2F0DA 1MGSA 2A73B 2F0VA 3AMUA 3R8BA 2IJ0A 2RSNA 3W3AA 2L11A 4K5WA 2K28A 3QO2A 2IX3A 1JWUD 1AW7A 1LV9A 1Q1EA 3CRKC 1XTCD 1GUWA 2B2YC 4EQOA 3NWTA 1DOMA 2F0SA 2ZXRA 4H7BA 3BG3A 4Y7NB 3HOUB 2PO4A 1KAAA 3HP3A 4RGTA 5KIXA 4QB4A 2VB2X 2F0LA 1GHKA 4N9TA 2PZWA 5ELBA 2N88A 5EQ0A 3QOLA 1SYBA 4LJZC 1KLUD 2B2UA 1D2BA 5BN5A 4C2MB 1TWAB 5EBCA 3DEOA 1SBBB 3W2DA 3PIO3 3J80E 3AB9A 2F0NA 4TKOB 5DM73 1HQMC 4DA2A 5DNFA 3RZOB 3R3OA 4FF2A 4OL7A 3D6CA 2B8FA 1EY9A 4HSPA 3BVMA 3KUPA 1D6EC 1F9PA 3VR6A 1DM0B 1IHZA 1T5XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6H A;  5IIF A;  1SNO A;  4ZUJ A;  3C1F A;  3D4W A;  5CV9 A;  5IGD A;  5C4Z A;  1RKN A;  4ODG A;  1SYD A;  3EJI A;  4QMG A;  4DU9 A;  1EYA A;  2F0D A;  5CV6 A;  5IGE A;  5IGC A;  2F0T A;  2EYP A;  3ITP A;  2F0V A;  1SND A;  3MVV A;  4ID6 A;  1KDC A;  4KJN A;  5I9O A;  3EVQ A;  3VA5 A;  4B9W A;  2M00 A;  4DGZ A;  2EYH A;  2F3W A;  4G57 A;  4IZ8 A;  4NKL A;  4EQP A;  1JOR A;  4K6D A;  4NDX A;  1STG A;  3OMG A;  4DF7 A;  5ISR A;  4KV6 A;  3OWF A;  1ENC A;  5NUC A;  5KYI A;  2KHS A;  4ZQ3 A;  4K5W A;  5C6A A;  4KY6 A;  5CV5 A;  1F2Y A;  1A3T A;  4K14 A;  1KDB A;  3U9O A;  4B9X A;  1EZ6 A;  5C3W A;  3P75 A;  2F0H A;  4K8J A;  1TR5 A;  3E5S A;  1F2M A;  4HMJ A;  3SK8 A;  1NUC A;  4K5V A;  4NP5 A;  5DAU A;  5C4H A;  1EYC A;  2EY6 A;  2F3V A;  4IAL A;  3MHB A;  2HQE A;  4HMI A;  4TRD A;  3NXW A;  1KAB A;  5DEH A;  5EGT A;  5CC4 A;  1A2T A;  1SYC A;  5J1Z A;  2O4X A;  1STY A;  2OEO A;  3T16 A;  4EQO A;  5HGT A;  2WAC A;  3NUC A;  4LAA A;  4DFA A;  3BDL A;  4PMC A;  5F2D A;  5IGB A;  5KRU A;  4HTH A;  1NSN S;  3D4D A;  3MZ5 A;  3NQT A;  4WOR A;  5IGG A;  2PZU A;  2F0S A;  3P1H A;  3SK5 A;  1SYE A;  4J1M A;  4K8I A;  1ENA A;  4QF4 A;  2F0K A;  3SHL A;  5CV7 A;  3RUZ A;  1AEX A;  2F0U A;  2PQE A;  4H7B A;  3NK9 A;  1STA A;  3DMU A;  3ERQ A;  5JOB A;  1KAA A;  1U9R A;  1EY0 A;  2EY5 A;  3NP8 A;  1JOK A;  5CR3 A;  2ENB A;  5EKL A;  3HEJ A;  4IUN A;  5KIX A;  2PZT A;  1TQO A;  1EY5 A;  3SR1 A;  2PW5 A;  3V2T A;  3OSO A;  4QB4 A;  4KD3 A;  2F0L A;  4KJO A;  5E1F A;  3DHQ A;  3TP5 A;  2QDB A;  2F0O A;  1EYD A;  4KTA A;  5KYL A;  1JOO A;  2EYM A;  4KY7 A;  4KD4 A;  4N9T A;  4EVO A;  1EY8 A;  2EY2 A;  2PZW A;  3T13 A;  3BDC A;  5I9P A;  4K2L A;  4EQN A;  3S9W A;  4I65 A;  5J39 A;  2F0M A;  1EQV A;  3C1E A;  1EY7 A;  3QOL A;  4KY5 A;  1EZ8 A;  2F0E A;  2OF1 A;  2NUC A;  1SYB A;  2RDF A;  5JAV A;  4RKL A;  5HUR A;  5J22 A;  4MIU A;  5C5M A;  3TP7 A;  3MXP A;  4ME5 A;  5IOD A;  2F0F A;  1EY4 A;  3HZX A;  3H6M A;  5C5L A;  5I6W A;  3SK6 A;  1KDA A;  4RKB A;  1JOQ A;  2SNS A;  3QB3 A;  2SOB A;  2EYJ A;  1SYF A;  2KQ3 A;  2EXZ A;  1EY6 A;  4NMZ A;  5CV4 A;  2F0W A;  4PMB A;  5CV8 A;  5KGU A;  5KEE A;  3LX0 A;  2PW7 A;  2EYF A;  1A2U A;  3SXH A;  2RKS A;  4ZUI A;  3SK4 A;  2F0N A;  3TME A;  4YIJ A;  3ERO A;  5I6Y A;  1II3 A;  4S3S A;  2LKV A;  5EKK A;  2F0G A;  3D8G A;  3TP6 A;  4PNY A;  1A3V A;  2F0P A;  2F0I A;  2PYK A;  1SNC A;  1SYG A;  5C3X A;  2EYL A;  2EY1 A;  2OXP A;  4E6I A;  3R3O A;  5IGF A;  5K5P A;  4OL7 A;  3D6C A;  4F8M A;  3NHH A;  1TT2 A;  1EY9 A;  1F2Z A;  3MEH A;  4K2K A;  4R8N A;  1STB A;  2EYO A;  2F0Q A;  5E3F A;  4F7X A;  3PMF A;  1SNM A;  1SNQ A;  5IOC A;  4N9P A;  1A3U A;  1STN A;  3QOJ A;  3TP8 A;  3OMC A;  1STH A;  4K5X A;  5M9O A;  5CGK A;  1IHZ A;  4KHV A;  1SNP A;  4WRD A;  2F0J A;  2RBM A;  2SNM A; 
#chains in the Genus database with same CATH topology
 4DV6 Q;  4LF4 Q;  3I90 A;  3T1H Q;  3AYH B;  3RZO H;  4GZY C;  4DU9 A;  5CV6 A;  3EIV A;  3JAM c;  4B3T Q;  1I4P A;  2CKZ B;  2CCZ A;  4BY7 B;  1H9S A;  1AFP A;  3MXN A;  1ILQ A;  1F9S A;  4DXF A;  5C3E B;  4ZQ3 A;  1C9O A;  1PFN A;  2E75 C;  3HOW B;  2B63 G;  1K8M A;  4HSV A;  1VQL A;  1WOC A;  3UDX A;  1EIF A;  3PCO B;  4FF1 A;  4B9X A;  3P75 A;  2F0H A;  1IYJ B;  3E5S A;  4LUV A;  3BYT B;  3G6E A;  1BBX C;  4BY7 H;  4NXN L;  3K8A A;  4DR7 L;  2BH8 A;  2EPB A;  5C3E H;  3NUC A;  1K0R A;  3HOW H;  4X3S A;  2NVT B;  1LAB A;  3A56 A;  1QVC A;  1HA5 A;  1X56 A;  5D14 A;  4J1M A;  2BDN A;  5K36 G;  4KHZ A;  3HRZ C;  4OX9 Q;  3CCL A;  5KNC A;  1VQN A;  4LFC L;  2NVT H;  1DOL A;  2GVA A;  3TP5 A;  4B3M Q;  5T1G A;  1FGB D;  1D1I A;  2Q2H A;  3CCS A;  1NJI C;  3DUZ A;  3JAM i;  4DPG A;  1PFM A;  1QWY A;  1YNJ D;  2QKI C;  1SXT A;  4OO1 H;  1E2W A;  1WTW A;  2R3Z A;  1O80 A;  1L1O C;  2F0F A;  1Q7Y C;  3HZX A;  1AP0 A;  3LWU A;  4QL5 A;  3J80 L;  1O7Y A;  1SFO B;  4ZK9 B;  3A8J E;  4XDX A;  4Y52 H;  2IL8 A;  2EXZ A;  2PMZ E;  1EEI D;  1LTT D;  2EJG C;  2PW7 A;  1GXD C;  1G91 A;  1DYQ A;  1XPO A;  1K8G A;  1II3 A;  5FJ8 H;  4XQQ A;  3HKZ E;  4G4K A;  2K14 A;  1I4Q A;  2PYK A;  2N8N A;  1SFO H;  2JJQ A;  1EIY B;  3CF5 A;  5CYU A;  3PMF A;  2X6L A;  1A3U A;  3OMC A;  2PI2 A;  2CHB D;  1HNZ L;  3TBI B;  1SNO A;  5IGD A;  1W2B A;  5EJW A;  2EYP A;  4BY1 G;  3NTH A;  1RTN A;  4QQB X;  5IP7 H;  1W6K A;  2NN6 G;  2XVS A;  3M7G A;  1VQ6 A;  2YTV A;  4J15 A;  2DN8 A;  1JWS D;  1GUO A;  1IBK Q;  1ET6 A;  1TII D;  1KRS A;  3PUW A;  4ULL A;  4BXX H;  2HIX A;  3RMH A;  1XMO Q;  4YWK A;  4LF7 L;  2VNU D;  1KDB A;  1NR4 A;  1OO9 B;  1ZEQ X;  3N6R A;  1XMQ L;  1FVI A;  2E2H B;  3GTP B;  5EGT A;  4R1J A;  1HTL D;  3M85 A;  4HIM A;  2K7V A;  1HR0 L;  3ZJY C;  2ZXP A;  3CQZ B;  1YNJ C;  3K81 C;  1B2T A;  2UU9 Q;  3SGI A;  2UUB L;  1KNA A;  4IUR A;  3RUZ A;  2RQX A;  2K50 A;  2E2H H;  1XNR L;  4Z9C B;  3RNU A;  3C46 A;  3GTP H;  1HCZ A;  3IKJ A;  1JOK A;  2Z6K C;  1TY0 A;  3PUV A;  4DV2 L;  3CQZ H;  4PZ7 A;  4KD3 A;  5CMD A;  1KC8 C;  3FPU B;  5IYD H;  4OEL B;  2QDB A;  2EIF A;  2MQH A;  3TS0 A;  1KIX A;  2I07 B;  4KD4 A;  4LF5 Q;  4TVA B;  4K2L A;  3S9W A;  1BO0 A;  5KND A;  3KYH C;  1IKM A;  2EOT A;  2Q2U A;  1E0B A;  1EOT A;  2VQE L;  3E3X A;  4I7A A;  3PV0 A;  2FXQ A;  4EX5 A;  4UP9 A;  1JJ2 A;  2IW3 A;  2RCF A;  2VB3 X;  2VQF Q;  4QGU A;  1JT8 A;  2M2L A;  1A2U A;  1HR0 W;  2CQO A;  1X3G A;  2EJF C;  4S3S A;  3K5O A;  1A15 A;  2HDM A;  1V8Q A;  2K52 A;  5JPN C;  1VQ4 A;  1JJG A;  4JI6 Q;  3RLN A;  3I4N B;  4NXM Q;  1RIP A;  2SEB D;  2K33 A;  4GKJ Q;  5C0X G;  4DR3 L;  2WB1 E;  4ZUJ A;  2ZTE A;  3WDN A;  3CPF A;  4YHH L;  1PFB A;  1PH4 A;  4K0K L;  3I70 A;  4DR1 Q;  4QMG A;  2WV6 D;  3I4N H;  3W1G A;  2UUC Q;  1HQR D;  1RDP D;  2NTT A;  1KDC A;  2NWG A;  3VA5 A;  3KBG A;  2F3W A;  2VW9 A;  1ASZ A;  2XTI A;  3V05 A;  1STG A;  2R93 B;  5JEA H;  5NUC A;  1S40 A;  1RD9 D;  3PSI A;  4L5S A;  4YCW A;  3H0G B;  4N8F A;  4ZLT F;  1EZ6 A;  4A3L G;  4DKA C;  1EQT A;  3KLR A;  4HMJ A;  4NP5 A;  1XWE A;  4IAL A;  3HOY B;  4HMI A;  4TRD A;  3PO2 G;  3Q0A A;  4LF9 L;  1EL0 A;  2HHH L;  2R93 H;  1Q3L A;  1V1P A;  4LAA A;  4LWC A;  2AWN A;  3H09 A;  4PMC A;  4RGM A;  1MBY A;  1T5E A;  2PNH A;  1CFM A;  3H0G H;  5D3I B;  4YWM A;  4LFA L;  4DK1 A;  1I6V C;  1J5E Q;  3HOY H;  2JP1 A;  3FKI G;  4A3F H;  1C0A A;  2QEX A;  5D65 A;  5JJZ A;  2R7F A;  1TQO A;  2KCT A;  3I4O A;  1SE3 A;  1KLG D;  1YI2 A;  1UEB A;  4GOP A;  4A3J G;  4JI5 L;  3I56 A;  2RHQ B;  2YYZ A;  3BZK A;  4QUF A;  3I91 A;  1UEA B;  4QJF A;  1V43 A;  1Z7T A;  5FO8 B;  3TQY A;  5HUR A;  3BJU A;  4CBV A;  4B3S L;  1G29 1;  1PTO H;  4R4O A;  2HUG A;  2AQ1 B;  4H13 C;  4FVM A;  1LTG D;  1B53 A;  2G9D A;  1KTK A;  1G2T A;  4JPB W;  4L8J A;  3TZD A;  2DGY A;  3QG1 A;  1CHP D;  5ELN A;  3MFY A;  2I5M X;  2B3G A;  3GTK B;  4YIJ A;  3FVQ A;  4PNY A;  1I4X A;  2Z9H A;  5C3X A;  4IUU A;  1BCP F;  3JC6 6;  1PZK D;  3H3V H;  5M5Y B;  1FGU A;  3BDO A;  1H9J A;  2EZV A;  5E3F A;  3GTK H;  3RD4 A;  4R4Q A;  3S16 B;  3KF6 A;  1O7I A;  3CCR A;  1SNP A;  2IWH A;  1CKM A;  4G7Z C;  2A6H D;  2PCF B;  3SEB A;  1Y1V G;  3E9I A;  1EOV A;  3T1Y L;  1YJN A;  5FLM G;  1BCP D;  5M5Y H;  5COR A;  1R4P B;  4F87 A;  3UE0 A;  4A93 G;  4AYB E;  4DR5 Q;  2F0T A;  2JA6 B;  1SND A;  3MVV A;  1A63 A;  3A7A B;  2RHS B;  1UNS A;  2HQL A;  3A54 A;  4LFB L;  4IZ8 A;  3A5Z B;  3RR5 A;  5HGQ A;  3S16 H;  3N52 A;  4DAY B;  2X6G A;  2MO1 A;  4DR4 Q;  1G8Z D;  3J80 c;  1LM0 A;  4FF3 A;  1QJO A;  1JJC B;  2ID0 A;  2JA6 H;  1D5M C;  1TR5 A;  3D0F A;  1X32 A;  1JQY D;  4LF8 L;  2HQE A;  5BR8 Q;  3M7N A;  4FXG C;  2I0Q A;  3IL8 A;  5TSS A;  3VR3 A;  4P74 A;  3CHB D;  5IWA L;  3P7J A;  1MKH A;  3PO3 H;  2VZA A;  4JBW A;  1T9H A;  4C1N K;  2JK8 A;  4HCS A;  4GN3 B;  1TS2 A;  1NMF A;  1XX8 A;  3NP8 A;  3MEF A;  4ZYS A;  4FXD A;  2ZTC A;  2KCM A;  2CH4 W;  4GNX A;  1B44 D;  1TS3 A;  3I72 A;  1CZG A;  1S5B D;  3E0E A;  1KQS A;  3DHQ A;  1HTP A;  4ZKC B;  1YZ6 A;  3J7Z C;  2OTJ A;  1NMG A;  4X3K A;  5E4X A;  1G51 A;  3G71 A;  2N55 A;  2UXD Q;  1YBY A;  4LF6 Q;  2RDF A;  5LMU Q;  1NE3 A;  3MAQ A;  5JJK A;  1PFS A;  3A8I E;  4H0L C;  2B29 A;  3J80 i;  5IY0 A;  2K6A A;  2K4K A;  2PI2 E;  2A6H C;  1SSO A;  3S15 H;  3M4Y A;  1UE7 A;  1W6J A;  3TRE A;  1BCP C;  2FMC A;  1N33 L;  3CMA A;  2JA8 G;  2ZM6 L;  4DNR B;  4R8I A;  2MPM A;  1YIJ A;  4X66 L;  4M1U B;  4LMQ D;  2F0G A;  4LUO A;  3WOF A;  2LXJ A;  1BQQ T;  4ZKB B;  1WTR A;  4A3D G;  4JBK A;  3F2C A;  1VQO A;  4N9P A;  4HID A;  3PIP 3;  3OPO A;  1PDQ A;  3D3R A;  3G7L A;  2F3I A;  1WCM B;  5G3L D;  3DWQ A;  3VR4 A;  1S72 A;  3T56 B;  1P16 A;  2E5L Q;  5IGE A;  1B7Y B;  1R9T H;  2Y0S G;  3DM3 A;  2BDO A;  4DUZ L;  4A3C G;  1N32 L;  1JCK B;  4PQX A;  4AQY L;  2L12 A;  4OWX B;  2CWA A;  3S1R B;  1M1K C;  1FYC A;  2B39 A;  5ISR A;  4LF4 L;  2WP8 J;  2A74 C;  2NZH A;  1VQD A;  2KHS A;  1FR3 A;  2BCO A;  3EFX D;  4GN5 A;  3VYT A;  2XWJ B;  3I55 A;  1F2Y A;  2NZO A;  1B70 B;  3CPW A;  4B3T L;  2B63 B;  2L5T A;  1HZC A;  4HJ5 A;  1D7Q A;  1U4M A;  2R6G A;  4APV A;  1SYC A;  3S1R H;  5FLX E;  2C5C A;  2QCP X;  2P5Z X;  2ALY B;  2VXW A;  3OTO Q;  2Q2T A;  1XNQ L;  3GP7 A;  3NQT A;  5IGG A;  2YTX A;  1QOH A;  2RDG A;  3K0Y A;  3SHL A;  2B63 H;  2F0U A;  1STA A;  2B2Y A;  3DMU A;  3HEJ A;  3KJO A;  2LY7 A;  2PW5 A;  4JYA L;  2BA1 A;  2QIL A;  1B9N A;  4KTA A;  2Q8T A;  2UXC L;  4EVO A;  3BDC A;  4OX9 L;  4EQN A;  4EQ5 A;  3F2B A;  1VQE A;  5J39 A;  1ASY A;  1OTC A;  1SDF A;  4CHT B;  2CH4 A;  2DNE A;  2DY8 A;  4B3M L;  4XQJ A;  5K36 H;  5IOD A;  4G7O C;  3J81 j;  1EEF D;  3K7U C;  1PYW D;  1Y1W G;  4L63 B;  5KEE A;  4YY3 Q;  4PZ6 A;  1PYB A;  4C3I G;  3I4M G;  4A3K G;  2G5D A;  2R7D A;  3TME A;  2DUD A;  4DV7 Q;  4DV5 Q;  4XYQ A;  1X3Q A;  3TP6 A;  2H1E A;  1WTO A;  4UY8 C;  1G2S A;  2F1M A;  3QWN A;  2UUA L;  2EYL A;  2HDL A;  4XQN A;  5K5P A;  5GAE C;  4HR7 B;  5JPM C;  4IPH A;  4NB3 A;  4IJL A;  2DNC A;  2EYO A;  5I4D A;  5M5W B;  4DV1 L;  5IOC A;  1STN A;  5M9O A;  1BKB A;  1HNW Q;  2G9H D;  3ICE A;  4MN3 A;  1KAW A;  1SYD A;  1YNN C;  4A3E G;  3EJI A;  1PZI D;  3U9S A;  1EYA A;  2MNA A;  3F2D A;  1ZXT A;  4FNF A;  2E8G A;  5M5W H;  2LS0 1;  4JCV E;  5CBE E;  4BA2 I;  4BY1 B;  1D5X C;  5IP9 G;  2OT2 A;  2Z1C A;  5LL6 S;  4UAI A;  2ZJP A;  3RN2 A;  1WVL A;  2E76 C;  2A69 D;  4L5T A;  2XRS D;  1X65 A;  2KVM A;  5FLX L;  1WCM G;  1PH9 A;  1B1Z A;  5C4H A;  2EY6 A;  3PUZ A;  2XN9 C;  4BY1 H;  1IBK L;  3IRB A;  5IT9 L;  4A3B G;  4ALP A;  3PIP A;  5JVG 3;  1WTV A;  2WKC A;  3DEP A;  1XMO L;  1DJR D;  5F2D A;  2L9H A;  2NN6 H;  1LTA D;  1EWH A;  1IL8 A;  3HKZ G;  1E22 A;  3MZ5 A;  1IXR A;  1YJW A;  1RTO A;  2JYO A;  1SRO A;  4R4I A;  2D0O A;  4QF4 A;  4K8I A;  5EPL A;  3KLS X;  2BE5 D;  1C8C A;  3TZU A;  3TEH B;  3FEW X;  4HIO A;  1BDO A;  2PZT A;  3MFG A;  2UU9 L;  2MJ8 A;  1CSP A;  4OWT B;  1Z47 A;  3A55 A;  2MGS A;  3ZYY X;  1BBW A;  5IE8 A;  2L1B A;  4HJ8 A;  1PH5 A;  3ULP A;  4U68 A;  1PV4 A;  2AUJ D;  1EQV A;  5CBA E;  1EY7 A;  2QA4 A;  4XTC S;  3KLW A;  1SEB D;  2OF1 A;  5FOB B;  1B8A A;  4MIU A;  1CK1 A;  3MWY W;  4ME5 A;  3E0J A;  1O7L A;  2J4X A;  1I4G A;  4LF5 L;  1YVC A;  2J0T D;  3HFZ B;  2HD3 A;  1TWH B;  1SYF A;  5KGU A;  5CV4 A;  4X65 Q;  3F1Z A;  3ER0 A;  5GAD C;  3LX0 A;  1EUJ A;  2B2T A;  3PF4 A;  2EE1 A;  2XGT A;  3OW2 A;  1KXL A;  4XXE A;  2IPK D;  3S24 A;  4KHP Q;  3K58 A;  1Y14 B;  1FJG Q;  1FD7 D;  3T4A C;  2F0P A;  4XIG S;  1N8R C;  5GAH C;  4E6I A;  2A6E D;  2VQF L;  1TWH H;  4A3I B;  1HA6 A;  4HED A;  1F2Z A;  2A69 C;  1E2V A;  2F0Q A;  4F7X A;  2XNA C;  1IL2 A;  3CU7 A;  1AN8 A;  4WJ3 M;  4RCN A;  4WRD A;  1FL0 A;  2SNM A;  4IPG A;  4JI6 L;  5LMN Q;  4UHV A;  2RA4 A;  4NXM L;  4DR6 Q;  4GKJ L;  1S5F D;  4WJ4 A;  4IO9 A;  4BBR G;  1N36 Q;  1SAP A;  2L0C A;  1S5D D;  2BE5 C;  1WTH A;  1CKN B;  1VQH A;  1EFW A;  1SLJ A;  4CKB A;  5C0X H;  1HRJ A;  4WJW A;  4BWG B;  5LHY 1;  4J8Q A;  5C6A A;  3HOV G;  1UE6 A;  1ILP A;  3QIA A;  2M9V A;  1S4Z A;  4IJH A;  5L37 A;  1PH6 A;  3SK8 A;  3K80 C;  1A2T A;  2O4X A;  2ZT9 C;  3IAY A;  3PO2 B;  1HNX Q;  1VQ7 A;  3AEV A;  2D2C C;  5KRU A;  1WJJ A;  3A0J A;  1QNU A;  4CKC A;  1V1Q A;  2JEA I;  1L1O B;  1CSQ A;  3PIO A;  4OIJ A;  1LAC A;  3NK9 A;  1CUK A;  4KK7 A;  4JI0 Q;  4TSS A;  4A3L H;  3NQI A;  1CA6 A;  1PMR A;  1WD1 A;  1TS5 A;  3PO2 H;  5I2Y A;  1NBW A;  2L55 A;  3V2T A;  3FKI B;  3LWE A;  4DXG A;  1LO5 D;  1ONL A;  3KF8 B;  5M3F B;  2ZJR A;  1EYD A;  3ONA B;  4TQU S;  1LLR D;  1O7Z A;  4RHS A;  1J5E L;  1EQR A;  4DK6 C;  4MHE A;  1TVX A;  4EGV A;  4A3J B;  2A6E C;  3P20 A;  4GKK Q;  1PTO F;  4B08 A;  1LT6 D;  2NUC A;  2NN6 I;  3R93 A;  3HOZ G;  3MXP A;  2WKD A;  3FKI H;  5M3M G;  3GTJ B;  2RVL A;  1CI3 M;  1Q8K A;  1R4Q B;  4BA1 I;  2EYJ A;  4L5Q A;  1GUG A;  4A3J H;  5AFW A;  1Y8P B;  3HOX G;  2LKV A;  2JA5 G;  2K5H A;  1XXG A;  3GTJ H;  3X3M A;  2DJF C;  3NHH A;  1ICF B;  1TT2 A;  4LNQ A;  4DV0 L;  3D6W A;  4XT1 B;  3QOJ A;  3TP8 A;  4FF4 A;  5ELO A;  2I46 A;  1CT1 D;  3A74 A;  2KHJ A;  4I7Z C;  4J6H A;  1AZP A;  3G6J B;  4X3T A;  1CM9 A;  2K5Q A;  1PH8 A;  1Y1V B;  3KOJ A;  3UDI A;  4C1N I;  4A3I G;  4LFC Q;  3EVQ A;  1J8I A;  4X64 Q;  4CDF C;  4A93 B;  2B2W A;  3OWF A;  1X3E A;  2FFK B;  4OO1 I;  4DR5 L;  3L9A X;  3A8K E;  1Y1V H;  3R2I A;  4KMU C;  4A4I A;  5FK9 C;  2HT1 A;  3W5O A;  4K5V A;  5FLM H;  1NR2 A;  1EYC A;  2FIN B;  3CCQ A;  4A93 H;  2UXB Q;  2Z8L A;  1B3A A;  3IFD A;  2N49 A;  5J1Z A;  4DR4 L;  2JA9 A;  1AH9 A;  2OEO A;  2SDF A;  3T16 A;  4GLA C;  3I73 A;  3TDQ A;  1PH2 A;  4PV1 C;  5FKA C;  4PMW A;  4HJA A;  4CJ1 B;  3S1N B;  1E24 A;  2EXD A;  2F52 A;  5BR8 L;  1JWM D;  3AU7 A;  5CR3 A;  2EY5 A;  4P73 A;  4IFD G;  3A5U A;  1MI2 A;  3F2U A;  4BBS G;  1VQG A;  2R7Z G;  3IFT A;  1LTR D;  3S1N H;  3J7A 5;  2VUM G;  4JV5 Q;  4AYB G;  3C2P A;  2QF7 A;  2WAQ G;  1E3P A;  2ASB A;  4HJ7 A;  2DY7 A;  2EJM A;  2JA7 G;  4V0B A;  2MP1 A;  1EY4 A;  2AQ2 B;  1SN8 A;  4UP7 A;  1ENF A;  1Y69 U;  4HAE A;  5FLX c;  1K8A C;  1JOQ A;  4A3G G;  3E6Z X;  1JE4 A;  5M3F G;  1GUS A;  2AWO A;  2HCI A;  2JN4 A;  1I4H A;  2PPB C;  3SK4 A;  3BZD B;  2BH2 A;  2NB0 A;  3ERO A;  4O1N A;  4LK1 C;  4BS9 A;  4DAY A;  4DNI A;  2K5W A;  4F88 A;  3SVM A;  2JA8 B;  2EQS A;  5EKK A;  2MUY A;  3J7A F;  2OXP A;  5BN3 A;  1YIT A;  3OIP A;  4PG3 A;  1HH2 P;  4K2K A;  4JC0 A;  4F8M A;  4DK3 C;  3CW2 C;  4HIK A;  1Z6H A;  3V96 A;  3K5L A;  4CDE C;  1B4O A;  1JE5 A;  1STH A;  4A3D B;  3U58 A;  1JB7 A;  5EPJ A;  1X6O A;  1XJV A;  2JA8 H;  2R92 B;  1VF5 C;  2ZXO A;  5BN4 A;  1CTM A;  4MTK A;  4P75 A;  1QZG A;  2ICE C;  1Q90 A;  4DV2 Q;  1QIL A;  1ZYR D;  2EYH A;  2Y0S B;  1PZJ D;  4G57 A;  4HN7 A;  4NKL A;  4A3D H;  2A5H A;  5A35 A;  3SDZ A;  2E5L L;  3VYU A;  2GA4 B;  3S2D B;  5D3D A;  1VCI A;  1PH3 A;  1I6H B;  2VQE Q;  1M90 C;  3ERS X;  3CCV A;  4A3C H;  5C4X G;  2WAC A;  4C3J G;  2PZU A;  1JB3 A;  4C3H G;  1PRT F;  4CKE A;  2F0K A;  2FJ2 A;  3S2D H;  2PQE A;  4IUV A;  4K6L A;  1CA5 A;  3QR8 A;  1LT4 D;  1YNX A;  1Y8N B;  1I6H H;  2NYZ D;  1K3B C;  1ESR A;  3OTO L;  2PNR C;  4KI0 A;  4IUN A;  1ESF A;  4JI2 Q;  3NBH B;  4YWL A;  3FDT A;  2AQ3 B;  4OWW B;  2YTY A;  3KBX A;  3I3C A;  2KEN A;  2B2V A;  4YHH Q;  4U67 3;  4YCU A;  5C5L A;  2Q8R E;  1PHJ A;  4X62 Q;  1VDZ A;  4LUZ A;  4OGQ C;  1EU4 A;  2KCC A;  2IHF A;  4NMZ A;  2HCC A;  1Y1W B;  1SE4 A;  3K7A B;  4XYO A;  5I6Y A;  3QJY A;  4UDU C;  2NVX B;  4C3I B;  4JBM A;  2KCN A;  3I4M B;  1ZYR C;  3KJP A;  4A3K B;  5M5X B;  2PQA B;  1L0X B;  4YY3 L;  5DLQ E;  1STB A;  2HHH Q;  4ZAI A;  1Y1W H;  3VDY A;  4HJ9 A;  3RLF A;  1ET9 A;  4DV5 L;  3RZD B;  1F9R A;  4KN7 C;  2NVX H;  4C3I H;  3KK7 A;  4R9W A;  2F4I A;  3I4M H;  4A3K H;  5IIF A;  4LFA Q;  5M5X H;  4FDB A;  1PH7 A;  1GUN A;  2JXM B;  1DXM A;  5IGC A;  4RA8 A;  2Q8I B;  2IX0 A;  3GD7 A;  4A3E B;  1UE1 A;  4JI1 Q;  2GVB A;  1BF4 A;  4GNX C;  3GV3 A;  1RCV D;  4DAP A;  1HNW L;  3RZD H;  2JE6 I;  3E9H A;  1AE3 A;  4JI5 Q;  4JOI A;  1VQC A;  1IBL L;  1EFI D;  1OXV A;  1A3T A;  1X3P A;  3I8Z A;  3U9O A;  2XRQ D;  4DV3 L;  5C3W A;  2R92 G;  4A3E H;  1J6Q A;  3FPP A;  3J81 L;  1VQA A;  3MHB A;  4H02 A;  3NXW A;  3NTI A;  3J7A V;  1QVF A;  2N3S A;  3X3N A;  1X55 A;  1HXY D;  4R4T A;  3BDL A;  2N78 A;  1BBU A;  4WOR A;  5IP9 H;  4A3B B;  3M4P A;  1NNX A;  2MO0 A;  1GVP A;  4DV6 L;  3HKZ B;  3T51 B;  1Q1B A;  3T1H L;  3H94 A;  1WCM H;  2KEC A;  3H3V I;  2ZJQ A;  3K59 A;  2XIW A;  1QUQ B;  4QY7 A;  1X54 A;  1BCP B;  4DAM A;  4NW2 A;  2OQK A;  4RGN A;  4A3B H;  4IUQ A;  1JOO A;  2EYM A;  4KY7 A;  1I94 Q;  1LTB D;  1YNN D;  5I9P A;  1CZW A;  4I65 A;  4M8A A;  4KY5 A;  3URY A;  1CQF A;  2DJG C;  5LL6 X;  3U4Z A;  4O42 A;  5J22 A;  1GHJ A;  5IT9 E;  4OXP A;  1S5C D;  3SK6 A;  1FNW A;  1I50 B;  2ICI A;  4FYD A;  3OYY A;  1U0L A;  1NTG A;  4RAU C;  4JI4 Q;  4QUC A;  5T1I A;  2K03 A;  4A3M G;  1SE8 A;  4OON A;  1J9O A;  3Q22 A;  5AJ3 Q;  5ELC A;  4DUY Q;  1A8V A;  3NWS A;  1K9M C;  2F0I A;  1I5F A;  1Q86 C;  1MHW C;  4X65 L;  1I50 H;  5EBD A;  4JI7 Q;  3C3L A;  2RCN A;  1HUM A;  4QIW B;  5JEA J;  1WTQ A;  4KHP L;  1FJG L;  1U5K A;  2HIV A;  2KEE A;  1TY2 A;  3D31 A;  1M4V A;  1RKN A;  1QB5 D;  1N34 Q;  5JJL A;  5JJI A;  4KJN A;  1G6P A;  2K04 A;  2K5N A;  1SMY D;  1K73 C;  4X3U A;  4BBR B;  5ELD A;  4ZCK A;  4IOA A;  4P71 A;  2D9U A;  1VQ5 A;  4DR6 L;  2NVY B;  1MJC A;  4JG2 A;  4RFB A;  1N36 L;  4K8J A;  2EDG A;  3VR2 A;  5C44 G;  3HOV B;  1XPU A;  1DD2 A;  4MTN A;  5DAU A;  2F3V A;  3S1M B;  2AMC B;  1B9M A;  4HCE A;  1D1K A;  2F03 A;  4BBR H;  1JMC A;  3CP0 A;  3EBE A;  4DFA A;  1M8A A;  5IGB A;  3OOC A;  1K8O A;  2NVY H;  1VMC A;  1N33 Q;  4JI8 Q;  3GV6 A;  1LT3 D;  2QEJ C;  4RGO S;  4XT3 B;  3HOV H;  4X66 Q;  3S1M H;  1TU2 B;  1EY0 A;  1VQI A;  3BZC A;  3OHX C;  3CC4 A;  2E2J B;  4GS3 A;  2GN5 A;  1LTS D;  2B2U C;  1OXT A;  1C7Y A;  1ZKO A;  2WB1 B;  4X6A H;  3FHW A;  1OXU A;  1BVS A;  5LMN W;  3C1E A;  1AZQ A;  1VQ8 A;  3L2P A;  2KA7 A;  1VQF A;  2EVB A;  3MXU A;  2E2J H;  3HS0 C;  1DON A;  3HOZ B;  3CCM A;  3ULJ A;  1YHB A;  2Z4I A;  5M3M B;  2R61 A;  2SOB A;  4IOC A;  4AQY Q;  4PMB A;  4O0A A;  4GKK L;  1K28 A;  2F4V Q;  1EU3 A;  4FP5 D;  2RDH A;  3FRP B;  1CKN A;  1Q12 A;  3K6O A;  4MZ9 A;  3HOX B;  4L6T B;  3D4R A;  1SMY C;  3HOZ H;  1SYG A;  4V19 0;  2NZ1 D;  1B50 A;  5M3M H;  2JA5 B;  5EPK A;  1HZ9 A;  2OQ0 A;  1XNQ Q;  5C4J B;  2RF4 A;  2K5D A;  4KN4 C;  2RBM A;  3HOX H;  2O5J C;  3C1F A;  2VS1 A;  5CV9 A;  3M4O B;  3TRZ A;  3GO5 A;  4ODG A;  1L1O A;  2JSO A;  2JA5 H;  3GQB A;  1TWF B;  2OCE A;  4ID6 A;  2OTL A;  3U50 C;  3S1Q B;  4GLX A;  1Q8I A;  2M00 A;  4JYA Q;  1JOR A;  5C4J H;  1S3O A;  4K6D A;  3MC0 B;  1B3Q A;  2KED A;  3OMG A;  4NDX A;  4ZRZ A;  5IYB G;  5DM6 3;  2UXC Q;  4FO2 A;  5FO7 B;  1U4R A;  1ROD A;  5KYI A;  3M4O H;  3KF8 A;  1IBM Q;  5IYC G;  1RJT A;  4KY6 A;  2CWP A;  1MD2 D;  4K14 A;  3L0O A;  1TWF H;  3NTK A;  4X64 L;  4IQZ A;  4B3R Q;  3S1Q H;  2OWO A;  1EYG A;  2YU9 B;  4WFN 3;  3K5M A;  4A3I H;  4JI3 Q;  2NBF A;  3FMC A;  3VYS A;  3CME A;  2H4O A;  3K5N A;  3D4D A;  3GTQ B;  3BVZ A;  3HOU G;  2B2T C;  1ENA A;  4KKS A;  3R2T A;  3EN2 A;  5CV7 A;  1AEX A;  2UXB L;  4CDD C;  1HFN A;  4DR1 L;  1X9N A;  1JR0 D;  1YHA A;  2YU9 H;  2JEB I;  1H9S B;  2ENB A;  1W3S A;  2UUC L;  2UUA Q;  3MXN B;  1SJE D;  5EKI A;  3OSO A;  2IT1 A;  3GTQ H;  4YCV A;  1OXX K;  5E1F A;  2A8V A;  4RHR A;  4DV1 Q;  4BBS B;  2R7Z B;  1EWC A;  3Q23 A;  3UE1 A;  5JVH 3;  1EIH A;  3S2H B;  1MSH A;  2K32 A;  2VUM B;  4A76 A;  1Z9F A;  4AYB B;  1BXT A;  3TP7 A;  1IKL A;  2WAQ B;  5I6W A;  4IFD H;  1H95 A;  2BA0 A;  3PGZ A;  4RKB A;  2JA7 B;  1DOK A;  4BBS H;  4JV5 L;  1SRU A;  5CV8 A;  1HUN A;  2R7Z H;  3J81 c;  1HJP A;  1YEZ A;  2EYF A;  1VQM A;  3B6Y A;  2KJX A;  2WB1 G;  2RKS A;  3G48 A;  3SXH A;  4ZUI A;  4A3G B;  5EAY A;  3S2H H;  2VUM H;  2NTS A;  4DR2 Q;  1YJ9 A;  3D8G A;  2Z6K A;  1XTD A;  4DV4 Q;  2JA7 H;  3ULL A;  5E7N A;  5GAG C;  3UDG A;  1VQB A;  3PUY A;  1WD0 A;  4IUT A;  1QNK A;  4OEM B;  3PQI A;  1GJX A;  4A3G H;  1A0I A;  1SNQ A;  5M3F H;  4FXK C;  4DAV A;  5CGK A;  2F0J A;  1PYS B;  2Z4H A;  1QVG A;  1C48 A;  3D4W A;  3NEM A;  4P72 A;  5C4Z A;  2K5V A;  2E2D C;  1PTO D;  4ILW A;  4QCL A;  2CQA A;  4BY7 G;  1LTI D;  1BOS A;  4QIW E;  1TXY A;  3ITP A;  1RL2 A;  5HY6 A;  1PLF A;  5I9O A;  3AFQ A;  4DGZ A;  5C3E G;  1GUT A;  4AH6 A;  3HOW G;  3J7Y W;  1F9Q A;  1ENC A;  3HG9 A;  4NXN Q;  4DR7 Q;  3WOE A;  1GOZ A;  3CKI B;  1EQQ A;  5CV5 A;  4KLK A;  2LFN A;  3K57 A;  2MFI A;  1Q46 A;  1K3R A;  4OHJ A;  4ABN A;  2QDL A;  3Q6S A;  3J81 i;  4JVZ A;  1IYV A;  3NSW A;  2K01 A;  1SE2 A;  4CGY B;  3UI2 A;  2D5D A;  3HKS A;  3LNN A;  1EIG A;  1KD1 C;  5C4X B;  2C35 B;  2ATW A;  1VMP A;  1WTP A;  2A68 D;  1IYU A;  2O2L D;  4IN3 A;  4KKU A;  4C3J B;  1WTX A;  2ZTD A;  2VY3 A;  2WII B;  4DN4 M;  3EQL C;  2VL6 A;  3GTG B;  4OO1 G;  4C3H B;  3RLO A;  3ERQ A;  4JW0 A;  2K75 A;  3MXG A;  2MHV A;  1I3Q B;  1UWV A;  2F0O A;  4IPD A;  5C4X H;  5J3B A;  4C3J H;  1VQK A;  3GTG H;  4C3H H;  2F0M A;  3M3Y B;  4JK1 C;  3S14 B;  5FJ8 G;  2J7Z A;  2CFM A;  3G4S A;  5JAV A;  1QCB D;  4RKL A;  4DNT B;  4JI2 L;  1I3Q H;  1LUZ A;  3NE5 B;  4UPA A;  3JAM E;  3H6M A;  1XYI A;  1LT5 D;  5C0X I;  3QB3 A;  4RG1 A;  1EY6 A;  1OXS C;  2F0W A;  2B2W C;  1E2Z A;  3M3Y H;  5KNB A;  3S14 H;  4Q5V A;  1PTO C;  2K1B A;  1L0Y B;  4ME3 A;  1H9M A;  4X62 L;  1A3V A;  2KUM A;  1HNZ Q;  1BR9 A;  3ND8 A;  3I4L A;  2AUK A;  5IP7 G;  1TS4 A;  1U4L A;  3FP9 A;  3EA6 A;  4UP8 A;  3NBI A;  4CJ2 C;  2L15 A;  1RF2 D;  3DXJ C;  4K5X A;  4BXX G;  4IFD I;  1Q82 C;  2QGQ A;  3CC2 A;  3H3V C;  2UXD L;  1JIC A;  1DGS A;  3DWP A;  4LF6 L;  3K0X A;  4A3F B;  1LTL A;  5LMU L;  5IT9 c;  2X69 A;  1NAP A;  1S5E D;  1A6X A;  1P8L A;  2FMM A;  4LF7 Q;  4B9W A;  1XMQ Q;  2A68 C;  3BYY B;  3SE0 A;  2V4D A;  3S17 B;  2XWB B;  4DF7 A;  1XPR A;  3OW7 A;  4C56 C;  3F8T A;  3L3O C;  1BNZ A;  2TMP A;  3CCE A;  2D0P A;  3NBH A;  3VYR A;  1HR0 Q;  1MIU A;  1L2F A;  3VA7 A;  1PTO B;  1E1O A;  4JI1 L;  1F2M A;  2UUB Q;  3BS1 A;  1E1T A;  1PVO A;  4R4C A;  5DEH A;  1KAB A;  3LGJ A;  1NCV A;  1TWC B;  4RWS C;  1XNR Q;  4O2D A;  4RH6 A;  3S17 H;  3HGB A;  5IYD G;  5HGT A;  1CKO A;  3Q8D A;  2LSS A;  3NPP A;  1BUV T;  1FNU A;  1WFQ A;  4HTH A;  5COY A;  1QG7 A;  2Z6B A;  2JQO A;  1K83 B;  3P1H A;  1KNE A;  3VR5 A;  1IW7 D;  1CHQ D;  5I2X A;  3NEN A;  4GOP C;  1TKW B;  2R92 H;  1U9R A;  1TWC H;  2IX1 A;  3TSS A;  1ICW A;  1SMX A;  3SR1 A;  2CVR A;  2B8G A;  4POF A;  2D62 A;  3CCJ A;  1VQ9 A;  4DV0 Q;  2PQA A;  1K83 H;  5KYL A;  1MSG A;  3JAM L;  3WWV A;  3DM1 A;  3UDF A;  1SJH D;  5A2Q E;  4OIK A;  3H15 A;  3J81 E;  4A75 A;  3AQQ A;  5C5M A;  3OIQ A;  1V1P B;  5ELF A;  1I94 L;  1KDA A;  1VF7 A;  4GN4 B;  3BU2 A;  2O5I C;  2E74 C;  1QZH A;  3TN2 A;  4GLV B;  3STB D;  2K05 A;  1PA6 A;  2A19 A;  1JC7 A;  4DR3 Q;  1PRT D;  4A3M B;  2WAQ E;  3I4N G;  4CDC C;  2EY1 A;  4JI4 L;  1GO3 E;  4GOP B;  4K0K Q;  3MEH A;  3PO3 B;  4R8N A;  2RSO A;  5C0X J;  3A7L A;  2WIN B;  5AJ3 L;  2KBN A;  1GD7 A;  4DUY L;  5JEA G;  3GTL B;  1UUP A;  4Q0F A;  4A3M H;  1NY4 A;  2LXK A;  1H9R A;  4JI7 L;  5FO9 B;  3KFU A;  2Z0S A;  3I2Z A;  1FNV A;  1AE2 A;  1DZ1 A;  3AFP A;  1EWI A;  2R93 G;  2IY5 B;  1F2L A;  3GTL H;  1IW7 C;  4EQP A;  1QUQ A;  3H0G G;  4KV6 A;  4LF9 Q;  2WFW A;  1D5Z C;  4IFD J;  4CJ0 B;  1DCZ A;  2CW0 D;  2ES2 A;  3K7A H;  2XSC A;  1VQJ A;  1N34 L;  4DV7 L;  1PXU A;  1ML0 D;  1CQV A;  3MA2 B;  3HOY G;  1N9W A;  2B2V C;  1HPC A;  4RCO A;  4A3F G;  2FHT A;  1H9K A;  1NUC A;  3TS2 A;  5E4W C;  5CC4 A;  5C44 B;  4H44 C;  3GTM B;  1STY A;  3KF6 B;  3L7Z C;  4DK0 A;  3S15 B;  3O13 A;  1NSN S;  3ND9 A;  3Q24 A;  2KOL A;  3SK5 A;  1SYE A;  5H1S E;  1STE A;  3GTO B;  1V1O A;  1F77 A;  4P2C B;  2IHE A;  5ELE A;  1KHI A;  5JOB A;  1HHV A;  1QE6 A;  5C44 H;  3GTM H;  5EKL A;  1G6Z A;  1K0S A;  3PUX A;  4IUP A;  3STB C;  1Y8O B;  2C9O A;  1EY5 A;  1I4R A;  5A2Q L;  4JI8 L;  4B3S Q;  4KJO A;  3M4Q A;  2LMC B;  3DWA A;  1PRT C;  1EY8 A;  2EY2 A;  3T13 A;  3GTO H;  2PMZ B;  3GDE A;  5G3L F;  3MTS A;  1RHP A;  1EZ8 A;  2F0E A;  3CRL C;  3KLS A;  1R9T B;  2YV5 A;  1GKH A;  2NVQ B;  3CXC A;  3T53 B;  3CC7 A;  1O78 A;  2AKW B;  1VQP A;  2SNS A;  2E2I B;  2KQ3 A;  4PZ8 A;  2L4N A;  4RMF A;  3W1B A;  4MNO A;  3M9B A;  4KKT A;  4JOI C;  2NVQ H;  4GNX B;  1PH1 A;  1SR3 A;  1C4Q A;  1SNC A;  5IGF A;  2BOS A;  2E2I H;  1A62 A;  2F4V L;  1U4P A;  3T1Y Q;  2AHO B;  2CW0 C;  4G7H C;  1TWG B;  1SNM A;  1WYD A;  4KHV A;  1GM5 A;  4LFB Q;  3H91 A;  2TSS A;  3OWE B;  1PRT B;  4IPC A;  3BVG A;  1UAP A;  3CAM A;  2JA6 G;  1HFG A;  2F0D A;  1MGS A;  1KL9 A;  1UE5 A;  2A73 B;  2F0V A;  3AMU A;  1TWG H;  3U4V A;  3PO3 G;  3R8B A;  1YHQ A;  1WI5 A;  4LF8 Q;  2IJ0 A;  3NEL A;  2RSN A;  3W3A A;  2L11 A;  4LW1 A;  4NPS A;  4K5W A;  5IWA Q;  2K28 A;  3QO2 A;  2IX3 A;  4AIM A;  1HZB A;  1JWU D;  4POG A;  1LYL A;  1LV9 A;  1AW7 A;  1Q1E A;  1D8L A;  3CRK C;  3I7F A;  1XTC D;  2A1A A;  4JBJ A;  5GQO A;  1GUW A;  2Q2I A;  1IBM L;  2B2Y C;  4EQO A;  1Q81 C;  3NWT A;  3CD6 A;  2KHI A;  1DOM A;  3KDF A;  5IYB H;  2F0S A;  2ZXR A;  4B3R L;  1IZ6 A;  5IYC H;  5LMN L;  1MJE A;  4H7B A;  3BG3 A;  4Y7N B;  3HOU B;  2PO4 A;  4JI3 L;  1KAA A;  3HP3 A;  4RGT A;  3CCU A;  2I5H A;  5KIX A;  4QB4 A;  2VB2 X;  2F0L A;  2H5X A;  1GHK A;  2Y0S E;  1VS0 A;  4N9T A;  2PZW A;  1V9P A;  5ELB A;  4Y7N H;  3HOU H;  2N88 A;  5EQ0 A;  3QOL A;  5GRO A;  4L5R C;  1SYB A;  4LJZ C;  1KLU D;  2ZM6 Q;  2B2U A;  1D2B A;  3RN5 A;  5BN5 A;  4C2M B;  1HNX L;  1TWA B;  5EBC A;  4N8X 1;  1X3F A;  1L0W A;  3DEO A;  1SBB B;  3W2D A;  3PIO 3;  3J80 E;  3AB9 A;  1IBL Q;  2F0N A;  4TKO B;  5DM7 3;  3DLL A;  1HQM C;  4DV3 Q;  4JI0 L;  4DA2 A;  1HZA A;  2QW7 A;  1KRT A;  5DNF A;  3RZO B;  3R3O A;  4FF2 A;  4C2M H;  4OL7 A;  1TWA H;  3D6C A;  2B8F A;  1EY9 A;  4HSP A;  3PF5 A;  3BVM A;  2I5L X;  3KUP A;  1E7Z A;  1D6E C;  1F9P A;  3VR6 A;  4DR2 L;  1DM0 B;  3KDF B;  4DUZ Q;  1IHZ A;  2V1C C;  1N32 Q;  1T5X D;  4DV4 L; 
#chains in the Genus database with same CATH homology
 3I90 A;  4GZY C;  4DU9 A;  5CV6 A;  1I4P A;  4BY7 B;  1AFP A;  1H9S A;  3MXN A;  1ILQ A;  1F9S A;  4DXF A;  5C3E B;  4ZQ3 A;  1PFN A;  2E75 C;  3HOW B;  1K8M A;  4HSV A;  4FF1 A;  4B9X A;  3P75 A;  2F0H A;  3E5S A;  3BYT B;  1BBX C;  2EPB A;  3NUC A;  4X3S A;  2NVT B;  1LAB A;  3A56 A;  1HA5 A;  5D14 A;  4J1M A;  2BDN A;  5K36 G;  4KHZ A;  3HRZ C;  5KNC A;  1DOL A;  3TP5 A;  5T1G A;  1FGB D;  1D1I A;  3DUZ A;  1PFM A;  1QWY A;  1YNJ D;  2QKI C;  1SXT A;  4OO1 H;  1E2W A;  1WTW A;  2R3Z A;  1O80 A;  2F0F A;  3HZX A;  1AP0 A;  3LWU A;  3J80 L;  1O7Y A;  1SFO B;  4ZK9 B;  3A8J E;  4XDX A;  2IL8 A;  2EXZ A;  1EEI D;  1LTT D;  2EJG C;  2PW7 A;  1GXD C;  1G91 A;  1DYQ A;  1II3 A;  4XQQ A;  4G4K A;  1I4Q A;  2PYK A;  5CYU A;  3PMF A;  2X6L A;  1A3U A;  3OMC A;  2CHB D;  3TBI B;  1SNO A;  5IGD A;  5EJW A;  2EYP A;  3NTH A;  1RTN A;  1W6K A;  2NN6 G;  2XVS A;  3M7G A;  2DN8 A;  1JWS D;  1GUO A;  1ET6 A;  1TII D;  3PUW A;  4ULL A;  3RMH A;  2VNU D;  1KDB A;  1NR4 A;  1OO9 B;  1ZEQ X;  3N6R A;  2E2H B;  3GTP B;  5EGT A;  3M85 A;  1HTL D;  2K7V A;  2ZXP A;  3CQZ B;  1YNJ C;  1B2T A;  1KNA A;  4IUR A;  3RUZ A;  2RQX A;  4Z9C B;  3C46 A;  1HCZ A;  3IKJ A;  1JOK A;  1TY0 A;  3PUV A;  4KD3 A;  5CMD A;  3FPU B;  2QDB A;  2I07 B;  4KD4 A;  4K2L A;  3S9W A;  1BO0 A;  5KND A;  1IKM A;  2EOT A;  1E0B A;  1EOT A;  3PV0 A;  2IW3 A;  2VB3 X;  2M2L A;  1A2U A;  2EJF C;  4S3S A;  3K5O A;  1A15 A;  2HDM A;  1V8Q A;  5JPN C;  3I4N B;  2SEB D;  2K33 A;  5C0X G;  4ZUJ A;  3WDN A;  1PFB A;  3I70 A;  4QMG A;  2WV6 D;  1HQR D;  1RDP D;  2NTT A;  1KDC A;  2NWG A;  3VA5 A;  3KBG A;  2F3W A;  3V05 A;  1STG A;  2R93 B;  5JEA H;  5NUC A;  1RD9 D;  3H0G B;  4ZLT F;  1EZ6 A;  1EQT A;  3KLR A;  4HMJ A;  4NP5 A;  1XWE A;  4IAL A;  3HOY B;  4HMI A;  4TRD A;  3Q0A A;  1EL0 A;  1Q3L A;  1V1P A;  4LAA A;  2AWN A;  3H09 A;  4PMC A;  4RGM A;  1MBY A;  1T5E A;  1CFM A;  5D3I B;  4DK1 A;  1I6V C;  2JP1 A;  5D65 A;  5JJZ A;  1TQO A;  1SE3 A;  1KLG D;  2YYZ A;  4QUF A;  3I91 A;  1UEA B;  1V43 A;  1Z7T A;  5FO8 B;  5HUR A;  4CBV A;  1G29 1;  1PTO H;  2HUG A;  2AQ1 B;  4H13 C;  4FVM A;  1LTG D;  1B53 A;  2G9D A;  1KTK A;  1G2T A;  4L8J A;  3TZD A;  3QG1 A;  1CHP D;  3MFY A;  3GTK B;  4YIJ A;  3FVQ A;  4PNY A;  1I4X A;  5C3X A;  4IUU A;  1BCP F;  1PZK D;  5M5Y B;  3BDO A;  1H9J A;  2EZV A;  5E3F A;  3RD4 A;  3S16 B;  1SNP A;  2IWH A;  4G7Z C;  2A6H D;  2PCF B;  3SEB A;  1BCP D;  5COR A;  1R4P B;  4F87 A;  2F0T A;  2JA6 B;  1SND A;  3MVV A;  3A7A B;  1UNS A;  3A54 A;  4IZ8 A;  3N52 A;  2X6G A;  1G8Z D;  4FF3 A;  1QJO A;  2ID0 A;  1D5M C;  1TR5 A;  1X32 A;  1JQY D;  2HQE A;  3M7N A;  4FXG C;  3IL8 A;  5TSS A;  3VR3 A;  3CHB D;  3P7J A;  4JBW A;  4C1N K;  4HCS A;  1TS2 A;  1XX8 A;  3NP8 A;  4ZYS A;  4FXD A;  1B44 D;  1TS3 A;  3I72 A;  1CZG A;  1S5B D;  3DHQ A;  1HTP A;  4ZKC B;  4X3K A;  5E4X A;  2N55 A;  2RDF A;  3MAQ A;  3A8I E;  4H0L C;  2K6A A;  2A6H C;  1SSO A;  3M4Y A;  1W6J A;  1BCP C;  2FMC A;  4DNR B;  4R8I A;  2MPM A;  4M1U B;  4LMQ D;  2F0G A;  3WOF A;  1BQQ T;  4ZKB B;  1WTR A;  4N9P A;  3PIP 3;  3OPO A;  1PDQ A;  3D3R A;  3G7L A;  1WCM B;  5G3L D;  3DWQ A;  3VR4 A;  3T56 B;  5IGE A;  2BDO A;  1JCK B;  4PQX A;  2L12 A;  3S1R B;  1FYC A;  2B39 A;  5ISR A;  2WP8 J;  2A74 C;  2KHS A;  1FR3 A;  2BCO A;  3EFX D;  3VYT A;  2XWJ B;  1F2Y A;  2B63 B;  2L5T A;  1U4M A;  2R6G A;  1SYC A;  5FLX E;  2C5C A;  2QCP X;  2VXW A;  3GP7 A;  3NQT A;  5IGG A;  1QOH A;  2RDG A;  3K0Y A;  3SHL A;  2F0U A;  1STA A;  2B2Y A;  3DMU A;  3HEJ A;  2LY7 A;  2PW5 A;  2BA1 A;  2QIL A;  1B9N A;  4KTA A;  2Q8T A;  4EVO A;  3BDC A;  4EQN A;  5J39 A;  1SDF A;  4CHT B;  2DNE A;  2DY8 A;  5K36 H;  4XQJ A;  5IOD A;  4G7O C;  1EEF D;  1PYW D;  4L63 B;  5KEE A;  4C3I G;  3TME A;  4XYQ A;  1X3Q A;  3TP6 A;  2H1E A;  1WTO A;  1G2S A;  2F1M A;  3QWN A;  2EYL A;  2HDL A;  4XQN A;  5K5P A;  4HR7 B;  5JPM C;  2DNC A;  2EYO A;  5I4D A;  5M5W B;  5IOC A;  1STN A;  5M9O A;  2G9H D;  4MN3 A;  1SYD A;  1YNN C;  3EJI A;  1PZI D;  3U9S A;  1EYA A;  1ZXT A;  4FNF A;  2LS0 1;  5CBE E;  4BA2 I;  4BY1 B;  1D5X C;  2OT2 A;  2Z1C A;  5LL6 S;  4UAI A;  1WVL A;  2E76 C;  2A69 D;  2XRS D;  2KVM A;  5FLX L;  1B1Z A;  5C4H A;  2EY6 A;  3PUZ A;  2XN9 C;  5IT9 L;  1WTV A;  5JVG 3;  2WKC A;  3DEP A;  5F2D A;  1DJR D;  2L9H A;  2NN6 H;  1LTA D;  1EWH A;  1IL8 A;  3MZ5 A;  1RTO A;  2JYO A;  4QF4 A;  4K8I A;  5EPL A;  3KLS X;  2BE5 D;  1C8C A;  3TZU A;  3FEW X;  1BDO A;  2PZT A;  3MFG A;  2MJ8 A;  1Z47 A;  3A55 A;  2MGS A;  3ZYY X;  2L1B A;  4U68 A;  2AUJ D;  1EQV A;  5CBA E;  1EY7 A;  4XTC S;  1SEB D;  2OF1 A;  5FOB B;  4MIU A;  1CK1 A;  3MWY W;  4ME5 A;  3E0J A;  1O7L A;  2J4X A;  1I4G A;  2J0T D;  1TWH B;  1SYF A;  5KGU A;  5CV4 A;  3LX0 A;  2B2T A;  2EE1 A;  4XXE A;  2IPK D;  3K58 A;  1FD7 D;  3T4A C;  2F0P A;  4XIG S;  4E6I A;  2A6E D;  4A3I B;  1HA6 A;  4HED A;  1F2Z A;  2A69 C;  1E2V A;  2F0Q A;  4F7X A;  2XNA C;  3CU7 A;  1AN8 A;  4RCN A;  4WRD A;  2SNM A;  2RA4 A;  1S5F D;  1SAP A;  2L0C A;  1S5D D;  2BE5 C;  4CKB A;  5C0X H;  1HRJ A;  4WJW A;  4BWG B;  5LHY 1;  4J8Q A;  5C6A A;  1ILP A;  3QIA A;  2M9V A;  1S4Z A;  3SK8 A;  1A2T A;  2O4X A;  2ZT9 C;  3IAY A;  3PO2 B;  2D2C C;  5KRU A;  1QNU A;  4CKC A;  2JEA I;  4OIJ A;  1LAC A;  3NK9 A;  4KK7 A;  4TSS A;  3NQI A;  1CA6 A;  1PMR A;  1WD1 A;  1TS5 A;  5I2Y A;  2L55 A;  3V2T A;  3FKI B;  3LWE A;  4DXG A;  1LO5 D;  1ONL A;  5M3F B;  4TQU S;  1EYD A;  3ONA B;  1LLR D;  1O7Z A;  4RHS A;  4MHE A;  1TVX A;  4EGV A;  4A3J B;  2A6E C;  3P20 A;  1PTO F;  4B08 A;  1LT6 D;  2NUC A;  2NN6 I;  3R93 A;  3MXP A;  2WKD A;  3GTJ B;  2RVL A;  1CI3 M;  1R4Q B;  4BA1 I;  2EYJ A;  1GUG A;  5AFW A;  1Y8P B;  2LKV A;  1XXG A;  3X3M A;  3NHH A;  1TT2 A;  3D6W A;  4XT1 B;  3QOJ A;  3TP8 A;  4FF4 A;  2I46 A;  1CT1 D;  4I7Z C;  4J6H A;  1AZP A;  3G6J B;  4X3T A;  1CM9 A;  2K5Q A;  1Y1V B;  4C1N I;  3EVQ A;  1J8I A;  4A93 B;  2B2W A;  3OWF A;  2FFK B;  4OO1 I;  3L9A X;  3A8K E;  3R2I A;  4KMU C;  5FK9 C;  4K5V A;  1NR2 A;  1EYC A;  2FIN B;  2Z8L A;  1B3A A;  3IFD A;  5J1Z A;  2OEO A;  2SDF A;  3T16 A;  3I73 A;  3TDQ A;  4PV1 C;  5FKA C;  4PMW A;  4CJ1 B;  3S1N B;  1JWM D;  3AU7 A;  5CR3 A;  2EY5 A;  4IFD G;  1MI2 A;  3F2U A;  3IFT A;  1LTR D;  3C2P A;  2QF7 A;  2DY7 A;  2EJM A;  4V0B A;  2MP1 A;  1EY4 A;  2AQ2 B;  1ENF A;  1Y69 U;  4HAE A;  1JOQ A;  3E6Z X;  1JE4 A;  1GUS A;  2AWO A;  2HCI A;  1I4H A;  2PPB C;  3SK4 A;  3BZD B;  2NB0 A;  4F88 A;  3ERO A;  4O1N A;  4LK1 C;  4BS9 A;  4DAY A;  2K5W A;  3SVM A;  2JA8 B;  5EKK A;  2MUY A;  3J7A F;  2OXP A;  5BN3 A;  3OIP A;  4F8M A;  4K2K A;  1Z6H A;  3V96 A;  3K5L A;  1B4O A;  1STH A;  4A3D B;  5EPJ A;  2R92 B;  1VF5 C;  2ZXO A;  5BN4 A;  1CTM A;  2ICE C;  1Q90 A;  1QIL A;  1ZYR D;  2EYH A;  2Y0S B;  1PZJ D;  4G57 A;  4HN7 A;  4NKL A;  2A5H A;  5A35 A;  3SDZ A;  3VYU A;  2GA4 B;  3S2D B;  5D3D A;  1VCI A;  1I6H B;  2WAC A;  4C3J G;  2PZU A;  1JB3 A;  4C3H G;  1PRT F;  4CKE A;  2F0K A;  2FJ2 A;  2PQE A;  4IUV A;  4K6L A;  1CA5 A;  1LT4 D;  1Y8N B;  2NYZ D;  1ESR A;  2PNR C;  4KI0 A;  4IUN A;  1ESF A;  3FDT A;  2AQ3 B;  3KBX A;  3I3C A;  2B2V A;  4U67 3;  5C5L A;  2Q8R E;  1VDZ A;  4OGQ C;  1EU4 A;  2KCC A;  4NMZ A;  2HCC A;  1Y1W B;  1SE4 A;  3K7A B;  4XYO A;  5I6Y A;  3QJY A;  4UDU C;  2NVX B;  4C3I B;  2KCN A;  3I4M B;  1ZYR C;  4A3K B;  5M5X B;  1L0X B;  1STB A;  4ZAI A;  3RLF A;  1ET9 A;  3RZD B;  1F9R A;  4KN7 C;  3KK7 A;  4R9W A;  2F4I A;  5IIF A;  1GUN A;  2JXM B;  1DXM A;  5IGC A;  4RA8 A;  2Q8I B;  2IX0 A;  3GD7 A;  4A3E B;  1BF4 A;  3GV3 A;  1RCV D;  4DAP A;  2JE6 I;  1EFI D;  1OXV A;  1A3T A;  1X3P A;  3I8Z A;  3U9O A;  2XRQ D;  5C3W A;  3FPP A;  3J81 L;  3MHB A;  3NXW A;  3NTI A;  3J7A V;  3X3N A;  1HXY D;  3BDL A;  4WOR A;  4A3B B;  3HKZ B;  3T51 B;  1Q1B A;  3H94 A;  2KEC A;  3K59 A;  2XIW A;  1BCP B;  4NW2 A;  4RGN A;  4IUQ A;  1JOO A;  2EYM A;  4KY7 A;  1LTB D;  1YNN D;  5I9P A;  1CZW A;  4I65 A;  4M8A A;  4KY5 A;  3URY A;  1CQF A;  5LL6 X;  4O42 A;  5J22 A;  1GHJ A;  5IT9 E;  1S5C D;  3SK6 A;  1FNW A;  1I50 B;  2ICI A;  4FYD A;  4RAU C;  4QUC A;  5T1I A;  2K03 A;  1J9O A;  3Q22 A;  5ELC A;  3NWS A;  2F0I A;  5EBD A;  3C3L A;  1HUM A;  4QIW B;  5JEA J;  1WTQ A;  2KEE A;  1TY2 A;  3D31 A;  1M4V A;  1RKN A;  1QB5 D;  4KJN A;  2K04 A;  1SMY D;  4X3U A;  4BBR B;  5ELD A;  2D9U A;  2NVY B;  4RFB A;  4K8J A;  2EDG A;  3VR2 A;  3HOV B;  1DD2 A;  5DAU A;  2F3V A;  3S1M B;  1B9M A;  4HCE A;  1D1K A;  2F03 A;  4DFA A;  1M8A A;  5IGB A;  3OOC A;  1K8O A;  1VMC A;  3GV6 A;  1LT3 D;  2QEJ C;  4RGO S;  4XT3 B;  1TU2 B;  1EY0 A;  3OHX C;  2E2J B;  1LTS D;  2B2U C;  1OXT A;  1ZKO A;  2WB1 B;  1OXU A;  1AZQ A;  3C1E A;  2KA7 A;  2EVB A;  3MXU A;  3HS0 C;  1DON A;  3HOZ B;  2Z4I A;  5M3M B;  2R61 A;  2SOB A;  4PMB A;  1EU3 A;  4FP5 D;  2RDH A;  3FRP B;  1Q12 A;  3K6O A;  3HOX B;  4L6T B;  3D4R A;  1SMY C;  1SYG A;  4V19 0;  2NZ1 D;  1B50 A;  2JA5 B;  5EPK A;  5C4J B;  2K5D A;  4KN4 C;  2RBM A;  2O5J C;  3C1F A;  3M4O B;  5CV9 A;  3GO5 A;  4ODG A;  2JSO A;  3GQB A;  1TWF B;  4ID6 A;  3S1Q B;  1Q8I A;  2M00 A;  1JOR A;  4K6D A;  3MC0 B;  4NDX A;  2KED A;  3OMG A;  4ZRZ A;  5DM6 3;  4FO2 A;  5FO7 B;  1U4R A;  1ROD A;  5KYI A;  3KF8 A;  1RJT A;  4KY6 A;  1MD2 D;  4K14 A;  3NTK A;  4IQZ A;  2YU9 B;  4WFN 3;  3K5M A;  2NBF A;  3FMC A;  3VYS A;  2H4O A;  3K5N A;  3D4D A;  3GTQ B;  3BVZ A;  2B2T C;  1ENA A;  4KKS A;  3R2T A;  5CV7 A;  1AEX A;  1HFN A;  1JR0 D;  2JEB I;  1H9S B;  2ENB A;  1SJE D;  5EKI A;  3OSO A;  2IT1 A;  1OXX K;  5E1F A;  4RHR A;  4BBS B;  2R7Z B;  1EWC A;  3Q23 A;  5JVH 3;  1EIH A;  3S2H B;  1MSH A;  2K32 A;  2VUM B;  4AYB B;  1BXT A;  3TP7 A;  1IKL A;  2WAQ B;  5I6W A;  4IFD H;  2BA0 A;  4RKB A;  2JA7 B;  1DOK A;  5CV8 A;  1HUN A;  2EYF A;  2KJX A;  3SXH A;  2RKS A;  4A3G B;  4ZUI A;  2NTS A;  3D8G A;  3PUY A;  1WD0 A;  4IUT A;  1QNK A;  1GJX A;  1SNQ A;  4FXK C;  4DAV A;  5CGK A;  2F0J A;  2Z4H A;  1C48 A;  3D4W A;  5C4Z A;  2E2D C;  1PTO D;  4ILW A;  4QCL A;  2CQA A;  1LTI D;  1BOS A;  3ITP A;  1PLF A;  5I9O A;  4DGZ A;  1GUT A;  3J7Y W;  1F9Q A;  1ENC A;  3HG9 A;  3WOE A;  1GOZ A;  3CKI B;  5CV5 A;  3K57 A;  2LFN A;  4OHJ A;  4ABN A;  3Q6S A;  1IYV A;  3NSW A;  2K01 A;  1SE2 A;  4CGY B;  3UI2 A;  2D5D A;  3LNN A;  1EIG A;  5C4X B;  1VMP A;  1WTP A;  2A68 D;  1IYU A;  4C3J B;  2O2L D;  4IN3 A;  4KKU A;  1WTX A;  4DN4 M;  2WII B;  3EQL C;  3GTG B;  4OO1 G;  4C3H B;  3ERQ A;  3MXG A;  2MHV A;  1I3Q B;  2F0O A;  2F0M A;  3M3Y B;  4JK1 C;  3S14 B;  2J7Z A;  5JAV A;  1QCB D;  4RKL A;  4DNT B;  3NE5 B;  3JAM E;  3H6M A;  1XYI A;  1LT5 D;  5C0X I;  3QB3 A;  1EY6 A;  1OXS C;  2F0W A;  2B2W C;  1E2Z A;  5KNB A;  4Q5V A;  1PTO C;  2K1B A;  1L0Y B;  1H9M A;  1A3V A;  2KUM A;  1BR9 A;  3ND8 A;  3I4L A;  2AUK A;  1TS4 A;  1U4L A;  3EA6 A;  3NBI A;  4CJ2 C;  1RF2 D;  3DXJ C;  4K5X A;  4IFD I;  3H3V C;  1JIC A;  3DWP A;  4A3F B;  2X69 A;  1NAP A;  1S5E D;  1A6X A;  2FMM A;  4B9W A;  2A68 C;  3BYY B;  3SE0 A;  2V4D A;  3S17 B;  2XWB B;  4DF7 A;  3OW7 A;  4C56 C;  3L3O C;  1BNZ A;  2TMP A;  3NBH A;  3VYR A;  3VA7 A;  1PTO B;  1F2M A;  3BS1 A;  5DEH A;  1KAB A;  1NCV A;  1TWC B;  4RWS C;  4RH6 A;  3HGB A;  5HGT A;  1BUV T;  1FNU A;  3NPP A;  4HTH A;  5COY A;  1QG7 A;  1K83 B;  3P1H A;  1KNE A;  3VR5 A;  1IW7 D;  1CHQ D;  5I2X A;  1TKW B;  1U9R A;  2IX1 A;  3TSS A;  1ICW A;  3SR1 A;  2CVR A;  2B8G A;  2D62 A;  5KYL A;  1MSG A;  3JAM L;  3DM1 A;  1SJH D;  5A2Q E;  4OIK A;  3J81 E;  5C5M A;  3OIQ A;  1V1P B;  5ELF A;  1KDA A;  1VF7 A;  2O5I C;  2E74 C;  3TN2 A;  2K05 A;  1JC7 A;  1PRT D;  4A3M B;  2EY1 A;  3MEH A;  3PO3 B;  4R8N A;  2RSO A;  5C0X J;  3A7L A;  2WIN B;  5JEA G;  3GTL B;  1UUP A;  4Q0F A;  1H9R A;  5FO9 B;  1FNV A;  1DZ1 A;  1F2L A;  1IW7 C;  4EQP A;  4KV6 A;  1D5Z C;  4IFD J;  4CJ0 B;  1DCZ A;  2CW0 D;  2XSC A;  1PXU A;  1ML0 D;  1CQV A;  3MA2 B;  2B2V C;  1HPC A;  4RCO A;  2FHT A;  1H9K A;  1NUC A;  5E4W C;  5CC4 A;  5C44 B;  4H44 C;  3GTM B;  1STY A;  3L7Z C;  4DK0 A;  3S15 B;  3O13 A;  1NSN S;  3ND9 A;  3Q24 A;  2KOL A;  3SK5 A;  1SYE A;  1STE A;  3GTO B;  1V1O A;  1F77 A;  4P2C B;  5ELE A;  5JOB A;  1HHV A;  1QE6 A;  5EKL A;  1G6Z A;  3PUX A;  4IUP A;  1Y8O B;  2C9O A;  1EY5 A;  1I4R A;  5A2Q L;  4KJO A;  2LMC B;  3DWA A;  1PRT C;  1EY8 A;  2EY2 A;  3T13 A;  2PMZ B;  5G3L F;  3MTS A;  1RHP A;  1EZ8 A;  2F0E A;  3CRL C;  3KLS A;  1R9T B;  2NVQ B;  3T53 B;  1O78 A;  2SNS A;  2E2I B;  2KQ3 A;  2L4N A;  4KKT A;  1C4Q A;  1SNC A;  5IGF A;  2BOS A;  1U4P A;  2CW0 C;  4G7H C;  1TWG B;  1SNM A;  4KHV A;  3H91 A;  2TSS A;  3OWE B;  1PRT B;  3BVG A;  1UAP A;  1HFG A;  2F0D A;  1MGS A;  2A73 B;  2F0V A;  3AMU A;  3R8B A;  2IJ0 A;  2RSN A;  3W3A A;  2L11 A;  4K5W A;  2K28 A;  3QO2 A;  2IX3 A;  1JWU D;  1AW7 A;  1LV9 A;  1Q1E A;  3CRK C;  1XTC D;  1GUW A;  2B2Y C;  4EQO A;  3NWT A;  1DOM A;  2F0S A;  2ZXR A;  4H7B A;  3BG3 A;  4Y7N B;  3HOU B;  2PO4 A;  1KAA A;  3HP3 A;  4RGT A;  5KIX A;  4QB4 A;  2VB2 X;  2F0L A;  1GHK A;  4N9T A;  2PZW A;  5ELB A;  2N88 A;  5EQ0 A;  3QOL A;  1SYB A;  4LJZ C;  1KLU D;  2B2U A;  1D2B A;  5BN5 A;  4C2M B;  1TWA B;  5EBC A;  3DEO A;  1SBB B;  3W2D A;  3PIO 3;  3J80 E;  3AB9 A;  2F0N A;  4TKO B;  5DM7 3;  1HQM C;  4DA2 A;  5DNF A;  3RZO B;  3R3O A;  4FF2 A;  4OL7 A;  3D6C A;  2B8F A;  1EY9 A;  4HSP A;  3BVM A;  3KUP A;  1D6E C;  1F9P A;  3VR6 A;  1DM0 B;  1IHZ A;  1T5X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...