4WQOB

Structure of vhl-elob-eloc-cul2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into Cullin-RING E3 Ubiquitin Ligase Recruitment: Structure of the VHL-EloBC-Cul2 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Von Hippel-Lindau disease tumor suppressor
total genus 25
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wqoB00
3JVZX 2ZEQA 4ANVA 3KUZA 4BKSD 3VXWA 3QA8A 3PRZA 5J17A 4MGYE 2N7EA 4GU2A 4PYZA 1UELA 4ANWA 1E7UA 3PRPB 4MSMB 4JL9A 2J0JA 5CX3A 3RUIB 2KXJA 1YQBA 3ZNHB 2EMSA 4EZLA 2M17A 3DVNU 2HE7A 4EOYA 2IO1B 1U4AA 2ZVNA 1MG8A 3EFUA 4ZDVA 2G4SA 4W9FA 1M94A 1FXTB 3DVGX 3W1SA 2ZNVC 4JGHB 3OAWA 4AP4C 1ZKHA 1KJTA 3WAOA 1OEYJ 1UD7A 3HM3A 1V81A 3RCZA 1D3ZA 4BFRA 1WJ6A 2KDIA 2KJ6A 2K8BA 3JYUA 1LM8B 2L05A 4DXAB 2NCNA 1WY8A 2PPHA 3SDLC 5LXHA 3UQAA 3O65B 4XZ4A 1E8WA 3ZVVA 4E71A 2DENB 4NQKE 1RAXA 2D3GA 3AI5A 3A1QB 3WANA 2KWUB 5J2RA 2K1FA 2DZMA 4NPNA 3VFKA 4F8CB 1X1MA 4TKNA 3K9PB 3D32A 3A4SC 2JZZA 2ZVOA 3EC8A 3WALA 4MGIE 1WM3A 4M8MA 3V6CB 4DBGA 2EKEC 1E7VA 3H7PA 1YIWA 2KFKA 2O6VB 3GZNI 3M62B 2Z0EB 3ONSA 2KVRA 4HDOA 4KDLB 1P9DU 4AUQC 2C7MB 3DVGY 1UZXB 1OTRB 4GMVA 4KSKC 4NJ7A 4WAAA 5JZEB 3RULA 2CHWA 1H8CA 2XK5B 4NAWA 2BKRB 1ZGUB 2KFJA 2LGDA 4AWJA 1V86A 2Z59B 3ZRCA 1E8XA 2KANA 2LZ6A 3IBEA 4DK5A 2ASQA 2FIFA 2L76A 3A9JA 3BINA 3NZSA 3PSEB 4EFOA 2CR5A 3TJPA 2L8JA 4MJSA 3RYTA 5EDSA 2RGFA 1C1YB 3DVNV 3KUCB 3L0WB 5AEKB 3UIPB 2W9NA 3V60A 1XT9B 2PEAA 1R4MI 2LGYA 4A20A 2GBNA 2DHZA 3CMMB 2KDEB 5D2MB 3BY4B 3DBSA 1P1AA 4GDLA 4PYUA 2DAFA 2KMAA 2K39A 3UF8A 1GNUA 1ISNA 3PRMB 4JIOU 1P3QU 2KWCA 4HJKA 4IG7B 4BBNC 3JSVA 4YL8A 2M8SA 2JPHA 3QCAA 1RLFA 3AU5A 3N3KB 4KV2A 1L7YA 2KLCA 5AZFA 3ML8A 2JVCA 4I6NB 1Z2MA 2LXAA 3R66C 4NJ6A 4WWOA 2BF8B 3H7SA 2M0XA 2PE6B 4RMAA 5LLIA 5IA7A 1OGWA 4B95A 1E8YA 1WF9A 1V6EA 2OJRA 3DBRI 3ENEA 1WGYA 2CS4A 4XC2A 5GMVA 2LGXA 3Q3FA 5KHQA 3WIMA 1EF5A 2IBIB 4W9HA 2MLBA 2OOBB 2G45B 3N30A 4W9IA 5E6NA 4DHJD 2KQ7A 4MEMA 3B0AA 3ZUNA 4BVUC 2N4FA 3NHEB 3L54A 5JH5C 4KVGB 2HTHA 2A4ZA 4BBNF 5L95C 3VQIA 2MBHA 3EECA 3QAQA 2DYBA 3SU8X 3DOWA 4ANUA 2FCQA 2O2VA 4FJYA 1YD8U 2MP2B 2KTRA 3PTFC 1VCBA 3ZTDA 1OQYA 2VRRB 4ASWC 4IWOA 1E5WA 1WMHA 1WIAA 1KLVA 2NBWB 1V5OA 5DPSA 1WH3A 4WWNA 4P7IA 2LVPA 3HHMA 3I3TB 3WAPA 5AZGA 1WGDA 2GBRA 4ANXA 4WQOB 4AJWA 2MBBB 2R2QA 3KH0A 2CU1A 4K7SA 4AJYB 2J0KA 3ZIMA 4FJZA 3IVFA 2KKCA 1GJZA 5CTRC 5D94A 4F1SA 3ZKJC 1IYFA 2REXA 3WA0A 2WDTB 2BYEA 1EF1A 4GDKB 2MX2A 1WI0A 2KDFB 3LDZE 2DYOA 4LCDE 2MBQA 1TTNA 1R4NI 4IM3A 2CKHB 2KJHB 4EKUA 4GDKA 1TZ1A 4BOSC 2DZKA 1IP9A 3PZDA 3HIZA 3DDCB 5E6PA 3ZO5B 2GBMA 4M0WB 3UQBA 1JRUA 2DYMA 2FNJB 3AULA 2LVQA 3A9KA 3JSVB 2MWSB 4G3XB 2BWFA 3ZDTA 2MCNB 2D2QA 4BOZB 3ML9A 4IUMB 3QIJA 4TV3A 4W9JA 4FBJB 1WGRA 2L0FA 2NBVB 1E90A 2EMTA 1T0YA 4HCNB 4G50A 2C7NB 2RR9A 3TL5A 4F7ZA 3IFWB 5JHBA 1YX5B 3RZFA 4EUTA 3DBHI 3RT3B 1HE8A 2MSED 2N7DA 4II2B 3QX1A 4NAWB 2KHWB 4BKTA 2MP2A 3DQVA 3GOEA 2J7QB 3M3JA 3PREA 4ICUA 5L83A 3KYCD 2HD5B 1F9JA 1TBEA 4HXDA 3B08A 2ZPYA 2KFKB 2MBEA 1ZW7A 1WZ0A 1NBFC 2BGFA 2O6VA 2UWQA 2B3AA 3L17A 2LRUA 2DAJA 2BPSA 2DZIA 2JY6A 3L08A 4K7WA 3VTUA 3X0WA 1H4RA 2KMCA 3C0RB 1G6JA 2JUOA 3ECIA 3HM6X 4KSLC 2G3QB 2DZJA 2KZRA 2KX0A 3L10B 1IPGA 2AL6A 2C5LC 1I42A 4FN2A 3V62A 2AYOB 3JW0X 2XK5A 3VAWA 2R2OA 4FULA 2O2VB 5DPWA 3KVFB 1WGGA 4MGKE 1WYWB 1V80A 3L13A 2KNBA 3HK0A 4PS7A 1V9JA 3KW5B 4G0NB 4I6PA 1TGZB 4G11A 4ZYNA 3Q3JA 5BO4B 4DWFA 2N1VA 2K25A 4IM2A 4EZKA 2JZ3B 3PHXB 4GOCA 3A4RA 3R7QA 4MDKE 1P0RA 3VDZA 2L0TA 1Q5WB 2C9WB 4KIKB 3OJ4B 2A5UA 4HCPB 3ALBA 4ZRIA 3WAMA 1LQBA 3P2BA 2KTFA 4N9F4 2AEHA 3KYDD 1K8RB 4WJQA 3ZLZA 3OJ3A 4A3OA 2K8CA 1WX8A 3H9DA 2QHOA 4IC7B 1J19A 4ICVA 3VTVA 3X23A 3PLUA 3QARA 5JHAA 2AWTA 1WE6A 2HJ8A 3W1SC 2D10A 1S1QB 2KDBA 4MJSB 5E6OA 2K6QA 2NR2A 4GDLB 4BKSA 1WXMA 4B9KA 2KOXA 4FADA 4GGQA 4HK2A 4KDIC 1J0GA 4IM0A 1Y8RC 1SIFA 1YX6B 2FIDA 2JF5A 2MBOA 2V3SA 2YLMA 3B1LX 5CHWA 2JWZA 1QZEA 1Q0WB 3VH4B 3MJWA 5LXIB 1GG3A 2IY0B 2ZJDA 4DHZB 1WXAA 4WJPA 1EO6A 2V4LA 3VUYA 4GXBA 1WXSA 2ZZPB 4WJNA 3TBLD 4HLEA 3PLVA 3ZNID 2IO0B 2PJHA 3IG3A 2KQSA 4FA6A 2WX1A 1WX9A 3APFA 2M1MA 2WWZA 2ZPNA 2GMIC 4MH0E 2O6VD 1UH6A 3L16A 2KJRA 3CSTA 1WJ4A 3VVWB 1XQQA 1GUAB 2KWVB 1L2NA 1NI2A 3NZUA 4OVVA 3QJZA 3AXCA 5D7GA 4NQLB 3U7DA 2M4NA 4EZJA 4MM3A 4W9CA 2FUHB 2DX5B 2GOWA 4EEWA 3RZWC 4W9GA 1WE7A 4K81A 3N32A 3OLMD 4HVBA 1EUVB 3T9LA 1CMXB 2XBBC 3AU4A 2LD9A 3A9KB 4LDTB 4DDGD 4TUUA 2L7RA 3M63B 1LXDA 2L00B 5D6JB 4CYEA 1KOTA 5DCNA 3ZNGC 3VH3B 3DPDA 1WXVA 2BWES 2NBUA 3NY5A 3W1YA 2JXXA 3IHPC 2BYVE 1P98A 3ZDMC 4CHKA 3H6NA 3CF6E 2NPTA 4FHJA 3QK0A 4KZ0A 4PS8A 3UGBB 4GSWA 5FR6A 4PS3A 3PVLA 3RD2A 3ZRFA 4NNJB 5C23A 1RRBA 4II3B 3S2AA 2LXCA 1WR6E 3LJ3A 4GIVA 4WJOA 2WX0A 3DCGA 4W9LA 4WWPA 1E8ZA 1Q1OA 2N9EB 1WJUA 3APCA 2RSUA 3TMPB 1WZ3A 3T8MA 3U30A 2K6DB 2CHXA 5IAAC 3U8ZA 1KM7A 2IO3B 4W9KA 2IY1B 5DPRA 3APDA 2LVOA 3VTWA 2GBJA 1GC7A 1RFAA 1UBQA 1WRDB 3A1QA 4FHKA 3DBLI 1WMHB 1NDDA 4HWIB 1A5RA 3PV1A 2ZCCA 2IZVB 4TQ1A 2LRWA 4LJPB 2FCSA 2C60A 4XX5A 3ZW3A 1V2YA 4RM8A 4W9EA 2I1KA 4JQWC 1V49A 3SHQA 3UINB 4FJVB 1C3TA 3VUWA 5HKHA 3QHTA 4HPLB 4RM9A 5CHFA 5J18A 3H1UA 4I6LB 4CO7A 1WGHA 2Y5BB 2K8HA 4DHJB 4GN1A 3QC8B 3ZTCA 2KX3A 2WYQA 2ZCBA 4LDTD 2KN5A 4KIKA 2CHZA 2IO2B 2JRHA 2KC1A 2MQJA 5TR5A 4B6WA 4JLCA 2AL3A 2JRIB 2NS5A 2FCNA 2KK8A 5G2NA 4FLHA 2YVCA 3TCAA 1UGMA 4MGZE 4GB9A 1BT0A 4J6IA 2MA9B 1WM2A 4W9DA 2FAZA 2I1JA 2KC2A 2C7HA 3PS6A 2JT4B 2KLGA 2L3ZA 3A9JB 3PPAA 3ZNZB 4AOFA 1J8CA 2V1YA 1GC6A 3UIOB 3V61A 3EHVA 4DDID 3NS8A 1PQSA 2MW5A 2N9XA 1SGHA 4M8NA 5KHOA 2LASA 1XD3B 1WR1A 2D11A 2KTRB 3QWZB 4MSQB 5CHVC 3VHTC 4E3CA 2GBKA 4BKGA 4URKA 2LI5A 2N9PC 3PT2B 1WFYA 2LUEA 3NOBA 3K9OB 2FCMA 3M95A 3VUXA 1WJNA 3R7RA 3PHWB 3MTNB 5G55A 2N1WA 1Z5SB 4E74A 4X57B 4KZCA 3MHSD 2BYFA 3H7PB 2KD0A 2LJ5A 4NY0A 4DHZE 2NVUI 5C1ZA 3SD5A 1V5TA 3R3MA 2Z0DB 2LWPA 4MELA 2UYZB 2MRPA 4K7UA 4LJOB 1I35A 4HDQA 1YJ1A 1S3SG 2NPTB 2G4DB 1OEYA 3PGEA 4ZRKA 3CSFA 4ZRJA 3V6EB 2RPQA 5AZHA 5DPTA 2KO3A 4IWQA 4K1RB 4A3PA 4HPMB 2PE9A 2XEWA 2J0MA 2BKFA 1LFDA 4IWPA 3QQ8B 1AARA 4OVUA 1UBIA 2ZNVB 4TQ0A 3TIXA 2RD0A 1WX7A 2D07B 1SE9A 3KUDB 1VD2A 2IYDB 4IW0A 3A33B
chains in the Genus database with same CATH superfamily
2ZEQA 3VXWA 3QA8A 3MFGA 2N7EA 1UGJA 4PYZA 1UELA 2KN4A 1E7UA 4MSMB 1YQBA 4EZLA 4EOYA 4YSYB 1QILA 1U4AA 1MG8A 3DVGX 4O1NA 1ZKHA 1UD7A 5C2TB 2DNFA 4KKJA 3AEAB 4MH8A 3UQAA 1F1HA 3O65B 1L6UA 4E71A 1TYGB 2DENB 1RAXA 2D3GA 3WANA 2KWUB 4RGOS 5HI1A 2K1FA 1DYQA 4HEA1 3K9PB 3D32A 4HRSA 1XF5L 2V4IB 2QMTA 2KFKA 2O6VB 5D3DA 3M62B 4A9AA 3ONSA 3GE3C 4AUQC 4WAAA 4KSKC 5JZEB 5EE3A 3Q69A 4NAWA 2BKRB 4AWJA 5T8IA 3SFEB 1E8XA 2VZKD 3IBEA 4DK5A 3N20C 3A9JA 4JWSC 2CR5A 3TJPA 1WRIA 2IGDA 4MJSA 4H2AA 2QDFA 5EDSA 3KUCB 1ROEA 2OJWA 2W9NA 3UIPB 1XT9B 1R4MI 4PT5A 3CMMB 5D2MB 4PYUA 2KMAA 2K39A 1ISNA 4JIOU 1E7PB 1P3QU 4BBNC 4IG7B 2M8SA 1FIQA 3AU5A 3C8YA 4KV2A 1PGXA 4I6NB 2LXAA 1FEHA 5JXVA 3H7SA 2M0XA 5LLIA 5IA7A 5EE9A 1E8YA 4NJCA 3ENEA 1WGYA 1CJEA 3Q3FA 1EF5A 4MM3B 2V0GA 2WU2B 4MEMA 3ZUNA 3NHEB 3L54A 3AE6B 2WXPA 2FUG1 2A4ZA 3QAQA 2DYBA 1PYWD 3DOWA 3BVGA 2KT7A 2MP2B 1KH0A 2KTRA 1V1PB 1E5WA 1R4MB 3E9SA 1WIAA 3ZXRA 1KLVA 1RM6C 2WNMA 1WH3A 4WWNA 2LVPA 3HHMA 5AZGA 2LHDA 2R2QA 3KH0A 4WQMA 2LGIA 1FXAA 2J0KA 2V3NA 5CTRC 2REXA 3W2DA 3WA0A 1XCTL 3IAM1 3AV8A 4PK1A 2LMCA 3DHHC 1TZ1A 4BOSC 2DZKA 5E6PA 1VZ8A 3UQBA 2JU6X 3AULA 2BWFA 3ZDTA 4BOZB 3ML9A 1SBBB 4W9JA 3R2TA 1L4ZB 4FBJB 2NBVB 1ZUD2 1E90A 2EMTA 4HCNB 1AWDA 3TL5A 5JHBA 1YX5B 4YTNB 4EUTA 2WXLA 3RT3B 1JROA 2N7DA 4NAWB 4BKTA 3DQVA 2J7QB 3M3JA 3PREA 1YN4A 1FRRA 4BAXA 2ZPYA 3C0RB 1AW7A 4KSLC 4WWMA 3P1MA 2AL6A 3CWIA 1LGRA 3PZ7A 4FN2A 3V62A 2AYOB 3JW0X 2J53A 4LTUA 2R2OA 2BYTA 3L13A 2KNBA 4PS7A 3UI3A 1I4RA 4J3OD 4ZYNA 3Q3JA 2N1VA 3EUB2 4IM2A 5FR3A 2JZ3B 3R7QA 4MDKE 1P0RA 1Q5WB 2C9WB 1QT9A 3OJ4B 1YOVB 2V3PA 4LNOA 4MACA 1LQBA 3MC0B 4HKZE 2AEHA 4YSXB 1K8RB 4A3OA 3CIRB 2QHOA 3MC9A 3VTVA 1C78A 3QARA 2HJ8A 4MJSB 2DWQA 1V97A 4BKSA 2QCZA 2KVZA 4KDIC 1J0GA 1D5XC 2FIDA 5CHWA 4C7ZA 2JWZA 3VH4B 5BYSA 1UUPA 3AE5B 2ZZPB 4HLEA 1VLBA 3ZNID 1WSPA 2PJHA 4YSZB 1WX9A 2M1MA 1LO5D 1PGAA 1F0ZA 1L4DB 3L16A 1MJDA 2IPKD 1XQQA 1YQ3B 1E0ZA 2M4NA 4W9CA 1YJIA 3NRZA 1IUEA 2MJ3A 1C76A 3OLMD 4HVBA 3AE4B 1YN5A 1EUVB 4DXFA 3A9KB 3BK1A 4LDTB 2IGHA 4TUUA 1ZP0B 1SE4A 4YTPB 4CYEA 1TKEA 1WXVA 4C4VB 2YEPF 3W1YA 4JPSA 3IHPC 2BYVE 3CF6E 2SAKA 1L5PA 4GSWA 3PVLA 2W55A 2LGSA 3S2AA 1QF6A 2WX0A 1Q1OA 2RSUA 3T8MA 3ZGZA 5IAAC 3TEXA 2IO3B 4W9KA 2DBYA 3APDA 2RDHA 3B9JA 2LVOA 5HFYA 3A1QA 3DBLI 1NDDA 3PV1A 4TQ1A 4XX5A 2WXHA 4W9EA 3UINB 1EU4A 5HKHA 3L4PA 2Y5BB 2K8HA 1JWSD 4GN1A 3QC8B 3ZTCA 2WYQA 4KIKA 4L1BA 2JRHA 4JLCA 1F2RI 2FCNA 2KK8A 5G2NA 4RGNA 3TCAA 4GB9A 1BT0A 1JCKB 4W9DA 5AUIA 1V1OA 1JALA 2FAZA 4M0WA 3PS6A 3A9JB 5C3JB 2M0AA 1PQSA 2N9XA 4CQNA 4MSQB 2GBKA 2N9PC 3PT2B 2LUEA 2B76B 2SEBD 3K9OB 3VUXA 3PHWB 3MHSD 3VRBB 2KD0A 4OW0A 3SD5A 1V5TA 3AMZA 1SEBD 1YJ1A 2ON8A 2MHJA 4KGRA 3CSFA 4ZRJA 2WS3B 2RPQA 2KO3A 4K1RB 1LFDA 1UBIA 2ZNVB 4TQ0A 2RD0A 4IW0A 3NVYA 4ANVA 3AE1B 4M01A 3PRZA 5J17A 4MGYE 1HEZE 4GU2A 1JWAD 1HTQA 1XLNA 4JL9A 3RUIB 1VDVA 2EMSA 1SE2A 3DVNU 4QAYA 1I4QA 1M94A 1FXTB 3N1ZC 3WAOA 3RCZA 1D3ZA 2KDIA 1ZE3D 3JYUA 4DXAB 1L0XB 3SDLC 3WCQA 3V3XA 2JWUA 1E8WA 3ZVVA 1VRAB 1JMLA 2INCC 2DZMA 3VRAB 2JX5A 4F8CB 4TKNA 2INDC 3A4SC 2JZZA 2ZVOA 2I38A 5I4DA 2EKEC 1STEA 4AQ7A 3GZNI 3Q8AA 2KVRA 2JYEA 2C7MB 3DVGY 4GMVA 3RULA 2JSVX 1VJKA 1QOGA 1FMAD 1V86A 1C9FA 3ZQ4A 2WXKA 2Z59B 1GB4A 3ZRCA 2KANA 4RF0A 2LZ6A 2ASQA 3PSEB 1T6BX 3AEGB 2L8JA 1UWMA 3RYTA 2RGFA 5AEKB 3TEYA 3V60A 4A20A 1OQQA 1PFDA 3NZ3A 2K0PA 4GDLA 4XGAB 2FBWB 1T5XD 3AEFB 3BVMA 2Y5CA 1TJEA 4YL8A 1XCQL 2HTME 1RLFA 2MJDA 1L7YA 2R61A 1Z2MA 2CJNA 4WWOA 2KDMA 4RMAA 4IOIE 4YT0B 3NJTA 4A6QA 3KQ4A 4KKIA 4XC2A 3DBRI 2CS4A 5KHQA 3AECB 1CQVA 2MLBA 2OOBB 2G45B 4W9IA 5E6NA 2WXRA 3AEEB 3P42A 3B0AA 2RDBC 1BUIC 1UF0A 2N7JA 4ARCA 3EECA 3SU8X 2PVGC 5HHDG 1EWYC 4XYCA 1C4CA 3RNCC 4L2YA 1OQYA 3FKYA 1FD6A 2WLBA 4OHJA 2VZKB 5IN7A 2AQ1B 3EA6A 3I3TB 3WAPA 5AUKA 1WGDA 2MBBB 3AN1A 4AJYB 3ZIMA 4LNNA 2KKCA 1GJZA 4F1SA 2WDTB 2BYEA 1EF1A 2DYOA 1I4XA 1KLGD 3PZDA 3DWMA 4M0WB 2DYMA 3JSVB 2ACZB 2MWSB 4G3XB 2XNAC 4IUMB 4TV3A 2ZW0A 1OQRA 1ZOYB 2C7NB 2RR9A 3ETRA 3DBHI 2MSED 4II2B 3QX1A 2KHWB 2MP2A 1KLUD 2K3UA 3GOEA 3B08A 5IO9A 1ZW7A 1WZ0A 2UWQA 2B3AA 2LRUA 2LJIA 2MJEA 3L08A 2KMCA 4RCOA 2FE8A 3HM6X 1P7FA 2DZJA 2KZRA 3W5UB 3L10B 1IBXA 4ITKA 1HA5A 4RFBA 1I42A 1TS3A 2QJLA 2XK5A 4UDUC 5DPWA 1V80A 2Y5PA 1FO4A 1CK1A 1TT5B 1V9JA 3KW5B 5H8YE 4I6PA 5EE0A 5BO4B 2WXMA 2J42A 2LFIA 1FNWA 1B1ZA 2A5UA 3SFDB 4DQOC 3ALBA 2I2YA 3WAMA 3OWEB 5H92C 1BXTA 1ENFA 3ZLZA 3NUHB 1SJED 2K8CA 1WX8A 3H9DA 2AWTA 1WE6A 3U52E 3W1SC 5E6OA 2K6QA 2NR2A 4HK2A 4IM0A 1Y8RC 2V3SA 3RNBC 1QZEA 1F2RC 3MJWA 1GG3A 4DHZB 1OFFA 2V4LA 3VUYA 3LB8C 3BK2A 3IG3A 3Q8FA 2WWZA 2GMIC 4MH0E 3CSTA 1N62A 4S17A 4WH4A 1DOIA 1GUAB 2KWVB 1L2NA 4OVVA 2AQ3B 1HQRD 3Q8EA 4NQLB 3U7DA 4A90A 4EZJA 1J7AA 2YEPB 5D3IB 2GOWA 4EEWA 1WE7A 4K81A 3IXSA 2Z8LA 4DDGD 2L7RA 1LXDA 1ZDXA 5D6JB 2JZPA 3I9V1 4RGMA 1N61A 4N58A 4KGSA 2VH1A 3FAHA 2PW9A 1FCCC 3H6NA 1J7BA 2NPTA 4FHJA 4PS8A 3UGBB 4LLGM 2BB6A 3MP9A 4NNJB 5C23A 4GIVA 3LJ3A 4WJOA 2IDYA 4KGTA 2N9EB 3FILB 2ZW1A 1DOXA 3TMPB 3U30A 2K6DB 1FPYA 4TMAB 1UBQA 2G9HD 1F77A 2ZCCA 1TY0A 3ZW3A 3FILA 4JQWC 1I7HA 4HPLB 3H1UA 4I6LB 5GXGB 4ACFA 4LDTD 2K22A 2VH2A 4HPPA 3U2SC 2CHZA 2IO2B 2KC1A 4B6WA 2W54A 1R4NB 2JRIB 1I4HA 4WAFA 3R2IA 4FLHA 2YVCA 2LHEA 4MGZE 1C77A 1WM2A 2I1JA 2JT4B 2KLGA 2L3ZA 1GC6A 1PGBA 5LNK1 4M8NA 2LASA 4URKA 5CHVC 1WFYA 3NOBA 3AE8B 4E74A 4KZCA 4NY0A 2BYFA 3H7PB 2Z0DB 5IP4D 4K7UA 1I35A 1S3SG 1TZOA 1FXIA 4A3PA 2NTTA 2XEWA 2J0MA 2BKFA 3AE3B 3QQ8B 1AARA 2OHFA 3TIXA 1SE9A 5BYQA 2IYDB 4OVZA 5BMIA 2V9HA 4LNFA 3NVWA 1ET6A 2WXGA 2EELA 3O13A 2BVCA 3J9CA 4ANWA 3PRPB 4IKGA 3ZNHB 5CX3A 2KXJA 3SR6A 3TSSA 3KWLA 4XDCA 1A70A 1EU3A 1MHHE 2M17A 2D3CA 2BQQA 2G4SA 4W9FA 4C80A 3W1SA 2ZNVC 4AP4C 1WWTA 1OEYJ 1V81A 3LYYA 4BFRA 1WJ6A 2K8BA 1LM8B 2W82A 1WY8A 5LXHA 4TSSA 3TEZA 2W3RA 4NQKE 4RGTA 1VR9A 4NPNA 3AE9B 2N9KA 1X1MA 3SEBA 1SIJA 4WIPA 3EC8A 1TKGA 1WM3A 3V6CB 1EWCA 4DBGA 3RMKC 4Q2JA 2RPVA 2WDRB 4B0EA 2Z0EB 5FK9C 4KDLB 1P9DU 2L1AA 1OTRB 3TEWA 1WXQA 1H8CA 3MJ5A 2XK5B 2LGDA 1ZGUB 2KFJA 1GB1A 1VZ6A 2H88B 2FIFA 2L76A 3NZSA 3V05A 2IJ0A 4D2KA 3DVNV 1C1YB 3BZDB 2LGYA 4P16A 2GBNA 3Q6BA 4L23A 3DBSA 1P1AA 3H8HA 2DAFA 4EE2A 1XO3A 3DWGC 2WXFA 4HKQA 4HJKA 2J4XA 5AZFA 2KLCA 2WXQA 4FXCA 1AN8A 3R66C 4NJ6A 3RNGC 2BF8B 1VZ7A 2EKIA 3HUIA 4B95A 4YTMB 1WF9A 3RNEC 3Q3MC 4MT5A 5GMVA 2BBCA 2LGXA 4REZA 1PUTA 3HVZA 1XLOA 2KQ7A 4BVUC 5JH5C 2N4FA 1XXGA 4N59A 2HTHA 3VQIA 4ANUA 1ZDVA 2O2VA 2PIAA 3AEDB 1VCBA 2VRRB 1SJHD 4IWOA 1Q10A 5FKAC 2NBWB 1V5OA 1TS4A 4A55A 2N9LA 4P1CC 4WQOB 4AJWA 3IVFA 1M4VA 5D94A 3ZKJC 2D3AA 3RI7C 4N6EB 3LDZE 3LXFA 2CKHB 2KJHB 4EKUA 4GDKA 4RH6A 1IP9A 3HIZA 3DDCB 5TSSA 1ACCA 4LNKA 3ZO5B 2FNJB 2LVQA 4US8A 2MCNB 3QIJA 1WGRA 2L0FA 1T0YA 5BMHA 4G50A 2LUMA 3RZFA 3N9YC 1HZ5A 1GPXA 2PVOD 4ICUA 5L83A 2MEKA 2CJOA 3I5JC 2KFKB 2MBEA 1NBFC 2O6VA 4K7WA 1D6EC 2DZIA 2BPSA 3KWVA 1H4RA 2M19A 1G6JA 1I4PA 2XN9C 2G3QB 2KX0A 3RNFC 1SE3A 3VAWA 1XLQA 2O2VB 4MGKE 1WYWB 3HK0A 1N5WA 2K5PA 3E56A 4G0NB 1FNUA 4P6VF 2E6XA 4C4VA 4DWFA 2K25A 3RFZB 4EZKA 4GOCA 3A4RA 1ZXHA 3EGRA 1YJJA 2ONQA 4ZRIA 3W5VB 3P2BA 2KTFA 4JX1C 1C79A 3KYDD 3OJ3A 1MFWA 1J19A 5JHAA 3BYYB 2D10A 1S1QB 2KDBA 2W3SA 3GP7A 3R8BA 2QEJC 2KOXA 5G5GA 2M56B 1FFVA 1YX6B 2MBOA 1RWSA 1Y56A 5LXIB 2IY0B 2ZJDA 1WXAA 1RFKA 4K3CA 4OZBA 4GXBA 1WXSA 4WJNA 1IGCA 2KQSA 1MPEA 4FA6A 3B2GA 2WX1A 4C56C 1E10A 3APFA 1V1PA 3Q3OC 1GOZA 1UH6A 1C4PA 3NZUA 3QJZA 5IOIA 1QQRA 1TS5A 1WGKA 2KACA 1N63A 5D7GA 1D5MC 2WU5B 4MM3A 1HZ6A 2GLSA 1K51A 4XWTA 3RZWC 1AYFA 1YN3A 1SB3C 3T9LA 1CMXB 1GAQB 2HDEA 2GB1A 4BZAA 3M63B 3AE7B 2J52A 1DOYA 2L00B 1KFYB 1KOTA 3ZNGC 4ZYSA 2N0SB 2BWES 2NBUA 2WP9B 2JXXA 2NMQA 4USAA 1P98A 3ZDMC 4CHKA 4P1BC 1QOAA 1D4BA 3QK0A 4B0MA 1T0SC 1XLPA 5FR6A 3RD2A 3ZRFA 3U4EG 1WR6E 3DCGA 4W9LA 1E8ZA 1QOBA 2WXNA 3Q2AC 1TY2A 1UNSA 1TKYA 1ESFA 2INNE 4XDDA 1FNVA 2X38A 2GBJA 1WRDB 4FHKA 1FFUA 1A5RA 2H89B 4LJPB 2FCSA 1QOFA 2C60A 4RM8A 1L0YB 1T3QA 3VUWA 1K53A 5CHFA 1FM0D 5J18A 1RYJA 4DHJB 2RDGA 2AX5A 3DHGC 2KX3A 2KN5A 2WGSA 5E6JA 2MQJA 5TR5A 5BYRA 2NS5A 2GI9A 2DLBA 2KMMA 1UGMA 1EM7A 2L83A 4ZRQA 2C7HA 3ZNZB 3UIOB 3EHVA 3VR8B 4DDID 3NS8A 2MW5A 3RNAC 5KHOA 2WDVB 3P4PB 1CZPA 4NZLB 3VHTC 4BKGA 2LI5A 2FCMA 3M95A 2PMVA 3R7RA 3W9CB 5G55A 2NVUI 4JE3B 2GRIA 2UYZB 2MRPA 4LJOB 3RPFC 1MVKA 4HDQA 3B2FA 3PGEA 3V6EB 4IWQA 3ZJVA 4HPMB 2PE9A 3GE8C 4OVUA 1N60A 4RNAA 3KUDB 1VD2A 3A33B 3JVZX 3FC4A 2BS4B 3KUZA 4BKSD 2TSSA 3BYTB 1JWBD 1YQ4B 2J0JA 4OZAA 2HE7A 2IO1B 3EFUA 2ZVNA 3C19A 4ZDVA 4NAMA 4JGHB 3OAWA 1KJTA 1F52A 3HM3A 1V8CA 2WXIA 2KAJA 2KJ6A 2L05A 2NCNA 1N5XA 2PPHA 2HJ1A 3P4QB 1WYGA 4XZ4A 4ZOHC 5J2RA 3AI5A 3A1QB 3AM9A 3VFKA 5G5HA 3GB1A 3WALA 4MGIE 4M8MA 2WXJA 1E7VA 3H7PA 1YIWA 1IBXB 4HDOA 3AH7A 1UZXB 4NJ7A 4M00A 1R7SA 2CHWA 1HXYD 1QKZA 1ZPSA 3BINA 4EFOA 4RF1A 1JQ4A 3L0WB 1XEEA 1K52A 2PEAA 3NVZA 3NS1A 2DHZA 2KDEB 3BY4B 1JW9D 3ZXVA 1NVID 3N1YC 3UF8A 1ZXIA 1GNUA 3PRMB 2KWCA 1T0QC 3JSVA 2JPHA 3QCAA 4US9A 3N3KB 3ML8A 2JVCA 4YXDB 2RMMA 3U7ZA 2PE6B 1I4GA 1OGWA 2PKOA 3PZ8A 1TS2A 1V6EA 2OJRA 3RN9C 3WIMA 2IBIB 4W9HA 3OG5A 3N1XC 3N30A 3I57A 1SXTA 2IGGA 2G1EA 4KVGB 2CU3A 4YWGG 1MI0A 4R3DA 4BBNF 5L95C 2MBHA 1FCLA 2FCQA 4FJYA 1YD8U 3T3OA 3PTFC 3BWUD 3ZTDA 3AEBB 4ASWC 3KLSX 1WMHA 2LEKA 2ICIA 3P63A 4S0RA 2KWDA 5DPSA 4P7IA 2PLPA 2GBRA 2L32A 4ANXA 4K7SA 2CU1A 4FJZA 4IDIA 1KTKA 1YNTE 4DXGA 1IYFA 1E6EB 4GDKB 2MX2A 1WI0A 2KDFB 3HVDA 4LCDE 2MBQA 1TTNA 1R4NI 4IM3A 2OEDA 3GZNB 1T0RC 1FRDA 2BS3B 2WXOA 2L52A 2GBMA 1JRUA 3A9KA 4C7YA 2UU7A 2D2QA 4HJGE 4ARIA 3AB5A 1TIFA 4F7ZA 3IFWB 1HE8A 1E9MA 4HROA 4A8XC 4ZHPA 3KYCD 2HD5B 1F9JA 4OZCA 1TBEA 3IT4B 4HXDA 1JRPA 1SSNA 3L17A 2BGFA 5C1ZA 3X0WA 2DAJA 2JY6A 3VTUA 2QILA 2JUOA 1IGDA 3ECIA 1MHXA 1D5ZC 1IPGA 4C00A 2C5LC 4FULA 3EFCA 1P7EA 3KVFB 1WGGA 1HTOA 2QIEB 3IAS1 2K9XA 1TGZB 3P4RB 4G11A 2JXTA 4LK0M 3PHXB 1B9RA 3VDZA 2L0TA 4KIKB 1PDXA 4HCPB 2X8XX 2KQ4X 5EE1A 2BW2A 4N9F4 2INPE 2D5GA 4WJQA 2JQRB 3AE2B 2D3BA 4IC7B 2MH7A 4ICVA 3X23A 3PLUA 3P4SB 2E3TA 4GDLB 1C4AA 1WXMA 4B9KA 4FADA 4GGQA 3ZJTA 1SIFA 3VR9B 2JF5A 5BMGA 1YMHE 2YLMA 3B1LX 1Q0WB 2BS2B 4WJPA 5HG2A 1EO6A 3IT6B 3TBLD 3BIID 3PLVA 2IO0B 2ZPNA 2O6VD 1NYRA 3T3NA 2KJRA 2Y3AA 1WJ4A 3VVWB 1KF6B 3GS2A 5IKCM 1NYQA 2PTLA 4AS1A 1NI2A 3DBLB 3AXCA 2BTEA 4GLSC 2FUHB 3URYA 2NTSA 2DX5B 3NG0A 4LNIA 4W9GA 1N6ZA 1NENB 3N32A 2XBBC 3AU4A 2LD9A 1J7CA 4WURA 5DCNA 3VH3B 3DPDA 4KX6B 3NY5A 3Q8BA 4ZRPA 3MC8A 3ZJUA 2KYWA 4XWWA 1ET9A 4KZ0A 1JWUD 4PS3A 3NVVA 2WDQB 1RRBA 2BB5A 4II3B 2LXCA 4M02A 4DHJD 4WWPA 1WJUA 3APCA 3I63C 1WZ3A 3Q8CA 2CHXA 3U8ZA 2QSDA 1KM7A 1JWMD 2IY1B 3PO0A 3ZYYX 5DPRA 2QC8A 2JYTA 3VTWA 4ZHOA 1GC7A 1RFAA 1KRHA 3DBHB 1WMHB 4HWIB 1MG4A 4K3BA 2IZVB 1SF0A 2LRWA 1NEKB 1V2YA 2BT6A 2I1KA 1V49A 3SHQA 4FJVB 2AQ2B 1C3TA 3MHZA 3QHTA 4RM9A 4CO7A 1WGHA 2ZCBA 3BVZA 2AL3A 1L6VA 1DGJA 4J6IA 2MA9B 3Q14C 2KC2A 1J8CA 1NI3A 3PPAA 4AOFA 2V1YA 3ABVB 3TUOA 3V61A 2WHIA 2WQYB 4JWUC 1SGHA 1XD3B 1WR1A 2D11A 2KTRB 3QWZB 4E3CA 3Q3NC 3HRDD 1WJNA 3MTNB 2N1WA 1Z5SB 4X57B 2LJ5A 4DHZE 4XE0A 3R3MA 4MELA 2LWPA 5MPOA 1K50A 2NPTB 2G4DB 1OEYA 4ZRKA 5AZHA 5DPTA 2Q5WD 4IWPA 1UWXA 1BMLC 3DBRB 3DHIC 1WX7A 2D07B 1L0VB 1QLBB
chains in the Genus database with same CATH topology
3JVZX 2ZEQA 4ANVA 3KUZA 4BKSD 3VXWA 3QA8A 3PRZA 5J17A 4MGYE 2N7EA 4GU2A 4PYZA 1UELA 4ANWA 1E7UA 3PRPB 4MSMB 4JL9A 2J0JA 5CX3A 3RUIB 2KXJA 1YQBA 3ZNHB 2EMSA 4EZLA 2M17A 3DVNU 2HE7A 4EOYA 2IO1B 1U4AA 2ZVNA 1MG8A 3EFUA 4ZDVA 2G4SA 4W9FA 1M94A 1FXTB 3DVGX 3W1SA 2ZNVC 4JGHB 3OAWA 4AP4C 1ZKHA 1KJTA 3WAOA 1OEYJ 1UD7A 3HM3A 1V81A 3RCZA 1D3ZA 4BFRA 1WJ6A 2KDIA 2KJ6A 2K8BA 3JYUA 1LM8B 2L05A 4DXAB 2NCNA 1WY8A 2PPHA 3SDLC 5LXHA 3UQAA 3O65B 4XZ4A 1E8WA 3ZVVA 4E71A 2DENB 4NQKE 1RAXA 2D3GA 3AI5A 3A1QB 3WANA 2KWUB 5J2RA 2K1FA 2DZMA 4NPNA 3VFKA 4F8CB 1X1MA 4TKNA 3K9PB 3D32A 3A4SC 2JZZA 2ZVOA 3EC8A 3WALA 4MGIE 1WM3A 4M8MA 3V6CB 4DBGA 2EKEC 1E7VA 3H7PA 1YIWA 2KFKA 2O6VB 3GZNI 3M62B 2Z0EB 3ONSA 2KVRA 4HDOA 4KDLB 1P9DU 4AUQC 2C7MB 3DVGY 1UZXB 1OTRB 4GMVA 4KSKC 4NJ7A 4WAAA 5JZEB 3RULA 2CHWA 1H8CA 2XK5B 4NAWA 2BKRB 1ZGUB 2KFJA 2LGDA 4AWJA 1V86A 2Z59B 3ZRCA 1E8XA 2KANA 2LZ6A 3IBEA 4DK5A 2ASQA 2FIFA 2L76A 3A9JA 3BINA 3NZSA 3PSEB 4EFOA 2CR5A 3TJPA 2L8JA 4MJSA 3RYTA 5EDSA 2RGFA 1C1YB 3DVNV 3KUCB 3L0WB 5AEKB 3UIPB 2W9NA 3V60A 1XT9B 2PEAA 1R4MI 2LGYA 4A20A 2GBNA 2DHZA 3CMMB 2KDEB 5D2MB 3BY4B 3DBSA 1P1AA 4GDLA 4PYUA 2DAFA 2KMAA 2K39A 3UF8A 1GNUA 1ISNA 3PRMB 4JIOU 1P3QU 2KWCA 4HJKA 4IG7B 4BBNC 3JSVA 4YL8A 2M8SA 2JPHA 3QCAA 1RLFA 3AU5A 3N3KB 4KV2A 1L7YA 2KLCA 5AZFA 3ML8A 2JVCA 4I6NB 1Z2MA 2LXAA 3R66C 4NJ6A 4WWOA 2BF8B 3H7SA 2M0XA 2PE6B 4RMAA 5LLIA 5IA7A 1OGWA 4B95A 1E8YA 1WF9A 1V6EA 2OJRA 3DBRI 3ENEA 1WGYA 2CS4A 4XC2A 5GMVA 2LGXA 3Q3FA 5KHQA 3WIMA 1EF5A 2IBIB 4W9HA 2MLBA 2OOBB 2G45B 3N30A 4W9IA 5E6NA 4DHJD 2KQ7A 4MEMA 3B0AA 3ZUNA 4BVUC 2N4FA 3NHEB 3L54A 5JH5C 4KVGB 2HTHA 2A4ZA 4BBNF 5L95C 3VQIA 2MBHA 3EECA 3QAQA 2DYBA 3SU8X 3DOWA 4ANUA 2FCQA 2O2VA 4FJYA 1YD8U 2MP2B 2KTRA 3PTFC 1VCBA 3ZTDA 1OQYA 2VRRB 4ASWC 4IWOA 1E5WA 1WMHA 1WIAA 1KLVA 2NBWB 1V5OA 5DPSA 1WH3A 4WWNA 4P7IA 2LVPA 3HHMA 3I3TB 3WAPA 5AZGA 1WGDA 2GBRA 4ANXA 4WQOB 4AJWA 2MBBB 2R2QA 3KH0A 2CU1A 4K7SA 4AJYB 2J0KA 3ZIMA 4FJZA 3IVFA 2KKCA 1GJZA 5CTRC 5D94A 4F1SA 3ZKJC 1IYFA 2REXA 3WA0A 2WDTB 2BYEA 1EF1A 4GDKB 2MX2A 1WI0A 2KDFB 3LDZE 2DYOA 4LCDE 2MBQA 1TTNA 1R4NI 4IM3A 2CKHB 2KJHB 4EKUA 4GDKA 1TZ1A 4BOSC 2DZKA 1IP9A 3PZDA 3HIZA 3DDCB 5E6PA 3ZO5B 2GBMA 4M0WB 3UQBA 1JRUA 2DYMA 2FNJB 3AULA 2LVQA 3A9KA 3JSVB 2MWSB 4G3XB 2BWFA 3ZDTA 2MCNB 2D2QA 4BOZB 3ML9A 4IUMB 3QIJA 4TV3A 4W9JA 4FBJB 1WGRA 2L0FA 2NBVB 1E90A 2EMTA 1T0YA 4HCNB 4G50A 2C7NB 2RR9A 3TL5A 4F7ZA 3IFWB 5JHBA 1YX5B 3RZFA 4EUTA 3DBHI 3RT3B 1HE8A 2MSED 2N7DA 4II2B 3QX1A 4NAWB 2KHWB 4BKTA 2MP2A 3DQVA 3GOEA 2J7QB 3M3JA 3PREA 4ICUA 5L83A 3KYCD 2HD5B 1F9JA 1TBEA 4HXDA 3B08A 2ZPYA 2KFKB 2MBEA 1ZW7A 1WZ0A 1NBFC 2BGFA 2O6VA 2UWQA 2B3AA 3L17A 2LRUA 2DAJA 2BPSA 2DZIA 2JY6A 3L08A 4K7WA 3VTUA 3X0WA 1H4RA 2KMCA 3C0RB 1G6JA 2JUOA 3ECIA 3HM6X 4KSLC 2G3QB 2DZJA 2KZRA 2KX0A 3L10B 1IPGA 2AL6A 2C5LC 1I42A 4FN2A 3V62A 2AYOB 3JW0X 2XK5A 3VAWA 2R2OA 4FULA 2O2VB 5DPWA 3KVFB 1WGGA 4MGKE 1WYWB 1V80A 3L13A 2KNBA 3HK0A 4PS7A 1V9JA 3KW5B 4G0NB 4I6PA 1TGZB 4G11A 4ZYNA 3Q3JA 5BO4B 4DWFA 2N1VA 2K25A 4IM2A 4EZKA 2JZ3B 3PHXB 4GOCA 3A4RA 3R7QA 4MDKE 1P0RA 3VDZA 2L0TA 1Q5WB 2C9WB 4KIKB 3OJ4B 2A5UA 4HCPB 3ALBA 4ZRIA 3WAMA 1LQBA 3P2BA 2KTFA 4N9F4 2AEHA 3KYDD 1K8RB 4WJQA 3ZLZA 3OJ3A 4A3OA 2K8CA 1WX8A 3H9DA 2QHOA 4IC7B 1J19A 4ICVA 3VTVA 3X23A 3PLUA 3QARA 5JHAA 2AWTA 1WE6A 2HJ8A 3W1SC 2D10A 1S1QB 2KDBA 4MJSB 5E6OA 2K6QA 2NR2A 4GDLB 4BKSA 1WXMA 4B9KA 2KOXA 4FADA 4GGQA 4HK2A 4KDIC 1J0GA 4IM0A 1Y8RC 1SIFA 1YX6B 2FIDA 2JF5A 2MBOA 2V3SA 2YLMA 3B1LX 5CHWA 2JWZA 1QZEA 1Q0WB 3VH4B 3MJWA 5LXIB 1GG3A 2IY0B 2ZJDA 4DHZB 1WXAA 4WJPA 1EO6A 2V4LA 3VUYA 4GXBA 1WXSA 2ZZPB 4WJNA 3TBLD 4HLEA 3PLVA 3ZNID 2IO0B 2PJHA 3IG3A 2KQSA 4FA6A 2WX1A 1WX9A 3APFA 2M1MA 2WWZA 2ZPNA 2GMIC 4MH0E 2O6VD 1UH6A 3L16A 2KJRA 3CSTA 1WJ4A 3VVWB 1XQQA 1GUAB 2KWVB 1L2NA 1NI2A 3NZUA 4OVVA 3QJZA 3AXCA 5D7GA 4NQLB 3U7DA 2M4NA 4EZJA 4MM3A 4W9CA 2FUHB 2DX5B 2GOWA 4EEWA 3RZWC 4W9GA 1WE7A 4K81A 3N32A 3OLMD 4HVBA 1EUVB 3T9LA 1CMXB 2XBBC 3AU4A 2LD9A 3A9KB 4LDTB 4DDGD 4TUUA 2L7RA 3M63B 1LXDA 2L00B 5D6JB 4CYEA 1KOTA 5DCNA 3ZNGC 3VH3B 3DPDA 1WXVA 2BWES 2NBUA 3NY5A 3W1YA 2JXXA 3IHPC 2BYVE 1P98A 3ZDMC 4CHKA 3H6NA 3CF6E 2NPTA 4FHJA 3QK0A 4KZ0A 4PS8A 3UGBB 4GSWA 5FR6A 4PS3A 3PVLA 3RD2A 3ZRFA 4NNJB 5C23A 1RRBA 4II3B 3S2AA 2LXCA 1WR6E 3LJ3A 4GIVA 4WJOA 2WX0A 3DCGA 4W9LA 4WWPA 1E8ZA 1Q1OA 2N9EB 1WJUA 3APCA 2RSUA 3TMPB 1WZ3A 3T8MA 3U30A 2K6DB 2CHXA 5IAAC 3U8ZA 1KM7A 2IO3B 4W9KA 2IY1B 5DPRA 3APDA 2LVOA 3VTWA 2GBJA 1GC7A 1RFAA 1UBQA 1WRDB 3A1QA 4FHKA 3DBLI 1WMHB 1NDDA 4HWIB 1A5RA 3PV1A 2ZCCA 2IZVB 4TQ1A 2LRWA 4LJPB 2FCSA 2C60A 4XX5A 3ZW3A 1V2YA 4RM8A 4W9EA 2I1KA 4JQWC 1V49A 3SHQA 3UINB 4FJVB 1C3TA 3VUWA 5HKHA 3QHTA 4HPLB 4RM9A 5CHFA 5J18A 3H1UA 4I6LB 4CO7A 1WGHA 2Y5BB 2K8HA 4DHJB 4GN1A 3QC8B 3ZTCA 2KX3A 2WYQA 2ZCBA 4LDTD 2KN5A 4KIKA 2CHZA 2IO2B 2JRHA 2KC1A 2MQJA 5TR5A 4B6WA 4JLCA 2AL3A 2JRIB 2NS5A 2FCNA 2KK8A 5G2NA 4FLHA 2YVCA 3TCAA 1UGMA 4MGZE 4GB9A 1BT0A 4J6IA 2MA9B 1WM2A 4W9DA 2FAZA 2I1JA 2KC2A 2C7HA 3PS6A 2JT4B 2KLGA 2L3ZA 3A9JB 3PPAA 3ZNZB 4AOFA 1J8CA 2V1YA 1GC6A 3UIOB 3V61A 3EHVA 4DDID 3NS8A 1PQSA 2MW5A 2N9XA 1SGHA 4M8NA 5KHOA 2LASA 1XD3B 1WR1A 2D11A 2KTRB 3QWZB 4MSQB 5CHVC 3VHTC 4E3CA 2GBKA 4BKGA 4URKA 2LI5A 2N9PC 3PT2B 1WFYA 2LUEA 3NOBA 3K9OB 2FCMA 3M95A 3VUXA 1WJNA 3R7RA 3PHWB 3MTNB 5G55A 2N1WA 1Z5SB 4E74A 4X57B 4KZCA 3MHSD 2BYFA 3H7PB 2KD0A 2LJ5A 4NY0A 4DHZE 2NVUI 5C1ZA 3SD5A 1V5TA 3R3MA 2Z0DB 2LWPA 4MELA 2UYZB 2MRPA 4K7UA 4LJOB 1I35A 4HDQA 1YJ1A 1S3SG 2NPTB 2G4DB 1OEYA 3PGEA 4ZRKA 3CSFA 4ZRJA 3V6EB 2RPQA 5AZHA 5DPTA 2KO3A 4IWQA 4K1RB 4A3PA 4HPMB 2PE9A 2XEWA 2J0MA 2BKFA 1LFDA 4IWPA 3QQ8B 1AARA 4OVUA 1UBIA 2ZNVB 4TQ0A 3TIXA 2RD0A 1WX7A 2D07B 1SE9A 3KUDB 1VD2A 2IYDB 4IW0A 3A33B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JVZ X;  2ZEQ A;  4ANV A;  3KUZ A;  4BKS D;  3VXW A;  3QA8 A;  3PRZ A;  5J17 A;  4MGY E;  2N7E A;  4GU2 A;  4PYZ A;  1UEL A;  4ANW A;  1E7U A;  3PRP B;  4MSM B;  4JL9 A;  2J0J A;  5CX3 A;  3RUI B;  2KXJ A;  1YQB A;  3ZNH B;  2EMS A;  4EZL A;  2M17 A;  3DVN U;  2HE7 A;  4EOY A;  2IO1 B;  1U4A A;  2ZVN A;  1MG8 A;  3EFU A;  4ZDV A;  2G4S A;  4W9F A;  1M94 A;  1FXT B;  3DVG X;  3W1S A;  2ZNV C;  4JGH B;  3OAW A;  4AP4 C;  1ZKH A;  1KJT A;  3WAO A;  1OEY J;  1UD7 A;  3HM3 A;  1V81 A;  3RCZ A;  1D3Z A;  4BFR A;  1WJ6 A;  2KDI A;  2KJ6 A;  2K8B A;  3JYU A;  1LM8 B;  2L05 A;  4DXA B;  2NCN A;  1WY8 A;  2PPH A;  3SDL C;  5LXH A;  3UQA A;  3O65 B;  4XZ4 A;  1E8W A;  3ZVV A;  4E71 A;  2DEN B;  4NQK E;  1RAX A;  2D3G A;  3AI5 A;  3A1Q B;  3WAN A;  2KWU B;  5J2R A;  2K1F A;  2DZM A;  4NPN A;  3VFK A;  4F8C B;  1X1M A;  4TKN A;  3K9P B;  3D32 A;  3A4S C;  2JZZ A;  2ZVO A;  3EC8 A;  3WAL A;  4MGI E;  1WM3 A;  4M8M A;  3V6C B;  4DBG A;  2EKE C;  1E7V A;  3H7P A;  1YIW A;  2KFK A;  2O6V B;  3GZN I;  3M62 B;  2Z0E B;  3ONS A;  2KVR A;  4HDO A;  4KDL B;  1P9D U;  4AUQ C;  2C7M B;  3DVG Y;  1UZX B;  1OTR B;  4GMV A;  4KSK C;  4NJ7 A;  4WAA A;  5JZE B;  3RUL A;  2CHW A;  1H8C A;  2XK5 B;  4NAW A;  2BKR B;  1ZGU B;  2KFJ A;  2LGD A;  4AWJ A;  1V86 A;  2Z59 B;  3ZRC A;  1E8X A;  2KAN A;  2LZ6 A;  3IBE A;  4DK5 A;  2ASQ A;  2FIF A;  2L76 A;  3A9J A;  3BIN A;  3NZS A;  3PSE B;  4EFO A;  2CR5 A;  3TJP A;  2L8J A;  4MJS A;  3RYT A;  5EDS A;  2RGF A;  1C1Y B;  3DVN V;  3KUC B;  3L0W B;  5AEK B;  3UIP B;  2W9N A;  3V60 A;  1XT9 B;  2PEA A;  1R4M I;  2LGY A;  4A20 A;  2GBN A;  2DHZ A;  3CMM B;  2KDE B;  5D2M B;  3BY4 B;  3DBS A;  1P1A A;  4GDL A;  4PYU A;  2DAF A;  2KMA A;  2K39 A;  3UF8 A;  1GNU A;  1ISN A;  3PRM B;  4JIO U;  1P3Q U;  2KWC A;  4HJK A;  4IG7 B;  4BBN C;  3JSV A;  4YL8 A;  2M8S A;  2JPH A;  3QCA A;  1RLF A;  3AU5 A;  3N3K B;  4KV2 A;  1L7Y A;  2KLC A;  5AZF A;  3ML8 A;  2JVC A;  4I6N B;  1Z2M A;  2LXA A;  3R66 C;  4NJ6 A;  4WWO A;  2BF8 B;  3H7S A;  2M0X A;  2PE6 B;  4RMA A;  5LLI A;  5IA7 A;  1OGW A;  4B95 A;  1E8Y A;  1WF9 A;  1V6E A;  2OJR A;  3DBR I;  3ENE A;  1WGY A;  2CS4 A;  4XC2 A;  5GMV A;  2LGX A;  3Q3F A;  5KHQ A;  3WIM A;  1EF5 A;  2IBI B;  4W9H A;  2MLB A;  2OOB B;  2G45 B;  3N30 A;  4W9I A;  5E6N A;  4DHJ D;  2KQ7 A;  4MEM A;  3B0A A;  3ZUN A;  4BVU C;  2N4F A;  3NHE B;  3L54 A;  5JH5 C;  4KVG B;  2HTH A;  2A4Z A;  4BBN F;  5L95 C;  3VQI A;  2MBH A;  3EEC A;  3QAQ A;  2DYB A;  3SU8 X;  3DOW A;  4ANU A;  2FCQ A;  2O2V A;  4FJY A;  1YD8 U;  2MP2 B;  2KTR A;  3PTF C;  1VCB A;  3ZTD A;  1OQY A;  2VRR B;  4ASW C;  4IWO A;  1E5W A;  1WMH A;  1WIA A;  1KLV A;  2NBW B;  1V5O A;  5DPS A;  1WH3 A;  4WWN A;  4P7I A;  2LVP A;  3HHM A;  3I3T B;  3WAP A;  5AZG A;  1WGD A;  2GBR A;  4ANX A;  4WQO B;  4AJW A;  2MBB B;  2R2Q A;  3KH0 A;  2CU1 A;  4K7S A;  4AJY B;  2J0K A;  3ZIM A;  4FJZ A;  3IVF A;  2KKC A;  1GJZ A;  5CTR C;  5D94 A;  4F1S A;  3ZKJ C;  1IYF A;  2REX A;  3WA0 A;  2WDT B;  2BYE A;  1EF1 A;  4GDK B;  2MX2 A;  1WI0 A;  2KDF B;  3LDZ E;  2DYO A;  4LCD E;  2MBQ A;  1TTN A;  1R4N I;  4IM3 A;  2CKH B;  2KJH B;  4EKU A;  4GDK A;  1TZ1 A;  4BOS C;  2DZK A;  1IP9 A;  3PZD A;  3HIZ A;  3DDC B;  5E6P A;  3ZO5 B;  2GBM A;  4M0W B;  3UQB A;  1JRU A;  2DYM A;  2FNJ B;  3AUL A;  2LVQ A;  3A9K A;  3JSV B;  2MWS B;  4G3X B;  2BWF A;  3ZDT A;  2MCN B;  2D2Q A;  4BOZ B;  3ML9 A;  4IUM B;  3QIJ A;  4TV3 A;  4W9J A;  4FBJ B;  1WGR A;  2L0F A;  2NBV B;  1E90 A;  2EMT A;  1T0Y A;  4HCN B;  4G50 A;  2C7N B;  2RR9 A;  3TL5 A;  4F7Z A;  3IFW B;  5JHB A;  1YX5 B;  3RZF A;  4EUT A;  3DBH I;  3RT3 B;  1HE8 A;  2MSE D;  2N7D A;  4II2 B;  3QX1 A;  4NAW B;  2KHW B;  4BKT A;  2MP2 A;  3DQV A;  3GOE A;  2J7Q B;  3M3J A;  3PRE A;  4ICU A;  5L83 A;  3KYC D;  2HD5 B;  1F9J A;  1TBE A;  4HXD A;  3B08 A;  2ZPY A;  2KFK B;  2MBE A;  1ZW7 A;  1WZ0 A;  1NBF C;  2BGF A;  2O6V A;  2UWQ A;  2B3A A;  3L17 A;  2LRU A;  2DAJ A;  2BPS A;  2DZI A;  2JY6 A;  3L08 A;  4K7W A;  3VTU A;  3X0W A;  1H4R A;  2KMC A;  3C0R B;  1G6J A;  2JUO A;  3ECI A;  3HM6 X;  4KSL C;  2G3Q B;  2DZJ A;  2KZR A;  2KX0 A;  3L10 B;  1IPG A;  2AL6 A;  2C5L C;  1I42 A;  4FN2 A;  3V62 A;  2AYO B;  3JW0 X;  2XK5 A;  3VAW A;  2R2O A;  4FUL A;  2O2V B;  5DPW A;  3KVF B;  1WGG A;  4MGK E;  1WYW B;  1V80 A;  3L13 A;  2KNB A;  3HK0 A;  4PS7 A;  1V9J A;  3KW5 B;  4G0N B;  4I6P A;  1TGZ B;  4G11 A;  4ZYN A;  3Q3J A;  5BO4 B;  4DWF A;  2N1V A;  2K25 A;  4IM2 A;  4EZK A;  2JZ3 B;  3PHX B;  4GOC A;  3A4R A;  3R7Q A;  4MDK E;  1P0R A;  3VDZ A;  2L0T A;  1Q5W B;  2C9W B;  4KIK B;  3OJ4 B;  2A5U A;  4HCP B;  3ALB A;  4ZRI A;  3WAM A;  1LQB A;  3P2B A;  2KTF A;  4N9F 4;  2AEH A;  3KYD D;  1K8R B;  4WJQ A;  3ZLZ A;  3OJ3 A;  4A3O A;  2K8C A;  1WX8 A;  3H9D A;  2QHO A;  4IC7 B;  1J19 A;  4ICV A;  3VTV A;  3X23 A;  3PLU A;  3QAR A;  5JHA A;  2AWT A;  1WE6 A;  2HJ8 A;  3W1S C;  2D10 A;  1S1Q B;  2KDB A;  4MJS B;  5E6O A;  2K6Q A;  2NR2 A;  4GDL B;  4BKS A;  1WXM A;  4B9K A;  2KOX A;  4FAD A;  4GGQ A;  4HK2 A;  4KDI C;  1J0G A;  4IM0 A;  1Y8R C;  1SIF A;  1YX6 B;  2FID A;  2JF5 A;  2MBO A;  2V3S A;  2YLM A;  3B1L X;  5CHW A;  2JWZ A;  1QZE A;  1Q0W B;  3VH4 B;  3MJW A;  5LXI B;  1GG3 A;  2IY0 B;  2ZJD A;  4DHZ B;  1WXA A;  4WJP A;  1EO6 A;  2V4L A;  3VUY A;  4GXB A;  1WXS A;  2ZZP B;  4WJN A;  3TBL D;  4HLE A;  3PLV A;  3ZNI D;  2IO0 B;  2PJH A;  3IG3 A;  2KQS A;  4FA6 A;  2WX1 A;  1WX9 A;  3APF A;  2M1M A;  2WWZ A;  2ZPN A;  2GMI C;  4MH0 E;  2O6V D;  1UH6 A;  3L16 A;  2KJR A;  3CST A;  1WJ4 A;  3VVW B;  1XQQ A;  1GUA B;  2KWV B;  1L2N A;  1NI2 A;  3NZU A;  4OVV A;  3QJZ A;  3AXC A;  5D7G A;  4NQL B;  3U7D A;  2M4N A;  4EZJ A;  4MM3 A;  4W9C A;  2FUH B;  2DX5 B;  2GOW A;  4EEW A;  3RZW C;  4W9G A;  1WE7 A;  4K81 A;  3N32 A;  3OLM D;  4HVB A;  1EUV B;  3T9L A;  1CMX B;  2XBB C;  3AU4 A;  2LD9 A;  3A9K B;  4LDT B;  4DDG D;  4TUU A;  2L7R A;  3M63 B;  1LXD A;  2L00 B;  5D6J B;  4CYE A;  1KOT A;  5DCN A;  3ZNG C;  3VH3 B;  3DPD A;  1WXV A;  2BWE S;  2NBU A;  3NY5 A;  3W1Y A;  2JXX A;  3IHP C;  2BYV E;  1P98 A;  3ZDM C;  4CHK A;  3H6N A;  3CF6 E;  2NPT A;  4FHJ A;  3QK0 A;  4KZ0 A;  4PS8 A;  3UGB B;  4GSW A;  5FR6 A;  4PS3 A;  3PVL A;  3RD2 A;  3ZRF A;  4NNJ B;  5C23 A;  1RRB A;  4II3 B;  3S2A A;  2LXC A;  1WR6 E;  3LJ3 A;  4GIV A;  4WJO A;  2WX0 A;  3DCG A;  4W9L A;  4WWP A;  1E8Z A;  1Q1O A;  2N9E B;  1WJU A;  3APC A;  2RSU A;  3TMP B;  1WZ3 A;  3T8M A;  3U30 A;  2K6D B;  2CHX A;  5IAA C;  3U8Z A;  1KM7 A;  2IO3 B;  4W9K A;  2IY1 B;  5DPR A;  3APD A;  2LVO A;  3VTW A;  2GBJ A;  1GC7 A;  1RFA A;  1UBQ A;  1WRD B;  3A1Q A;  4FHK A;  3DBL I;  1WMH B;  1NDD A;  4HWI B;  1A5R A;  3PV1 A;  2ZCC A;  2IZV B;  4TQ1 A;  2LRW A;  4LJP B;  2FCS A;  2C60 A;  4XX5 A;  3ZW3 A;  1V2Y A;  4RM8 A;  4W9E A;  2I1K A;  4JQW C;  1V49 A;  3SHQ A;  3UIN B;  4FJV B;  1C3T A;  3VUW A;  5HKH A;  3QHT A;  4HPL B;  4RM9 A;  5CHF A;  5J18 A;  3H1U A;  4I6L B;  4CO7 A;  1WGH A;  2Y5B B;  2K8H A;  4DHJ B;  4GN1 A;  3QC8 B;  3ZTC A;  2KX3 A;  2WYQ A;  2ZCB A;  4LDT D;  2KN5 A;  4KIK A;  2CHZ A;  2IO2 B;  2JRH A;  2KC1 A;  2MQJ A;  5TR5 A;  4B6W A;  4JLC A;  2AL3 A;  2JRI B;  2NS5 A;  2FCN A;  2KK8 A;  5G2N A;  4FLH A;  2YVC A;  3TCA A;  1UGM A;  4MGZ E;  4GB9 A;  1BT0 A;  4J6I A;  2MA9 B;  1WM2 A;  4W9D A;  2FAZ A;  2I1J A;  2KC2 A;  2C7H A;  3PS6 A;  2JT4 B;  2KLG A;  2L3Z A;  3A9J B;  3PPA A;  3ZNZ B;  4AOF A;  1J8C A;  2V1Y A;  1GC6 A;  3UIO B;  3V61 A;  3EHV A;  4DDI D;  3NS8 A;  1PQS A;  2MW5 A;  2N9X A;  1SGH A;  4M8N A;  5KHO A;  2LAS A;  1XD3 B;  1WR1 A;  2D11 A;  2KTR B;  3QWZ B;  4MSQ B;  5CHV C;  3VHT C;  4E3C A;  2GBK A;  4BKG A;  4URK A;  2LI5 A;  2N9P C;  3PT2 B;  1WFY A;  2LUE A;  3NOB A;  3K9O B;  2FCM A;  3M95 A;  3VUX A;  1WJN A;  3R7R A;  3PHW B;  3MTN B;  5G55 A;  2N1W A;  1Z5S B;  4E74 A;  4X57 B;  4KZC A;  3MHS D;  2BYF A;  3H7P B;  2KD0 A;  2LJ5 A;  4NY0 A;  4DHZ E;  2NVU I;  5C1Z A;  3SD5 A;  1V5T A;  3R3M A;  2Z0D B;  2LWP A;  4MEL A;  2UYZ B;  2MRP A;  4K7U A;  4LJO B;  1I35 A;  4HDQ A;  1YJ1 A;  1S3S G;  2NPT B;  2G4D B;  1OEY A;  3PGE A;  4ZRK A;  3CSF A;  4ZRJ A;  3V6E B;  2RPQ A;  5AZH A;  5DPT A;  2KO3 A;  4IWQ A;  4K1R B;  4A3P A;  4HPM B;  2PE9 A;  2XEW A;  2J0M A;  2BKF A;  1LFD A;  4IWP A;  3QQ8 B;  1AAR A;  4OVU A;  1UBI A;  2ZNV B;  4TQ0 A;  3TIX A;  2RD0 A;  1WX7 A;  2D07 B;  1SE9 A;  3KUD B;  1VD2 A;  2IYD B;  4IW0 A;  3A33 B; 
#chains in the Genus database with same CATH topology
 2ZEQ A;  3VXW A;  3QA8 A;  3MFG A;  2N7E A;  1UGJ A;  4PYZ A;  1UEL A;  2KN4 A;  1E7U A;  4MSM B;  1YQB A;  4EZL A;  4EOY A;  4YSY B;  1QIL A;  1U4A A;  1MG8 A;  3DVG X;  4O1N A;  1ZKH A;  1UD7 A;  5C2T B;  2DNF A;  4KKJ A;  3AEA B;  4MH8 A;  3UQA A;  1F1H A;  3O65 B;  1L6U A;  4E71 A;  1TYG B;  2DEN B;  1RAX A;  2D3G A;  3WAN A;  2KWU B;  4RGO S;  5HI1 A;  2K1F A;  1DYQ A;  4HEA 1;  3K9P B;  3D32 A;  4HRS A;  1XF5 L;  2V4I B;  2QMT A;  2KFK A;  2O6V B;  5D3D A;  3M62 B;  4A9A A;  3ONS A;  3GE3 C;  4AUQ C;  4WAA A;  4KSK C;  5JZE B;  5EE3 A;  3Q69 A;  4NAW A;  2BKR B;  4AWJ A;  5T8I A;  3SFE B;  1E8X A;  2VZK D;  3IBE A;  4DK5 A;  3N20 C;  3A9J A;  4JWS C;  2CR5 A;  3TJP A;  1WRI A;  2IGD A;  4MJS A;  4H2A A;  2QDF A;  5EDS A;  3KUC B;  1ROE A;  2OJW A;  2W9N A;  3UIP B;  1XT9 B;  1R4M I;  4PT5 A;  3CMM B;  5D2M B;  4PYU A;  2KMA A;  2K39 A;  1ISN A;  4JIO U;  1E7P B;  1P3Q U;  4BBN C;  4IG7 B;  2M8S A;  1FIQ A;  3AU5 A;  3C8Y A;  4KV2 A;  1PGX A;  4I6N B;  2LXA A;  1FEH A;  5JXV A;  3H7S A;  2M0X A;  5LLI A;  5IA7 A;  5EE9 A;  1E8Y A;  4NJC A;  3ENE A;  1WGY A;  1CJE A;  3Q3F A;  1EF5 A;  4MM3 B;  2V0G A;  2WU2 B;  4MEM A;  3ZUN A;  3NHE B;  3L54 A;  3AE6 B;  2WXP A;  2FUG 1;  2A4Z A;  3QAQ A;  2DYB A;  1PYW D;  3DOW A;  3BVG A;  2KT7 A;  2MP2 B;  1KH0 A;  2KTR A;  1V1P B;  1E5W A;  1R4M B;  3E9S A;  1WIA A;  3ZXR A;  1KLV A;  1RM6 C;  2WNM A;  1WH3 A;  4WWN A;  2LVP A;  3HHM A;  5AZG A;  2LHD A;  2R2Q A;  3KH0 A;  4WQM A;  2LGI A;  1FXA A;  2J0K A;  2V3N A;  5CTR C;  2REX A;  3W2D A;  3WA0 A;  1XCT L;  3IAM 1;  3AV8 A;  4PK1 A;  2LMC A;  3DHH C;  1TZ1 A;  4BOS C;  2DZK A;  5E6P A;  1VZ8 A;  3UQB A;  2JU6 X;  3AUL A;  2BWF A;  3ZDT A;  4BOZ B;  3ML9 A;  1SBB B;  4W9J A;  3R2T A;  1L4Z B;  4FBJ B;  2NBV B;  1ZUD 2;  1E90 A;  2EMT A;  4HCN B;  1AWD A;  3TL5 A;  5JHB A;  1YX5 B;  4YTN B;  4EUT A;  2WXL A;  3RT3 B;  1JRO A;  2N7D A;  4NAW B;  4BKT A;  3DQV A;  2J7Q B;  3M3J A;  3PRE A;  1YN4 A;  1FRR A;  4BAX A;  2ZPY A;  3C0R B;  1AW7 A;  4KSL C;  4WWM A;  3P1M A;  2AL6 A;  3CWI A;  1LGR A;  3PZ7 A;  4FN2 A;  3V62 A;  2AYO B;  3JW0 X;  2J53 A;  4LTU A;  2R2O A;  2BYT A;  3L13 A;  2KNB A;  4PS7 A;  3UI3 A;  1I4R A;  4J3O D;  4ZYN A;  3Q3J A;  2N1V A;  3EUB 2;  4IM2 A;  5FR3 A;  2JZ3 B;  3R7Q A;  4MDK E;  1P0R A;  1Q5W B;  2C9W B;  1QT9 A;  3OJ4 B;  1YOV B;  2V3P A;  4LNO A;  4MAC A;  1LQB A;  3MC0 B;  4HKZ E;  2AEH A;  4YSX B;  1K8R B;  4A3O A;  3CIR B;  2QHO A;  3MC9 A;  3VTV A;  1C78 A;  3QAR A;  2HJ8 A;  4MJS B;  2DWQ A;  1V97 A;  4BKS A;  2QCZ A;  2KVZ A;  4KDI C;  1J0G A;  1D5X C;  2FID A;  5CHW A;  4C7Z A;  2JWZ A;  3VH4 B;  5BYS A;  1UUP A;  3AE5 B;  2ZZP B;  4HLE A;  1VLB A;  3ZNI D;  1WSP A;  2PJH A;  4YSZ B;  1WX9 A;  2M1M A;  1LO5 D;  1PGA A;  1F0Z A;  1L4D B;  3L16 A;  1MJD A;  2IPK D;  1XQQ A;  1YQ3 B;  1E0Z A;  2M4N A;  4W9C A;  1YJI A;  3NRZ A;  1IUE A;  2MJ3 A;  1C76 A;  3OLM D;  4HVB A;  3AE4 B;  1YN5 A;  1EUV B;  4DXF A;  3A9K B;  3BK1 A;  4LDT B;  2IGH A;  4TUU A;  1ZP0 B;  1SE4 A;  4YTP B;  4CYE A;  1TKE A;  1WXV A;  4C4V B;  2YEP F;  3W1Y A;  4JPS A;  3IHP C;  2BYV E;  3CF6 E;  2SAK A;  1L5P A;  4GSW A;  3PVL A;  2W55 A;  2LGS A;  3S2A A;  1QF6 A;  2WX0 A;  1Q1O A;  2RSU A;  3T8M A;  3ZGZ A;  5IAA C;  3TEX A;  2IO3 B;  4W9K A;  2DBY A;  3APD A;  2RDH A;  3B9J A;  2LVO A;  5HFY A;  3A1Q A;  3DBL I;  1NDD A;  3PV1 A;  4TQ1 A;  4XX5 A;  2WXH A;  4W9E A;  3UIN B;  1EU4 A;  5HKH A;  3L4P A;  2Y5B B;  2K8H A;  1JWS D;  4GN1 A;  3QC8 B;  3ZTC A;  2WYQ A;  4KIK A;  4L1B A;  2JRH A;  4JLC A;  1F2R I;  2FCN A;  2KK8 A;  5G2N A;  4RGN A;  3TCA A;  4GB9 A;  1BT0 A;  1JCK B;  4W9D A;  5AUI A;  1V1O A;  1JAL A;  2FAZ A;  4M0W A;  3PS6 A;  3A9J B;  5C3J B;  2M0A A;  1PQS A;  2N9X A;  4CQN A;  4MSQ B;  2GBK A;  2N9P C;  3PT2 B;  2LUE A;  2B76 B;  2SEB D;  3K9O B;  3VUX A;  3PHW B;  3MHS D;  3VRB B;  2KD0 A;  4OW0 A;  3SD5 A;  1V5T A;  3AMZ A;  1SEB D;  1YJ1 A;  2ON8 A;  2MHJ A;  4KGR A;  3CSF A;  4ZRJ A;  2WS3 B;  2RPQ A;  2KO3 A;  4K1R B;  1LFD A;  1UBI A;  2ZNV B;  4TQ0 A;  2RD0 A;  4IW0 A;  3NVY A;  4ANV A;  3AE1 B;  4M01 A;  3PRZ A;  5J17 A;  4MGY E;  1HEZ E;  4GU2 A;  1JWA D;  1HTQ A;  1XLN A;  4JL9 A;  3RUI B;  1VDV A;  2EMS A;  1SE2 A;  3DVN U;  4QAY A;  1I4Q A;  1M94 A;  1FXT B;  3N1Z C;  3WAO A;  3RCZ A;  1D3Z A;  2KDI A;  1ZE3 D;  3JYU A;  4DXA B;  1L0X B;  3SDL C;  3WCQ A;  3V3X A;  2JWU A;  1E8W A;  3ZVV A;  1VRA B;  1JML A;  2INC C;  2DZM A;  3VRA B;  2JX5 A;  4F8C B;  4TKN A;  2IND C;  3A4S C;  2JZZ A;  2ZVO A;  2I38 A;  5I4D A;  2EKE C;  1STE A;  4AQ7 A;  3GZN I;  3Q8A A;  2KVR A;  2JYE A;  2C7M B;  3DVG Y;  4GMV A;  3RUL A;  2JSV X;  1VJK A;  1QOG A;  1FMA D;  1V86 A;  1C9F A;  3ZQ4 A;  2WXK A;  2Z59 B;  1GB4 A;  3ZRC A;  2KAN A;  4RF0 A;  2LZ6 A;  2ASQ A;  3PSE B;  1T6B X;  3AEG B;  2L8J A;  1UWM A;  3RYT A;  2RGF A;  5AEK B;  3TEY A;  3V60 A;  4A20 A;  1OQQ A;  1PFD A;  3NZ3 A;  2K0P A;  4GDL A;  4XGA B;  2FBW B;  1T5X D;  3AEF B;  3BVM A;  2Y5C A;  1TJE A;  4YL8 A;  1XCQ L;  2HTM E;  1RLF A;  2MJD A;  1L7Y A;  2R61 A;  1Z2M A;  2CJN A;  4WWO A;  2KDM A;  4RMA A;  4IOI E;  4YT0 B;  3NJT A;  4A6Q A;  3KQ4 A;  4KKI A;  4XC2 A;  3DBR I;  2CS4 A;  5KHQ A;  3AEC B;  1CQV A;  2MLB A;  2OOB B;  2G45 B;  4W9I A;  5E6N A;  2WXR A;  3AEE B;  3P42 A;  3B0A A;  2RDB C;  1BUI C;  1UF0 A;  2N7J A;  4ARC A;  3EEC A;  3SU8 X;  2PVG C;  5HHD G;  1EWY C;  4XYC A;  1C4C A;  3RNC C;  4L2Y A;  1OQY A;  3FKY A;  1FD6 A;  2WLB A;  4OHJ A;  2VZK B;  5IN7 A;  2AQ1 B;  3EA6 A;  3I3T B;  3WAP A;  5AUK A;  1WGD A;  2MBB B;  3AN1 A;  4AJY B;  3ZIM A;  4LNN A;  2KKC A;  1GJZ A;  4F1S A;  2WDT B;  2BYE A;  1EF1 A;  2DYO A;  1I4X A;  1KLG D;  3PZD A;  3DWM A;  4M0W B;  2DYM A;  3JSV B;  2ACZ B;  2MWS B;  4G3X B;  2XNA C;  4IUM B;  4TV3 A;  2ZW0 A;  1OQR A;  1ZOY B;  2C7N B;  2RR9 A;  3ETR A;  3DBH I;  2MSE D;  4II2 B;  3QX1 A;  2KHW B;  2MP2 A;  1KLU D;  2K3U A;  3GOE A;  3B08 A;  5IO9 A;  1ZW7 A;  1WZ0 A;  2UWQ A;  2B3A A;  2LRU A;  2LJI A;  2MJE A;  3L08 A;  2KMC A;  4RCO A;  2FE8 A;  3HM6 X;  1P7F A;  2DZJ A;  2KZR A;  3W5U B;  3L10 B;  1IBX A;  4ITK A;  1HA5 A;  4RFB A;  1I42 A;  1TS3 A;  2QJL A;  2XK5 A;  4UDU C;  5DPW A;  1V80 A;  2Y5P A;  1FO4 A;  1CK1 A;  1TT5 B;  1V9J A;  3KW5 B;  5H8Y E;  4I6P A;  5EE0 A;  5BO4 B;  2WXM A;  2J42 A;  2LFI A;  1FNW A;  1B1Z A;  2A5U A;  3SFD B;  4DQO C;  3ALB A;  2I2Y A;  3WAM A;  3OWE B;  5H92 C;  1BXT A;  1ENF A;  3ZLZ A;  3NUH B;  1SJE D;  2K8C A;  1WX8 A;  3H9D A;  2AWT A;  1WE6 A;  3U52 E;  3W1S C;  5E6O A;  2K6Q A;  2NR2 A;  4HK2 A;  4IM0 A;  1Y8R C;  2V3S A;  3RNB C;  1QZE A;  1F2R C;  3MJW A;  1GG3 A;  4DHZ B;  1OFF A;  2V4L A;  3VUY A;  3LB8 C;  3BK2 A;  3IG3 A;  3Q8F A;  2WWZ A;  2GMI C;  4MH0 E;  3CST A;  1N62 A;  4S17 A;  4WH4 A;  1DOI A;  1GUA B;  2KWV B;  1L2N A;  4OVV A;  2AQ3 B;  1HQR D;  3Q8E A;  4NQL B;  3U7D A;  4A90 A;  4EZJ A;  1J7A A;  2YEP B;  5D3I B;  2GOW A;  4EEW A;  1WE7 A;  4K81 A;  3IXS A;  2Z8L A;  4DDG D;  2L7R A;  1LXD A;  1ZDX A;  5D6J B;  2JZP A;  3I9V 1;  4RGM A;  1N61 A;  4N58 A;  4KGS A;  2VH1 A;  3FAH A;  2PW9 A;  1FCC C;  3H6N A;  1J7B A;  2NPT A;  4FHJ A;  4PS8 A;  3UGB B;  4LLG M;  2BB6 A;  3MP9 A;  4NNJ B;  5C23 A;  4GIV A;  3LJ3 A;  4WJO A;  2IDY A;  4KGT A;  2N9E B;  3FIL B;  2ZW1 A;  1DOX A;  3TMP B;  3U30 A;  2K6D B;  1FPY A;  4TMA B;  1UBQ A;  2G9H D;  1F77 A;  2ZCC A;  1TY0 A;  3ZW3 A;  3FIL A;  4JQW C;  1I7H A;  4HPL B;  3H1U A;  4I6L B;  5GXG B;  4ACF A;  4LDT D;  2K22 A;  2VH2 A;  4HPP A;  3U2S C;  2CHZ A;  2IO2 B;  2KC1 A;  4B6W A;  2W54 A;  1R4N B;  2JRI B;  1I4H A;  4WAF A;  3R2I A;  4FLH A;  2YVC A;  2LHE A;  4MGZ E;  1C77 A;  1WM2 A;  2I1J A;  2JT4 B;  2KLG A;  2L3Z A;  1GC6 A;  1PGB A;  5LNK 1;  4M8N A;  2LAS A;  4URK A;  5CHV C;  1WFY A;  3NOB A;  3AE8 B;  4E74 A;  4KZC A;  4NY0 A;  2BYF A;  3H7P B;  2Z0D B;  5IP4 D;  4K7U A;  1I35 A;  1S3S G;  1TZO A;  1FXI A;  4A3P A;  2NTT A;  2XEW A;  2J0M A;  2BKF A;  3AE3 B;  3QQ8 B;  1AAR A;  2OHF A;  3TIX A;  1SE9 A;  5BYQ A;  2IYD B;  4OVZ A;  5BMI A;  2V9H A;  4LNF A;  3NVW A;  1ET6 A;  2WXG A;  2EEL A;  3O13 A;  2BVC A;  3J9C A;  4ANW A;  3PRP B;  4IKG A;  3ZNH B;  5CX3 A;  2KXJ A;  3SR6 A;  3TSS A;  3KWL A;  4XDC A;  1A70 A;  1EU3 A;  1MHH E;  2M17 A;  2D3C A;  2BQQ A;  2G4S A;  4W9F A;  4C80 A;  3W1S A;  2ZNV C;  4AP4 C;  1WWT A;  1OEY J;  1V81 A;  3LYY A;  4BFR A;  1WJ6 A;  2K8B A;  1LM8 B;  2W82 A;  1WY8 A;  5LXH A;  4TSS A;  3TEZ A;  2W3R A;  4NQK E;  4RGT A;  1VR9 A;  4NPN A;  3AE9 B;  2N9K A;  1X1M A;  3SEB A;  1SIJ A;  4WIP A;  3EC8 A;  1TKG A;  1WM3 A;  3V6C B;  1EWC A;  4DBG A;  3RMK C;  4Q2J A;  2RPV A;  2WDR B;  4B0E A;  2Z0E B;  5FK9 C;  4KDL B;  1P9D U;  2L1A A;  1OTR B;  3TEW A;  1WXQ A;  1H8C A;  3MJ5 A;  2XK5 B;  2LGD A;  1ZGU B;  2KFJ A;  1GB1 A;  1VZ6 A;  2H88 B;  2FIF A;  2L76 A;  3NZS A;  3V05 A;  2IJ0 A;  4D2K A;  3DVN V;  1C1Y B;  3BZD B;  2LGY A;  4P16 A;  2GBN A;  3Q6B A;  4L23 A;  3DBS A;  1P1A A;  3H8H A;  2DAF A;  4EE2 A;  1XO3 A;  3DWG C;  2WXF A;  4HKQ A;  4HJK A;  2J4X A;  5AZF A;  2KLC A;  2WXQ A;  4FXC A;  1AN8 A;  3R66 C;  4NJ6 A;  3RNG C;  2BF8 B;  1VZ7 A;  2EKI A;  3HUI A;  4B95 A;  4YTM B;  1WF9 A;  3RNE C;  3Q3M C;  4MT5 A;  5GMV A;  2BBC A;  2LGX A;  4REZ A;  1PUT A;  3HVZ A;  1XLO A;  2KQ7 A;  4BVU C;  5JH5 C;  2N4F A;  1XXG A;  4N59 A;  2HTH A;  3VQI A;  4ANU A;  1ZDV A;  2O2V A;  2PIA A;  3AED B;  1VCB A;  2VRR B;  1SJH D;  4IWO A;  1Q10 A;  5FKA C;  2NBW B;  1V5O A;  1TS4 A;  4A55 A;  2N9L A;  4P1C C;  4WQO B;  4AJW A;  3IVF A;  1M4V A;  5D94 A;  3ZKJ C;  2D3A A;  3RI7 C;  4N6E B;  3LDZ E;  3LXF A;  2CKH B;  2KJH B;  4EKU A;  4GDK A;  4RH6 A;  1IP9 A;  3HIZ A;  3DDC B;  5TSS A;  1ACC A;  4LNK A;  3ZO5 B;  2FNJ B;  2LVQ A;  4US8 A;  2MCN B;  3QIJ A;  1WGR A;  2L0F A;  1T0Y A;  5BMH A;  4G50 A;  2LUM A;  3RZF A;  3N9Y C;  1HZ5 A;  1GPX A;  2PVO D;  4ICU A;  5L83 A;  2MEK A;  2CJO A;  3I5J C;  2KFK B;  2MBE A;  1NBF C;  2O6V A;  4K7W A;  1D6E C;  2DZI A;  2BPS A;  3KWV A;  1H4R A;  2M19 A;  1G6J A;  1I4P A;  2XN9 C;  2G3Q B;  2KX0 A;  3RNF C;  1SE3 A;  3VAW A;  1XLQ A;  2O2V B;  4MGK E;  1WYW B;  3HK0 A;  1N5W A;  2K5P A;  3E56 A;  4G0N B;  1FNU A;  4P6V F;  2E6X A;  4C4V A;  4DWF A;  2K25 A;  3RFZ B;  4EZK A;  4GOC A;  3A4R A;  1ZXH A;  3EGR A;  1YJJ A;  2ONQ A;  4ZRI A;  3W5V B;  3P2B A;  2KTF A;  4JX1 C;  1C79 A;  3KYD D;  3OJ3 A;  1MFW A;  1J19 A;  5JHA A;  3BYY B;  2D10 A;  1S1Q B;  2KDB A;  2W3S A;  3GP7 A;  3R8B A;  2QEJ C;  2KOX A;  5G5G A;  2M56 B;  1FFV A;  1YX6 B;  2MBO A;  1RWS A;  1Y56 A;  5LXI B;  2IY0 B;  2ZJD A;  1WXA A;  1RFK A;  4K3C A;  4OZB A;  4GXB A;  1WXS A;  4WJN A;  1IGC A;  2KQS A;  1MPE A;  4FA6 A;  3B2G A;  2WX1 A;  4C56 C;  1E10 A;  3APF A;  1V1P A;  3Q3O C;  1GOZ A;  1UH6 A;  1C4P A;  3NZU A;  3QJZ A;  5IOI A;  1QQR A;  1TS5 A;  1WGK A;  2KAC A;  1N63 A;  5D7G A;  1D5M C;  2WU5 B;  4MM3 A;  1HZ6 A;  2GLS A;  1K51 A;  4XWT A;  3RZW C;  1AYF A;  1YN3 A;  1SB3 C;  3T9L A;  1CMX B;  1GAQ B;  2HDE A;  2GB1 A;  4BZA A;  3M63 B;  3AE7 B;  2J52 A;  1DOY A;  2L00 B;  1KFY B;  1KOT A;  3ZNG C;  4ZYS A;  2N0S B;  2BWE S;  2NBU A;  2WP9 B;  2JXX A;  2NMQ A;  4USA A;  1P98 A;  3ZDM C;  4CHK A;  4P1B C;  1QOA A;  1D4B A;  3QK0 A;  4B0M A;  1T0S C;  1XLP A;  5FR6 A;  3RD2 A;  3ZRF A;  3U4E G;  1WR6 E;  3DCG A;  4W9L A;  1E8Z A;  1QOB A;  2WXN A;  3Q2A C;  1TY2 A;  1UNS A;  1TKY A;  1ESF A;  2INN E;  4XDD A;  1FNV A;  2X38 A;  2GBJ A;  1WRD B;  4FHK A;  1FFU A;  1A5R A;  2H89 B;  4LJP B;  2FCS A;  1QOF A;  2C60 A;  4RM8 A;  1L0Y B;  1T3Q A;  3VUW A;  1K53 A;  5CHF A;  1FM0 D;  5J18 A;  1RYJ A;  4DHJ B;  2RDG A;  2AX5 A;  3DHG C;  2KX3 A;  2KN5 A;  2WGS A;  5E6J A;  2MQJ A;  5TR5 A;  5BYR A;  2NS5 A;  2GI9 A;  2DLB A;  2KMM A;  1UGM A;  1EM7 A;  2L83 A;  4ZRQ A;  2C7H A;  3ZNZ B;  3UIO B;  3EHV A;  3VR8 B;  4DDI D;  3NS8 A;  2MW5 A;  3RNA C;  5KHO A;  2WDV B;  3P4P B;  1CZP A;  4NZL B;  3VHT C;  4BKG A;  2LI5 A;  2FCM A;  3M95 A;  2PMV A;  3R7R A;  3W9C B;  5G55 A;  2NVU I;  4JE3 B;  2GRI A;  2UYZ B;  2MRP A;  4LJO B;  3RPF C;  1MVK A;  4HDQ A;  3B2F A;  3PGE A;  3V6E B;  4IWQ A;  3ZJV A;  4HPM B;  2PE9 A;  3GE8 C;  4OVU A;  1N60 A;  4RNA A;  3KUD B;  1VD2 A;  3A33 B;  3JVZ X;  3FC4 A;  2BS4 B;  3KUZ A;  4BKS D;  2TSS A;  3BYT B;  1JWB D;  1YQ4 B;  2J0J A;  4OZA A;  2HE7 A;  2IO1 B;  3EFU A;  2ZVN A;  3C19 A;  4ZDV A;  4NAM A;  4JGH B;  3OAW A;  1KJT A;  1F52 A;  3HM3 A;  1V8C A;  2WXI A;  2KAJ A;  2KJ6 A;  2L05 A;  2NCN A;  1N5X A;  2PPH A;  2HJ1 A;  3P4Q B;  1WYG A;  4XZ4 A;  4ZOH C;  5J2R A;  3AI5 A;  3A1Q B;  3AM9 A;  3VFK A;  5G5H A;  3GB1 A;  3WAL A;  4MGI E;  4M8M A;  2WXJ A;  1E7V A;  3H7P A;  1YIW A;  1IBX B;  4HDO A;  3AH7 A;  1UZX B;  4NJ7 A;  4M00 A;  1R7S A;  2CHW A;  1HXY D;  1QKZ A;  1ZPS A;  3BIN A;  4EFO A;  4RF1 A;  1JQ4 A;  3L0W B;  1XEE A;  1K52 A;  2PEA A;  3NVZ A;  3NS1 A;  2DHZ A;  2KDE B;  3BY4 B;  1JW9 D;  3ZXV A;  1NVI D;  3N1Y C;  3UF8 A;  1ZXI A;  1GNU A;  3PRM B;  2KWC A;  1T0Q C;  3JSV A;  2JPH A;  3QCA A;  4US9 A;  3N3K B;  3ML8 A;  2JVC A;  4YXD B;  2RMM A;  3U7Z A;  2PE6 B;  1I4G A;  1OGW A;  2PKO A;  3PZ8 A;  1TS2 A;  1V6E A;  2OJR A;  3RN9 C;  3WIM A;  2IBI B;  4W9H A;  3OG5 A;  3N1X C;  3N30 A;  3I57 A;  1SXT A;  2IGG A;  2G1E A;  4KVG B;  2CU3 A;  4YWG G;  1MI0 A;  4R3D A;  4BBN F;  5L95 C;  2MBH A;  1FCL A;  2FCQ A;  4FJY A;  1YD8 U;  3T3O A;  3PTF C;  3BWU D;  3ZTD A;  3AEB B;  4ASW C;  3KLS X;  1WMH A;  2LEK A;  2ICI A;  3P63 A;  4S0R A;  2KWD A;  5DPS A;  4P7I A;  2PLP A;  2GBR A;  2L32 A;  4ANX A;  4K7S A;  2CU1 A;  4FJZ A;  4IDI A;  1KTK A;  1YNT E;  4DXG A;  1IYF A;  1E6E B;  4GDK B;  2MX2 A;  1WI0 A;  2KDF B;  3HVD A;  4LCD E;  2MBQ A;  1TTN A;  1R4N I;  4IM3 A;  2OED A;  3GZN B;  1T0R C;  1FRD A;  2BS3 B;  2WXO A;  2L52 A;  2GBM A;  1JRU A;  3A9K A;  4C7Y A;  2UU7 A;  2D2Q A;  4HJG E;  4ARI A;  3AB5 A;  1TIF A;  4F7Z A;  3IFW B;  1HE8 A;  1E9M A;  4HRO A;  4A8X C;  4ZHP A;  3KYC D;  2HD5 B;  1F9J A;  4OZC A;  1TBE A;  3IT4 B;  4HXD A;  1JRP A;  1SSN A;  3L17 A;  2BGF A;  5C1Z A;  3X0W A;  2DAJ A;  2JY6 A;  3VTU A;  2QIL A;  2JUO A;  1IGD A;  3ECI A;  1MHX A;  1D5Z C;  1IPG A;  4C00 A;  2C5L C;  4FUL A;  3EFC A;  1P7E A;  3KVF B;  1WGG A;  1HTO A;  2QIE B;  3IAS 1;  2K9X A;  1TGZ B;  3P4R B;  4G11 A;  2JXT A;  4LK0 M;  3PHX B;  1B9R A;  3VDZ A;  2L0T A;  4KIK B;  1PDX A;  4HCP B;  2X8X X;  2KQ4 X;  5EE1 A;  2BW2 A;  4N9F 4;  2INP E;  2D5G A;  4WJQ A;  2JQR B;  3AE2 B;  2D3B A;  4IC7 B;  2MH7 A;  4ICV A;  3X23 A;  3PLU A;  3P4S B;  2E3T A;  4GDL B;  1C4A A;  1WXM A;  4B9K A;  4FAD A;  4GGQ A;  3ZJT A;  1SIF A;  3VR9 B;  2JF5 A;  5BMG A;  1YMH E;  2YLM A;  3B1L X;  1Q0W B;  2BS2 B;  4WJP A;  5HG2 A;  1EO6 A;  3IT6 B;  3TBL D;  3BII D;  3PLV A;  2IO0 B;  2ZPN A;  2O6V D;  1NYR A;  3T3N A;  2KJR A;  2Y3A A;  1WJ4 A;  3VVW B;  1KF6 B;  3GS2 A;  5IKC M;  1NYQ A;  2PTL A;  4AS1 A;  1NI2 A;  3DBL B;  3AXC A;  2BTE A;  4GLS C;  2FUH B;  3URY A;  2NTS A;  2DX5 B;  3NG0 A;  4LNI A;  4W9G A;  1N6Z A;  1NEN B;  3N32 A;  2XBB C;  3AU4 A;  2LD9 A;  1J7C A;  4WUR A;  5DCN A;  3VH3 B;  3DPD A;  4KX6 B;  3NY5 A;  3Q8B A;  4ZRP A;  3MC8 A;  3ZJU A;  2KYW A;  4XWW A;  1ET9 A;  4KZ0 A;  1JWU D;  4PS3 A;  3NVV A;  2WDQ B;  1RRB A;  2BB5 A;  4II3 B;  2LXC A;  4M02 A;  4DHJ D;  4WWP A;  1WJU A;  3APC A;  3I63 C;  1WZ3 A;  3Q8C A;  2CHX A;  3U8Z A;  2QSD A;  1KM7 A;  1JWM D;  2IY1 B;  3PO0 A;  3ZYY X;  5DPR A;  2QC8 A;  2JYT A;  3VTW A;  4ZHO A;  1GC7 A;  1RFA A;  1KRH A;  3DBH B;  1WMH B;  4HWI B;  1MG4 A;  4K3B A;  2IZV B;  1SF0 A;  2LRW A;  1NEK B;  1V2Y A;  2BT6 A;  2I1K A;  1V49 A;  3SHQ A;  4FJV B;  2AQ2 B;  1C3T A;  3MHZ A;  3QHT A;  4RM9 A;  4CO7 A;  1WGH A;  2ZCB A;  3BVZ A;  2AL3 A;  1L6V A;  1DGJ A;  4J6I A;  2MA9 B;  3Q14 C;  2KC2 A;  1J8C A;  1NI3 A;  3PPA A;  4AOF A;  2V1Y A;  3ABV B;  3TUO A;  3V61 A;  2WHI A;  2WQY B;  4JWU C;  1SGH A;  1XD3 B;  1WR1 A;  2D11 A;  2KTR B;  3QWZ B;  4E3C A;  3Q3N C;  3HRD D;  1WJN A;  3MTN B;  2N1W A;  1Z5S B;  4X57 B;  2LJ5 A;  4DHZ E;  4XE0 A;  3R3M A;  4MEL A;  2LWP A;  5MPO A;  1K50 A;  2NPT B;  2G4D B;  1OEY A;  4ZRK A;  5AZH A;  5DPT A;  2Q5W D;  4IWP A;  1UWX A;  1BML C;  3DBR B;  3DHI C;  1WX7 A;  2D07 B;  1L0V B;  1QLB B; 
#chains in the Genus database with same CATH homology
 3JVZ X;  2ZEQ A;  4ANV A;  3KUZ A;  4BKS D;  3VXW A;  3QA8 A;  3PRZ A;  5J17 A;  4MGY E;  2N7E A;  4GU2 A;  4PYZ A;  1UEL A;  4ANW A;  1E7U A;  3PRP B;  4MSM B;  4JL9 A;  2J0J A;  5CX3 A;  3RUI B;  2KXJ A;  1YQB A;  3ZNH B;  2EMS A;  4EZL A;  2M17 A;  3DVN U;  2HE7 A;  4EOY A;  2IO1 B;  1U4A A;  2ZVN A;  1MG8 A;  3EFU A;  4ZDV A;  2G4S A;  4W9F A;  1M94 A;  1FXT B;  3DVG X;  3W1S A;  2ZNV C;  4JGH B;  3OAW A;  4AP4 C;  1ZKH A;  1KJT A;  3WAO A;  1OEY J;  1UD7 A;  3HM3 A;  1V81 A;  3RCZ A;  1D3Z A;  4BFR A;  1WJ6 A;  2KDI A;  2KJ6 A;  2K8B A;  3JYU A;  1LM8 B;  2L05 A;  4DXA B;  2NCN A;  1WY8 A;  2PPH A;  3SDL C;  5LXH A;  3UQA A;  3O65 B;  4XZ4 A;  1E8W A;  3ZVV A;  4E71 A;  2DEN B;  4NQK E;  1RAX A;  2D3G A;  3AI5 A;  3A1Q B;  3WAN A;  2KWU B;  5J2R A;  2K1F A;  2DZM A;  4NPN A;  3VFK A;  4F8C B;  1X1M A;  4TKN A;  3K9P B;  3D32 A;  3A4S C;  2JZZ A;  2ZVO A;  3EC8 A;  3WAL A;  4MGI E;  1WM3 A;  4M8M A;  3V6C B;  4DBG A;  2EKE C;  1E7V A;  3H7P A;  1YIW A;  2KFK A;  2O6V B;  3GZN I;  3M62 B;  2Z0E B;  3ONS A;  2KVR A;  4HDO A;  4KDL B;  1P9D U;  4AUQ C;  2C7M B;  3DVG Y;  1UZX B;  1OTR B;  4GMV A;  4KSK C;  4NJ7 A;  4WAA A;  5JZE B;  3RUL A;  2CHW A;  1H8C A;  2XK5 B;  4NAW A;  2BKR B;  1ZGU B;  2KFJ A;  2LGD A;  4AWJ A;  1V86 A;  2Z59 B;  3ZRC A;  1E8X A;  2KAN A;  2LZ6 A;  3IBE A;  4DK5 A;  2ASQ A;  2FIF A;  2L76 A;  3A9J A;  3BIN A;  3NZS A;  3PSE B;  4EFO A;  2CR5 A;  3TJP A;  2L8J A;  4MJS A;  3RYT A;  5EDS A;  2RGF A;  1C1Y B;  3DVN V;  3KUC B;  3L0W B;  5AEK B;  3UIP B;  2W9N A;  3V60 A;  1XT9 B;  2PEA A;  1R4M I;  2LGY A;  4A20 A;  2GBN A;  2DHZ A;  3CMM B;  2KDE B;  5D2M B;  3BY4 B;  3DBS A;  1P1A A;  4GDL A;  4PYU A;  2DAF A;  2KMA A;  2K39 A;  3UF8 A;  1GNU A;  1ISN A;  3PRM B;  4JIO U;  1P3Q U;  2KWC A;  4HJK A;  4IG7 B;  4BBN C;  3JSV A;  4YL8 A;  2M8S A;  2JPH A;  3QCA A;  1RLF A;  3AU5 A;  3N3K B;  4KV2 A;  1L7Y A;  2KLC A;  5AZF A;  3ML8 A;  2JVC A;  4I6N B;  1Z2M A;  2LXA A;  3R66 C;  4NJ6 A;  4WWO A;  2BF8 B;  3H7S A;  2M0X A;  2PE6 B;  4RMA A;  5LLI A;  5IA7 A;  1OGW A;  4B95 A;  1E8Y A;  1WF9 A;  1V6E A;  2OJR A;  3DBR I;  3ENE A;  1WGY A;  2CS4 A;  4XC2 A;  5GMV A;  2LGX A;  3Q3F A;  5KHQ A;  3WIM A;  1EF5 A;  2IBI B;  4W9H A;  2MLB A;  2OOB B;  2G45 B;  3N30 A;  4W9I A;  5E6N A;  4DHJ D;  2KQ7 A;  4MEM A;  3B0A A;  3ZUN A;  4BVU C;  2N4F A;  3NHE B;  3L54 A;  5JH5 C;  4KVG B;  2HTH A;  2A4Z A;  4BBN F;  5L95 C;  3VQI A;  2MBH A;  3EEC A;  3QAQ A;  2DYB A;  3SU8 X;  3DOW A;  4ANU A;  2FCQ A;  2O2V A;  4FJY A;  1YD8 U;  2MP2 B;  2KTR A;  3PTF C;  1VCB A;  3ZTD A;  1OQY A;  2VRR B;  4ASW C;  4IWO A;  1E5W A;  1WMH A;  1WIA A;  1KLV A;  2NBW B;  1V5O A;  5DPS A;  1WH3 A;  4WWN A;  4P7I A;  2LVP A;  3HHM A;  3I3T B;  3WAP A;  5AZG A;  1WGD A;  2GBR A;  4ANX A;  4WQO B;  4AJW A;  2MBB B;  2R2Q A;  3KH0 A;  2CU1 A;  4K7S A;  4AJY B;  2J0K A;  3ZIM A;  4FJZ A;  3IVF A;  2KKC A;  1GJZ A;  5CTR C;  5D94 A;  4F1S A;  3ZKJ C;  1IYF A;  2REX A;  3WA0 A;  2WDT B;  2BYE A;  1EF1 A;  4GDK B;  2MX2 A;  1WI0 A;  2KDF B;  3LDZ E;  2DYO A;  4LCD E;  2MBQ A;  1TTN A;  1R4N I;  4IM3 A;  2CKH B;  2KJH B;  4EKU A;  4GDK A;  1TZ1 A;  4BOS C;  2DZK A;  1IP9 A;  3PZD A;  3HIZ A;  3DDC B;  5E6P A;  3ZO5 B;  2GBM A;  4M0W B;  3UQB A;  1JRU A;  2DYM A;  2FNJ B;  3AUL A;  2LVQ A;  3A9K A;  3JSV B;  2MWS B;  4G3X B;  2BWF A;  3ZDT A;  2MCN B;  2D2Q A;  4BOZ B;  3ML9 A;  4IUM B;  3QIJ A;  4TV3 A;  4W9J A;  4FBJ B;  1WGR A;  2L0F A;  2NBV B;  1E90 A;  2EMT A;  1T0Y A;  4HCN B;  4G50 A;  2C7N B;  2RR9 A;  3TL5 A;  4F7Z A;  3IFW B;  5JHB A;  1YX5 B;  3RZF A;  4EUT A;  3DBH I;  3RT3 B;  1HE8 A;  2MSE D;  2N7D A;  4II2 B;  3QX1 A;  4NAW B;  2KHW B;  4BKT A;  2MP2 A;  3DQV A;  3GOE A;  2J7Q B;  3M3J A;  3PRE A;  4ICU A;  5L83 A;  3KYC D;  2HD5 B;  1F9J A;  1TBE A;  4HXD A;  3B08 A;  2ZPY A;  2KFK B;  2MBE A;  1ZW7 A;  1WZ0 A;  1NBF C;  2BGF A;  2O6V A;  2UWQ A;  2B3A A;  3L17 A;  2LRU A;  2DAJ A;  2BPS A;  2DZI A;  2JY6 A;  3L08 A;  4K7W A;  3VTU A;  3X0W A;  1H4R A;  2KMC A;  3C0R B;  1G6J A;  2JUO A;  3ECI A;  3HM6 X;  4KSL C;  2G3Q B;  2DZJ A;  2KZR A;  2KX0 A;  3L10 B;  1IPG A;  2AL6 A;  2C5L C;  1I42 A;  4FN2 A;  3V62 A;  2AYO B;  3JW0 X;  2XK5 A;  3VAW A;  2R2O A;  4FUL A;  2O2V B;  5DPW A;  3KVF B;  1WGG A;  4MGK E;  1WYW B;  1V80 A;  3L13 A;  2KNB A;  3HK0 A;  4PS7 A;  1V9J A;  3KW5 B;  4G0N B;  4I6P A;  1TGZ B;  4G11 A;  4ZYN A;  3Q3J A;  5BO4 B;  4DWF A;  2N1V A;  2K25 A;  4IM2 A;  4EZK A;  2JZ3 B;  3PHX B;  4GOC A;  3A4R A;  3R7Q A;  4MDK E;  1P0R A;  3VDZ A;  2L0T A;  1Q5W B;  2C9W B;  4KIK B;  3OJ4 B;  2A5U A;  4HCP B;  3ALB A;  4ZRI A;  3WAM A;  1LQB A;  3P2B A;  2KTF A;  4N9F 4;  2AEH A;  3KYD D;  1K8R B;  4WJQ A;  3ZLZ A;  3OJ3 A;  4A3O A;  2K8C A;  1WX8 A;  3H9D A;  2QHO A;  4IC7 B;  1J19 A;  4ICV A;  3VTV A;  3X23 A;  3PLU A;  3QAR A;  5JHA A;  2AWT A;  1WE6 A;  2HJ8 A;  3W1S C;  2D10 A;  1S1Q B;  2KDB A;  4MJS B;  5E6O A;  2K6Q A;  2NR2 A;  4GDL B;  4BKS A;  1WXM A;  4B9K A;  2KOX A;  4FAD A;  4GGQ A;  4HK2 A;  4KDI C;  1J0G A;  4IM0 A;  1Y8R C;  1SIF A;  1YX6 B;  2FID A;  2JF5 A;  2MBO A;  2V3S A;  2YLM A;  3B1L X;  5CHW A;  2JWZ A;  1QZE A;  1Q0W B;  3VH4 B;  3MJW A;  5LXI B;  1GG3 A;  2IY0 B;  2ZJD A;  4DHZ B;  1WXA A;  4WJP A;  1EO6 A;  2V4L A;  3VUY A;  4GXB A;  1WXS A;  2ZZP B;  4WJN A;  3TBL D;  4HLE A;  3PLV A;  3ZNI D;  2IO0 B;  2PJH A;  3IG3 A;  2KQS A;  4FA6 A;  2WX1 A;  1WX9 A;  3APF A;  2M1M A;  2WWZ A;  2ZPN A;  2GMI C;  4MH0 E;  2O6V D;  1UH6 A;  3L16 A;  2KJR A;  3CST A;  1WJ4 A;  3VVW B;  1XQQ A;  1GUA B;  2KWV B;  1L2N A;  1NI2 A;  3NZU A;  4OVV A;  3QJZ A;  3AXC A;  5D7G A;  4NQL B;  3U7D A;  2M4N A;  4EZJ A;  4MM3 A;  4W9C A;  2FUH B;  2DX5 B;  2GOW A;  4EEW A;  3RZW C;  4W9G A;  1WE7 A;  4K81 A;  3N32 A;  3OLM D;  4HVB A;  1EUV B;  3T9L A;  1CMX B;  2XBB C;  3AU4 A;  2LD9 A;  3A9K B;  4LDT B;  4DDG D;  4TUU A;  2L7R A;  3M63 B;  1LXD A;  2L00 B;  5D6J B;  4CYE A;  1KOT A;  5DCN A;  3ZNG C;  3VH3 B;  3DPD A;  1WXV A;  2BWE S;  2NBU A;  3NY5 A;  3W1Y A;  2JXX A;  3IHP C;  2BYV E;  1P98 A;  3ZDM C;  4CHK A;  3H6N A;  3CF6 E;  2NPT A;  4FHJ A;  3QK0 A;  4KZ0 A;  4PS8 A;  3UGB B;  4GSW A;  5FR6 A;  4PS3 A;  3PVL A;  3RD2 A;  3ZRF A;  4NNJ B;  5C23 A;  1RRB A;  4II3 B;  3S2A A;  2LXC A;  1WR6 E;  3LJ3 A;  4GIV A;  4WJO A;  2WX0 A;  3DCG A;  4W9L A;  4WWP A;  1E8Z A;  1Q1O A;  2N9E B;  1WJU A;  3APC A;  2RSU A;  3TMP B;  1WZ3 A;  3T8M A;  3U30 A;  2K6D B;  2CHX A;  5IAA C;  3U8Z A;  1KM7 A;  2IO3 B;  4W9K A;  2IY1 B;  5DPR A;  3APD A;  2LVO A;  3VTW A;  2GBJ A;  1GC7 A;  1RFA A;  1UBQ A;  1WRD B;  3A1Q A;  4FHK A;  3DBL I;  1WMH B;  1NDD A;  4HWI B;  1A5R A;  3PV1 A;  2ZCC A;  2IZV B;  4TQ1 A;  2LRW A;  4LJP B;  2FCS A;  2C60 A;  4XX5 A;  3ZW3 A;  1V2Y A;  4RM8 A;  4W9E A;  2I1K A;  4JQW C;  1V49 A;  3SHQ A;  3UIN B;  4FJV B;  1C3T A;  3VUW A;  5HKH A;  3QHT A;  4HPL B;  4RM9 A;  5CHF A;  5J18 A;  3H1U A;  4I6L B;  4CO7 A;  1WGH A;  2Y5B B;  2K8H A;  4DHJ B;  4GN1 A;  3QC8 B;  3ZTC A;  2KX3 A;  2WYQ A;  2ZCB A;  4LDT D;  2KN5 A;  4KIK A;  2CHZ A;  2IO2 B;  2JRH A;  2KC1 A;  2MQJ A;  5TR5 A;  4B6W A;  4JLC A;  2AL3 A;  2JRI B;  2NS5 A;  2FCN A;  2KK8 A;  5G2N A;  4FLH A;  2YVC A;  3TCA A;  1UGM A;  4MGZ E;  4GB9 A;  1BT0 A;  4J6I A;  2MA9 B;  1WM2 A;  4W9D A;  2FAZ A;  2I1J A;  2KC2 A;  2C7H A;  3PS6 A;  2JT4 B;  2KLG A;  2L3Z A;  3A9J B;  3PPA A;  3ZNZ B;  4AOF A;  1J8C A;  2V1Y A;  1GC6 A;  3UIO B;  3V61 A;  3EHV A;  4DDI D;  3NS8 A;  1PQS A;  2MW5 A;  2N9X A;  1SGH A;  4M8N A;  5KHO A;  2LAS A;  1XD3 B;  1WR1 A;  2D11 A;  2KTR B;  3QWZ B;  4MSQ B;  5CHV C;  3VHT C;  4E3C A;  2GBK A;  4BKG A;  4URK A;  2LI5 A;  2N9P C;  3PT2 B;  1WFY A;  2LUE A;  3NOB A;  3K9O B;  2FCM A;  3M95 A;  3VUX A;  1WJN A;  3R7R A;  3PHW B;  3MTN B;  5G55 A;  2N1W A;  1Z5S B;  4E74 A;  4X57 B;  4KZC A;  3MHS D;  2BYF A;  3H7P B;  2KD0 A;  2LJ5 A;  4NY0 A;  4DHZ E;  2NVU I;  5C1Z A;  3SD5 A;  1V5T A;  3R3M A;  2Z0D B;  2LWP A;  4MEL A;  2UYZ B;  2MRP A;  4K7U A;  4LJO B;  1I35 A;  4HDQ A;  1YJ1 A;  1S3S G;  2NPT B;  2G4D B;  1OEY A;  3PGE A;  4ZRK A;  3CSF A;  4ZRJ A;  3V6E B;  2RPQ A;  5AZH A;  5DPT A;  2KO3 A;  4IWQ A;  4K1R B;  4A3P A;  4HPM B;  2PE9 A;  2XEW A;  2J0M A;  2BKF A;  1LFD A;  4IWP A;  3QQ8 B;  1AAR A;  4OVU A;  1UBI A;  2ZNV B;  4TQ0 A;  3TIX A;  2RD0 A;  1WX7 A;  2D07 B;  1SE9 A;  3KUD B;  1VD2 A;  2IYD B;  4IW0 A;  3A33 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...