4WQOB

Structure of vhl-elob-eloc-cul2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into Cullin-RING E3 Ubiquitin Ligase Recruitment: Structure of the VHL-EloBC-Cul2 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Von Hippel-Lindau disease tumor suppressor
total genus 25
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wqoB00
3JW0X 3UIOB 4TQ0A 3UF8A 3HM6X 2IO2B 3QJZA 1P98A 3L10B 2MCNB 3RYTA 4FA6A 2PEAA 2WX0A 1LXDA 3EECA 5CHWA 2IY1B 3KUZA 3W1YA 1Y8RC 2ASQA 4CO7A 5DPTA 4WWNA 2K8HA 2DHZA 2ZPNA 4IM0A 4ICUA 2KDFB 3HM3A 4LCDE 1GC6A 3WALA 1E8ZA 2K8CA 2KD0A 4MGIE 4KSKC 4ASWC 3PREA 2LUEA 2KDEB 2ZPYA 2LASA 2KOXA 2FIDA 3NHEB 3X23A 1GJZA 3ZO5B 2NS5A 3DBSA 4IUMB 3VXWA 4IWOA 4DK5A 2RD0A 5CHFA 4A20A 1FXTB 3ZVVA 2OJRA 1Z5SB 4RM8A 2CR5A 2HJ8A 4W9LA 4W9JA 4I6LB 1I42A 2KLGA 3PHWB 4DHZE 1WI0A 5LXIB 1JRUA 4TUUA 2FCNA 1TZ1A 3AU5A 2L0FA 3OJ4B 4PYZA 3X0WA 1L2NA 3SD5A 1E5WA 3EHVA 3KYDD 4AJYB 2KFKA 2XK5B 1WFYA 2MX2A 2N9PC 2RGFA 3C0RB 1RFAA 2D11A 2FNJB 4ZRJA 3TJPA 5J18A 1IPGA 1WGDA 2MSED 4FJZA 4K81A 4MJSB 2A4ZA 2ZVNA 1P1AA 2IO3B 5L83A 2LGYA 5D7GA 1WR1A 4DXAB 2M17A 2C7MB 2L0TA 4WJQA 2MA9B 3W1SC 3Q3FA 1EF1A 1K8RB 5JZEB 3NZUA 3V62A 4DDGD 2JWZA 3A4SC 3PRZA 1UBIA 1WYWB 1AARA 2KJHB 3ZRCA 2ZZPB 4DHZB 4MGKE 3ZTCA 3KUDB 3U8ZA 2N7DA 3B1LX 3QK0A 5JHBA 2N7EA 1HE8A 2DZJA 5EDSA 2WWZA 3IG3A 2BKRB 4GDKA 4HCNB 2GBJA 1CMXB 3DBHI 2GBKA 3QHTA 1C3TA 3VQIA 3JVZX 1WGYA 2MP2B 3I3TB 3IFWB 3V60A 5AZHA 1Q5WB 4EZLA 1RRBA 1WGHA 2DAFA 2N4FA 4BFRA 1WZ3A 2NPTA 4M8MA 1RLFA 1LQBA 3H7PB 4IG7B 3ML9A 5DPWA 2KN5A 4HK2A 4BKSD 4NJ7A 2KXJA 2KLCA 5CX3A 3VTWA 2KWVB 3ZW3A 4W9DA 2BKFA 4WJOA 3NOBA 1TGZB 2Y5BB 3DBLI 2PE9A 2N9XA 4W9HA 4AOFA 4MM3A 4W9IA 2J0KA 2PPHA 3H7PA 3ZRFA 4ANUA 1E7VA 4ICVA 4GGQA 2EMTA 3A4RA 4WAAA 5TR5A 2LJ5A 3PLUA 4DHJB 3KVFB 1D3ZA 3UQBA 3V6EB 3R3MA 1KOTA 4E74A 4URKA 3ZLZA 4CHKA 1OQYA 2OOBB 4LJPB 5KHOA 4JLCA 4XZ4A 5DPSA 2Z59B 4W9EA 1Q0WB 4NAWB 2NCNA 2K6DB 2LXCA 3PGEA 2MW5A 2Z0DB 4DDID 1EUVB 4A3PA 2WX1A 4A3OA 5GMVA 2MBBB 3JSVB 3S2AA 2JRHA 1GUAB 2ZNVB 2KTRB 3ONSA 2L8JA 5J2RA 3N3KB 1H8CA 3DVGY 2RR9A 1EF5A 2JZZA 4WJPA 4EFOA 2V1YA 4KV2A 5CHVC 4AP4C 3O65B 3AI5A 3A9JB 3VFKA 3VHTC 4KIKB 3DVNU 2AWTA 1WIAA 1NI2A 3M62B 1Q1OA 2EMSA 1NDDA 2WYQA 1LM8B 1C1YB 3DQVA 3IHPC 2KHWB 3PPAA 2C7NB 4II2B 4DWFA 2BYEA 4EOYA 1OGWA 2AL3A 3DPDA 1L7YA 2NVUI 4YL8A 3N32A 5JH5C 4K7WA 1V81A 4GIVA 3RZFA 3NY5A 1H4RA 1WJ6A 1WXVA 2KFJA 3TIXA 4MEMA 2ZJDA 2FCQA 3A33B 4MELA 4B6WA 3PV1A 3CSTA 4DHJD 4EUTA 3DVGX 3QARA 2G45B 2NPTB 3QC8B 4NQLB 4E71A 3QAQA 1UGMA 2Z0EB 1V2YA 4GSWA 4I6PA 3VUXA 1VCBA 3V6CB 3AULA 4G11A 3SU8X 4HVBA 2KNBA 2KMAA 2GOWA 2KX3A 3ZIMA 4ANXA 4F8CB 2BWES 4PYUA 1YD8U 4WWOA 3PRPB 1V9JA 2LWPA 3ZNID 4B9KA 5C1ZA 1V5OA 3AXCA 4ZDVA 1J8CA 3DCGA 4GMVA 1V6EA 2LVQA 4ANVA 1XT9B 2KKCA 1UH6A 1WM2A 2R2OA 4N9F4 3DDCB 3RUIB 5E6OA 1UBQA 2YVCA 3VVWB 1YIWA 5FR6A 5AZFA 4KIKA 2XK5A 3ZKJC 4IW0A 4W9CA 2MRPA 5G2NA 3LJ3A 3TMPB 1EO6A 4JL9A 3VH4B 2MBHA 4HJKA 4GU2A 2JRIB 3U7DA 3GOEA 3H7SA 1YX5B 4RM9A 3A1QB 2L05A 2HE7A 3A9KA 3M95A 1UZXB 1E8WA 2REXA 1Z2MA 4W9KA 3MTNB 2KWCA 3A9JA 3WAPA 2FIFA 2LRUA 3PSEB 3EC8A 2D07B 3K9PB 4HDOA 5C23A 1WX8A 4FADA 2LZ6A 4J6IA 4GDLB 1WGRA 2MWSB 2IYDB 2BYFA 2CHZA 3HIZA 4GOCA 4FJYA 3QX1A 4GXBA 4G0NB 3ECIA 4NPNA 3LDZE 1XQQA 4KSLC 1OEYA 2JY6A 4KVGB 2JZ3B 5D6JB 4GDKB 5HKHA 1XD3B 4MH0E 4DBGA 1NBFC 3UGBB 2MQJA 4BKGA 4G3XB 2MBOA 3APCA 3ZUNA 4HXDA 3TL5A 3ZTDA 2C5LC 3DBRI 4K7SA 4OVVA 4PS3A 1ZGUB 4MSQB 3VAWA 2IZVB 1ZKHA 4BKTA 4AUQC 4K7UA 4XX5A 3APFA 2KK8A 1V49A 4OVUA 1WMHB 2ZEQA 4IWQA 4TV3A 1ISNA 2DZIA 2KDBA 3CSFA 3DVNV 1OEYJ 1M94A 4GB9A 2K25A 4ZRKA 3MHSD 4GDLA 2EKEC 4HPMB 2KFKB 4EZJA 2ZCBA 2M8SA 4ANWA 4E3CA 2WDTB 1YQBA 4P7IA 3L13A 3GZNI 3A9KB 4PS8A 2V3SA 3UINB 2JUOA 1SE9A 4EZKA 3QIJA 4BBNC 3HK0A 3QQ8B 3T9LA 4MGZE 2IY0B 3WAOA 3RD2A 3KUCB 4FN2A 2O2VA 2O2VB 4JQWC 1WRDB 5L95C 2LVOA 3L08A 2M4NA 4WJNA 1E90A 2LI5A 4JIOU 3ALBA 3IBEA 1P0RA 4RMAA 4CYEA 3PHXB 1V86A 4FLHA 2UYZB 4XC2A 5IA7A 2IO1B 2QHOA 4HCPB 1R4NI 1KM7A 2NBUA 4NAWA 4BOSC 2DZMA 4PS7A 4WWPA 2G3QB 2K39A 1WGGA 2I1JA 4IWPA 4BBNF 5JHAA 3DOWA 3Q3JA 3JSVA 2KQSA 4NQKE 3ZNGC 5KHQA 2M1MA 2KJRA 4MGYE 4KDLB 2KWUB 5LLIA 2LRWA 4F7ZA 4BOZB 2MBQA 1S3SG 1UD7A 3R7QA 5LXHA 1ZW7A 3B08A 3R7RA 2N1VA 1YJ1A 5AZGA 2CKHB 4HWIB 1IP9A 3U30A 1WR6E 2K6QA 4FULA 3PTFC 2HTHA 3NZSA 1WH3A 1WJNA 3VTVA 2AEHA 1WX7A 2GBRA 2V4LA 1E8YA 3ZNHB 1GC7A 2GBNA 2DYBA 2J7QB 3JYUA 1V5TA 4IC7B 3SDLC 5DCNA 1I35A 4NNJB 3VH3B 2NR2A 1VD2A 3ZNZB 1WZ0A 2RPQA 4MJSA 3CMMB 4GN1A 2DENB 4HPLB 1V80A 3RCZA 3TCAA 3ENEA 1KJTA 3HHMA 2K1FA 3P2BA 2L00B 2M0XA 4TKNA 1LFDA 3AU4A 1WXMA 3VUYA 1WM3A 3KH0A 3ML8A 2KJ6A 4LDTD 1P9DU 5IAAC 2N9EB 3M63B 2KMCA 2KDIA 4K1RB 2KX0A 2L7RA 4NY0A 3KYCD 3L17A 2FUHB 3VUWA 1YX6B 2PJHA 1WY8A 1PQSA 4NJ6A 2JF5A 1A5RA 2JXXA 3W1SA 3APDA 3MJWA 5BO4B 4MSMB 3WA0A 2KTRA 5J17A 1WJUA 1GG3A 2KC1A 1WX9A 4W9FA 3RT3B 2UWQA 1WE6A 1WE7A 3KW5B 2CHWA 3N30A 4LDTB 1QZEA 2AYOB 2C7HA 4FHJA 5CTRC 4ZRIA 4IM3A 3H1UA 3WAMA 5D94A 2FCMA 2ZCCA 2J0MA 4TQ1A 1TTNA 2LD9A 1G6JA 4II3B 1E7UA 2IBIB 4FBJB 2D2QA 2ZVOA 2CU1A 3WIMA 4MDKE 4FJVB 4BKSA 1J19A 2B3AA 4ZYNA 3RULA 5E6NA 2C9WB 2MLBA 1P3QU 2DYMA 3OLMD 2DAJA 2O6VA 2CS4A 1R4MI 1T0YA 2BGFA 1S1QB 3PT2B 3OAWA 3M3JA 3NS8A 3VDZA 2NBVB 4EEWA 1GNUA 4X57B 2NBWB 3UQAA 4KZ0A 4M8NA 4BVUC 2L3ZA 3R66C 4FHKA 3QA8A 1IYFA 2AL6A 2KVRA 1MG8A 2FAZA 2O6VB 2RSUA 3QCAA 4KZCA 2J0JA 2N1WA 3QWZB 2GMIC 3D32A 3OJ3A 2IO0B 2L76A 2A5UA 2LXAA 1WXSA 4LJOB 1KLVA 2LVPA 2GBMA 4JGHB 3TBLD 2PE6B 2KO3A 3L16A 1WMHA 2FCSA 3B0AA 3VTUA 3CF6E 1TBEA 4G50A 3IVFA 4KDIC 4HLEA 5AEKB 3PVLA 2G4DB 2MBEA 2W9NA 1F9JA 4HDQA 3ZDMC 1WXAA 2ZNVC 2XBBC 2HD5B 2BF8B 2JT4B 3BINA 3PRMB 2KC2A 2BYVE 3L0WB 2KTFA 1UELA 1WF9A 1J0GA 5E6PA 2KZRA 3H9DA 3PZDA 2I1KA 2R2QA 4W9GA 3T8MA 3UIPB 3PS6A 5D2MB 1U4AA 1OTRB 2D3GA 3L54A 2KANA 1SGHA 4WQOB 5DPRA 1RAXA 2LGXA 3WANA 2C60A 2KQ7A 3RZWC 3H6NA 4AWJA 2CHXA 1WJ4A 1X1MA 2JVCA 2JPHA 2VRRB 4I6NB 3V61A 3BY4B 5G55A 3A1QA 3PLVA 2O6VD 2K8BA 2LGDA 2XEWA 3SHQA 1SIFA 4M0WB 4EKUA 2YLMA 3EFUA 3K9OB 2D10A 2MP2A 4F1SA 2DYOA 1E8XA 2DZKA 2G4SA 3ZDTA 2BWFA 4B95A 2DX5B 4AJWA 1BT0A 4IM2A 2BPSA
chains in the Genus database with same CATH superfamily
3UF8A 2NTSA 2KACA 5E6JA 2ASQA 1Y56A 5DPTA 4RGTA 2K8HA 2ZPNA 4IM0A 4ICUA 3HM3A 3FKYA 3WALA 3AEGB 3HVDA 4MGIE 4YSZB 1E10A 3PREA 2LASA 3Q8AA 2LFIA 1GJZA 1DOYA 3DBSA 1JW9D 1FPYA 1FXTB 2SAKA 4W9JA 4I6LB 1I42A 2KLGA 4TUUA 3OJ4B 1L2NA 3BIID 1E5WA 3SD5A 1OQRA 5LNK1 2KFKA 2XK5B 3AEFB 1AYFA 2K0PA 3RPFC 3HRDD 3C0RB 2FNJB 3TJPA 2MSED 4DQOC 2BB5A 1P1AA 1WR1A 1ZUD2 2M17A 2L0TA 3DBRB 3W1SC 3RN9C 1EF1A 3ZQ4A 3NZUA 4DDGD 3A4SC 1UWXA 1UBIA 3ZRCA 2ZZPB 4MGKE 1HTQA 2N7DA 3ZGZA 2DZJA 2M19A 4ZRQA 1WGYA 3IFWB 3FILA 5AZHA 1Q5WB 1RRBA 5AUKA 3E9SA 3RNEC 1DGJA 1RLFA 1M4VA 2D3BA 4HK2A 2M0AA 2ZW0A 2KXJA 5CX3A 2BKFA 3NOBA 2JSVX 3DBLB 2IGGA 2PE9A 2N9XA 2D3CA 1V1OA 3AE4B 4W9IA 4ANUA 1E7VA 4HPPA 4GGQA 2EMTA 3PLUA 4URKA 4CHKA 4OZCA 5DPSA 2Z59B 1C4PA 2MW5A 5FK9C 5BYSA 2MBBB 1C9FA 1ZDVA 2ZW1A 2ZNVB 5MPOA 3Q3OC 2L8JA 5I4DA 3N3KB 1TIFA 2RR9A 1EF5A 2JZZA 4RGNA 4KV2A 3BVGA 5CHVC 3AI5A 2YEPF 4LNOA 2AWTA 1WIAA 4TMAB 3N1YC 2V3NA 1LM8B 4MT5A 2RMMA 3PPAA 4ACFA 1F0ZA 3DHHC 1L7YA 1V97A 2IJ0A 3NVVA 3RZFA 3NY5A 1WJ6A 1WXVA 2KFJA 1FCCC 3TIXA 1ACCA 4DXFA 4N59A 3DVGX 3P4PB 3QARA 4NQLB 3BYTB 1UUPA 3QAQA 1V2YA 4I6PA 1HQRD 4M02A 1XLOA 3AULA 4HVBA 4F8CB 1ET6A 2J42A 2BWES 2WP9B 1V5OA 1J8CA 4GMVA 1V6EA 3CIRB 1L6UA 5FR6A 5IOIA 1D5XC 4KIKA 3ZKJC 1TS2A 2MRPA 2EKIA 3Q6BA 1TY2A 4RM9A 2H88B 3A9KA 1UZXB 3WAPA 2REXA 1CK1A 2KWCA 2R61A 3AE2B 2D07B 1E7PB 2LZ6A 2RDGA 3VRBB 3QX1A 1TKGA 1FNVA 4NPNA 3LDZE 1QKZA 1OEYA 2JZ3B 2X38A 3AE6B 4GDKB 5D6JB 4MH0E 1NBFC 2FUG1 4BKGA 2LMCA 3ZUNA 2C5LC 3DBRI 4OVVA 1ENFA 1ZGUB 2AX5A 3VAWA 4A8XC 4K7UA 3PZ8A 3APFA 1J7AA 2KK8A 4IWQA 1JROA 2RDHA 5C3JB 3CSFA 1M94A 2K25A 4GDLA 1FXIA 1TKEA 4E3CA 1YQBA 3SFDB 1SE9A 2VH1A 3QIJA 3WAOA 3KUCB 3AH7A 2M4NA 1E90A 1JMLA 3ALBA 2J4XA 3BYYB 1JRPA 2IO1B 1AWDA 1R4NI 1KM7A 1QQRA 4NAWA 4WWPA 1WGGA 2OEDA 2I1JA 4IWPA 3DOWA 3EFCA 3ZNGC 2M1MA 2KJRA 1LGRA 4F7ZA 2CJOA 2MBQA 1UD7A 3ZYYX 3R7QA 3B08A 3R7RA 1HA5A 1ZOYB 2L83A 2M56B 3AEEB 1WJNA 1MVKA 2GBRA 1WX7A 2V4LA 4HJGE 1JQ4A 2FE8A 2WU2B 1MI0A 2GBNA 3JYUA 1I35A 1YJJA 3VH3B 1VD2A 2Y3AA 2HTME 3GP7A 2JZPA 3CMMB 2WXOA 1V80A 4HPLB 3TCAA 1MJDA 2KJ6A 1P9DU 1FD6A 2BVCA 2L7RA 1YX6B 3RNFC 1WY8A 2JXXA 3MJWA 4UDUC 2KTRA 3SR6A 3VR8B 1WJUA 2KC1A 4W9FA 4CQNA 3KW5B 3N30A 5CTRC 4ZRIA 1QZEA 2AYOB 3U4EG 3ZJVA 2FBWB 3WAMA 2WHIA 2ZCCA 4TQ1A 2LD9A 2V4IB 1I4HA 2IBIB 4FBJB 3WIMA 4FJVB 2GB1A 2INDC 4IDIA 5E6NA 2L32A 2MLBA 3OLMD 2CS4A 2WXPA 1I4XA 3VDZA 2NBVB 4OHJA 2NBWB 5JXVA 4M8NA 1AN8A 1IYFA 1MG8A 2O6VB 3OG5A 1YN5A 3QCAA 1FIQA 2HJ1A 2UU7A 4J3OD 4LJOB 1WXSA 2Y5PA 4RNAA 4JGHB 2FCSA 1AW7A 1SSNA 4HLEA 2JWUA 4C4VB 2W9NA 2ZNVC 4XE0A 1PYWD 1QT9A 2JT4B 2KC2A 1C76A 3L0WB 2KTFA 3H9DA 4W9GA 2R2QA 5H8YE 1U4AA 1OTRB 1WSPA 1SGHA 4WQOB 3AE9B 2B76B 1WJ4A 1XEEA 2JVCA 3V61A 5G55A 3PLVA 2O6VD 2K8BA 1C4CA 1PGAA 1E8XA 1R4NB 1XCQL 1WWTA 1D4BA 2G4SA 3ZDTA 1V1PB 2PLPA 3AEDB 4IM2A 3AE5B 2ICIA 3RYTA 4FA6A 2MJEA 3EECA 3V3XA 2IY1B 3KUZA 1JWMD 4CO7A 2NTTA 1SB3C 1GAQB 2DHZA 2KDFB 4LCDE 4ZOHC 5BYQA 4ASWC 1MPEA 2KOXA 3NHEB 3T3NA 3L4PA 4DXGA 3X23A 3SFEB 3ZO5B 1DOXA 1VDVA 2V9HA 1L0XB 2HJ8A 4HKQA 3PHWB 1WI0A 5LXIB 1JRUA 1N60A 1FCLA 2FCNA 3W9CB 3EHVA 3VR9B 2MX2A 1P7FA 2N9PC 4S17A 2G1EA 4ZRJA 4FJZA 4K81A 2A4ZA 2ZVNA 2LGYA 4WWMA 4DXAB 2C7MB 3Q3FA 1K8RB 3V62A 2JWZA 3PRZA 1JWAD 3N9YC 3ZTCA 3QK0A 2G9HD 2N7EA 4GDKA 4HCNB 3W2DA 3DBHI 3VQIA 3JVZX 3ABVB 4EZLA 3NG0A 3DBHB 2NPTA 3MHZA 1LQBA 1QOFA 2GLSA 1YJIA 3ML9A 2KN5A 4BKSD 4NJ7A 3Q69A 4YT0B 2H89B 4YWGG 2KWVB 1B9RA 4WJOA 1C4AA 2EELA 3DBLI 4W9HA 4NAMA 2PPHA 3NZ3A 4ICVA 4A55A 4NZLB 5TR5A 1TZOA 4LTUA 3UQBA 3V6EB 2QIEB 3AM9A 1OFFA 4WIPA 4E74A 3ZLZA 2OOBB 1K51A 1T5XD 2NMQA 4YSXB 4W9EA 3PZ7A 1SE3A 1SEBD 4NAWB 2NCNA 2Z0DB 3Q3MC 1EUVB 4XGAB 4A3OA 1QLBB 1GUAB 3N20C 1T0QC 3ONSA 1BUIC 3DVGY 2BBCA 1L5PA 3B2GA 1RFKA 3A9JB 3M62B 2EMSA 1NDDA 1BMLC 1IGDA 2C7NB 2WXNA 2BYEA 2NVUI 1JCKB 1V81A 1H4RA 3TEYA 2FCQA 2ONQA 4B6WA 4EUTA 3PV1A 3Q14C 2RPVA 1I7HA 4GSWA 1ET9A 1VCBA 4G11A 5HI1A 2WXKA 2KMAA 2KX3A 3LXFA 4WWOA 4WURA 1FNUA 5C1ZA 3T3OA 1XLPA 3LB8C 1XT9B 2Z8LA 1UH6A 4RCOA 4N9F4 1EM7A 1KLGD 3RUIB 5E6OA 1UBQA 1YIWA 5AZFA 2XK5A 1PDXA 4W9CA 4EE2A 3TMPB 3VH4B 2MBHA 2WDVB 4LNIA 1YX5B 3A1QB 2L05A 3P4SB 1E9MA 2N7JA 5EE9A 3K9PB 4RFBA 4GDLB 3NJTA 2CHZA 4RF0A 4FJYA 4GXBA 2E3TA 4KSLC 3U7ZA 5HKHA 1XD3B 4G3XB 2WXFA 2IGDA 3APCA 4HXDA 4PS3A 4IOIE 4PT5A 2K5PA 2WU5B 4P1BC 1ZKHA 3BZDB 4AUQC 4BKTA 2GI9A 5C2TB 2QEJC 4YTNB 3DVNV 4B0EA 4ZRKA 4M00A 2J53A 2EKEC 4HPMB 1RYJA 3RNAC 4M0WA 3L13A 1EU3A 3GZNI 2JXTA 3A9KB 1UGJA 3UINB 4O1NA 4EZKA 4RH6A 3QQ8B 3T9LA 1NENB 4MGZE 4MACA 2O2VA 4JQWC 5L95C 4WJNA 1N61A 5IA7A 1R4MB 2DZMA 3URYA 4ARIA 1NI3A 1GPXA 4BBNF 1ZXHA 3AEBB 3GS2A 4MGYE 4KDLB 5LLIA 1VZ6A 1KF6B 4USAA 3IAM1 2N1VA 2CKHB 3ZXRA 3U30A 2K6QA 1D5MC 2HTHA 1WH3A 2AEHA 3ZNHB 4IC7B 1YOVB 3ZNZB 4JWUC 1N5XA 2MEKA 4GN1A 2DENB 3RCZA 2N0SB 2K1FA 3P2BA 3HUIA 2L00B 1LFDA 3ML8A 1ZP0B 2INNE 4YXDB 1FRDA 1IGCA 2KX0A 4NY0A 3L17A 1ZPSA 2JF5A 1YQ3B 3APDA 3GB1A 4MSMB 1GB4A 1WYGA 5IP4D 1WX9A 1WE6A 4LDTB 1SE4A 4FHJA 3KQ4A 3H1UA 5D94A 4LK0M 2I2YA 4HKZE 4II3B 1E7UA 1V8CA 3AECB 2K22A 1J19A 2B3AA 3RULA 3TEWA 1TY0A 2DYMA 4L1BA 2O6VA 1T0YA 1TYGB 2JYEA 2XN9C 3UQAA 4BVUC 2PVGC 4FHKA 3QA8A 2KVRA 3RFZB 2RSUA 1JWSD 2W3SA 3TEZA 2IO0B 1J7BA 2AQ2B 3KWLA 3TBLD 3Q8FA 5D3DA 1TBEA 1HZ5A 4KDIC 5AEKB 3PVLA 2MBEA 1F9JA 3KWVA 1WXAA 2XBBC 1V1PA 3BINA 2BS3B 2BYVE 3IXSA 1WF9A 5E6PA 2KZRA 3T8MA 3BK1A 3L54A 2KANA 4C00A 5DPRA 1HTOA 1MHXA 2C60A 1ZXIA 4AWJA 2JPHA 4I6NB 2J52A 1TKYA 4D2KA 4WAFA 2LGDA 2YLMA 3K9OB 4ZRPA 1SXTA 2INCC 3U2SC 4R3DA 2JX5A 2DZKA 2BTEA 4ZYSA 3MFGA 3DWGC 1RWSA 2DYBA 2BPSA 4TQ0A 4KGSA 3HM6X 3QJZA 1P98A 1L4DB 4HRSA 3AV8A 4WWNA 4IKGA 2WXQA 1GC6A 1E8ZA 2KD0A 4KSKC 2ZPYA 2FIDA 1DOIA 2QILA 4C80A 2NS5A 3VXWA 4IWOA 5CHFA 1KTKA 2CR5A 1IBXB 4OZAA 4DHZE 4AS1A 1TZ1A 1WGKA 3AU5A 2LHDA 2L0FA 3KYDD 2VZKB 3BVMA 1STEA 3RI7C 2RGFA 5GXGB 5H92C 1IPGA 4MJSB 4H2AA 2IO3B 3IAS1 5JZEB 1FO4A 4WH4A 3KUDB 3B2FA 3B1LX 2WQYB 1HE8A 5EDSA 2WWZA 3IG3A 3AE8B 2GBJA 1CMXB 3GZNB 3QHTA 2GBKA 3I3TB 3V60A 2QC8A 1WGHA 2DAFA 1YN3A 2N4FA 3EA6A 3FC4A 4BFRA 1WZ3A 2WXGA 3H7PB 1UWMA 3P63A 5DPWA 2KLCA 3VTWA 3DHGC 2VZKD 4W9DA 3RNCC 1TGZB 2Y5BB 2WXMA 4AOFA 4MM3A 2J0KA 3H7PA 3A4RA 2LJ5A 1D3ZA 3KVFB 1FEHA 3R3MA 1K50A 4KGTA 1OQYA 2KT7A 3HVZA 2LUMA 4LNKA 2LXCA 2WGSA 3PGEA 4A3PA 3S2AA 2JRHA 3E56A 3DWMA 4XWWA 2I38A 3I9V1 5J2RA 1F2RI 1H8CA 4YSYB 5BYRA 3N1XC 4WJPA 4EFOA 1HZ6A 2V1YA 3VHTC 2WLBA 3DVNU 1JWBD 1Q1OA 1C1YB 2KHWB 4II2B 2AL3A 3ETRA 4YL8A 3RNGC 3N32A 4K7WA 5BMGA 1FRRA 2LHEA 2Y5CA 4MEMA 5D3IB 5EE1A 3CSTA 4MH8A 4US9A 2G45B 2NPTB 4E71A 1SE2A 1UGMA 2Z0EB 2RDBC 1YMHE 4RGOS 2V0GA 2GOWA 3ZIMA 3R2TA 1YD8U 2JYTA 3NRZA 3PRPB 1V9JA 4B9KA 3PO0A 3EGRA 4ANVA 2KKCA 1FXAA 3DDCB 3VVWB 2MH7A 4IW0A 4JL9A 4HJKA 4GU2A 2JRIB 3U7DA 4A9AA 3H7SA 4GLSC 2HE7A 4HROA 4RF1A 1E8WA 4W9KA 1Z2MA 4S0RA 4WQMA 5BMHA 3EC8A 4HDOA 1WX8A 3EUB2 4J6IA 1WGRA 2MWSB 2IYDB 4GOCA 1TS4A 1VZ8A 4ITKA 1XQQA 2GRIA 2JY6A 4KVGB 1I4QA 1IUEA 2MQJA 2MBOA 2QMTA 3BVZA 4XX5A 4MM3B 4A90A 4OVUA 1WMHB 2ZEQA 1ISNA 2DZIA 1SIJA 1XCTL 2KDBA 3ZXVA 4GB9A 2X8XX 1F77A 2KFKB 4EZJA 1ZDXA 2M8SA 4ANWA 2WDTB 4P7IA 1VR9A 2V3SA 3R2IA 2JUOA 4BBNC 3HK0A 3RD2A 4FN2A 1WRDB 2L1AA 2LVOA 2LI5A 4JIOU 3NVYA 4YTPB 3PHXB 1V86A 1EWYC 4HCPB 3MC9A 4BOSC 4PS7A 2G3QB 3P4QB 2YEPB 5JHAA 3JSVA 4NQKE 1N6ZA 5KHQA 1EWCA 1T3QA 2QCZA 3UI3A 2KWUB 2LRWA 1QF6A 4BOZB 1S3SG 3B9JA 1ZW7A 2BB6A 5AZGA 1YJ1A 4HWIB 1T0RC 1WR6E 4FULA 3VTVA 3NUHB 1L0YB 1GC7A 1V5TA 3FAHA 4REZA 3SDLC 4BAXA 4NNJB 1PGXA 1MHHE 1D5ZC 1WZ0A 4MJSA 1TJEA 3ENEA 2DLBA 4TKNA 1T6BX 1I4RA 1WXMA 3AE1B 1XF5L 3AE7B 5FR3A 4LDTD 2WDQB 2BS4B 5IAAC 3TUOA 3C19A 3M63B 2KMCA 1XLNA 2WXJA 3KYCD 2FUHB 2PJHA 1QILA 3W1SA 5BO4B 3WA0A 5J17A 2HDEA 2ACZB 3ZJUA 3RT3B 2UWQA 4OW0A 2CHWA 2C7HA 4IM3A 1OQQA 3N1ZC 2FCMA 1TTNA 1G6JA 2K9XA 4YTMB 2CU1A 1GB1A 4BKSA 2KQ4X 4OVZA 2C9WB 1P3QU 1LO5D 1DYQA 2BGFA 3PT2B 1UF0A 2ON8A 3OAWA 1JWUD 1MFWA 4X57B 1K52A 2L3ZA 2W82A 2FAZA 3Q2AC 4KZCA 2N1WA 2IPKD 3D32A 3OJ3A 2L76A 2LXAA 2A5UA 1SJHD 1YQ4B 2BT6A 3P4RB 2KYWA 3CF6E 3RMKC 1L6VA 2G4DB 3I5JC 4L2YA 4JX1C 2PKOA 2HD5B 2BF8B 3Q8EA 3PRMB 2W54A 3BK2A 1UELA 1N5WA 2BW2A 3OWEB 1J0GA 2I1KA 3UIPB 3PS6A 5D2MB 2D5GA 1FM0D 1KLUD 1RAXA 3WANA 1F1HA 3H6NA 3NS1A 1X1MA 4LLGM 3BY4B 1L0VB 3NVWA 1VZ7A 4ZHOA 3SHQA 1SIFA 4EKUA 1IBXA 2D10A 3H8HA 4F1SA 2DYOA 4ARCA 5IKCM 4ZHPA 3GE3C 2INPE 4B95A 2DX5B 5TSSA 4AJWA 3JW0X 3UIOB 3GE8C 4K3BA 2IO2B 3L10B 2MCNB 1MG4A 2PEAA 2WX0A 1LXDA 5CHWA 1NYQA 3W1YA 1Y8RC 4KKIA 5EE3A 2K8CA 2KAJA 2LUEA 2KDEB 4C56C 4NJCA 2KN4A 4LNFA 1L4ZB 1KRHA 2WXHA 3AEAB 4XWTA 2WS3B 4IUMB 3IT6B 2BQQA 2JQRB 4DK5A 2RD0A 4A20A 3ZVVA 2OJRA 1Z5SB 4RM8A 1GOZA 2BS2B 2LJIA 4HEA1 4N58A 4W9LA 1N62A 2XNAC 1P7EA 2WXLA 4C7ZA 2TSSA 4PYZA 3X0WA 4AJYB 1VRAB 4P16A 5G5GA 2CJNA 1C78A 1FFUA 1WFYA 1RFAA 2D11A 5J18A 1WGDA 5L83A 5D7GA 1TS3A 4Q2JA 4WJQA 2MA9B 3Q3NC 1BXTA 1WYWB 1AARA 2KJHB 4DHZB 3U8ZA 1JALA 5JHBA 4C4VA 2BKRB 1CJEA 1C3TA 2MHJA 1HEZE 2MP2B 3O13A 1K53A 2E6XA 4M8MA 4IG7B 4KX6B 1XLQA 2LGIA 3DHIC 3ZW3A 1QOGA 3ZRFA 4WAAA 4DHJB 3SEBA 1KOTA 1WXQA 2KMMA 4LJPB 5KHOA 2IGHA 4JLCA 1SJED 4XZ4A 1D6EC 1Q0WB 4JPSA 3CWIA 2K6DB 4DDID 2WX1A 5GMVA 5HG2A 3JSVB 1A70A 2KTRB 2W3RA 4TSSA 3MC8A 3V05A 1B1ZA 4XYCA 1J7CA 2OHFA 4AP4C 2N9KA 3O65B 3VFKA 4KIKB 2QSDA 2PIAA 1NI2A 3BWUD 2WYQA 3DQVA 3IHPC 4DWFA 4EOYA 1OGWA 3DPDA 5HHDG 3WCQA 2KWDA 5AUIA 5JH5C 4GIVA 4L23A 2DWQA 2ZJDA 3A33B 4MELA 4DHJD 4FXCA 3QC8B 2PMVA 3KLSX 4QAYA 3VUXA 2K3UA 3TEXA 3V6CB 4C7YA 3SU8X 2KNBA 4ANXA 4PYUA 4P1CC 4OZBA 1C77A 3ZNID 2LWPA 4M01A 3Q8CA 3AXCA 4ZDVA 1N63A 2PVOD 3DCGA 2LVQA 4LNNA 1WM2A 2R2OA 2SEBD 1E0ZA 1E6EB 2Q5WD 2YVCA 5G2NA 2AQ3B 1HXYD 3LJ3A 1EO6A 1YNTE 3GOEA 2IDYA 2LGSA 3M95A 2WXRA 5HFYA 3MTNB 3A9JA 2FIFA 2LRUA 3PSEB 5C23A 3ZJTA 4FADA 1QOBA 1R7SA 5IO9A 2BYFA 3MP9A 3HIZA 4A6QA 3P1MA 4G0NB 3ECIA 3AE3B 2MJ3A 4DBGA 4XDDA 3UGBB 3ZTDA 3TL5A 4K7SA 3VRAB 4MSQB 1VLBA 2IZVB 5BMIA 3MJ5A 3AB5A 1V49A 4KGRA 4TV3A 2KVZA 2KDMA 1OEYJ 1XO3A 3MHSD 1SF0A 2ZCBA 1I4PA 1TS5A 4PS8A 2D3AA 2IY0B 2O2VB 1Q10A 3L08A 1NEKB 3IBEA 1P0RA 4RMAA 4CYEA 2PW9A 4FLHA 3I63C 2QJLA 2UYZB 4XC2A 4AQ7A 1RM6C 2QHOA 1T0SC 4JE3B 2NBUA 2K39A 3U52E 3Q3JA 2KQSA 5LXHA 1EU4A 1IP9A 3PTFC 3NZSA 1CZPA 1E8YA 2WDRB 4BZAA 2J7QB 2W55A 5DCNA 2NR2A 1PUTA 3I57A 1F2RC 2N9LA 2RPQA 1F52A 1KJTA 3HHMA 5EE0A 2M0XA 3AMZA 3RNBC 1ROEA 3AU4A 3VUYA 3FILB 1WM3A 3KH0A 1XXGA 3J9CA 2N9EB 4K1RB 2KDIA 3MC0B 3VUWA 5IN7A 1PQSA 4NJ6A 1A5RA 1GG3A 1KFYB 1WE7A 4P6VF 2PTLA 2V3PA 1NYRA 2J0MA 1QOAA 3W5VB 2D2QA 2ZVOA 4MDKE 3C8YA 4ZYNA 2DAJA 1R4MI 1YN4A 2LEKA 5FKAC 1S1QB 4PK1A 3M3JA 3NS8A 4EEWA 1GNUA 3R8BA 4KZ0A 1C79A 3R66C 1VJKA 2AL6A 1ZE3D 3LYYA 4B0MA 3IT4B 2J0JA 3QWZB 2GMIC 2BYTA 1WRIA 1KLVA 2LVPA 2QDFA 2GBMA 1I4GA 2OJWA 2PE6B 2KO3A 3L16A 1WMHA 3B0AA 2L52A 3VTUA 1KH0A 4G50A 3IVFA 4K3CA 2DBYA 3AN1A 1FNWA 1TT5B 4HDQA 3ZDMC 1PFDA 1ESFA 2WXIA 3W5UB 3NVZA 4US8A 5G5HA 1FFVA 2AQ1B 3TSSA 1PGBA 1UNSA 3Q8BA 3P42A 3PZDA 2CU3A 2DNFA 2D3GA 1NVID 2LGXA 2KQ7A 3RZWC 2CHXA 2VRRB 2WNMA 2MJDA 3A1QA 2VH2A 2XEWA 4M0WB 3EFUA 2MP2A 4RGMA 1SBBB 4N6EB 4XDCA 2JU6X 4KKJA 2BWFA 4JWSC 1FMAD 5T8IA 1BT0A 1CQVA
chains in the Genus database with same CATH topology
3JW0X 3UIOB 4TQ0A 3UF8A 3HM6X 2IO2B 3QJZA 1P98A 3L10B 2MCNB 3RYTA 4FA6A 2PEAA 2WX0A 1LXDA 3EECA 5CHWA 2IY1B 3KUZA 3W1YA 1Y8RC 2ASQA 4CO7A 5DPTA 4WWNA 2K8HA 2DHZA 2ZPNA 4IM0A 4ICUA 2KDFB 3HM3A 4LCDE 1GC6A 3WALA 1E8ZA 2K8CA 2KD0A 4MGIE 4KSKC 4ASWC 3PREA 2LUEA 2KDEB 2ZPYA 2LASA 2KOXA 2FIDA 3NHEB 3X23A 1GJZA 3ZO5B 2NS5A 3DBSA 4IUMB 3VXWA 4IWOA 4DK5A 2RD0A 5CHFA 4A20A 1FXTB 3ZVVA 2OJRA 1Z5SB 4RM8A 2CR5A 2HJ8A 4W9LA 4W9JA 4I6LB 1I42A 2KLGA 3PHWB 4DHZE 1WI0A 5LXIB 1JRUA 4TUUA 2FCNA 1TZ1A 3AU5A 2L0FA 3OJ4B 4PYZA 3X0WA 1L2NA 3SD5A 1E5WA 3EHVA 3KYDD 4AJYB 2KFKA 2XK5B 1WFYA 2MX2A 2N9PC 2RGFA 3C0RB 1RFAA 2D11A 2FNJB 4ZRJA 3TJPA 5J18A 1IPGA 1WGDA 2MSED 4FJZA 4K81A 4MJSB 2A4ZA 2ZVNA 1P1AA 2IO3B 5L83A 2LGYA 5D7GA 1WR1A 4DXAB 2M17A 2C7MB 2L0TA 4WJQA 2MA9B 3W1SC 3Q3FA 1EF1A 1K8RB 5JZEB 3NZUA 3V62A 4DDGD 2JWZA 3A4SC 3PRZA 1UBIA 1WYWB 1AARA 2KJHB 3ZRCA 2ZZPB 4DHZB 4MGKE 3ZTCA 3KUDB 3U8ZA 2N7DA 3B1LX 3QK0A 5JHBA 2N7EA 1HE8A 2DZJA 5EDSA 2WWZA 3IG3A 2BKRB 4GDKA 4HCNB 2GBJA 1CMXB 3DBHI 2GBKA 3QHTA 1C3TA 3VQIA 3JVZX 1WGYA 2MP2B 3I3TB 3IFWB 3V60A 5AZHA 1Q5WB 4EZLA 1RRBA 1WGHA 2DAFA 2N4FA 4BFRA 1WZ3A 2NPTA 4M8MA 1RLFA 1LQBA 3H7PB 4IG7B 3ML9A 5DPWA 2KN5A 4HK2A 4BKSD 4NJ7A 2KXJA 2KLCA 5CX3A 3VTWA 2KWVB 3ZW3A 4W9DA 2BKFA 4WJOA 3NOBA 1TGZB 2Y5BB 3DBLI 2PE9A 2N9XA 4W9HA 4AOFA 4MM3A 4W9IA 2J0KA 2PPHA 3H7PA 3ZRFA 4ANUA 1E7VA 4ICVA 4GGQA 2EMTA 3A4RA 4WAAA 5TR5A 2LJ5A 3PLUA 4DHJB 3KVFB 1D3ZA 3UQBA 3V6EB 3R3MA 1KOTA 4E74A 4URKA 3ZLZA 4CHKA 1OQYA 2OOBB 4LJPB 5KHOA 4JLCA 4XZ4A 5DPSA 2Z59B 4W9EA 1Q0WB 4NAWB 2NCNA 2K6DB 2LXCA 3PGEA 2MW5A 2Z0DB 4DDID 1EUVB 4A3PA 2WX1A 4A3OA 5GMVA 2MBBB 3JSVB 3S2AA 2JRHA 1GUAB 2ZNVB 2KTRB 3ONSA 2L8JA 5J2RA 3N3KB 1H8CA 3DVGY 2RR9A 1EF5A 2JZZA 4WJPA 4EFOA 2V1YA 4KV2A 5CHVC 4AP4C 3O65B 3AI5A 3A9JB 3VFKA 3VHTC 4KIKB 3DVNU 2AWTA 1WIAA 1NI2A 3M62B 1Q1OA 2EMSA 1NDDA 2WYQA 1LM8B 1C1YB 3DQVA 3IHPC 2KHWB 3PPAA 2C7NB 4II2B 4DWFA 2BYEA 4EOYA 1OGWA 2AL3A 3DPDA 1L7YA 2NVUI 4YL8A 3N32A 5JH5C 4K7WA 1V81A 4GIVA 3RZFA 3NY5A 1H4RA 1WJ6A 1WXVA 2KFJA 3TIXA 4MEMA 2ZJDA 2FCQA 3A33B 4MELA 4B6WA 3PV1A 3CSTA 4DHJD 4EUTA 3DVGX 3QARA 2G45B 2NPTB 3QC8B 4NQLB 4E71A 3QAQA 1UGMA 2Z0EB 1V2YA 4GSWA 4I6PA 3VUXA 1VCBA 3V6CB 3AULA 4G11A 3SU8X 4HVBA 2KNBA 2KMAA 2GOWA 2KX3A 3ZIMA 4ANXA 4F8CB 2BWES 4PYUA 1YD8U 4WWOA 3PRPB 1V9JA 2LWPA 3ZNID 4B9KA 5C1ZA 1V5OA 3AXCA 4ZDVA 1J8CA 3DCGA 4GMVA 1V6EA 2LVQA 4ANVA 1XT9B 2KKCA 1UH6A 1WM2A 2R2OA 4N9F4 3DDCB 3RUIB 5E6OA 1UBQA 2YVCA 3VVWB 1YIWA 5FR6A 5AZFA 4KIKA 2XK5A 3ZKJC 4IW0A 4W9CA 2MRPA 5G2NA 3LJ3A 3TMPB 1EO6A 4JL9A 3VH4B 2MBHA 4HJKA 4GU2A 2JRIB 3U7DA 3GOEA 3H7SA 1YX5B 4RM9A 3A1QB 2L05A 2HE7A 3A9KA 3M95A 1UZXB 1E8WA 2REXA 1Z2MA 4W9KA 3MTNB 2KWCA 3A9JA 3WAPA 2FIFA 2LRUA 3PSEB 3EC8A 2D07B 3K9PB 4HDOA 5C23A 1WX8A 4FADA 2LZ6A 4J6IA 4GDLB 1WGRA 2MWSB 2IYDB 2BYFA 2CHZA 3HIZA 4GOCA 4FJYA 3QX1A 4GXBA 4G0NB 3ECIA 4NPNA 3LDZE 1XQQA 4KSLC 1OEYA 2JY6A 4KVGB 2JZ3B 5D6JB 4GDKB 5HKHA 1XD3B 4MH0E 4DBGA 1NBFC 3UGBB 2MQJA 4BKGA 4G3XB 2MBOA 3APCA 3ZUNA 4HXDA 3TL5A 3ZTDA 2C5LC 3DBRI 4K7SA 4OVVA 4PS3A 1ZGUB 4MSQB 3VAWA 2IZVB 1ZKHA 4BKTA 4AUQC 4K7UA 4XX5A 3APFA 2KK8A 1V49A 4OVUA 1WMHB 2ZEQA 4IWQA 4TV3A 1ISNA 2DZIA 2KDBA 3CSFA 3DVNV 1OEYJ 1M94A 4GB9A 2K25A 4ZRKA 3MHSD 4GDLA 2EKEC 4HPMB 2KFKB 4EZJA 2ZCBA 2M8SA 4ANWA 4E3CA 2WDTB 1YQBA 4P7IA 3L13A 3GZNI 3A9KB 4PS8A 2V3SA 3UINB 2JUOA 1SE9A 4EZKA 3QIJA 4BBNC 3HK0A 3QQ8B 3T9LA 4MGZE 2IY0B 3WAOA 3RD2A 3KUCB 4FN2A 2O2VA 2O2VB 4JQWC 1WRDB 5L95C 2LVOA 3L08A 2M4NA 4WJNA 1E90A 2LI5A 4JIOU 3ALBA 3IBEA 1P0RA 4RMAA 4CYEA 3PHXB 1V86A 4FLHA 2UYZB 4XC2A 5IA7A 2IO1B 2QHOA 4HCPB 1R4NI 1KM7A 2NBUA 4NAWA 4BOSC 2DZMA 4PS7A 4WWPA 2G3QB 2K39A 1WGGA 2I1JA 4IWPA 4BBNF 5JHAA 3DOWA 3Q3JA 3JSVA 2KQSA 4NQKE 3ZNGC 5KHQA 2M1MA 2KJRA 4MGYE 4KDLB 2KWUB 5LLIA 2LRWA 4F7ZA 4BOZB 2MBQA 1S3SG 1UD7A 3R7QA 5LXHA 1ZW7A 3B08A 3R7RA 2N1VA 1YJ1A 5AZGA 2CKHB 4HWIB 1IP9A 3U30A 1WR6E 2K6QA 4FULA 3PTFC 2HTHA 3NZSA 1WH3A 1WJNA 3VTVA 2AEHA 1WX7A 2GBRA 2V4LA 1E8YA 3ZNHB 1GC7A 2GBNA 2DYBA 2J7QB 3JYUA 1V5TA 4IC7B 3SDLC 5DCNA 1I35A 4NNJB 3VH3B 2NR2A 1VD2A 3ZNZB 1WZ0A 2RPQA 4MJSA 3CMMB 4GN1A 2DENB 4HPLB 1V80A 3RCZA 3TCAA 3ENEA 1KJTA 3HHMA 2K1FA 3P2BA 2L00B 2M0XA 4TKNA 1LFDA 3AU4A 1WXMA 3VUYA 1WM3A 3KH0A 3ML8A 2KJ6A 4LDTD 1P9DU 5IAAC 2N9EB 3M63B 2KMCA 2KDIA 4K1RB 2KX0A 2L7RA 4NY0A 3KYCD 3L17A 2FUHB 3VUWA 1YX6B 2PJHA 1WY8A 1PQSA 4NJ6A 2JF5A 1A5RA 2JXXA 3W1SA 3APDA 3MJWA 5BO4B 4MSMB 3WA0A 2KTRA 5J17A 1WJUA 1GG3A 2KC1A 1WX9A 4W9FA 3RT3B 2UWQA 1WE6A 1WE7A 3KW5B 2CHWA 3N30A 4LDTB 1QZEA 2AYOB 2C7HA 4FHJA 5CTRC 4ZRIA 4IM3A 3H1UA 3WAMA 5D94A 2FCMA 2ZCCA 2J0MA 4TQ1A 1TTNA 2LD9A 1G6JA 4II3B 1E7UA 2IBIB 4FBJB 2D2QA 2ZVOA 2CU1A 3WIMA 4MDKE 4FJVB 4BKSA 1J19A 2B3AA 4ZYNA 3RULA 5E6NA 2C9WB 2MLBA 1P3QU 2DYMA 3OLMD 2DAJA 2O6VA 2CS4A 1R4MI 1T0YA 2BGFA 1S1QB 3PT2B 3OAWA 3M3JA 3NS8A 3VDZA 2NBVB 4EEWA 1GNUA 4X57B 2NBWB 3UQAA 4KZ0A 4M8NA 4BVUC 2L3ZA 3R66C 4FHKA 3QA8A 1IYFA 2AL6A 2KVRA 1MG8A 2FAZA 2O6VB 2RSUA 3QCAA 4KZCA 2J0JA 2N1WA 3QWZB 2GMIC 3D32A 3OJ3A 2IO0B 2L76A 2A5UA 2LXAA 1WXSA 4LJOB 1KLVA 2LVPA 2GBMA 4JGHB 3TBLD 2PE6B 2KO3A 3L16A 1WMHA 2FCSA 3B0AA 3VTUA 3CF6E 1TBEA 4G50A 3IVFA 4KDIC 4HLEA 5AEKB 3PVLA 2G4DB 2MBEA 2W9NA 1F9JA 4HDQA 3ZDMC 1WXAA 2ZNVC 2XBBC 2HD5B 2BF8B 2JT4B 3BINA 3PRMB 2KC2A 2BYVE 3L0WB 2KTFA 1UELA 1WF9A 1J0GA 5E6PA 2KZRA 3H9DA 3PZDA 2I1KA 2R2QA 4W9GA 3T8MA 3UIPB 3PS6A 5D2MB 1U4AA 1OTRB 2D3GA 3L54A 2KANA 1SGHA 4WQOB 5DPRA 1RAXA 2LGXA 3WANA 2C60A 2KQ7A 3RZWC 3H6NA 4AWJA 2CHXA 1WJ4A 1X1MA 2JVCA 2JPHA 2VRRB 4I6NB 3V61A 3BY4B 5G55A 3A1QA 3PLVA 2O6VD 2K8BA 2LGDA 2XEWA 3SHQA 1SIFA 4M0WB 4EKUA 2YLMA 3EFUA 3K9OB 2D10A 2MP2A 4F1SA 2DYOA 1E8XA 2DZKA 2G4SA 3ZDTA 2BWFA 4B95A 2DX5B 4AJWA 1BT0A 4IM2A 2BPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JW0 X;  3UIO B;  4TQ0 A;  3UF8 A;  3HM6 X;  2IO2 B;  3QJZ A;  1P98 A;  3L10 B;  2MCN B;  3RYT A;  4FA6 A;  2PEA A;  2WX0 A;  1LXD A;  3EEC A;  5CHW A;  2IY1 B;  3KUZ A;  3W1Y A;  1Y8R C;  2ASQ A;  4CO7 A;  5DPT A;  4WWN A;  2K8H A;  2DHZ A;  2ZPN A;  4IM0 A;  4ICU A;  2KDF B;  3HM3 A;  4LCD E;  1GC6 A;  3WAL A;  1E8Z A;  2K8C A;  2KD0 A;  4MGI E;  4KSK C;  4ASW C;  3PRE A;  2LUE A;  2KDE B;  2ZPY A;  2LAS A;  2KOX A;  2FID A;  3NHE B;  3X23 A;  1GJZ A;  3ZO5 B;  2NS5 A;  3DBS A;  4IUM B;  3VXW A;  4IWO A;  4DK5 A;  2RD0 A;  5CHF A;  4A20 A;  1FXT B;  3ZVV A;  2OJR A;  1Z5S B;  4RM8 A;  2CR5 A;  2HJ8 A;  4W9L A;  4W9J A;  4I6L B;  1I42 A;  2KLG A;  3PHW B;  4DHZ E;  1WI0 A;  5LXI B;  1JRU A;  4TUU A;  2FCN A;  1TZ1 A;  3AU5 A;  2L0F A;  3OJ4 B;  4PYZ A;  3X0W A;  1L2N A;  3SD5 A;  1E5W A;  3EHV A;  3KYD D;  4AJY B;  2KFK A;  2XK5 B;  1WFY A;  2MX2 A;  2N9P C;  2RGF A;  3C0R B;  1RFA A;  2D11 A;  2FNJ B;  4ZRJ A;  3TJP A;  5J18 A;  1IPG A;  1WGD A;  2MSE D;  4FJZ A;  4K81 A;  4MJS B;  2A4Z A;  2ZVN A;  1P1A A;  2IO3 B;  5L83 A;  2LGY A;  5D7G A;  1WR1 A;  4DXA B;  2M17 A;  2C7M B;  2L0T A;  4WJQ A;  2MA9 B;  3W1S C;  3Q3F A;  1EF1 A;  1K8R B;  5JZE B;  3NZU A;  3V62 A;  4DDG D;  2JWZ A;  3A4S C;  3PRZ A;  1UBI A;  1WYW B;  1AAR A;  2KJH B;  3ZRC A;  2ZZP B;  4DHZ B;  4MGK E;  3ZTC A;  3KUD B;  3U8Z A;  2N7D A;  3B1L X;  3QK0 A;  5JHB A;  2N7E A;  1HE8 A;  2DZJ A;  5EDS A;  2WWZ A;  3IG3 A;  2BKR B;  4GDK A;  4HCN B;  2GBJ A;  1CMX B;  3DBH I;  2GBK A;  3QHT A;  1C3T A;  3VQI A;  3JVZ X;  1WGY A;  2MP2 B;  3I3T B;  3IFW B;  3V60 A;  5AZH A;  1Q5W B;  4EZL A;  1RRB A;  1WGH A;  2DAF A;  2N4F A;  4BFR A;  1WZ3 A;  2NPT A;  4M8M A;  1RLF A;  1LQB A;  3H7P B;  4IG7 B;  3ML9 A;  5DPW A;  2KN5 A;  4HK2 A;  4BKS D;  4NJ7 A;  2KXJ A;  2KLC A;  5CX3 A;  3VTW A;  2KWV B;  3ZW3 A;  4W9D A;  2BKF A;  4WJO A;  3NOB A;  1TGZ B;  2Y5B B;  3DBL I;  2PE9 A;  2N9X A;  4W9H A;  4AOF A;  4MM3 A;  4W9I A;  2J0K A;  2PPH A;  3H7P A;  3ZRF A;  4ANU A;  1E7V A;  4ICV A;  4GGQ A;  2EMT A;  3A4R A;  4WAA A;  5TR5 A;  2LJ5 A;  3PLU A;  4DHJ B;  3KVF B;  1D3Z A;  3UQB A;  3V6E B;  3R3M A;  1KOT A;  4E74 A;  4URK A;  3ZLZ A;  4CHK A;  1OQY A;  2OOB B;  4LJP B;  5KHO A;  4JLC A;  4XZ4 A;  5DPS A;  2Z59 B;  4W9E A;  1Q0W B;  4NAW B;  2NCN A;  2K6D B;  2LXC A;  3PGE A;  2MW5 A;  2Z0D B;  4DDI D;  1EUV B;  4A3P A;  2WX1 A;  4A3O A;  5GMV A;  2MBB B;  3JSV B;  3S2A A;  2JRH A;  1GUA B;  2ZNV B;  2KTR B;  3ONS A;  2L8J A;  5J2R A;  3N3K B;  1H8C A;  3DVG Y;  2RR9 A;  1EF5 A;  2JZZ A;  4WJP A;  4EFO A;  2V1Y A;  4KV2 A;  5CHV C;  4AP4 C;  3O65 B;  3AI5 A;  3A9J B;  3VFK A;  3VHT C;  4KIK B;  3DVN U;  2AWT A;  1WIA A;  1NI2 A;  3M62 B;  1Q1O A;  2EMS A;  1NDD A;  2WYQ A;  1LM8 B;  1C1Y B;  3DQV A;  3IHP C;  2KHW B;  3PPA A;  2C7N B;  4II2 B;  4DWF A;  2BYE A;  4EOY A;  1OGW A;  2AL3 A;  3DPD A;  1L7Y A;  2NVU I;  4YL8 A;  3N32 A;  5JH5 C;  4K7W A;  1V81 A;  4GIV A;  3RZF A;  3NY5 A;  1H4R A;  1WJ6 A;  1WXV A;  2KFJ A;  3TIX A;  4MEM A;  2ZJD A;  2FCQ A;  3A33 B;  4MEL A;  4B6W A;  3PV1 A;  3CST A;  4DHJ D;  4EUT A;  3DVG X;  3QAR A;  2G45 B;  2NPT B;  3QC8 B;  4NQL B;  4E71 A;  3QAQ A;  1UGM A;  2Z0E B;  1V2Y A;  4GSW A;  4I6P A;  3VUX A;  1VCB A;  3V6C B;  3AUL A;  4G11 A;  3SU8 X;  4HVB A;  2KNB A;  2KMA A;  2GOW A;  2KX3 A;  3ZIM A;  4ANX A;  4F8C B;  2BWE S;  4PYU A;  1YD8 U;  4WWO A;  3PRP B;  1V9J A;  2LWP A;  3ZNI D;  4B9K A;  5C1Z A;  1V5O A;  3AXC A;  4ZDV A;  1J8C A;  3DCG A;  4GMV A;  1V6E A;  2LVQ A;  4ANV A;  1XT9 B;  2KKC A;  1UH6 A;  1WM2 A;  2R2O A;  4N9F 4;  3DDC B;  3RUI B;  5E6O A;  1UBQ A;  2YVC A;  3VVW B;  1YIW A;  5FR6 A;  5AZF A;  4KIK A;  2XK5 A;  3ZKJ C;  4IW0 A;  4W9C A;  2MRP A;  5G2N A;  3LJ3 A;  3TMP B;  1EO6 A;  4JL9 A;  3VH4 B;  2MBH A;  4HJK A;  4GU2 A;  2JRI B;  3U7D A;  3GOE A;  3H7S A;  1YX5 B;  4RM9 A;  3A1Q B;  2L05 A;  2HE7 A;  3A9K A;  3M95 A;  1UZX B;  1E8W A;  2REX A;  1Z2M A;  4W9K A;  3MTN B;  2KWC A;  3A9J A;  3WAP A;  2FIF A;  2LRU A;  3PSE B;  3EC8 A;  2D07 B;  3K9P B;  4HDO A;  5C23 A;  1WX8 A;  4FAD A;  2LZ6 A;  4J6I A;  4GDL B;  1WGR A;  2MWS B;  2IYD B;  2BYF A;  2CHZ A;  3HIZ A;  4GOC A;  4FJY A;  3QX1 A;  4GXB A;  4G0N B;  3ECI A;  4NPN A;  3LDZ E;  1XQQ A;  4KSL C;  1OEY A;  2JY6 A;  4KVG B;  2JZ3 B;  5D6J B;  4GDK B;  5HKH A;  1XD3 B;  4MH0 E;  4DBG A;  1NBF C;  3UGB B;  2MQJ A;  4BKG A;  4G3X B;  2MBO A;  3APC A;  3ZUN A;  4HXD A;  3TL5 A;  3ZTD A;  2C5L C;  3DBR I;  4K7S A;  4OVV A;  4PS3 A;  1ZGU B;  4MSQ B;  3VAW A;  2IZV B;  1ZKH A;  4BKT A;  4AUQ C;  4K7U A;  4XX5 A;  3APF A;  2KK8 A;  1V49 A;  4OVU A;  1WMH B;  2ZEQ A;  4IWQ A;  4TV3 A;  1ISN A;  2DZI A;  2KDB A;  3CSF A;  3DVN V;  1OEY J;  1M94 A;  4GB9 A;  2K25 A;  4ZRK A;  3MHS D;  4GDL A;  2EKE C;  4HPM B;  2KFK B;  4EZJ A;  2ZCB A;  2M8S A;  4ANW A;  4E3C A;  2WDT B;  1YQB A;  4P7I A;  3L13 A;  3GZN I;  3A9K B;  4PS8 A;  2V3S A;  3UIN B;  2JUO A;  1SE9 A;  4EZK A;  3QIJ A;  4BBN C;  3HK0 A;  3QQ8 B;  3T9L A;  4MGZ E;  2IY0 B;  3WAO A;  3RD2 A;  3KUC B;  4FN2 A;  2O2V A;  2O2V B;  4JQW C;  1WRD B;  5L95 C;  2LVO A;  3L08 A;  2M4N A;  4WJN A;  1E90 A;  2LI5 A;  4JIO U;  3ALB A;  3IBE A;  1P0R A;  4RMA A;  4CYE A;  3PHX B;  1V86 A;  4FLH A;  2UYZ B;  4XC2 A;  5IA7 A;  2IO1 B;  2QHO A;  4HCP B;  1R4N I;  1KM7 A;  2NBU A;  4NAW A;  4BOS C;  2DZM A;  4PS7 A;  4WWP A;  2G3Q B;  2K39 A;  1WGG A;  2I1J A;  4IWP A;  4BBN F;  5JHA A;  3DOW A;  3Q3J A;  3JSV A;  2KQS A;  4NQK E;  3ZNG C;  5KHQ A;  2M1M A;  2KJR A;  4MGY E;  4KDL B;  2KWU B;  5LLI A;  2LRW A;  4F7Z A;  4BOZ B;  2MBQ A;  1S3S G;  1UD7 A;  3R7Q A;  5LXH A;  1ZW7 A;  3B08 A;  3R7R A;  2N1V A;  1YJ1 A;  5AZG A;  2CKH B;  4HWI B;  1IP9 A;  3U30 A;  1WR6 E;  2K6Q A;  4FUL A;  3PTF C;  2HTH A;  3NZS A;  1WH3 A;  1WJN A;  3VTV A;  2AEH A;  1WX7 A;  2GBR A;  2V4L A;  1E8Y A;  3ZNH B;  1GC7 A;  2GBN A;  2DYB A;  2J7Q B;  3JYU A;  1V5T A;  4IC7 B;  3SDL C;  5DCN A;  1I35 A;  4NNJ B;  3VH3 B;  2NR2 A;  1VD2 A;  3ZNZ B;  1WZ0 A;  2RPQ A;  4MJS A;  3CMM B;  4GN1 A;  2DEN B;  4HPL B;  1V80 A;  3RCZ A;  3TCA A;  3ENE A;  1KJT A;  3HHM A;  2K1F A;  3P2B A;  2L00 B;  2M0X A;  4TKN A;  1LFD A;  3AU4 A;  1WXM A;  3VUY A;  1WM3 A;  3KH0 A;  3ML8 A;  2KJ6 A;  4LDT D;  1P9D U;  5IAA C;  2N9E B;  3M63 B;  2KMC A;  2KDI A;  4K1R B;  2KX0 A;  2L7R A;  4NY0 A;  3KYC D;  3L17 A;  2FUH B;  3VUW A;  1YX6 B;  2PJH A;  1WY8 A;  1PQS A;  4NJ6 A;  2JF5 A;  1A5R A;  2JXX A;  3W1S A;  3APD A;  3MJW A;  5BO4 B;  4MSM B;  3WA0 A;  2KTR A;  5J17 A;  1WJU A;  1GG3 A;  2KC1 A;  1WX9 A;  4W9F A;  3RT3 B;  2UWQ A;  1WE6 A;  1WE7 A;  3KW5 B;  2CHW A;  3N30 A;  4LDT B;  1QZE A;  2AYO B;  2C7H A;  4FHJ A;  5CTR C;  4ZRI A;  4IM3 A;  3H1U A;  3WAM A;  5D94 A;  2FCM A;  2ZCC A;  2J0M A;  4TQ1 A;  1TTN A;  2LD9 A;  1G6J A;  4II3 B;  1E7U A;  2IBI B;  4FBJ B;  2D2Q A;  2ZVO A;  2CU1 A;  3WIM A;  4MDK E;  4FJV B;  4BKS A;  1J19 A;  2B3A A;  4ZYN A;  3RUL A;  5E6N A;  2C9W B;  2MLB A;  1P3Q U;  2DYM A;  3OLM D;  2DAJ A;  2O6V A;  2CS4 A;  1R4M I;  1T0Y A;  2BGF A;  1S1Q B;  3PT2 B;  3OAW A;  3M3J A;  3NS8 A;  3VDZ A;  2NBV B;  4EEW A;  1GNU A;  4X57 B;  2NBW B;  3UQA A;  4KZ0 A;  4M8N A;  4BVU C;  2L3Z A;  3R66 C;  4FHK A;  3QA8 A;  1IYF A;  2AL6 A;  2KVR A;  1MG8 A;  2FAZ A;  2O6V B;  2RSU A;  3QCA A;  4KZC A;  2J0J A;  2N1W A;  3QWZ B;  2GMI C;  3D32 A;  3OJ3 A;  2IO0 B;  2L76 A;  2A5U A;  2LXA A;  1WXS A;  4LJO B;  1KLV A;  2LVP A;  2GBM A;  4JGH B;  3TBL D;  2PE6 B;  2KO3 A;  3L16 A;  1WMH A;  2FCS A;  3B0A A;  3VTU A;  3CF6 E;  1TBE A;  4G50 A;  3IVF A;  4KDI C;  4HLE A;  5AEK B;  3PVL A;  2G4D B;  2MBE A;  2W9N A;  1F9J A;  4HDQ A;  3ZDM C;  1WXA A;  2ZNV C;  2XBB C;  2HD5 B;  2BF8 B;  2JT4 B;  3BIN A;  3PRM B;  2KC2 A;  2BYV E;  3L0W B;  2KTF A;  1UEL A;  1WF9 A;  1J0G A;  5E6P A;  2KZR A;  3H9D A;  3PZD A;  2I1K A;  2R2Q A;  4W9G A;  3T8M A;  3UIP B;  3PS6 A;  5D2M B;  1U4A A;  1OTR B;  2D3G A;  3L54 A;  2KAN A;  1SGH A;  4WQO B;  5DPR A;  1RAX A;  2LGX A;  3WAN A;  2C60 A;  2KQ7 A;  3RZW C;  3H6N A;  4AWJ A;  2CHX A;  1WJ4 A;  1X1M A;  2JVC A;  2JPH A;  2VRR B;  4I6N B;  3V61 A;  3BY4 B;  5G55 A;  3A1Q A;  3PLV A;  2O6V D;  2K8B A;  2LGD A;  2XEW A;  3SHQ A;  1SIF A;  4M0W B;  4EKU A;  2YLM A;  3EFU A;  3K9O B;  2D10 A;  2MP2 A;  4F1S A;  2DYO A;  1E8X A;  2DZK A;  2G4S A;  3ZDT A;  2BWF A;  4B95 A;  2DX5 B;  4AJW A;  1BT0 A;  4IM2 A;  2BPS A; 
#chains in the Genus database with same CATH topology
 3UF8 A;  2NTS A;  2KAC A;  5E6J A;  2ASQ A;  1Y56 A;  5DPT A;  4RGT A;  2K8H A;  2ZPN A;  4IM0 A;  4ICU A;  3HM3 A;  3FKY A;  3WAL A;  3AEG B;  3HVD A;  4MGI E;  4YSZ B;  1E10 A;  3PRE A;  2LAS A;  3Q8A A;  2LFI A;  1GJZ A;  1DOY A;  3DBS A;  1JW9 D;  1FPY A;  1FXT B;  2SAK A;  4W9J A;  4I6L B;  1I42 A;  2KLG A;  4TUU A;  3OJ4 B;  1L2N A;  3BII D;  1E5W A;  3SD5 A;  1OQR A;  5LNK 1;  2KFK A;  2XK5 B;  3AEF B;  1AYF A;  2K0P A;  3RPF C;  3HRD D;  3C0R B;  2FNJ B;  3TJP A;  2MSE D;  4DQO C;  2BB5 A;  1P1A A;  1WR1 A;  1ZUD 2;  2M17 A;  2L0T A;  3DBR B;  3W1S C;  3RN9 C;  1EF1 A;  3ZQ4 A;  3NZU A;  4DDG D;  3A4S C;  1UWX A;  1UBI A;  3ZRC A;  2ZZP B;  4MGK E;  1HTQ A;  2N7D A;  3ZGZ A;  2DZJ A;  2M19 A;  4ZRQ A;  1WGY A;  3IFW B;  3FIL A;  5AZH A;  1Q5W B;  1RRB A;  5AUK A;  3E9S A;  3RNE C;  1DGJ A;  1RLF A;  1M4V A;  2D3B A;  4HK2 A;  2M0A A;  2ZW0 A;  2KXJ A;  5CX3 A;  2BKF A;  3NOB A;  2JSV X;  3DBL B;  2IGG A;  2PE9 A;  2N9X A;  2D3C A;  1V1O A;  3AE4 B;  4W9I A;  4ANU A;  1E7V A;  4HPP A;  4GGQ A;  2EMT A;  3PLU A;  4URK A;  4CHK A;  4OZC A;  5DPS A;  2Z59 B;  1C4P A;  2MW5 A;  5FK9 C;  5BYS A;  2MBB B;  1C9F A;  1ZDV A;  2ZW1 A;  2ZNV B;  5MPO A;  3Q3O C;  2L8J A;  5I4D A;  3N3K B;  1TIF A;  2RR9 A;  1EF5 A;  2JZZ A;  4RGN A;  4KV2 A;  3BVG A;  5CHV C;  3AI5 A;  2YEP F;  4LNO A;  2AWT A;  1WIA A;  4TMA B;  3N1Y C;  2V3N A;  1LM8 B;  4MT5 A;  2RMM A;  3PPA A;  4ACF A;  1F0Z A;  3DHH C;  1L7Y A;  1V97 A;  2IJ0 A;  3NVV A;  3RZF A;  3NY5 A;  1WJ6 A;  1WXV A;  2KFJ A;  1FCC C;  3TIX A;  1ACC A;  4DXF A;  4N59 A;  3DVG X;  3P4P B;  3QAR A;  4NQL B;  3BYT B;  1UUP A;  3QAQ A;  1V2Y A;  4I6P A;  1HQR D;  4M02 A;  1XLO A;  3AUL A;  4HVB A;  4F8C B;  1ET6 A;  2J42 A;  2BWE S;  2WP9 B;  1V5O A;  1J8C A;  4GMV A;  1V6E A;  3CIR B;  1L6U A;  5FR6 A;  5IOI A;  1D5X C;  4KIK A;  3ZKJ C;  1TS2 A;  2MRP A;  2EKI A;  3Q6B A;  1TY2 A;  4RM9 A;  2H88 B;  3A9K A;  1UZX B;  3WAP A;  2REX A;  1CK1 A;  2KWC A;  2R61 A;  3AE2 B;  2D07 B;  1E7P B;  2LZ6 A;  2RDG A;  3VRB B;  3QX1 A;  1TKG A;  1FNV A;  4NPN A;  3LDZ E;  1QKZ A;  1OEY A;  2JZ3 B;  2X38 A;  3AE6 B;  4GDK B;  5D6J B;  4MH0 E;  1NBF C;  2FUG 1;  4BKG A;  2LMC A;  3ZUN A;  2C5L C;  3DBR I;  4OVV A;  1ENF A;  1ZGU B;  2AX5 A;  3VAW A;  4A8X C;  4K7U A;  3PZ8 A;  3APF A;  1J7A A;  2KK8 A;  4IWQ A;  1JRO A;  2RDH A;  5C3J B;  3CSF A;  1M94 A;  2K25 A;  4GDL A;  1FXI A;  1TKE A;  4E3C A;  1YQB A;  3SFD B;  1SE9 A;  2VH1 A;  3QIJ A;  3WAO A;  3KUC B;  3AH7 A;  2M4N A;  1E90 A;  1JML A;  3ALB A;  2J4X A;  3BYY B;  1JRP A;  2IO1 B;  1AWD A;  1R4N I;  1KM7 A;  1QQR A;  4NAW A;  4WWP A;  1WGG A;  2OED A;  2I1J A;  4IWP A;  3DOW A;  3EFC A;  3ZNG C;  2M1M A;  2KJR A;  1LGR A;  4F7Z A;  2CJO A;  2MBQ A;  1UD7 A;  3ZYY X;  3R7Q A;  3B08 A;  3R7R A;  1HA5 A;  1ZOY B;  2L83 A;  2M56 B;  3AEE B;  1WJN A;  1MVK A;  2GBR A;  1WX7 A;  2V4L A;  4HJG E;  1JQ4 A;  2FE8 A;  2WU2 B;  1MI0 A;  2GBN A;  3JYU A;  1I35 A;  1YJJ A;  3VH3 B;  1VD2 A;  2Y3A A;  2HTM E;  3GP7 A;  2JZP A;  3CMM B;  2WXO A;  1V80 A;  4HPL B;  3TCA A;  1MJD A;  2KJ6 A;  1P9D U;  1FD6 A;  2BVC A;  2L7R A;  1YX6 B;  3RNF C;  1WY8 A;  2JXX A;  3MJW A;  4UDU C;  2KTR A;  3SR6 A;  3VR8 B;  1WJU A;  2KC1 A;  4W9F A;  4CQN A;  3KW5 B;  3N30 A;  5CTR C;  4ZRI A;  1QZE A;  2AYO B;  3U4E G;  3ZJV A;  2FBW B;  3WAM A;  2WHI A;  2ZCC A;  4TQ1 A;  2LD9 A;  2V4I B;  1I4H A;  2IBI B;  4FBJ B;  3WIM A;  4FJV B;  2GB1 A;  2IND C;  4IDI A;  5E6N A;  2L32 A;  2MLB A;  3OLM D;  2CS4 A;  2WXP A;  1I4X A;  3VDZ A;  2NBV B;  4OHJ A;  2NBW B;  5JXV A;  4M8N A;  1AN8 A;  1IYF A;  1MG8 A;  2O6V B;  3OG5 A;  1YN5 A;  3QCA A;  1FIQ A;  2HJ1 A;  2UU7 A;  4J3O D;  4LJO B;  1WXS A;  2Y5P A;  4RNA A;  4JGH B;  2FCS A;  1AW7 A;  1SSN A;  4HLE A;  2JWU A;  4C4V B;  2W9N A;  2ZNV C;  4XE0 A;  1PYW D;  1QT9 A;  2JT4 B;  2KC2 A;  1C76 A;  3L0W B;  2KTF A;  3H9D A;  4W9G A;  2R2Q A;  5H8Y E;  1U4A A;  1OTR B;  1WSP A;  1SGH A;  4WQO B;  3AE9 B;  2B76 B;  1WJ4 A;  1XEE A;  2JVC A;  3V61 A;  5G55 A;  3PLV A;  2O6V D;  2K8B A;  1C4C A;  1PGA A;  1E8X A;  1R4N B;  1XCQ L;  1WWT A;  1D4B A;  2G4S A;  3ZDT A;  1V1P B;  2PLP A;  3AED B;  4IM2 A;  3AE5 B;  2ICI A;  3RYT A;  4FA6 A;  2MJE A;  3EEC A;  3V3X A;  2IY1 B;  3KUZ A;  1JWM D;  4CO7 A;  2NTT A;  1SB3 C;  1GAQ B;  2DHZ A;  2KDF B;  4LCD E;  4ZOH C;  5BYQ A;  4ASW C;  1MPE A;  2KOX A;  3NHE B;  3T3N A;  3L4P A;  4DXG A;  3X23 A;  3SFE B;  3ZO5 B;  1DOX A;  1VDV A;  2V9H A;  1L0X B;  2HJ8 A;  4HKQ A;  3PHW B;  1WI0 A;  5LXI B;  1JRU A;  1N60 A;  1FCL A;  2FCN A;  3W9C B;  3EHV A;  3VR9 B;  2MX2 A;  1P7F A;  2N9P C;  4S17 A;  2G1E A;  4ZRJ A;  4FJZ A;  4K81 A;  2A4Z A;  2ZVN A;  2LGY A;  4WWM A;  4DXA B;  2C7M B;  3Q3F A;  1K8R B;  3V62 A;  2JWZ A;  3PRZ A;  1JWA D;  3N9Y C;  3ZTC A;  3QK0 A;  2G9H D;  2N7E A;  4GDK A;  4HCN B;  3W2D A;  3DBH I;  3VQI A;  3JVZ X;  3ABV B;  4EZL A;  3NG0 A;  3DBH B;  2NPT A;  3MHZ A;  1LQB A;  1QOF A;  2GLS A;  1YJI A;  3ML9 A;  2KN5 A;  4BKS D;  4NJ7 A;  3Q69 A;  4YT0 B;  2H89 B;  4YWG G;  2KWV B;  1B9R A;  4WJO A;  1C4A A;  2EEL A;  3DBL I;  4W9H A;  4NAM A;  2PPH A;  3NZ3 A;  4ICV A;  4A55 A;  4NZL B;  5TR5 A;  1TZO A;  4LTU A;  3UQB A;  3V6E B;  2QIE B;  3AM9 A;  1OFF A;  4WIP A;  4E74 A;  3ZLZ A;  2OOB B;  1K51 A;  1T5X D;  2NMQ A;  4YSX B;  4W9E A;  3PZ7 A;  1SE3 A;  1SEB D;  4NAW B;  2NCN A;  2Z0D B;  3Q3M C;  1EUV B;  4XGA B;  4A3O A;  1QLB B;  1GUA B;  3N20 C;  1T0Q C;  3ONS A;  1BUI C;  3DVG Y;  2BBC A;  1L5P A;  3B2G A;  1RFK A;  3A9J B;  3M62 B;  2EMS A;  1NDD A;  1BML C;  1IGD A;  2C7N B;  2WXN A;  2BYE A;  2NVU I;  1JCK B;  1V81 A;  1H4R A;  3TEY A;  2FCQ A;  2ONQ A;  4B6W A;  4EUT A;  3PV1 A;  3Q14 C;  2RPV A;  1I7H A;  4GSW A;  1ET9 A;  1VCB A;  4G11 A;  5HI1 A;  2WXK A;  2KMA A;  2KX3 A;  3LXF A;  4WWO A;  4WUR A;  1FNU A;  5C1Z A;  3T3O A;  1XLP A;  3LB8 C;  1XT9 B;  2Z8L A;  1UH6 A;  4RCO A;  4N9F 4;  1EM7 A;  1KLG D;  3RUI B;  5E6O A;  1UBQ A;  1YIW A;  5AZF A;  2XK5 A;  1PDX A;  4W9C A;  4EE2 A;  3TMP B;  3VH4 B;  2MBH A;  2WDV B;  4LNI A;  1YX5 B;  3A1Q B;  2L05 A;  3P4S B;  1E9M A;  2N7J A;  5EE9 A;  3K9P B;  4RFB A;  4GDL B;  3NJT A;  2CHZ A;  4RF0 A;  4FJY A;  4GXB A;  2E3T A;  4KSL C;  3U7Z A;  5HKH A;  1XD3 B;  4G3X B;  2WXF A;  2IGD A;  3APC A;  4HXD A;  4PS3 A;  4IOI E;  4PT5 A;  2K5P A;  2WU5 B;  4P1B C;  1ZKH A;  3BZD B;  4AUQ C;  4BKT A;  2GI9 A;  5C2T B;  2QEJ C;  4YTN B;  3DVN V;  4B0E A;  4ZRK A;  4M00 A;  2J53 A;  2EKE C;  4HPM B;  1RYJ A;  3RNA C;  4M0W A;  3L13 A;  1EU3 A;  3GZN I;  2JXT A;  3A9K B;  1UGJ A;  3UIN B;  4O1N A;  4EZK A;  4RH6 A;  3QQ8 B;  3T9L A;  1NEN B;  4MGZ E;  4MAC A;  2O2V A;  4JQW C;  5L95 C;  4WJN A;  1N61 A;  5IA7 A;  1R4M B;  2DZM A;  3URY A;  4ARI A;  1NI3 A;  1GPX A;  4BBN F;  1ZXH A;  3AEB B;  3GS2 A;  4MGY E;  4KDL B;  5LLI A;  1VZ6 A;  1KF6 B;  4USA A;  3IAM 1;  2N1V A;  2CKH B;  3ZXR A;  3U30 A;  2K6Q A;  1D5M C;  2HTH A;  1WH3 A;  2AEH A;  3ZNH B;  4IC7 B;  1YOV B;  3ZNZ B;  4JWU C;  1N5X A;  2MEK A;  4GN1 A;  2DEN B;  3RCZ A;  2N0S B;  2K1F A;  3P2B A;  3HUI A;  2L00 B;  1LFD A;  3ML8 A;  1ZP0 B;  2INN E;  4YXD B;  1FRD A;  1IGC A;  2KX0 A;  4NY0 A;  3L17 A;  1ZPS A;  2JF5 A;  1YQ3 B;  3APD A;  3GB1 A;  4MSM B;  1GB4 A;  1WYG A;  5IP4 D;  1WX9 A;  1WE6 A;  4LDT B;  1SE4 A;  4FHJ A;  3KQ4 A;  3H1U A;  5D94 A;  4LK0 M;  2I2Y A;  4HKZ E;  4II3 B;  1E7U A;  1V8C A;  3AEC B;  2K22 A;  1J19 A;  2B3A A;  3RUL A;  3TEW A;  1TY0 A;  2DYM A;  4L1B A;  2O6V A;  1T0Y A;  1TYG B;  2JYE A;  2XN9 C;  3UQA A;  4BVU C;  2PVG C;  4FHK A;  3QA8 A;  2KVR A;  3RFZ B;  2RSU A;  1JWS D;  2W3S A;  3TEZ A;  2IO0 B;  1J7B A;  2AQ2 B;  3KWL A;  3TBL D;  3Q8F A;  5D3D A;  1TBE A;  1HZ5 A;  4KDI C;  5AEK B;  3PVL A;  2MBE A;  1F9J A;  3KWV A;  1WXA A;  2XBB C;  1V1P A;  3BIN A;  2BS3 B;  2BYV E;  3IXS A;  1WF9 A;  5E6P A;  2KZR A;  3T8M A;  3BK1 A;  3L54 A;  2KAN A;  4C00 A;  5DPR A;  1HTO A;  1MHX A;  2C60 A;  1ZXI A;  4AWJ A;  2JPH A;  4I6N B;  2J52 A;  1TKY A;  4D2K A;  4WAF A;  2LGD A;  2YLM A;  3K9O B;  4ZRP A;  1SXT A;  2INC C;  3U2S C;  4R3D A;  2JX5 A;  2DZK A;  2BTE A;  4ZYS A;  3MFG A;  3DWG C;  1RWS A;  2DYB A;  2BPS A;  4TQ0 A;  4KGS A;  3HM6 X;  3QJZ A;  1P98 A;  1L4D B;  4HRS A;  3AV8 A;  4WWN A;  4IKG A;  2WXQ A;  1GC6 A;  1E8Z A;  2KD0 A;  4KSK C;  2ZPY A;  2FID A;  1DOI A;  2QIL A;  4C80 A;  2NS5 A;  3VXW A;  4IWO A;  5CHF A;  1KTK A;  2CR5 A;  1IBX B;  4OZA A;  4DHZ E;  4AS1 A;  1TZ1 A;  1WGK A;  3AU5 A;  2LHD A;  2L0F A;  3KYD D;  2VZK B;  3BVM A;  1STE A;  3RI7 C;  2RGF A;  5GXG B;  5H92 C;  1IPG A;  4MJS B;  4H2A A;  2IO3 B;  3IAS 1;  5JZE B;  1FO4 A;  4WH4 A;  3KUD B;  3B2F A;  3B1L X;  2WQY B;  1HE8 A;  5EDS A;  2WWZ A;  3IG3 A;  3AE8 B;  2GBJ A;  1CMX B;  3GZN B;  3QHT A;  2GBK A;  3I3T B;  3V60 A;  2QC8 A;  1WGH A;  2DAF A;  1YN3 A;  2N4F A;  3EA6 A;  3FC4 A;  4BFR A;  1WZ3 A;  2WXG A;  3H7P B;  1UWM A;  3P63 A;  5DPW A;  2KLC A;  3VTW A;  3DHG C;  2VZK D;  4W9D A;  3RNC C;  1TGZ B;  2Y5B B;  2WXM A;  4AOF A;  4MM3 A;  2J0K A;  3H7P A;  3A4R A;  2LJ5 A;  1D3Z A;  3KVF B;  1FEH A;  3R3M A;  1K50 A;  4KGT A;  1OQY A;  2KT7 A;  3HVZ A;  2LUM A;  4LNK A;  2LXC A;  2WGS A;  3PGE A;  4A3P A;  3S2A A;  2JRH A;  3E56 A;  3DWM A;  4XWW A;  2I38 A;  3I9V 1;  5J2R A;  1F2R I;  1H8C A;  4YSY B;  5BYR A;  3N1X C;  4WJP A;  4EFO A;  1HZ6 A;  2V1Y A;  3VHT C;  2WLB A;  3DVN U;  1JWB D;  1Q1O A;  1C1Y B;  2KHW B;  4II2 B;  2AL3 A;  3ETR A;  4YL8 A;  3RNG C;  3N32 A;  4K7W A;  5BMG A;  1FRR A;  2LHE A;  2Y5C A;  4MEM A;  5D3I B;  5EE1 A;  3CST A;  4MH8 A;  4US9 A;  2G45 B;  2NPT B;  4E71 A;  1SE2 A;  1UGM A;  2Z0E B;  2RDB C;  1YMH E;  4RGO S;  2V0G A;  2GOW A;  3ZIM A;  3R2T A;  1YD8 U;  2JYT A;  3NRZ A;  3PRP B;  1V9J A;  4B9K A;  3PO0 A;  3EGR A;  4ANV A;  2KKC A;  1FXA A;  3DDC B;  3VVW B;  2MH7 A;  4IW0 A;  4JL9 A;  4HJK A;  4GU2 A;  2JRI B;  3U7D A;  4A9A A;  3H7S A;  4GLS C;  2HE7 A;  4HRO A;  4RF1 A;  1E8W A;  4W9K A;  1Z2M A;  4S0R A;  4WQM A;  5BMH A;  3EC8 A;  4HDO A;  1WX8 A;  3EUB 2;  4J6I A;  1WGR A;  2MWS B;  2IYD B;  4GOC A;  1TS4 A;  1VZ8 A;  4ITK A;  1XQQ A;  2GRI A;  2JY6 A;  4KVG B;  1I4Q A;  1IUE A;  2MQJ A;  2MBO A;  2QMT A;  3BVZ A;  4XX5 A;  4MM3 B;  4A90 A;  4OVU A;  1WMH B;  2ZEQ A;  1ISN A;  2DZI A;  1SIJ A;  1XCT L;  2KDB A;  3ZXV A;  4GB9 A;  2X8X X;  1F77 A;  2KFK B;  4EZJ A;  1ZDX A;  2M8S A;  4ANW A;  2WDT B;  4P7I A;  1VR9 A;  2V3S A;  3R2I A;  2JUO A;  4BBN C;  3HK0 A;  3RD2 A;  4FN2 A;  1WRD B;  2L1A A;  2LVO A;  2LI5 A;  4JIO U;  3NVY A;  4YTP B;  3PHX B;  1V86 A;  1EWY C;  4HCP B;  3MC9 A;  4BOS C;  4PS7 A;  2G3Q B;  3P4Q B;  2YEP B;  5JHA A;  3JSV A;  4NQK E;  1N6Z A;  5KHQ A;  1EWC A;  1T3Q A;  2QCZ A;  3UI3 A;  2KWU B;  2LRW A;  1QF6 A;  4BOZ B;  1S3S G;  3B9J A;  1ZW7 A;  2BB6 A;  5AZG A;  1YJ1 A;  4HWI B;  1T0R C;  1WR6 E;  4FUL A;  3VTV A;  3NUH B;  1L0Y B;  1GC7 A;  1V5T A;  3FAH A;  4REZ A;  3SDL C;  4BAX A;  4NNJ B;  1PGX A;  1MHH E;  1D5Z C;  1WZ0 A;  4MJS A;  1TJE A;  3ENE A;  2DLB A;  4TKN A;  1T6B X;  1I4R A;  1WXM A;  3AE1 B;  1XF5 L;  3AE7 B;  5FR3 A;  4LDT D;  2WDQ B;  2BS4 B;  5IAA C;  3TUO A;  3C19 A;  3M63 B;  2KMC A;  1XLN A;  2WXJ A;  3KYC D;  2FUH B;  2PJH A;  1QIL A;  3W1S A;  5BO4 B;  3WA0 A;  5J17 A;  2HDE A;  2ACZ B;  3ZJU A;  3RT3 B;  2UWQ A;  4OW0 A;  2CHW A;  2C7H A;  4IM3 A;  1OQQ A;  3N1Z C;  2FCM A;  1TTN A;  1G6J A;  2K9X A;  4YTM B;  2CU1 A;  1GB1 A;  4BKS A;  2KQ4 X;  4OVZ A;  2C9W B;  1P3Q U;  1LO5 D;  1DYQ A;  2BGF A;  3PT2 B;  1UF0 A;  2ON8 A;  3OAW A;  1JWU D;  1MFW A;  4X57 B;  1K52 A;  2L3Z A;  2W82 A;  2FAZ A;  3Q2A C;  4KZC A;  2N1W A;  2IPK D;  3D32 A;  3OJ3 A;  2L76 A;  2LXA A;  2A5U A;  1SJH D;  1YQ4 B;  2BT6 A;  3P4R B;  2KYW A;  3CF6 E;  3RMK C;  1L6V A;  2G4D B;  3I5J C;  4L2Y A;  4JX1 C;  2PKO A;  2HD5 B;  2BF8 B;  3Q8E A;  3PRM B;  2W54 A;  3BK2 A;  1UEL A;  1N5W A;  2BW2 A;  3OWE B;  1J0G A;  2I1K A;  3UIP B;  3PS6 A;  5D2M B;  2D5G A;  1FM0 D;  1KLU D;  1RAX A;  3WAN A;  1F1H A;  3H6N A;  3NS1 A;  1X1M A;  4LLG M;  3BY4 B;  1L0V B;  3NVW A;  1VZ7 A;  4ZHO A;  3SHQ A;  1SIF A;  4EKU A;  1IBX A;  2D10 A;  3H8H A;  4F1S A;  2DYO A;  4ARC A;  5IKC M;  4ZHP A;  3GE3 C;  2INP E;  4B95 A;  2DX5 B;  5TSS A;  4AJW A;  3JW0 X;  3UIO B;  3GE8 C;  4K3B A;  2IO2 B;  3L10 B;  2MCN B;  1MG4 A;  2PEA A;  2WX0 A;  1LXD A;  5CHW A;  1NYQ A;  3W1Y A;  1Y8R C;  4KKI A;  5EE3 A;  2K8C A;  2KAJ A;  2LUE A;  2KDE B;  4C56 C;  4NJC A;  2KN4 A;  4LNF A;  1L4Z B;  1KRH A;  2WXH A;  3AEA B;  4XWT A;  2WS3 B;  4IUM B;  3IT6 B;  2BQQ A;  2JQR B;  4DK5 A;  2RD0 A;  4A20 A;  3ZVV A;  2OJR A;  1Z5S B;  4RM8 A;  1GOZ A;  2BS2 B;  2LJI A;  4HEA 1;  4N58 A;  4W9L A;  1N62 A;  2XNA C;  1P7E A;  2WXL A;  4C7Z A;  2TSS A;  4PYZ A;  3X0W A;  4AJY B;  1VRA B;  4P16 A;  5G5G A;  2CJN A;  1C78 A;  1FFU A;  1WFY A;  1RFA A;  2D11 A;  5J18 A;  1WGD A;  5L83 A;  5D7G A;  1TS3 A;  4Q2J A;  4WJQ A;  2MA9 B;  3Q3N C;  1BXT A;  1WYW B;  1AAR A;  2KJH B;  4DHZ B;  3U8Z A;  1JAL A;  5JHB A;  4C4V A;  2BKR B;  1CJE A;  1C3T A;  2MHJ A;  1HEZ E;  2MP2 B;  3O13 A;  1K53 A;  2E6X A;  4M8M A;  4IG7 B;  4KX6 B;  1XLQ A;  2LGI A;  3DHI C;  3ZW3 A;  1QOG A;  3ZRF A;  4WAA A;  4DHJ B;  3SEB A;  1KOT A;  1WXQ A;  2KMM A;  4LJP B;  5KHO A;  2IGH A;  4JLC A;  1SJE D;  4XZ4 A;  1D6E C;  1Q0W B;  4JPS A;  3CWI A;  2K6D B;  4DDI D;  2WX1 A;  5GMV A;  5HG2 A;  3JSV B;  1A70 A;  2KTR B;  2W3R A;  4TSS A;  3MC8 A;  3V05 A;  1B1Z A;  4XYC A;  1J7C A;  2OHF A;  4AP4 C;  2N9K A;  3O65 B;  3VFK A;  4KIK B;  2QSD A;  2PIA A;  1NI2 A;  3BWU D;  2WYQ A;  3DQV A;  3IHP C;  4DWF A;  4EOY A;  1OGW A;  3DPD A;  5HHD G;  3WCQ A;  2KWD A;  5AUI A;  5JH5 C;  4GIV A;  4L23 A;  2DWQ A;  2ZJD A;  3A33 B;  4MEL A;  4DHJ D;  4FXC A;  3QC8 B;  2PMV A;  3KLS X;  4QAY A;  3VUX A;  2K3U A;  3TEX A;  3V6C B;  4C7Y A;  3SU8 X;  2KNB A;  4ANX A;  4PYU A;  4P1C C;  4OZB A;  1C77 A;  3ZNI D;  2LWP A;  4M01 A;  3Q8C A;  3AXC A;  4ZDV A;  1N63 A;  2PVO D;  3DCG A;  2LVQ A;  4LNN A;  1WM2 A;  2R2O A;  2SEB D;  1E0Z A;  1E6E B;  2Q5W D;  2YVC A;  5G2N A;  2AQ3 B;  1HXY D;  3LJ3 A;  1EO6 A;  1YNT E;  3GOE A;  2IDY A;  2LGS A;  3M95 A;  2WXR A;  5HFY A;  3MTN B;  3A9J A;  2FIF A;  2LRU A;  3PSE B;  5C23 A;  3ZJT A;  4FAD A;  1QOB A;  1R7S A;  5IO9 A;  2BYF A;  3MP9 A;  3HIZ A;  4A6Q A;  3P1M A;  4G0N B;  3ECI A;  3AE3 B;  2MJ3 A;  4DBG A;  4XDD A;  3UGB B;  3ZTD A;  3TL5 A;  4K7S A;  3VRA B;  4MSQ B;  1VLB A;  2IZV B;  5BMI A;  3MJ5 A;  3AB5 A;  1V49 A;  4KGR A;  4TV3 A;  2KVZ A;  2KDM A;  1OEY J;  1XO3 A;  3MHS D;  1SF0 A;  2ZCB A;  1I4P A;  1TS5 A;  4PS8 A;  2D3A A;  2IY0 B;  2O2V B;  1Q10 A;  3L08 A;  1NEK B;  3IBE A;  1P0R A;  4RMA A;  4CYE A;  2PW9 A;  4FLH A;  3I63 C;  2QJL A;  2UYZ B;  4XC2 A;  4AQ7 A;  1RM6 C;  2QHO A;  1T0S C;  4JE3 B;  2NBU A;  2K39 A;  3U52 E;  3Q3J A;  2KQS A;  5LXH A;  1EU4 A;  1IP9 A;  3PTF C;  3NZS A;  1CZP A;  1E8Y A;  2WDR B;  4BZA A;  2J7Q B;  2W55 A;  5DCN A;  2NR2 A;  1PUT A;  3I57 A;  1F2R C;  2N9L A;  2RPQ A;  1F52 A;  1KJT A;  3HHM A;  5EE0 A;  2M0X A;  3AMZ A;  3RNB C;  1ROE A;  3AU4 A;  3VUY A;  3FIL B;  1WM3 A;  3KH0 A;  1XXG A;  3J9C A;  2N9E B;  4K1R B;  2KDI A;  3MC0 B;  3VUW A;  5IN7 A;  1PQS A;  4NJ6 A;  1A5R A;  1GG3 A;  1KFY B;  1WE7 A;  4P6V F;  2PTL A;  2V3P A;  1NYR A;  2J0M A;  1QOA A;  3W5V B;  2D2Q A;  2ZVO A;  4MDK E;  3C8Y A;  4ZYN A;  2DAJ A;  1R4M I;  1YN4 A;  2LEK A;  5FKA C;  1S1Q B;  4PK1 A;  3M3J A;  3NS8 A;  4EEW A;  1GNU A;  3R8B A;  4KZ0 A;  1C79 A;  3R66 C;  1VJK A;  2AL6 A;  1ZE3 D;  3LYY A;  4B0M A;  3IT4 B;  2J0J A;  3QWZ B;  2GMI C;  2BYT A;  1WRI A;  1KLV A;  2LVP A;  2QDF A;  2GBM A;  1I4G A;  2OJW A;  2PE6 B;  2KO3 A;  3L16 A;  1WMH A;  3B0A A;  2L52 A;  3VTU A;  1KH0 A;  4G50 A;  3IVF A;  4K3C A;  2DBY A;  3AN1 A;  1FNW A;  1TT5 B;  4HDQ A;  3ZDM C;  1PFD A;  1ESF A;  2WXI A;  3W5U B;  3NVZ A;  4US8 A;  5G5H A;  1FFV A;  2AQ1 B;  3TSS A;  1PGB A;  1UNS A;  3Q8B A;  3P42 A;  3PZD A;  2CU3 A;  2DNF A;  2D3G A;  1NVI D;  2LGX A;  2KQ7 A;  3RZW C;  2CHX A;  2VRR B;  2WNM A;  2MJD A;  3A1Q A;  2VH2 A;  2XEW A;  4M0W B;  3EFU A;  2MP2 A;  4RGM A;  1SBB B;  4N6E B;  4XDC A;  2JU6 X;  4KKJ A;  2BWF A;  4JWS C;  1FMA D;  5T8I A;  1BT0 A;  1CQV A; 
#chains in the Genus database with same CATH homology
 3JW0 X;  3UIO B;  4TQ0 A;  3UF8 A;  3HM6 X;  2IO2 B;  3QJZ A;  1P98 A;  3L10 B;  2MCN B;  3RYT A;  4FA6 A;  2PEA A;  2WX0 A;  1LXD A;  3EEC A;  5CHW A;  2IY1 B;  3KUZ A;  3W1Y A;  1Y8R C;  2ASQ A;  4CO7 A;  5DPT A;  4WWN A;  2K8H A;  2DHZ A;  2ZPN A;  4IM0 A;  4ICU A;  2KDF B;  3HM3 A;  4LCD E;  1GC6 A;  3WAL A;  1E8Z A;  2K8C A;  2KD0 A;  4MGI E;  4KSK C;  4ASW C;  3PRE A;  2LUE A;  2KDE B;  2ZPY A;  2LAS A;  2KOX A;  2FID A;  3NHE B;  3X23 A;  1GJZ A;  3ZO5 B;  2NS5 A;  3DBS A;  4IUM B;  3VXW A;  4IWO A;  4DK5 A;  2RD0 A;  5CHF A;  4A20 A;  1FXT B;  3ZVV A;  2OJR A;  1Z5S B;  4RM8 A;  2CR5 A;  2HJ8 A;  4W9L A;  4W9J A;  4I6L B;  1I42 A;  2KLG A;  3PHW B;  4DHZ E;  1WI0 A;  5LXI B;  1JRU A;  4TUU A;  2FCN A;  1TZ1 A;  3AU5 A;  2L0F A;  3OJ4 B;  4PYZ A;  3X0W A;  1L2N A;  3SD5 A;  1E5W A;  3EHV A;  3KYD D;  4AJY B;  2KFK A;  2XK5 B;  1WFY A;  2MX2 A;  2N9P C;  2RGF A;  3C0R B;  1RFA A;  2D11 A;  2FNJ B;  4ZRJ A;  3TJP A;  5J18 A;  1IPG A;  1WGD A;  2MSE D;  4FJZ A;  4K81 A;  4MJS B;  2A4Z A;  2ZVN A;  1P1A A;  2IO3 B;  5L83 A;  2LGY A;  5D7G A;  1WR1 A;  4DXA B;  2M17 A;  2C7M B;  2L0T A;  4WJQ A;  2MA9 B;  3W1S C;  3Q3F A;  1EF1 A;  1K8R B;  5JZE B;  3NZU A;  3V62 A;  4DDG D;  2JWZ A;  3A4S C;  3PRZ A;  1UBI A;  1WYW B;  1AAR A;  2KJH B;  3ZRC A;  2ZZP B;  4DHZ B;  4MGK E;  3ZTC A;  3KUD B;  3U8Z A;  2N7D A;  3B1L X;  3QK0 A;  5JHB A;  2N7E A;  1HE8 A;  2DZJ A;  5EDS A;  2WWZ A;  3IG3 A;  2BKR B;  4GDK A;  4HCN B;  2GBJ A;  1CMX B;  3DBH I;  2GBK A;  3QHT A;  1C3T A;  3VQI A;  3JVZ X;  1WGY A;  2MP2 B;  3I3T B;  3IFW B;  3V60 A;  5AZH A;  1Q5W B;  4EZL A;  1RRB A;  1WGH A;  2DAF A;  2N4F A;  4BFR A;  1WZ3 A;  2NPT A;  4M8M A;  1RLF A;  1LQB A;  3H7P B;  4IG7 B;  3ML9 A;  5DPW A;  2KN5 A;  4HK2 A;  4BKS D;  4NJ7 A;  2KXJ A;  2KLC A;  5CX3 A;  3VTW A;  2KWV B;  3ZW3 A;  4W9D A;  2BKF A;  4WJO A;  3NOB A;  1TGZ B;  2Y5B B;  3DBL I;  2PE9 A;  2N9X A;  4W9H A;  4AOF A;  4MM3 A;  4W9I A;  2J0K A;  2PPH A;  3H7P A;  3ZRF A;  4ANU A;  1E7V A;  4ICV A;  4GGQ A;  2EMT A;  3A4R A;  4WAA A;  5TR5 A;  2LJ5 A;  3PLU A;  4DHJ B;  3KVF B;  1D3Z A;  3UQB A;  3V6E B;  3R3M A;  1KOT A;  4E74 A;  4URK A;  3ZLZ A;  4CHK A;  1OQY A;  2OOB B;  4LJP B;  5KHO A;  4JLC A;  4XZ4 A;  5DPS A;  2Z59 B;  4W9E A;  1Q0W B;  4NAW B;  2NCN A;  2K6D B;  2LXC A;  3PGE A;  2MW5 A;  2Z0D B;  4DDI D;  1EUV B;  4A3P A;  2WX1 A;  4A3O A;  5GMV A;  2MBB B;  3JSV B;  3S2A A;  2JRH A;  1GUA B;  2ZNV B;  2KTR B;  3ONS A;  2L8J A;  5J2R A;  3N3K B;  1H8C A;  3DVG Y;  2RR9 A;  1EF5 A;  2JZZ A;  4WJP A;  4EFO A;  2V1Y A;  4KV2 A;  5CHV C;  4AP4 C;  3O65 B;  3AI5 A;  3A9J B;  3VFK A;  3VHT C;  4KIK B;  3DVN U;  2AWT A;  1WIA A;  1NI2 A;  3M62 B;  1Q1O A;  2EMS A;  1NDD A;  2WYQ A;  1LM8 B;  1C1Y B;  3DQV A;  3IHP C;  2KHW B;  3PPA A;  2C7N B;  4II2 B;  4DWF A;  2BYE A;  4EOY A;  1OGW A;  2AL3 A;  3DPD A;  1L7Y A;  2NVU I;  4YL8 A;  3N32 A;  5JH5 C;  4K7W A;  1V81 A;  4GIV A;  3RZF A;  3NY5 A;  1H4R A;  1WJ6 A;  1WXV A;  2KFJ A;  3TIX A;  4MEM A;  2ZJD A;  2FCQ A;  3A33 B;  4MEL A;  4B6W A;  3PV1 A;  3CST A;  4DHJ D;  4EUT A;  3DVG X;  3QAR A;  2G45 B;  2NPT B;  3QC8 B;  4NQL B;  4E71 A;  3QAQ A;  1UGM A;  2Z0E B;  1V2Y A;  4GSW A;  4I6P A;  3VUX A;  1VCB A;  3V6C B;  3AUL A;  4G11 A;  3SU8 X;  4HVB A;  2KNB A;  2KMA A;  2GOW A;  2KX3 A;  3ZIM A;  4ANX A;  4F8C B;  2BWE S;  4PYU A;  1YD8 U;  4WWO A;  3PRP B;  1V9J A;  2LWP A;  3ZNI D;  4B9K A;  5C1Z A;  1V5O A;  3AXC A;  4ZDV A;  1J8C A;  3DCG A;  4GMV A;  1V6E A;  2LVQ A;  4ANV A;  1XT9 B;  2KKC A;  1UH6 A;  1WM2 A;  2R2O A;  4N9F 4;  3DDC B;  3RUI B;  5E6O A;  1UBQ A;  2YVC A;  3VVW B;  1YIW A;  5FR6 A;  5AZF A;  4KIK A;  2XK5 A;  3ZKJ C;  4IW0 A;  4W9C A;  2MRP A;  5G2N A;  3LJ3 A;  3TMP B;  1EO6 A;  4JL9 A;  3VH4 B;  2MBH A;  4HJK A;  4GU2 A;  2JRI B;  3U7D A;  3GOE A;  3H7S A;  1YX5 B;  4RM9 A;  3A1Q B;  2L05 A;  2HE7 A;  3A9K A;  3M95 A;  1UZX B;  1E8W A;  2REX A;  1Z2M A;  4W9K A;  3MTN B;  2KWC A;  3A9J A;  3WAP A;  2FIF A;  2LRU A;  3PSE B;  3EC8 A;  2D07 B;  3K9P B;  4HDO A;  5C23 A;  1WX8 A;  4FAD A;  2LZ6 A;  4J6I A;  4GDL B;  1WGR A;  2MWS B;  2IYD B;  2BYF A;  2CHZ A;  3HIZ A;  4GOC A;  4FJY A;  3QX1 A;  4GXB A;  4G0N B;  3ECI A;  4NPN A;  3LDZ E;  1XQQ A;  4KSL C;  1OEY A;  2JY6 A;  4KVG B;  2JZ3 B;  5D6J B;  4GDK B;  5HKH A;  1XD3 B;  4MH0 E;  4DBG A;  1NBF C;  3UGB B;  2MQJ A;  4BKG A;  4G3X B;  2MBO A;  3APC A;  3ZUN A;  4HXD A;  3TL5 A;  3ZTD A;  2C5L C;  3DBR I;  4K7S A;  4OVV A;  4PS3 A;  1ZGU B;  4MSQ B;  3VAW A;  2IZV B;  1ZKH A;  4BKT A;  4AUQ C;  4K7U A;  4XX5 A;  3APF A;  2KK8 A;  1V49 A;  4OVU A;  1WMH B;  2ZEQ A;  4IWQ A;  4TV3 A;  1ISN A;  2DZI A;  2KDB A;  3CSF A;  3DVN V;  1OEY J;  1M94 A;  4GB9 A;  2K25 A;  4ZRK A;  3MHS D;  4GDL A;  2EKE C;  4HPM B;  2KFK B;  4EZJ A;  2ZCB A;  2M8S A;  4ANW A;  4E3C A;  2WDT B;  1YQB A;  4P7I A;  3L13 A;  3GZN I;  3A9K B;  4PS8 A;  2V3S A;  3UIN B;  2JUO A;  1SE9 A;  4EZK A;  3QIJ A;  4BBN C;  3HK0 A;  3QQ8 B;  3T9L A;  4MGZ E;  2IY0 B;  3WAO A;  3RD2 A;  3KUC B;  4FN2 A;  2O2V A;  2O2V B;  4JQW C;  1WRD B;  5L95 C;  2LVO A;  3L08 A;  2M4N A;  4WJN A;  1E90 A;  2LI5 A;  4JIO U;  3ALB A;  3IBE A;  1P0R A;  4RMA A;  4CYE A;  3PHX B;  1V86 A;  4FLH A;  2UYZ B;  4XC2 A;  5IA7 A;  2IO1 B;  2QHO A;  4HCP B;  1R4N I;  1KM7 A;  2NBU A;  4NAW A;  4BOS C;  2DZM A;  4PS7 A;  4WWP A;  2G3Q B;  2K39 A;  1WGG A;  2I1J A;  4IWP A;  4BBN F;  5JHA A;  3DOW A;  3Q3J A;  3JSV A;  2KQS A;  4NQK E;  3ZNG C;  5KHQ A;  2M1M A;  2KJR A;  4MGY E;  4KDL B;  2KWU B;  5LLI A;  2LRW A;  4F7Z A;  4BOZ B;  2MBQ A;  1S3S G;  1UD7 A;  3R7Q A;  5LXH A;  1ZW7 A;  3B08 A;  3R7R A;  2N1V A;  1YJ1 A;  5AZG A;  2CKH B;  4HWI B;  1IP9 A;  3U30 A;  1WR6 E;  2K6Q A;  4FUL A;  3PTF C;  2HTH A;  3NZS A;  1WH3 A;  1WJN A;  3VTV A;  2AEH A;  1WX7 A;  2GBR A;  2V4L A;  1E8Y A;  3ZNH B;  1GC7 A;  2GBN A;  2DYB A;  2J7Q B;  3JYU A;  1V5T A;  4IC7 B;  3SDL C;  5DCN A;  1I35 A;  4NNJ B;  3VH3 B;  2NR2 A;  1VD2 A;  3ZNZ B;  1WZ0 A;  2RPQ A;  4MJS A;  3CMM B;  4GN1 A;  2DEN B;  4HPL B;  1V80 A;  3RCZ A;  3TCA A;  3ENE A;  1KJT A;  3HHM A;  2K1F A;  3P2B A;  2L00 B;  2M0X A;  4TKN A;  1LFD A;  3AU4 A;  1WXM A;  3VUY A;  1WM3 A;  3KH0 A;  3ML8 A;  2KJ6 A;  4LDT D;  1P9D U;  5IAA C;  2N9E B;  3M63 B;  2KMC A;  2KDI A;  4K1R B;  2KX0 A;  2L7R A;  4NY0 A;  3KYC D;  3L17 A;  2FUH B;  3VUW A;  1YX6 B;  2PJH A;  1WY8 A;  1PQS A;  4NJ6 A;  2JF5 A;  1A5R A;  2JXX A;  3W1S A;  3APD A;  3MJW A;  5BO4 B;  4MSM B;  3WA0 A;  2KTR A;  5J17 A;  1WJU A;  1GG3 A;  2KC1 A;  1WX9 A;  4W9F A;  3RT3 B;  2UWQ A;  1WE6 A;  1WE7 A;  3KW5 B;  2CHW A;  3N30 A;  4LDT B;  1QZE A;  2AYO B;  2C7H A;  4FHJ A;  5CTR C;  4ZRI A;  4IM3 A;  3H1U A;  3WAM A;  5D94 A;  2FCM A;  2ZCC A;  2J0M A;  4TQ1 A;  1TTN A;  2LD9 A;  1G6J A;  4II3 B;  1E7U A;  2IBI B;  4FBJ B;  2D2Q A;  2ZVO A;  2CU1 A;  3WIM A;  4MDK E;  4FJV B;  4BKS A;  1J19 A;  2B3A A;  4ZYN A;  3RUL A;  5E6N A;  2C9W B;  2MLB A;  1P3Q U;  2DYM A;  3OLM D;  2DAJ A;  2O6V A;  2CS4 A;  1R4M I;  1T0Y A;  2BGF A;  1S1Q B;  3PT2 B;  3OAW A;  3M3J A;  3NS8 A;  3VDZ A;  2NBV B;  4EEW A;  1GNU A;  4X57 B;  2NBW B;  3UQA A;  4KZ0 A;  4M8N A;  4BVU C;  2L3Z A;  3R66 C;  4FHK A;  3QA8 A;  1IYF A;  2AL6 A;  2KVR A;  1MG8 A;  2FAZ A;  2O6V B;  2RSU A;  3QCA A;  4KZC A;  2J0J A;  2N1W A;  3QWZ B;  2GMI C;  3D32 A;  3OJ3 A;  2IO0 B;  2L76 A;  2A5U A;  2LXA A;  1WXS A;  4LJO B;  1KLV A;  2LVP A;  2GBM A;  4JGH B;  3TBL D;  2PE6 B;  2KO3 A;  3L16 A;  1WMH A;  2FCS A;  3B0A A;  3VTU A;  3CF6 E;  1TBE A;  4G50 A;  3IVF A;  4KDI C;  4HLE A;  5AEK B;  3PVL A;  2G4D B;  2MBE A;  2W9N A;  1F9J A;  4HDQ A;  3ZDM C;  1WXA A;  2ZNV C;  2XBB C;  2HD5 B;  2BF8 B;  2JT4 B;  3BIN A;  3PRM B;  2KC2 A;  2BYV E;  3L0W B;  2KTF A;  1UEL A;  1WF9 A;  1J0G A;  5E6P A;  2KZR A;  3H9D A;  3PZD A;  2I1K A;  2R2Q A;  4W9G A;  3T8M A;  3UIP B;  3PS6 A;  5D2M B;  1U4A A;  1OTR B;  2D3G A;  3L54 A;  2KAN A;  1SGH A;  4WQO B;  5DPR A;  1RAX A;  2LGX A;  3WAN A;  2C60 A;  2KQ7 A;  3RZW C;  3H6N A;  4AWJ A;  2CHX A;  1WJ4 A;  1X1M A;  2JVC A;  2JPH A;  2VRR B;  4I6N B;  3V61 A;  3BY4 B;  5G55 A;  3A1Q A;  3PLV A;  2O6V D;  2K8B A;  2LGD A;  2XEW A;  3SHQ A;  1SIF A;  4M0W B;  4EKU A;  2YLM A;  3EFU A;  3K9O B;  2D10 A;  2MP2 A;  4F1S A;  2DYO A;  1E8X A;  2DZK A;  2G4S A;  3ZDT A;  2BWF A;  4B95 A;  2DX5 B;  4AJW A;  1BT0 A;  4IM2 A;  2BPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...