4WQOB

Structure of vhl-elob-eloc-cul2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Von Hippel-Lindau disease tumor suppressor
publication title Insights into Cullin-RING E3 Ubiquitin Ligase Recruitment: Structure of the VHL-EloBC-Cul2 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 25
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wqoB00
4I6NB 4JIOU 4FJYA 1ZW7A 2JT4B 2KDIA 4IUMB 3PHWB 4LDTB 4MJSA 3WAOA 3U30A 1G6JA 2R2OA 4MGIE 4KDIC 2BKRB 2C60A 2NBVB 2JPHA 4HPMB 4NY0A 3VUYA 2KDFB 4FHKA 4GIVA 3ZTCA 2BYVE 2LRUA 4AJWA 3QAQA 2KTRA 2G4SA 3W1SC 3KYDD 4KZ0A 1WE6A 2K25A 2ZZPB 1E8XA 3JSVB 3PREA 2B3AA 1S1QB 1WY8A 5AZGA 2HE7A 1WGDA 4B95A 1WGRA 4W9EA 1M94A 2DYBA 3RCZA 4PYZA 2A5UA 4NJ6A 4MGKE 2L76A 1RAXA 3M63B 1OGWA 4ANWA 1J19A 2NCNA 3DVNV 3NS8A 3IFWB 4AUQC 2L05A 3DQVA 2ZVNA 3OJ4B 1ZGUB 3NZSA 3QWZB 1UBIA 3TJPA 2JWZA 4YL8A 2LI5A 4W9FA 2QHOA 2XBBC 3UIOB 1P0RA 2N7EA 1TBEA 1A5RA 5JZEB 2J0JA 3ML8A 3ZNHB 4AWJA 2RR9A 5C1ZA 1AARA 3KVFB 4B9KA 1YQBA 2KK8A 3WALA 4EKUA 2O2VB 1NDDA 3EC8A 4LDTD 3ZTDA 3UF8A 4BFRA 4XZ4A 4PYUA 3KW5B 4MSMB 2KWVB 2GBJA 2DZKA 3WAMA 5GMVA 3QJZA 4F8CB 3MHSD 3PVLA 3B08A 3WA0A 4W9KA 2K6QA 3PPAA 1RFAA 3HHMA 1SGHA 5L83A 3A9JA 3HIZA 3GOEA 4GDLB 1IP9A 1E90A 1OEYJ 3KH0A 4E71A 1UD7A 2OJRA 2BF8B 2KLGA 5E6NA 4LCDE 2LGXA 4BVUC 2K8HA 3M3JA 1LQBA 2J7QB 2RSUA 4IWQA 3V61A 2M8SA 3LDZE 3X0WA 3VUXA 2KOXA 1WZ0A 1WJUA 3KUZA 4HXDA 4KSLC 4AJYB 3AULA 2N9EB 3ZNGC 4DHZB 4JGHB 3ALBA 3WIMA 1F9JA 3L0WB 4K7SA 4WJPA 1R4NI 2MP2A 3DBLI 1P9DU 3A9KA 2PJHA 3T8MA 3VHTC 4CO7A 4HWIB 2KNBA 1V80A 1D3ZA 3X23A 1OQYA 4DHJD 3AI5A 2NBUA 1EF1A 5D6JB 4IM3A 4MJSB 3RD2A 3VDZA 1J0GA 4TQ0A 1SE9A 1K8RB 5CTRC 4A20A 3ZDTA 1WE7A 4EZLA 3V60A 2CHXA 2D11A 2K8BA 2FUHB 1V2YA 3M95A 2KTRB 1E8YA 2KJHB 2AL6A 4II2B 1T0YA 3ONSA 5CX3A 1LM8B 4E74A 4TUUA 4KDLB 2IY1B 2XEWA 2L3ZA 3ZRFA 4BOSC 2O6VD 3PV1A 4MELA 3DPDA 3DVNU 3ZLZA 1C3TA 3PHXB 3ECIA 4HDQA 2FCMA 4PS7A 1P3QU 2KC2A 2O6VA 4KVGB 2IO1B 2KTFA 2RPQA 4K7UA 2L0FA 4BOZB 2GOWA 1EUVB 3PGEA 2V1YA 3PRMB 4GDKA 3JW0X 4B6WA 4WAAA 3H7PA 3QC8B 3V6CB 2PE6B 2UYZB 2DAJA 2KHWB 2BKFA 2KXJA 4URKA 4WJQA 2KJ6A 3L16A 2BYFA 2D3GA 1FXTB 1JRUA 3W1YA 5DPSA 2CS4A 2KQSA 2IO0B 2L7RA 5CHFA 3R7QA 2M0XA 2D10A 2UWQA 2LASA 2C9WB 3UINB 1S3SG 2MQJA 3A1QA 3ZNID 3CF6E 3RYTA 2L8JA 5BO4B 2N4FA 4KSKC 3A9JB 1XD3B 3A33B 1GC6A 3ZIMA 3S2AA 3KUCB 1MG8A 3KYCD 1YIWA 3PS6A 1GNUA 4AOFA 4AP4C 3VXWA 4FHJA 3DVGX 3DOWA 2KLCA 3TBLD 3TL5A 1P98A 4WJNA 1V49A 2NS5A 5D2MB 3SD5A 1WJNA 3NOBA 5FR6A 3ZNZB 2JZZA 2Z59B 4BBNC 4NAWA 2GMIC 2LUEA 1WIAA 3EECA 3TCAA 2ZPNA 2EMSA 1E7UA 2DHZA 2JVCA 2N1VA 4A3OA 1KLVA 2MP2B 3A9KB 1H4RA 5CHWA 3OLMD 1GUAB 2N9PC 3D32A 3IG3A 4HVBA 2LGDA 4GGQA 4W9DA 3NHEB 3RULA 3UQAA 3VVWB 4DDID 1WRDB 2JUOA 2JXXA 2OOBB 3C0RB 4KIKA 3AXCA 3PSEB 1RRBA 4DHJB 4GXBA 3H9DA 2MWSB 1WI0A 2GBNA 4W9GA 3UGBB 2KD0A 4JL9A 4IM2A 2VRRB 4FULA 2GBMA 4MGYE 2BWFA 2XK5A 1NBFC 1XT9B 4WJOA 5IA7A 3VAWA 4HDOA 2DX5B 2L00B 1WGGA 4HCPB 4II3B 4K81A 2M1MA 4G3XB 1WR6E 5AZHA 2M4NA 4F1SA 3PRPB 4E3CA 1WH3A 4GSWA 5J2RA 1R4MI 3K9PB 2ZJDA 3WANA 1J8CA 2YLMA 2L0TA 1YX5B 2O6VB 2CR5A 2ZEQA 4PS8A 2V3SA 2PEAA 2C7HA 2C5LC 4MGZE 2ZNVB 1E5WA 2KMCA 4TKNA 2BGFA 4GDKB 4MH0E 2EKEC 5AZFA 5G55A 3H7PB 2BPSA 3RT3B 1IPGA 2G4DB 2IY0B 4HCNB 3LJ3A 2FIFA 5DPTA 4G11A 3B1LX 3PRZA 2KZRA 2Y5BB 1SIFA 3ZO5B 5KHQA 3H7SA 3UQBA 1YX6B 1UZXB 1WJ6A 5L95C 4MDKE 1I42A 2LXAA 2KANA 4XC2A 1UGMA 1WXSA 3JVZX 5HKHA 1TTNA 3Q3JA 3VH4B 4WWNA 2RGFA 1GC7A 4OVUA 4I6LB 2KKCA 1WF9A 1V5TA 3A1QB 2CU1A 1Z5SB 1WR1A 2BYEA 3L13A 4DK5A 2K8CA 1OTRB 1WMHA 2FCQA 1E8ZA 3ZVVA 5D94A 3DBHI 4FA6A 1VCBA 1Y8RC 3MTNB 3ZKJC 3VQIA 1V86A 4M8NA 1IYFA 2CHWA 2J0MA 4BKSA 3PLUA 2LJ5A 2AWTA 4ANUA 2MCNB 4DWFA 1V81A 4ZRIA 3APDA 4MSQB 2KVRA 2KFKA 4IWOA 1QZEA 3BINA 3DBSA 2MBQA 2DZIA 2KO3A 3ZRCA 4W9CA 4GN1A 2IO2B 4NAWB 1VD2A 2KWCA 1WX9A 3OAWA 1U4AA 2KX0A 4J6IA 4WWOA 2C7NB 2IZVB 3V6EB 2N1WA 3CSFA 4G50A 4IW0A 4MM3A 2MLBA 2KFJA 1ISNA 3JYUA 4BKTA 4FBJB 5CHVC 4FJZA 2NPTA 5LXIB 2LVQA 4KIKB 4HLEA 2K39A 2MBOA 4KV2A 1X1MA 1OEYA 2KN5A 3ENEA 4OVVA 2N9XA 5E6PA 5DPRA 2D2QA 2NR2A 2W9NA 3VTVA 2M17A 5LLIA 2XK5B 3IBEA 3VTWA 3BY4B 4RM8A 4ANXA 4DXAB 5TR5A 4NPNA 1C1YB 4DHZE 3SDLC 3TMPB 4ASWC 1XQQA 1LXDA 4PS3A 3APFA 4JQWC 3RZFA 1Q5WB 1P1AA 4HPLB 1UELA 1WJ4A 1WXAA 3SU8X 2LXCA 1Q0WB 3IVFA 1WXMA 5LXHA 3HM6X 2HD5B 2AL3A 4HK2A 3PTFC 3HK0A 1V9JA 1EO6A 3EHVA 4X57B 4A3PA 4F7ZA 4DBGA 2ZVOA 2GBKA 3L54A 4ICVA 3PZDA 2G45B 3R7RA 2MBEA 2JRHA 2KJRA 1WGHA 3APCA 4I6PA 2ZCCA 3GZNI 1KM7A 2IO3B 1WXVA 3N3KB 2NVUI 3A4SC 3HM3A 3QX1A 1WFYA 1WM2A 2K1FA 2MBBB 2JF5A 3M62B 4GU2A 1Q1OA 2LGYA 2DYMA 2WYQA 4ZRJA 3R66C 3SHQA 3T9LA 1L2NA 4XX5A 1EF5A 2KQ7A 3N30A 4DDGD 2JZ3B 4FN2A 3L17A 4K1RB 2FCNA 3QK0A 4RM9A 4WQOB 4KZCA 3RUIB 1E8WA 3ML9A 4CYEA 2DZJA 3ZUNA 1WMHB 2JY6A 4MEMA 4NNJB 4W9HA 1RLFA 2MBHA 2FAZA 4FLHA 4GOCA 2KDBA 3PT2B 3DDCB 4IM0A 1WX8A 2ZCBA 4TQ1A 4W9JA 2WWZA 4WWPA 1YJ1A 1UBQA 3TIXA 2HTHA 2MA9B 2YVCA 3IHPC 3UIPB 5JHAA 2KFKB 5C23A 5DPWA 5IAAC 2ZNVC 3VTUA 4EOYA 2DENB 5DCNA 2HJ8A 2GBRA 2MSED 3I3TB 2J0KA 1PQSA 1GG3A 1TZ1A 2CKHB 2R2QA 2REXA 2AEHA 3P2BA 4NQLB 2KWUB 4P7IA 4FADA 2KC1A 3QCAA 1LFDA 2ASQA 2PPHA 3K9OB 3U8ZA 2LVPA 2PE9A 2G3QB 2Z0DB 3EFUA 3H1UA 3B0AA 5D7GA 4TV3A 2KX3A 2NPTB 3VH3B 2DYOA 3JSVA 1I35A 1KJTA 2N7DA 3NZUA 4M8MA 5AEKB 3W1SA 5JH5C 5E6OA 5JHBA 1WZ3A 1L7YA 4K7WA 2LVOA 4EEWA 1V5OA 1WX7A 2IYDB 2KDEB 2WX1A 4CHKA 1H8CA 3NY5A 4G0NB 2FCSA 3DBRI 3RZWC 2WDTB 2KMAA 4EFOA 4BKSD 3OJ3A 4LJOB 3AU5A 3H6NA 3CSTA 4NJ7A 4GMVA 1WYWB 5KHOA 2MW5A 3R3MA 1UH6A 1GJZA 4ICUA 3V62A 2RD0A 4FJVB 1V6EA 3CMMB 3QQ8B 2O2VA 3MJWA 5J18A 4EZKA 3KUDB 3QARA 1WGYA 3QHTA 2WX0A 3ZW3A 4ANVA 2EMTA 2DAFA 2I1JA 4ZRKA 2FNJB 2IBIB 2LD9A 3QA8A 4LJPB 4EZJA 3Q3FA 1BT0A 1YD8U 4M0WB 1WM3A 1TGZB 1CMXB 3WAPA 5G2NA 4ZDVA 2BWES 3U7DA 1KOTA 2K6DB 4IG7B 2LZ6A 4RMAA 3ZDMC 3QIJA 3O65B 4GDLA 4N9F4 2I1KA 4ZYNA 5EDSA 2AYOB 2DZMA 2CHZA 3DVGY 2MX2A 3A4RA 1HE8A 4W9IA 3VUWA 3L08A 3L10B 4IWPA 5J17A 4W9LA 1ZKHA 4NQKE 2NBWB 3N32A 4GB9A 4HJKA 2D07B 4EUTA 2LRWA 4BKGA 4JLCA 2Z0EB 1NI2A 2V4LA 2JRIB 3VFKA 4IC7B 3PLVA 3DCGA 2A4ZA 1Z2MA 2MRPA 3AU4A 2FIDA 2ZPYA 2LWPA 2C7MB 1E7VA 4BBNF
chains in the Genus database with same CATH superfamily
3BWUD 2QCZA 4FJYA 3MP9A 2SAKA 3U30A 1JROA 1UWMA 2L83A 4KDIC 2NBVB 2JPHA 2K9XA 2X38A 4GIVA 3R8BA 3QAQA 1WE6A 1JWUD 2B3AA 2HE7A 2LGIA 2RDBC 1FFUA 4B95A 4W9EA 1M94A 2DYBA 4DXFA 5BYRA 1OGWA 2FBWB 3NS8A 1R7SA 2ZVNA 1ZGUB 4YL8A 2QHOA 3ZJUA 2J0JA 3ML8A 3ZNHB 3FILB 1SBBB 2KK8A 4EKUA 3I57A 1K50A 4WWMA 3RN9C 3EC8A 4LDTD 3ZTDA 4BFRA 4MSMB 2KWVB 3P4SB 5FK9C 3PVLA 1QOAA 2WXMA 4JPSA 4W9KA 1DOIA 1MHHE 3LYYA 1OQRA 3R2TA 3HIZA 3MHZA 4N59A 2PKOA 3N1XC 4LCDE 2K8HA 3M3JA 1YQ3B 2WXJA 2J7QB 4IWQA 3V61A 3LDZE 3X0WA 3AE8B 3KUZA 4AJYB 3AULA 1HZ5A 3WIMA 4K7SA 4WJPA 1SSNA 1R4NI 2KWDA 3T8MA 1V8CA 1D3ZA 1XCTL 2WDVB 3AI5A 5D6JB 4MJSB 1J0GA 2WDRB 1SE9A 3ZDTA 1WE7A 4EZLA 2D11A 4R3DA 1TY2A 4UDUC 3SR6A 4II2B 1LM8B 2WXPA 3VR8B 4MELA 2UU7A 4HDQA 4XGAB 2L0FA 2J42A 3JW0X 4B6WA 3H7PA 3QC8B 3MFGA 3KLSX 1KRHA 4US8A 2AQ2B 3ABVB 4NJCA 4JWUC 1HTQA 1J7AA 3RNFC 4ZRQA 2JYTA 3C19A 5IO9A 3SFDB 4MT5A 1XCQL 2UWQA 2LASA 3W5VB 5BO4B 3A9JB 1GC6A 3S2AA 4AOFA 3VXWA 4FHJA 2KLCA 1P98A 3SD5A 1V49A 3ZNZB 1N5WA 5E6JA 2JZZA 2Z59B 2EKIA 3DHHC 1L6UA 4NAWA 2GMIC 2LUEA 1WIAA 2ZPNA 2EMSA 1EM7A 2DHZA 2E3TA 5I4DA 3CWIA 1TS4A 1VRAB 2N9PC 3IG3A 4S17A 4W9DA 1TS2A 3AEEB 2BTEA 4KIKA 2JXXA 3AXCA 4DHJB 2KMMA 4GXBA 3H9DA 2MWSB 1WI0A 2MHJA 2GBMA 2XK5A 1NBFC 1QOGA 1I4PA 3GE8C 4HCPB 4K81A 2M4NA 4E3CA 1FD6A 3Q8CA 4B0MA 3IT4B 5EE1A 3K9PB 2ZJDA 2YLMA 2WXQA 1WSPA 2CR5A 1NEKB 2WLBA 3DWGC 2ZNVB 4HKZE 3NVZA 4P1CC 4GDKB 1N5XA 2B76B 4MH0E 1J7BA 2IY0B 4YTMB 2RDGA 4G11A 2Y5BB 1K53A 3ZO5B 1UF0A 3UQBA 3KQ4A 1I42A 2LXAA 2WU5B 4YSXB 1TTNA 3VH4B 2RGFA 4I6LB 2ACZB 4AS1A 3P4RB 2BYEA 3DBHI 4FA6A 1Y8RC 1PYWD 3ZKJC 2GB1A 1D6EC 4M8NA 1IYFA 3BVZA 1F52A 1ZUD2 2LJ5A 4ANUA 2MCNB 4DWFA 4ZRIA 2H89B 1QOBA 1YN4A 4MSQB 3GE3C 1I4HA 2L1AA 2MBQA 4GN1A 1VD2A 3H8HA 2GRIA 2TSSA 4J6IA 2IZVB 4MM3A 3JYUA 2AQ3B 4FBJB 5CHVC 4FJZA 2NPTA 5LXIB 4C00A 4HLEA 4HKQA 1OEYA 3ENEA 5E6PA 3VTVA 2D2QA 1DOYA 4DXAB 3BY4B 4DHZE 4ASWC 4PS3A 4JQWC 2PW9A 1JWMD 1P1AA 3SU8X 1VJKA 2BBCA 1WXMA 2HD5B 1ZE3D 4HK2A 3PTFC 3HK0A 2ZVOA 2G45B 2DLBA 4J3OD 2JRHA 4OZAA 2KJRA 1L5PA 2ZCCA 2IO3B 1MI0A 2NVUI 3HM3A 3EGRA 4M0WA 3RI7C 2K1FA 2JF5A 2PMVA 2K22A 2INPE 3R66C 3T9LA 1L2NA 2KQ7A 4FN2A 3QK0A 4RM9A 1E9MA 4KZCA 1E8WA 4XYCA 3ML9A 4CYEA 1MG4A 3ZUNA 1WMHB 2JY6A 2MBHA 2FAZA 1FFVA 3PT2B 4USAA 3DDCB 4IM0A 1WX8A 4TQ1A 2WWZA 2KFKB 2XN9C 3RMKC 5DCNA 2HJ8A 1PQSA 2R2QA 4AJWA 3P2BA 1FXIA 3QCAA 2ASQA 3U8ZA 1ZPSA 2IPKD 2G3QB 3E56A 3Q3MC 1WWTA 4TV3A 4LLGM 1F2RC 2DYOA 1STEA 2PIAA 1KLGD 3AH7A 3JSVA 3NZUA 2QMTA 1V5OA 3N1YC 1H8CA 2GLSA 1YN5A 2PTLA 1BUIC 1SJED 1TZOA 2FUG1 2INDC 2WDTB 2KMAA 3NRZA 3OJ3A 3AU5A 3O13A 3CSTA 3DBHB 1WYWB 1GJZA 1KH0A 4DXGA 3CMMB 3QQ8B 4JE3B 2W3SA 3RFZB 1ET9A 2YEPB 1UUPA 4ANVA 3FKYA 2I1JA 4KX6B 1VDVA 4LJPB 3NZ3A 4H2AA 2WU2B 3U7DA 3QIJA 4GDLA 2I1KA 2DZMA 1CQVA 1HE8A 3VUWA 3L10B 5T8IA 4W9LA 1QT9A 4GB9A 2LRWA 4BKGA 4XE0A 4JLCA 2Z0EB 5HI1A 3VFKA 4IC7B 3DCGA 2A4ZA 5FR3A 1E10A 2MRPA 2FIDA 2IGDA 3AE2B 3N1ZC 4BBNF 4I6NB 4JIOU 2JT4B 2KDIA 4O1NA 1G6JA 1TS3A 2R2OA 2J52A 4NY0A 5D3DA 4HPMB 3VUYA 2KDFB 2VH1A 5HHDG 3W5UB 3ZTCA 2KTRA 1S1QB 5AZGA 2WXLA 1TIFA 4N6EB 1WGRA 2RMMA 3RCZA 3P1MA 4NJ6A 4MGKE 3M63B 3IFWB 4AUQC 2WDQB 2L05A 4Q2JA 3TUOA 1D4BA 2LI5A 4W9FA 2N7EA 5JZEB 4WH4A 4B9KA 1YQBA 1SXTA 3WALA 2WGSA 1NDDA 4A8XC 3UF8A 3W2DA 1ZP0B 1V1PB 1XXGA 2GBJA 2DZKA 5GMVA 4F8CB 3OWEB 1IBXA 3MHSD 1L0VB 1EU4A 3AE4B 3PPAA 1IUEA 1C4CA 1SGHA 5L83A 1MVKA 1IP9A 2MH7A 2OJRA 2BF8B 2KLGA 5E6NA 5IN7A 2QEJC 3L4PA 2BQQA 2H88B 2KAJA 2N9EB 3ZNGC 1F9JA 3DWMA 2MP2A 3AB5A 3A9KA 4K3CA 4CO7A 1FEHA 3AE5B 2V3NA 3NJTA 4DHJD 1EF1A 4IM3A 4TQ0A 4HPPA 5CTRC 3V60A 2CHXA 3ZJTA 1CK1A 2K8BA 1NYQA 4RGNA 3RNEC 2HJ1A 1E8YA 2KJHB 4WIPA 2AL6A 1T0YA 2IY1B 4BOSC 1DGJA 3NVWA 3AEFB 3DVNU 2ONQA 1C3TA 1P3QU 2IO1B 4A90A 2RPQA 4K7UA 2GOWA 4HROA 1VZ8A 3PRMB 1IGDA 2DAJA 2BKFA 1L4DB 1K52A 4LTUA 1DYQA 2BYFA 3IAS1 3W1YA 3B2GA 4RF1A 2IO0B 5CHFA 3R7QA 1FCLA 2D10A 3U7ZA 2C9WB 3UINB 3A1QA 2L8JA 1XD3B 2KACA 2WXIA 3ZIMA 1JRPA 1ZXHA 3KUCB 3KYCD 1YIWA 4L2YA 4AP4C 4P6VF 1EU3A 1TKYA 2I38A 1L6VA 5D2MB 2LFIA 5FR6A 1N6ZA 3TCAA 3ZJVA 4ACFA 2N1VA 1KLVA 3GS2A 5CHWA 3OLMD 2CU3A 3D32A 4RGMA 4HVBA 2LGDA 1FM0D 3T3OA 3UQAA 3VVWB 4DDID 1N63A 1EWYC 1RRBA 4AQ7A 4IM2A 2VRRB 5IA7A 4WJOA 3VAWA 4HDOA 5D3IB 2L00B 1JW9D 4II3B 2M56B 1C79A 3P4QB 1WR6E 4G3XB 4F1SA 3PRPB 2J4XA 2N7JA 2INCC 2L0TA 1PGBA 2O6VB 2V3SA 2PEAA 4P16A 2C7HA 2C5LC 2KN4A 1ENFA 4RGOS 3TSSA 1C77A 1XF5L 5G55A 3FAHA 4TMAB 3PRZA 2KZRA 1RYJA 2KANA 3JVZX 1YNTE 1N60A 5MPOA 4WWNA 3WCQA 2KKCA 2JSVX 1E6EB 1UGJA 3CIRB 1Z5SB 2FCQA 2VZKB 3ZVVA 1V86A 2N9LA 2PVGC 1NI3A 4XDDA 2QIEB 3HUIA 4WURA 2NTTA 1QZEA 1HTOA 2KO3A 3C8YA 2IO2B 2WHIA 3OAWA 1WX9A 4RH6A 4YXDB 3V6EB 3P42A 3CSFA 2KFJA 3E9SA 2KYWA 2K39A 1X1MA 2KN5A 2N9XA 3V3XA 4YTPB 3MC0B 3N9YC 5DPRA 2W9NA 5LLIA 1ZOYB 3DHIC 4ANXA 3SDLC 1LXDA 3KWVA 3RZFA 2M19A 1Q5WB 4HPLB 1UELA 1WJ4A 1WXAA 3DHGC 2QILA 3EHVA 4X57B 3AEDB 3BYTB 2GBKA 3PZDA 3R7RA 4HJGE 3U52E 3APCA 3GZNI 3QX1A 3A4SC 1Y56A 1AYFA 1WFYA 2IGHA 3GP7A 4XWTA 4GU2A 2WXHA 4C4VB 2LGSA 2DYMA 4ZRJA 4LNNA 2LUMA 4DDGD 3ZQ4A 3L17A 1RWSA 2Y3AA 3RUIB 3BZDB 3Q3OC 1PDXA 2K0PA 1L0XB 3HVDA 3ZXRA 2ZCBA 5BYSA 2HTHA 2MA9B 5JHAA 3VTUA 4GLSC 2GBRA 2MSED 2J0KA 1UNSA 2AEHA 4FADA 4PT5A 1LGRA 3K9OB 2LVPA 2Z0DB 2YEPF 5D7GA 2WP9B 2KX3A 1R4NB 2X8XX 1I35A 4L1BA 1KJTA 2N7DA 3OG5A 2DWQA 4K3BA 5JHBA 4YSZB 2W55A 1QLBB 4RNAA 4K7WA 1WRIA 4A6QA 1WX7A 4M02A 1ZXIA 2FCSA 3DBRI 3RZWC 3BK1A 2ON8A 3PZ7A 4LJOB 4C7YA 1E0ZA 3H6NA 1XLPA 5TSSA 5KHOA 4ICUA 3V62A 3FILA 4WAFA 2KDMA 4FJVB 3U2SC 1V6EA 2HTME 4EZKA 3I63C 2D3BA 2INNE 2EMTA 1D5ZC 4ZRKA 2LD9A 2WQYB 1BT0A 3WAPA 2K6DB 4L23A 2LZ6A 4RMAA 2OJWA 2JQRB 1VLBA 1SEBD 2CHZA 2MX2A 3A4RA 1C76A 3J9CA 4W9IA 2KQ4X 3N32A 1FMAD 2V4LA 2ZPYA 2LEKA 2C7MB 1Q10A 5EE3A 2CJNA 4IUMB 3PHWB 4LDTB 4MJSA 5FKAC 3WAOA 2G9HD 4MGIE 2BKRB 2C60A 4FHKA 2DBYA 3Q69A 2BYVE 2LRUA 3T3NA 3GZNB 1FIQA 3W1SC 4KZ0A 2ZZPB 3PREA 1V1OA 2N9KA 3GB1A 2A5UA 2WXFA 2L52A 4BZAA 2NCNA 5GXGB 1BMLC 2ZW0A 3DQVA 3QWZB 3OJ4B 4C56C 2JWZA 2HDEA 2XBBC 1TBEA 1C4AA 2MEKA 4AWJA 1AARA 1L0YB 1DOXA 2O2VB 3RPFC 4ZYSA 4XZ4A 1TS5A 4PYUA 3KW5B 3Q6BA 5AUIA 2FE8A 4REZA 1CJEA 2MJ3A 2BS3B 1JWSD 2K6QA 2WNMA 3HHMA 3A9JA 1JWAD 3GOEA 1E90A 1OEYJ 2BYTA 4BVUC 5LNK1 2QSDA 2JWUA 1FPYA 2W3RA 2M8SA 3VUXA 4HXDA 1WJUA 4KSLC 3DBRB 3TEYA 4KKJA 3AMZA 4JGHB 3EFCA 2Y5CA 3ZYYX 3DBLI 1P9DU 2PJHA 1SJHD 3AE3B 2KNBA 1KTKA 2WXOA 2NBUA 3RD2A 1E7PB 4NZLB 1WXQA 3Q8FA 1T0QC 3R2IA 5EE9A 2FUHB 3AE7B 3MC8A 1I7HA 3ONSA 5CX3A 2KT7A 2XEWA 2O6VD 3B2FA 3PV1A 1ESFA 2BS2B 3ZLZA 2FCMA 4PS7A 2KTFA 4JX1C 2QJLA 1EUVB 2ZW1A 1FNVA 4GDKA 3HVZA 2PVOD 4WAAA 4M00A 3Q3NC 1XO3A 2UYZB 2KHWB 3UI3A 4PK1A 2KXJA 4URKA 3KWLA 4KGRA 1BXTA 2D3GA 4EE2A 2CS4A 2D3AA 5C3JB 2L7RA 2M0XA 2Z8LA 2VZKD 5HFYA 2MQJA 2N4FA 4KSKC 5IP4D 5H92C 1F0ZA 1MG8A 4LNFA 1GNUA 5JXVA 1OQQA 3DVGX 3DOWA 1WJNA 3N20C 3NOBA 3Q8BA 1GAQB 4BBNC 1YMHE 1HEZE 4A3OA 1H4RA 4GGQA 1AWDA 3RULA 4MACA 3IXSA 2MJDA 3PSEB 2GBNA 4W9GA 2WXRA 3AN1A 4JL9A 4RF0A 4MGYE 4FULA 5BMIA 1XT9B 2GI9A 4S0RA 1JCKB 1OFFA 5AZHA 3EA6A 4GSWA 1GB4A 1R4MI 1J8CA 4ITKA 1YX5B 3Q2AC 2KMCA 1D5XC 2EKEC 5AZFA 3H7PB 3RT3B 1IPGA 2G4DB 2FIFA 5DPTA 3B1LX 2AQ1B 3TEZA 1UZXB 5L95C 2EELA 3SEBA 1UGMA 1WXSA 2V4IB 4KGTA 1WF9A 1P7FA 1V5TA 2CJOA 3L13A 4DK5A 1I4QA 1JWBD 1OTRB 1WMHA 5D94A 1J7CA 2J0MA 3IAM1 2AWTA 5AUKA 1V97A 2KFKA 4IWOA 3DBSA 2DZIA 4NAWB 2KWCA 3I5JC 1U4AA 2KX0A 3BIID 2K5PA 2N1WA 4C80A 1M4VA 2MLBA 4BKTA 1ISNA 4WQMA 1NVID 2LVQA 4KIKB 2MBOA 1ZDVA 2XK5B 4RM8A 4NPNA 1HZ6A 3TMPB 1QF6A 1XQQA 1Q0WB 4DQOC 3ETRA 1V9JA 1EO6A 4F7ZA 1NYRA 1CZPA 1HXYD 3LB8C 3L54A 1C9FA 1WGHA 2V9HA 4I6PA 3N3KB 1WXVA 5C2TB 1WM2A 2MBBB 3M62B 1Q1OA 2LGYA 2WYQA 2K3UA 4LNOA 4XX5A 1EF5A 3N30A 4K1RB 4ZRPA 2FCNA 4WQOB 2WXKA 4OVZA 3PO0A 4MEMA 4MH8A 4W9JA 4RGTA 4WWPA 3IHPC 2YVCA 5C23A 5DPWA 1MFWA 1R4MB 2ZNVC 3AEGB 2BVCA 4EOYA 1T0RC 3AM9A 4ZHPA 4US9A 2CKHB 4NQLB 1TZ1A 3ZRCA 2WXGA 1LFDA 2PE9A 3EFUA 1YJJA 3H1UA 3B0AA 4MM3B 4C7ZA 2NPTB 1D5MC 1PGXA 4M8MA 3W1SA 5JH5C 2BB6A 5G5HA 1VZ6A 2LVOA 3MC9A 2KDEB 2IYDB 2WX1A 4CHKA 1B1ZA 5BMHA 3TEWA 1GPXA 4NJ7A 3AEAB 2MW5A 1UH6A 2W82A 3W9CB 2L32A 2RD0A 1T6BX 1VZ7A 3PZ8A 1ROEA 1T5XD 2D5GA 5J18A 1XLNA 3BVGA 2WXNA 3QARA 4ZHOA 1FXAA 1IGCA 3QHTA 5BYQA 4YT0B 1V1PA 4OW0A 2BB5A 1F1HA 2FNJB 4EZJA 4M0WB 1WM3A 1CMXB 4ZDVA 5HG2A 1KOTA 4IG7B 4N9F4 3O65B 1PFDA 5EDSA 4QAYA 1P7EA 3RNAC 4IWPA 5J17A 3TEXA 1ZKHA 4NQKE 3NUHB 4HJKA 2D07B 4EUTA 2J53A 1NI2A 3PLVA 2IDYA 3AU4A 2KVZA 2LWPA 2BT6A 1TJEA 1E7VA 1C78A 1EWCA 1ZW7A 3Q8EA 4M01A 1FO4A 1FRDA 1GOZA 2JXTA 3AE1B 1SE2A 2G4SA 4JWSC 5EE0A 3KYDD 2K25A 3JSVB 1E8XA 2QC8A 1WY8A 1WGDA 3AE6B 4OZBA 4HRSA 4PYZA 1KFYB 3Q8AA 2L76A 1RAXA 4ANWA 1J19A 3DVNV 3TJPA 3IT6B 3NZSA 1UBIA 3VRBB 3UIOB 1P0RA 2ICIA 1SE3A 1A5RA 2RR9A 5C1ZA 1FCCC 3KVFB 3LXFA 2BW2A 2RDHA 4YSYB 1HQRD 3QJZA 3B08A 3WA0A 1RFAA 1TKEA 3BVMA 4GDLB 4E71A 3KH0A 1UD7A 4XWWA 1FNUA 1LO5D 2LGXA 1YN3A 1MJDA 3RNCC 1LQBA 2RSUA 4D2KA 2KOXA 1WZ0A 1N62A 1C4PA 4DHZB 3ALBA 1F77A 3L0WB 2V3PA 3VHTC 4HWIB 1V80A 1KF6B 3X23A 1OQYA 3SFEB 3VDZA 4LK0M 2VH2A 1K8RB 4A20A 1QOFA 2OEDA 1V2YA 3M95A 2KTRB 1I4XA 2IGGA 4E74A 4TUUA 4KDLB 4IOIE 2L3ZA 3ZRFA 2V0GA 4ARCA 3DPDA 3RNBC 4A55A 3B9JA 3PHXB 3ECIA 2O6VA 2KC2A 1PUTA 4KVGB 1TT5B 3VR9B 3AE9B 4KKIA 4BOZB 3PGEA 4ZOHC 2V1YA 3NVYA 2MJEA 3V6CB 2PE6B 4OZCA 4WJQA 2KJ6A 1PGAA 3L16A 1FXTB 1JRUA 3AEBB 5DPSA 2KQSA 1NENB 1IBXB 2LHEA 1S3SG 3ZNID 3CF6E 3RYTA 2PLPA 1XLOA 3A33B 4YWGG 2JZPA 3PS6A 2E6XA 1ACCA 3TBLD 3TL5A 1YOVB 3NG0A 2NS5A 4WJNA 1K51A 3EECA 4N58A 1E7UA 2JVCA 1T0SC 2MP2B 3A9KB 5BMGA 1GUAB 2LHDA 4LNKA 2LMCA 3NHEB 1A70A 1WRDB 2JUOA 2OOBB 3NVVA 3C0RB 1QKZA 3UGBB 2KD0A 5G5GA 3AECB 2BWFA 2DX5B 1WGGA 2JYEA 2M1MA 2BS4B 1WH3A 1FNWA 5J2RA 3WANA 4PS8A 2ZEQA 4IKGA 5IOIA 4MGZE 1E5WA 4TKNA 2BGFA 2M0AA 1RM6C 3Q14C 1XLQA 2BPSA 4HCNB 3LJ3A 4B0EA 1HA5A 1SIFA 5KHQA 3H7SA 1YX6B 1WYGA 1WJ6A 4MDKE 4XC2A 2NTSA 4C4VA 5HKHA 1F2RI 3Q3JA 1GC7A 2SEBD 4OVUA 4YTNB 4P1BC 3A1QB 3MJ5A 2CU1A 5IKCM 1WR1A 1QQRA 2K8CA 3EUB2 1E8ZA 1MHXA 2OHFA 1VCBA 3MTNB 3VQIA 1AW7A 3URYA 2CHWA 4BKSA 3PLUA 1V81A 3APDA 2KVRA 3BINA 2W54A 4W9CA 4BAXA 1YJIA 1B9RA 1SIJA 3I9V1 4WWOA 3ZXVA 2C7NB 2QDFA 1XEEA 4G50A 4IW0A 1SB3C 4KV2A 1TY0A 4OVVA 3BYYB 2NR2A 4HEA1 3AV8A 2M17A 3IBEA 3VTWA 5TR5A 1C1YB 1GB1A 3APFA 1MPEA 2LXCA 1I4GA 2IJ0A 3IVFA 5LXHA 4A9AA 2JU6X 3HM6X 2AL3A 4A3PA 4DBGA 5H8YE 3NS1A 4ICVA 2MBEA 2NMQA 2WS3B 1KM7A 4FXCA 3HRDD 3SHQA 1SF0A 2JZ3B 2Y5PA 2XNAC 2Q5WD 2DZJA 1N61A 3P4PB 4RCOA 4NNJB 1QILA 1UWXA 4W9HA 1RLFA 2G1EA 4FLHA 4GOCA 2KDBA 4OHJA 2JX5A 4XDCA 1YJ1A 1UBQA 3TIXA 3V05A 3UIPB 1I4RA 5IAAC 2DENB 3BK2A 3I3TB 2REXA 3WAMA 1GG3A 4P7IA 4IDIA 2KWUB 2I2YA 2KC1A 1L4ZB 1TYGB 2AX5A 2PPHA 1JQ4A 3VH3B 3DBLB 1T3QA 5AEKB 5E6OA 3VRAB 1WZ3A 1L7YA 1TKGA 4TSSA 4EEWA 2LJIA 2D3CA 3NY5A 4G0NB 4EFOA 4BKSD 1FRRA 4GMVA 4CQNA 3R3MA 2O2VA 3MJWA 1AN8A 3KUDB 1SE4A 1WGYA 1WGKA 2WX0A 3ZW3A 4ARIA 2DAFA 3RNGC 2R61A 2IBIB 3QA8A 3Q3FA 1YD8U 1TGZB 1YQ4B 5G2NA 1JMLA 2BWES 1ZDXA 3ZDMC 4ZYNA 1KLUD 4KGSA 2AYOB 3ZGZA 3DVGY 3L08A 2N0SB 3U4EG 2NBWB 4RFBA 2JRIB 2DNFA 1JALA 1RFKA 1Z2MA 3FC4A 4LNIA 1ET6A 3P63A 1VR9A 2RPVA 4NAMA
chains in the Genus database with same CATH topology
4I6NB 4JIOU 4FJYA 1ZW7A 2JT4B 2KDIA 4IUMB 3PHWB 4LDTB 4MJSA 3WAOA 3U30A 1G6JA 2R2OA 4MGIE 4KDIC 2BKRB 2C60A 2NBVB 2JPHA 4HPMB 4NY0A 3VUYA 2KDFB 4FHKA 4GIVA 3ZTCA 2BYVE 2LRUA 4AJWA 3QAQA 2KTRA 2G4SA 3W1SC 3KYDD 4KZ0A 1WE6A 2K25A 2ZZPB 1E8XA 3JSVB 3PREA 2B3AA 1S1QB 1WY8A 5AZGA 2HE7A 1WGDA 4B95A 1WGRA 4W9EA 1M94A 2DYBA 3RCZA 4PYZA 2A5UA 4NJ6A 4MGKE 2L76A 1RAXA 3M63B 1OGWA 4ANWA 1J19A 2NCNA 3DVNV 3NS8A 3IFWB 4AUQC 2L05A 3DQVA 2ZVNA 3OJ4B 1ZGUB 3NZSA 3QWZB 1UBIA 3TJPA 2JWZA 4YL8A 2LI5A 4W9FA 2QHOA 2XBBC 3UIOB 1P0RA 2N7EA 1TBEA 1A5RA 5JZEB 2J0JA 3ML8A 3ZNHB 4AWJA 2RR9A 5C1ZA 1AARA 3KVFB 4B9KA 1YQBA 2KK8A 3WALA 4EKUA 2O2VB 1NDDA 3EC8A 4LDTD 3ZTDA 3UF8A 4BFRA 4XZ4A 4PYUA 3KW5B 4MSMB 2KWVB 2GBJA 2DZKA 3WAMA 5GMVA 3QJZA 4F8CB 3MHSD 3PVLA 3B08A 3WA0A 4W9KA 2K6QA 3PPAA 1RFAA 3HHMA 1SGHA 5L83A 3A9JA 3HIZA 3GOEA 4GDLB 1IP9A 1E90A 1OEYJ 3KH0A 4E71A 1UD7A 2OJRA 2BF8B 2KLGA 5E6NA 4LCDE 2LGXA 4BVUC 2K8HA 3M3JA 1LQBA 2J7QB 2RSUA 4IWQA 3V61A 2M8SA 3LDZE 3X0WA 3VUXA 2KOXA 1WZ0A 1WJUA 3KUZA 4HXDA 4KSLC 4AJYB 3AULA 2N9EB 3ZNGC 4DHZB 4JGHB 3ALBA 3WIMA 1F9JA 3L0WB 4K7SA 4WJPA 1R4NI 2MP2A 3DBLI 1P9DU 3A9KA 2PJHA 3T8MA 3VHTC 4CO7A 4HWIB 2KNBA 1V80A 1D3ZA 3X23A 1OQYA 4DHJD 3AI5A 2NBUA 1EF1A 5D6JB 4IM3A 4MJSB 3RD2A 3VDZA 1J0GA 4TQ0A 1SE9A 1K8RB 5CTRC 4A20A 3ZDTA 1WE7A 4EZLA 3V60A 2CHXA 2D11A 2K8BA 2FUHB 1V2YA 3M95A 2KTRB 1E8YA 2KJHB 2AL6A 4II2B 1T0YA 3ONSA 5CX3A 1LM8B 4E74A 4TUUA 4KDLB 2IY1B 2XEWA 2L3ZA 3ZRFA 4BOSC 2O6VD 3PV1A 4MELA 3DPDA 3DVNU 3ZLZA 1C3TA 3PHXB 3ECIA 4HDQA 2FCMA 4PS7A 1P3QU 2KC2A 2O6VA 4KVGB 2IO1B 2KTFA 2RPQA 4K7UA 2L0FA 4BOZB 2GOWA 1EUVB 3PGEA 2V1YA 3PRMB 4GDKA 3JW0X 4B6WA 4WAAA 3H7PA 3QC8B 3V6CB 2PE6B 2UYZB 2DAJA 2KHWB 2BKFA 2KXJA 4URKA 4WJQA 2KJ6A 3L16A 2BYFA 2D3GA 1FXTB 1JRUA 3W1YA 5DPSA 2CS4A 2KQSA 2IO0B 2L7RA 5CHFA 3R7QA 2M0XA 2D10A 2UWQA 2LASA 2C9WB 3UINB 1S3SG 2MQJA 3A1QA 3ZNID 3CF6E 3RYTA 2L8JA 5BO4B 2N4FA 4KSKC 3A9JB 1XD3B 3A33B 1GC6A 3ZIMA 3S2AA 3KUCB 1MG8A 3KYCD 1YIWA 3PS6A 1GNUA 4AOFA 4AP4C 3VXWA 4FHJA 3DVGX 3DOWA 2KLCA 3TBLD 3TL5A 1P98A 4WJNA 1V49A 2NS5A 5D2MB 3SD5A 1WJNA 3NOBA 5FR6A 3ZNZB 2JZZA 2Z59B 4BBNC 4NAWA 2GMIC 2LUEA 1WIAA 3EECA 3TCAA 2ZPNA 2EMSA 1E7UA 2DHZA 2JVCA 2N1VA 4A3OA 1KLVA 2MP2B 3A9KB 1H4RA 5CHWA 3OLMD 1GUAB 2N9PC 3D32A 3IG3A 4HVBA 2LGDA 4GGQA 4W9DA 3NHEB 3RULA 3UQAA 3VVWB 4DDID 1WRDB 2JUOA 2JXXA 2OOBB 3C0RB 4KIKA 3AXCA 3PSEB 1RRBA 4DHJB 4GXBA 3H9DA 2MWSB 1WI0A 2GBNA 4W9GA 3UGBB 2KD0A 4JL9A 4IM2A 2VRRB 4FULA 2GBMA 4MGYE 2BWFA 2XK5A 1NBFC 1XT9B 4WJOA 5IA7A 3VAWA 4HDOA 2DX5B 2L00B 1WGGA 4HCPB 4II3B 4K81A 2M1MA 4G3XB 1WR6E 5AZHA 2M4NA 4F1SA 3PRPB 4E3CA 1WH3A 4GSWA 5J2RA 1R4MI 3K9PB 2ZJDA 3WANA 1J8CA 2YLMA 2L0TA 1YX5B 2O6VB 2CR5A 2ZEQA 4PS8A 2V3SA 2PEAA 2C7HA 2C5LC 4MGZE 2ZNVB 1E5WA 2KMCA 4TKNA 2BGFA 4GDKB 4MH0E 2EKEC 5AZFA 5G55A 3H7PB 2BPSA 3RT3B 1IPGA 2G4DB 2IY0B 4HCNB 3LJ3A 2FIFA 5DPTA 4G11A 3B1LX 3PRZA 2KZRA 2Y5BB 1SIFA 3ZO5B 5KHQA 3H7SA 3UQBA 1YX6B 1UZXB 1WJ6A 5L95C 4MDKE 1I42A 2LXAA 2KANA 4XC2A 1UGMA 1WXSA 3JVZX 5HKHA 1TTNA 3Q3JA 3VH4B 4WWNA 2RGFA 1GC7A 4OVUA 4I6LB 2KKCA 1WF9A 1V5TA 3A1QB 2CU1A 1Z5SB 1WR1A 2BYEA 3L13A 4DK5A 2K8CA 1OTRB 1WMHA 2FCQA 1E8ZA 3ZVVA 5D94A 3DBHI 4FA6A 1VCBA 1Y8RC 3MTNB 3ZKJC 3VQIA 1V86A 4M8NA 1IYFA 2CHWA 2J0MA 4BKSA 3PLUA 2LJ5A 2AWTA 4ANUA 2MCNB 4DWFA 1V81A 4ZRIA 3APDA 4MSQB 2KVRA 2KFKA 4IWOA 1QZEA 3BINA 3DBSA 2MBQA 2DZIA 2KO3A 3ZRCA 4W9CA 4GN1A 2IO2B 4NAWB 1VD2A 2KWCA 1WX9A 3OAWA 1U4AA 2KX0A 4J6IA 4WWOA 2C7NB 2IZVB 3V6EB 2N1WA 3CSFA 4G50A 4IW0A 4MM3A 2MLBA 2KFJA 1ISNA 3JYUA 4BKTA 4FBJB 5CHVC 4FJZA 2NPTA 5LXIB 2LVQA 4KIKB 4HLEA 2K39A 2MBOA 4KV2A 1X1MA 1OEYA 2KN5A 3ENEA 4OVVA 2N9XA 5E6PA 5DPRA 2D2QA 2NR2A 2W9NA 3VTVA 2M17A 5LLIA 2XK5B 3IBEA 3VTWA 3BY4B 4RM8A 4ANXA 4DXAB 5TR5A 4NPNA 1C1YB 4DHZE 3SDLC 3TMPB 4ASWC 1XQQA 1LXDA 4PS3A 3APFA 4JQWC 3RZFA 1Q5WB 1P1AA 4HPLB 1UELA 1WJ4A 1WXAA 3SU8X 2LXCA 1Q0WB 3IVFA 1WXMA 5LXHA 3HM6X 2HD5B 2AL3A 4HK2A 3PTFC 3HK0A 1V9JA 1EO6A 3EHVA 4X57B 4A3PA 4F7ZA 4DBGA 2ZVOA 2GBKA 3L54A 4ICVA 3PZDA 2G45B 3R7RA 2MBEA 2JRHA 2KJRA 1WGHA 3APCA 4I6PA 2ZCCA 3GZNI 1KM7A 2IO3B 1WXVA 3N3KB 2NVUI 3A4SC 3HM3A 3QX1A 1WFYA 1WM2A 2K1FA 2MBBB 2JF5A 3M62B 4GU2A 1Q1OA 2LGYA 2DYMA 2WYQA 4ZRJA 3R66C 3SHQA 3T9LA 1L2NA 4XX5A 1EF5A 2KQ7A 3N30A 4DDGD 2JZ3B 4FN2A 3L17A 4K1RB 2FCNA 3QK0A 4RM9A 4WQOB 4KZCA 3RUIB 1E8WA 3ML9A 4CYEA 2DZJA 3ZUNA 1WMHB 2JY6A 4MEMA 4NNJB 4W9HA 1RLFA 2MBHA 2FAZA 4FLHA 4GOCA 2KDBA 3PT2B 3DDCB 4IM0A 1WX8A 2ZCBA 4TQ1A 4W9JA 2WWZA 4WWPA 1YJ1A 1UBQA 3TIXA 2HTHA 2MA9B 2YVCA 3IHPC 3UIPB 5JHAA 2KFKB 5C23A 5DPWA 5IAAC 2ZNVC 3VTUA 4EOYA 2DENB 5DCNA 2HJ8A 2GBRA 2MSED 3I3TB 2J0KA 1PQSA 1GG3A 1TZ1A 2CKHB 2R2QA 2REXA 2AEHA 3P2BA 4NQLB 2KWUB 4P7IA 4FADA 2KC1A 3QCAA 1LFDA 2ASQA 2PPHA 3K9OB 3U8ZA 2LVPA 2PE9A 2G3QB 2Z0DB 3EFUA 3H1UA 3B0AA 5D7GA 4TV3A 2KX3A 2NPTB 3VH3B 2DYOA 3JSVA 1I35A 1KJTA 2N7DA 3NZUA 4M8MA 5AEKB 3W1SA 5JH5C 5E6OA 5JHBA 1WZ3A 1L7YA 4K7WA 2LVOA 4EEWA 1V5OA 1WX7A 2IYDB 2KDEB 2WX1A 4CHKA 1H8CA 3NY5A 4G0NB 2FCSA 3DBRI 3RZWC 2WDTB 2KMAA 4EFOA 4BKSD 3OJ3A 4LJOB 3AU5A 3H6NA 3CSTA 4NJ7A 4GMVA 1WYWB 5KHOA 2MW5A 3R3MA 1UH6A 1GJZA 4ICUA 3V62A 2RD0A 4FJVB 1V6EA 3CMMB 3QQ8B 2O2VA 3MJWA 5J18A 4EZKA 3KUDB 3QARA 1WGYA 3QHTA 2WX0A 3ZW3A 4ANVA 2EMTA 2DAFA 2I1JA 4ZRKA 2FNJB 2IBIB 2LD9A 3QA8A 4LJPB 4EZJA 3Q3FA 1BT0A 1YD8U 4M0WB 1WM3A 1TGZB 1CMXB 3WAPA 5G2NA 4ZDVA 2BWES 3U7DA 1KOTA 2K6DB 4IG7B 2LZ6A 4RMAA 3ZDMC 3QIJA 3O65B 4GDLA 4N9F4 2I1KA 4ZYNA 5EDSA 2AYOB 2DZMA 2CHZA 3DVGY 2MX2A 3A4RA 1HE8A 4W9IA 3VUWA 3L08A 3L10B 4IWPA 5J17A 4W9LA 1ZKHA 4NQKE 2NBWB 3N32A 4GB9A 4HJKA 2D07B 4EUTA 2LRWA 4BKGA 4JLCA 2Z0EB 1NI2A 2V4LA 2JRIB 3VFKA 4IC7B 3PLVA 3DCGA 2A4ZA 1Z2MA 2MRPA 3AU4A 2FIDA 2ZPYA 2LWPA 2C7MB 1E7VA 4BBNF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6N B;  4JIO U;  4FJY A;  1ZW7 A;  2JT4 B;  2KDI A;  4IUM B;  3PHW B;  4LDT B;  4MJS A;  3WAO A;  3U30 A;  1G6J A;  2R2O A;  4MGI E;  4KDI C;  2BKR B;  2C60 A;  2NBV B;  2JPH A;  4HPM B;  4NY0 A;  3VUY A;  2KDF B;  4FHK A;  4GIV A;  3ZTC A;  2BYV E;  2LRU A;  4AJW A;  3QAQ A;  2KTR A;  2G4S A;  3W1S C;  3KYD D;  4KZ0 A;  1WE6 A;  2K25 A;  2ZZP B;  1E8X A;  3JSV B;  3PRE A;  2B3A A;  1S1Q B;  1WY8 A;  5AZG A;  2HE7 A;  1WGD A;  4B95 A;  1WGR A;  4W9E A;  1M94 A;  2DYB A;  3RCZ A;  4PYZ A;  2A5U A;  4NJ6 A;  4MGK E;  2L76 A;  1RAX A;  3M63 B;  1OGW A;  4ANW A;  1J19 A;  2NCN A;  3DVN V;  3NS8 A;  3IFW B;  4AUQ C;  2L05 A;  3DQV A;  2ZVN A;  3OJ4 B;  1ZGU B;  3NZS A;  3QWZ B;  1UBI A;  3TJP A;  2JWZ A;  4YL8 A;  2LI5 A;  4W9F A;  2QHO A;  2XBB C;  3UIO B;  1P0R A;  2N7E A;  1TBE A;  1A5R A;  5JZE B;  2J0J A;  3ML8 A;  3ZNH B;  4AWJ A;  2RR9 A;  5C1Z A;  1AAR A;  3KVF B;  4B9K A;  1YQB A;  2KK8 A;  3WAL A;  4EKU A;  2O2V B;  1NDD A;  3EC8 A;  4LDT D;  3ZTD A;  3UF8 A;  4BFR A;  4XZ4 A;  4PYU A;  3KW5 B;  4MSM B;  2KWV B;  2GBJ A;  2DZK A;  3WAM A;  5GMV A;  3QJZ A;  4F8C B;  3MHS D;  3PVL A;  3B08 A;  3WA0 A;  4W9K A;  2K6Q A;  3PPA A;  1RFA A;  3HHM A;  1SGH A;  5L83 A;  3A9J A;  3HIZ A;  3GOE A;  4GDL B;  1IP9 A;  1E90 A;  1OEY J;  3KH0 A;  4E71 A;  1UD7 A;  2OJR A;  2BF8 B;  2KLG A;  5E6N A;  4LCD E;  2LGX A;  4BVU C;  2K8H A;  3M3J A;  1LQB A;  2J7Q B;  2RSU A;  4IWQ A;  3V61 A;  2M8S A;  3LDZ E;  3X0W A;  3VUX A;  2KOX A;  1WZ0 A;  1WJU A;  3KUZ A;  4HXD A;  4KSL C;  4AJY B;  3AUL A;  2N9E B;  3ZNG C;  4DHZ B;  4JGH B;  3ALB A;  3WIM A;  1F9J A;  3L0W B;  4K7S A;  4WJP A;  1R4N I;  2MP2 A;  3DBL I;  1P9D U;  3A9K A;  2PJH A;  3T8M A;  3VHT C;  4CO7 A;  4HWI B;  2KNB A;  1V80 A;  1D3Z A;  3X23 A;  1OQY A;  4DHJ D;  3AI5 A;  2NBU A;  1EF1 A;  5D6J B;  4IM3 A;  4MJS B;  3RD2 A;  3VDZ A;  1J0G A;  4TQ0 A;  1SE9 A;  1K8R B;  5CTR C;  4A20 A;  3ZDT A;  1WE7 A;  4EZL A;  3V60 A;  2CHX A;  2D11 A;  2K8B A;  2FUH B;  1V2Y A;  3M95 A;  2KTR B;  1E8Y A;  2KJH B;  2AL6 A;  4II2 B;  1T0Y A;  3ONS A;  5CX3 A;  1LM8 B;  4E74 A;  4TUU A;  4KDL B;  2IY1 B;  2XEW A;  2L3Z A;  3ZRF A;  4BOS C;  2O6V D;  3PV1 A;  4MEL A;  3DPD A;  3DVN U;  3ZLZ A;  1C3T A;  3PHX B;  3ECI A;  4HDQ A;  2FCM A;  4PS7 A;  1P3Q U;  2KC2 A;  2O6V A;  4KVG B;  2IO1 B;  2KTF A;  2RPQ A;  4K7U A;  2L0F A;  4BOZ B;  2GOW A;  1EUV B;  3PGE A;  2V1Y A;  3PRM B;  4GDK A;  3JW0 X;  4B6W A;  4WAA A;  3H7P A;  3QC8 B;  3V6C B;  2PE6 B;  2UYZ B;  2DAJ A;  2KHW B;  2BKF A;  2KXJ A;  4URK A;  4WJQ A;  2KJ6 A;  3L16 A;  2BYF A;  2D3G A;  1FXT B;  1JRU A;  3W1Y A;  5DPS A;  2CS4 A;  2KQS A;  2IO0 B;  2L7R A;  5CHF A;  3R7Q A;  2M0X A;  2D10 A;  2UWQ A;  2LAS A;  2C9W B;  3UIN B;  1S3S G;  2MQJ A;  3A1Q A;  3ZNI D;  3CF6 E;  3RYT A;  2L8J A;  5BO4 B;  2N4F A;  4KSK C;  3A9J B;  1XD3 B;  3A33 B;  1GC6 A;  3ZIM A;  3S2A A;  3KUC B;  1MG8 A;  3KYC D;  1YIW A;  3PS6 A;  1GNU A;  4AOF A;  4AP4 C;  3VXW A;  4FHJ A;  3DVG X;  3DOW A;  2KLC A;  3TBL D;  3TL5 A;  1P98 A;  4WJN A;  1V49 A;  2NS5 A;  5D2M B;  3SD5 A;  1WJN A;  3NOB A;  5FR6 A;  3ZNZ B;  2JZZ A;  2Z59 B;  4BBN C;  4NAW A;  2GMI C;  2LUE A;  1WIA A;  3EEC A;  3TCA A;  2ZPN A;  2EMS A;  1E7U A;  2DHZ A;  2JVC A;  2N1V A;  4A3O A;  1KLV A;  2MP2 B;  3A9K B;  1H4R A;  5CHW A;  3OLM D;  1GUA B;  2N9P C;  3D32 A;  3IG3 A;  4HVB A;  2LGD A;  4GGQ A;  4W9D A;  3NHE B;  3RUL A;  3UQA A;  3VVW B;  4DDI D;  1WRD B;  2JUO A;  2JXX A;  2OOB B;  3C0R B;  4KIK A;  3AXC A;  3PSE B;  1RRB A;  4DHJ B;  4GXB A;  3H9D A;  2MWS B;  1WI0 A;  2GBN A;  4W9G A;  3UGB B;  2KD0 A;  4JL9 A;  4IM2 A;  2VRR B;  4FUL A;  2GBM A;  4MGY E;  2BWF A;  2XK5 A;  1NBF C;  1XT9 B;  4WJO A;  5IA7 A;  3VAW A;  4HDO A;  2DX5 B;  2L00 B;  1WGG A;  4HCP B;  4II3 B;  4K81 A;  2M1M A;  4G3X B;  1WR6 E;  5AZH A;  2M4N A;  4F1S A;  3PRP B;  4E3C A;  1WH3 A;  4GSW A;  5J2R A;  1R4M I;  3K9P B;  2ZJD A;  3WAN A;  1J8C A;  2YLM A;  2L0T A;  1YX5 B;  2O6V B;  2CR5 A;  2ZEQ A;  4PS8 A;  2V3S A;  2PEA A;  2C7H A;  2C5L C;  4MGZ E;  2ZNV B;  1E5W A;  2KMC A;  4TKN A;  2BGF A;  4GDK B;  4MH0 E;  2EKE C;  5AZF A;  5G55 A;  3H7P B;  2BPS A;  3RT3 B;  1IPG A;  2G4D B;  2IY0 B;  4HCN B;  3LJ3 A;  2FIF A;  5DPT A;  4G11 A;  3B1L X;  3PRZ A;  2KZR A;  2Y5B B;  1SIF A;  3ZO5 B;  5KHQ A;  3H7S A;  3UQB A;  1YX6 B;  1UZX B;  1WJ6 A;  5L95 C;  4MDK E;  1I42 A;  2LXA A;  2KAN A;  4XC2 A;  1UGM A;  1WXS A;  3JVZ X;  5HKH A;  1TTN A;  3Q3J A;  3VH4 B;  4WWN A;  2RGF A;  1GC7 A;  4OVU A;  4I6L B;  2KKC A;  1WF9 A;  1V5T A;  3A1Q B;  2CU1 A;  1Z5S B;  1WR1 A;  2BYE A;  3L13 A;  4DK5 A;  2K8C A;  1OTR B;  1WMH A;  2FCQ A;  1E8Z A;  3ZVV A;  5D94 A;  3DBH I;  4FA6 A;  1VCB A;  1Y8R C;  3MTN B;  3ZKJ C;  3VQI A;  1V86 A;  4M8N A;  1IYF A;  2CHW A;  2J0M A;  4BKS A;  3PLU A;  2LJ5 A;  2AWT A;  4ANU A;  2MCN B;  4DWF A;  1V81 A;  4ZRI A;  3APD A;  4MSQ B;  2KVR A;  2KFK A;  4IWO A;  1QZE A;  3BIN A;  3DBS A;  2MBQ A;  2DZI A;  2KO3 A;  3ZRC A;  4W9C A;  4GN1 A;  2IO2 B;  4NAW B;  1VD2 A;  2KWC A;  1WX9 A;  3OAW A;  1U4A A;  2KX0 A;  4J6I A;  4WWO A;  2C7N B;  2IZV B;  3V6E B;  2N1W A;  3CSF A;  4G50 A;  4IW0 A;  4MM3 A;  2MLB A;  2KFJ A;  1ISN A;  3JYU A;  4BKT A;  4FBJ B;  5CHV C;  4FJZ A;  2NPT A;  5LXI B;  2LVQ A;  4KIK B;  4HLE A;  2K39 A;  2MBO A;  4KV2 A;  1X1M A;  1OEY A;  2KN5 A;  3ENE A;  4OVV A;  2N9X A;  5E6P A;  5DPR A;  2D2Q A;  2NR2 A;  2W9N A;  3VTV A;  2M17 A;  5LLI A;  2XK5 B;  3IBE A;  3VTW A;  3BY4 B;  4RM8 A;  4ANX A;  4DXA B;  5TR5 A;  4NPN A;  1C1Y B;  4DHZ E;  3SDL C;  3TMP B;  4ASW C;  1XQQ A;  1LXD A;  4PS3 A;  3APF A;  4JQW C;  3RZF A;  1Q5W B;  1P1A A;  4HPL B;  1UEL A;  1WJ4 A;  1WXA A;  3SU8 X;  2LXC A;  1Q0W B;  3IVF A;  1WXM A;  5LXH A;  3HM6 X;  2HD5 B;  2AL3 A;  4HK2 A;  3PTF C;  3HK0 A;  1V9J A;  1EO6 A;  3EHV A;  4X57 B;  4A3P A;  4F7Z A;  4DBG A;  2ZVO A;  2GBK A;  3L54 A;  4ICV A;  3PZD A;  2G45 B;  3R7R A;  2MBE A;  2JRH A;  2KJR A;  1WGH A;  3APC A;  4I6P A;  2ZCC A;  3GZN I;  1KM7 A;  2IO3 B;  1WXV A;  3N3K B;  2NVU I;  3A4S C;  3HM3 A;  3QX1 A;  1WFY A;  1WM2 A;  2K1F A;  2MBB B;  2JF5 A;  3M62 B;  4GU2 A;  1Q1O A;  2LGY A;  2DYM A;  2WYQ A;  4ZRJ A;  3R66 C;  3SHQ A;  3T9L A;  1L2N A;  4XX5 A;  1EF5 A;  2KQ7 A;  3N30 A;  4DDG D;  2JZ3 B;  4FN2 A;  3L17 A;  4K1R B;  2FCN A;  3QK0 A;  4RM9 A;  4WQO B;  4KZC A;  3RUI B;  1E8W A;  3ML9 A;  4CYE A;  2DZJ A;  3ZUN A;  1WMH B;  2JY6 A;  4MEM A;  4NNJ B;  4W9H A;  1RLF A;  2MBH A;  2FAZ A;  4FLH A;  4GOC A;  2KDB A;  3PT2 B;  3DDC B;  4IM0 A;  1WX8 A;  2ZCB A;  4TQ1 A;  4W9J A;  2WWZ A;  4WWP A;  1YJ1 A;  1UBQ A;  3TIX A;  2HTH A;  2MA9 B;  2YVC A;  3IHP C;  3UIP B;  5JHA A;  2KFK B;  5C23 A;  5DPW A;  5IAA C;  2ZNV C;  3VTU A;  4EOY A;  2DEN B;  5DCN A;  2HJ8 A;  2GBR A;  2MSE D;  3I3T B;  2J0K A;  1PQS A;  1GG3 A;  1TZ1 A;  2CKH B;  2R2Q A;  2REX A;  2AEH A;  3P2B A;  4NQL B;  2KWU B;  4P7I A;  4FAD A;  2KC1 A;  3QCA A;  1LFD A;  2ASQ A;  2PPH A;  3K9O B;  3U8Z A;  2LVP A;  2PE9 A;  2G3Q B;  2Z0D B;  3EFU A;  3H1U A;  3B0A A;  5D7G A;  4TV3 A;  2KX3 A;  2NPT B;  3VH3 B;  2DYO A;  3JSV A;  1I35 A;  1KJT A;  2N7D A;  3NZU A;  4M8M A;  5AEK B;  3W1S A;  5JH5 C;  5E6O A;  5JHB A;  1WZ3 A;  1L7Y A;  4K7W A;  2LVO A;  4EEW A;  1V5O A;  1WX7 A;  2IYD B;  2KDE B;  2WX1 A;  4CHK A;  1H8C A;  3NY5 A;  4G0N B;  2FCS A;  3DBR I;  3RZW C;  2WDT B;  2KMA A;  4EFO A;  4BKS D;  3OJ3 A;  4LJO B;  3AU5 A;  3H6N A;  3CST A;  4NJ7 A;  4GMV A;  1WYW B;  5KHO A;  2MW5 A;  3R3M A;  1UH6 A;  1GJZ A;  4ICU A;  3V62 A;  2RD0 A;  4FJV B;  1V6E A;  3CMM B;  3QQ8 B;  2O2V A;  3MJW A;  5J18 A;  4EZK A;  3KUD B;  3QAR A;  1WGY A;  3QHT A;  2WX0 A;  3ZW3 A;  4ANV A;  2EMT A;  2DAF A;  2I1J A;  4ZRK A;  2FNJ B;  2IBI B;  2LD9 A;  3QA8 A;  4LJP B;  4EZJ A;  3Q3F A;  1BT0 A;  1YD8 U;  4M0W B;  1WM3 A;  1TGZ B;  1CMX B;  3WAP A;  5G2N A;  4ZDV A;  2BWE S;  3U7D A;  1KOT A;  2K6D B;  4IG7 B;  2LZ6 A;  4RMA A;  3ZDM C;  3QIJ A;  3O65 B;  4GDL A;  4N9F 4;  2I1K A;  4ZYN A;  5EDS A;  2AYO B;  2DZM A;  2CHZ A;  3DVG Y;  2MX2 A;  3A4R A;  1HE8 A;  4W9I A;  3VUW A;  3L08 A;  3L10 B;  4IWP A;  5J17 A;  4W9L A;  1ZKH A;  4NQK E;  2NBW B;  3N32 A;  4GB9 A;  4HJK A;  2D07 B;  4EUT A;  2LRW A;  4BKG A;  4JLC A;  2Z0E B;  1NI2 A;  2V4L A;  2JRI B;  3VFK A;  4IC7 B;  3PLV A;  3DCG A;  2A4Z A;  1Z2M A;  2MRP A;  3AU4 A;  2FID A;  2ZPY A;  2LWP A;  2C7M B;  1E7V A;  4BBN F; 
#chains in the Genus database with same CATH topology
 3BWU D;  2QCZ A;  4FJY A;  3MP9 A;  2SAK A;  3U30 A;  1JRO A;  1UWM A;  2L83 A;  4KDI C;  2NBV B;  2JPH A;  2K9X A;  2X38 A;  4GIV A;  3R8B A;  3QAQ A;  1WE6 A;  1JWU D;  2B3A A;  2HE7 A;  2LGI A;  2RDB C;  1FFU A;  4B95 A;  4W9E A;  1M94 A;  2DYB A;  4DXF A;  5BYR A;  1OGW A;  2FBW B;  3NS8 A;  1R7S A;  2ZVN A;  1ZGU B;  4YL8 A;  2QHO A;  3ZJU A;  2J0J A;  3ML8 A;  3ZNH B;  3FIL B;  1SBB B;  2KK8 A;  4EKU A;  3I57 A;  1K50 A;  4WWM A;  3RN9 C;  3EC8 A;  4LDT D;  3ZTD A;  4BFR A;  4MSM B;  2KWV B;  3P4S B;  5FK9 C;  3PVL A;  1QOA A;  2WXM A;  4JPS A;  4W9K A;  1DOI A;  1MHH E;  3LYY A;  1OQR A;  3R2T A;  3HIZ A;  3MHZ A;  4N59 A;  2PKO A;  3N1X C;  4LCD E;  2K8H A;  3M3J A;  1YQ3 B;  2WXJ A;  2J7Q B;  4IWQ A;  3V61 A;  3LDZ E;  3X0W A;  3AE8 B;  3KUZ A;  4AJY B;  3AUL A;  1HZ5 A;  3WIM A;  4K7S A;  4WJP A;  1SSN A;  1R4N I;  2KWD A;  3T8M A;  1V8C A;  1D3Z A;  1XCT L;  2WDV B;  3AI5 A;  5D6J B;  4MJS B;  1J0G A;  2WDR B;  1SE9 A;  3ZDT A;  1WE7 A;  4EZL A;  2D11 A;  4R3D A;  1TY2 A;  4UDU C;  3SR6 A;  4II2 B;  1LM8 B;  2WXP A;  3VR8 B;  4MEL A;  2UU7 A;  4HDQ A;  4XGA B;  2L0F A;  2J42 A;  3JW0 X;  4B6W A;  3H7P A;  3QC8 B;  3MFG A;  3KLS X;  1KRH A;  4US8 A;  2AQ2 B;  3ABV B;  4NJC A;  4JWU C;  1HTQ A;  1J7A A;  3RNF C;  4ZRQ A;  2JYT A;  3C19 A;  5IO9 A;  3SFD B;  4MT5 A;  1XCQ L;  2UWQ A;  2LAS A;  3W5V B;  5BO4 B;  3A9J B;  1GC6 A;  3S2A A;  4AOF A;  3VXW A;  4FHJ A;  2KLC A;  1P98 A;  3SD5 A;  1V49 A;  3ZNZ B;  1N5W A;  5E6J A;  2JZZ A;  2Z59 B;  2EKI A;  3DHH C;  1L6U A;  4NAW A;  2GMI C;  2LUE A;  1WIA A;  2ZPN A;  2EMS A;  1EM7 A;  2DHZ A;  2E3T A;  5I4D A;  3CWI A;  1TS4 A;  1VRA B;  2N9P C;  3IG3 A;  4S17 A;  4W9D A;  1TS2 A;  3AEE B;  2BTE A;  4KIK A;  2JXX A;  3AXC A;  4DHJ B;  2KMM A;  4GXB A;  3H9D A;  2MWS B;  1WI0 A;  2MHJ A;  2GBM A;  2XK5 A;  1NBF C;  1QOG A;  1I4P A;  3GE8 C;  4HCP B;  4K81 A;  2M4N A;  4E3C A;  1FD6 A;  3Q8C A;  4B0M A;  3IT4 B;  5EE1 A;  3K9P B;  2ZJD A;  2YLM A;  2WXQ A;  1WSP A;  2CR5 A;  1NEK B;  2WLB A;  3DWG C;  2ZNV B;  4HKZ E;  3NVZ A;  4P1C C;  4GDK B;  1N5X A;  2B76 B;  4MH0 E;  1J7B A;  2IY0 B;  4YTM B;  2RDG A;  4G11 A;  2Y5B B;  1K53 A;  3ZO5 B;  1UF0 A;  3UQB A;  3KQ4 A;  1I42 A;  2LXA A;  2WU5 B;  4YSX B;  1TTN A;  3VH4 B;  2RGF A;  4I6L B;  2ACZ B;  4AS1 A;  3P4R B;  2BYE A;  3DBH I;  4FA6 A;  1Y8R C;  1PYW D;  3ZKJ C;  2GB1 A;  1D6E C;  4M8N A;  1IYF A;  3BVZ A;  1F52 A;  1ZUD 2;  2LJ5 A;  4ANU A;  2MCN B;  4DWF A;  4ZRI A;  2H89 B;  1QOB A;  1YN4 A;  4MSQ B;  3GE3 C;  1I4H A;  2L1A A;  2MBQ A;  4GN1 A;  1VD2 A;  3H8H A;  2GRI A;  2TSS A;  4J6I A;  2IZV B;  4MM3 A;  3JYU A;  2AQ3 B;  4FBJ B;  5CHV C;  4FJZ A;  2NPT A;  5LXI B;  4C00 A;  4HLE A;  4HKQ A;  1OEY A;  3ENE A;  5E6P A;  3VTV A;  2D2Q A;  1DOY A;  4DXA B;  3BY4 B;  4DHZ E;  4ASW C;  4PS3 A;  4JQW C;  2PW9 A;  1JWM D;  1P1A A;  3SU8 X;  1VJK A;  2BBC A;  1WXM A;  2HD5 B;  1ZE3 D;  4HK2 A;  3PTF C;  3HK0 A;  2ZVO A;  2G45 B;  2DLB A;  4J3O D;  2JRH A;  4OZA A;  2KJR A;  1L5P A;  2ZCC A;  2IO3 B;  1MI0 A;  2NVU I;  3HM3 A;  3EGR A;  4M0W A;  3RI7 C;  2K1F A;  2JF5 A;  2PMV A;  2K22 A;  2INP E;  3R66 C;  3T9L A;  1L2N A;  2KQ7 A;  4FN2 A;  3QK0 A;  4RM9 A;  1E9M A;  4KZC A;  1E8W A;  4XYC A;  3ML9 A;  4CYE A;  1MG4 A;  3ZUN A;  1WMH B;  2JY6 A;  2MBH A;  2FAZ A;  1FFV A;  3PT2 B;  4USA A;  3DDC B;  4IM0 A;  1WX8 A;  4TQ1 A;  2WWZ A;  2KFK B;  2XN9 C;  3RMK C;  5DCN A;  2HJ8 A;  1PQS A;  2R2Q A;  4AJW A;  3P2B A;  1FXI A;  3QCA A;  2ASQ A;  3U8Z A;  1ZPS A;  2IPK D;  2G3Q B;  3E56 A;  3Q3M C;  1WWT A;  4TV3 A;  4LLG M;  1F2R C;  2DYO A;  1STE A;  2PIA A;  1KLG D;  3AH7 A;  3JSV A;  3NZU A;  2QMT A;  1V5O A;  3N1Y C;  1H8C A;  2GLS A;  1YN5 A;  2PTL A;  1BUI C;  1SJE D;  1TZO A;  2FUG 1;  2IND C;  2WDT B;  2KMA A;  3NRZ A;  3OJ3 A;  3AU5 A;  3O13 A;  3CST A;  3DBH B;  1WYW B;  1GJZ A;  1KH0 A;  4DXG A;  3CMM B;  3QQ8 B;  4JE3 B;  2W3S A;  3RFZ B;  1ET9 A;  2YEP B;  1UUP A;  4ANV A;  3FKY A;  2I1J A;  4KX6 B;  1VDV A;  4LJP B;  3NZ3 A;  4H2A A;  2WU2 B;  3U7D A;  3QIJ A;  4GDL A;  2I1K A;  2DZM A;  1CQV A;  1HE8 A;  3VUW A;  3L10 B;  5T8I A;  4W9L A;  1QT9 A;  4GB9 A;  2LRW A;  4BKG A;  4XE0 A;  4JLC A;  2Z0E B;  5HI1 A;  3VFK A;  4IC7 B;  3DCG A;  2A4Z A;  5FR3 A;  1E10 A;  2MRP A;  2FID A;  2IGD A;  3AE2 B;  3N1Z C;  4BBN F;  4I6N B;  4JIO U;  2JT4 B;  2KDI A;  4O1N A;  1G6J A;  1TS3 A;  2R2O A;  2J52 A;  4NY0 A;  5D3D A;  4HPM B;  3VUY A;  2KDF B;  2VH1 A;  5HHD G;  3W5U B;  3ZTC A;  2KTR A;  1S1Q B;  5AZG A;  2WXL A;  1TIF A;  4N6E B;  1WGR A;  2RMM A;  3RCZ A;  3P1M A;  4NJ6 A;  4MGK E;  3M63 B;  3IFW B;  4AUQ C;  2WDQ B;  2L05 A;  4Q2J A;  3TUO A;  1D4B A;  2LI5 A;  4W9F A;  2N7E A;  5JZE B;  4WH4 A;  4B9K A;  1YQB A;  1SXT A;  3WAL A;  2WGS A;  1NDD A;  4A8X C;  3UF8 A;  3W2D A;  1ZP0 B;  1V1P B;  1XXG A;  2GBJ A;  2DZK A;  5GMV A;  4F8C B;  3OWE B;  1IBX A;  3MHS D;  1L0V B;  1EU4 A;  3AE4 B;  3PPA A;  1IUE A;  1C4C A;  1SGH A;  5L83 A;  1MVK A;  1IP9 A;  2MH7 A;  2OJR A;  2BF8 B;  2KLG A;  5E6N A;  5IN7 A;  2QEJ C;  3L4P A;  2BQQ A;  2H88 B;  2KAJ A;  2N9E B;  3ZNG C;  1F9J A;  3DWM A;  2MP2 A;  3AB5 A;  3A9K A;  4K3C A;  4CO7 A;  1FEH A;  3AE5 B;  2V3N A;  3NJT A;  4DHJ D;  1EF1 A;  4IM3 A;  4TQ0 A;  4HPP A;  5CTR C;  3V60 A;  2CHX A;  3ZJT A;  1CK1 A;  2K8B A;  1NYQ A;  4RGN A;  3RNE C;  2HJ1 A;  1E8Y A;  2KJH B;  4WIP A;  2AL6 A;  1T0Y A;  2IY1 B;  4BOS C;  1DGJ A;  3NVW A;  3AEF B;  3DVN U;  2ONQ A;  1C3T A;  1P3Q U;  2IO1 B;  4A90 A;  2RPQ A;  4K7U A;  2GOW A;  4HRO A;  1VZ8 A;  3PRM B;  1IGD A;  2DAJ A;  2BKF A;  1L4D B;  1K52 A;  4LTU A;  1DYQ A;  2BYF A;  3IAS 1;  3W1Y A;  3B2G A;  4RF1 A;  2IO0 B;  5CHF A;  3R7Q A;  1FCL A;  2D10 A;  3U7Z A;  2C9W B;  3UIN B;  3A1Q A;  2L8J A;  1XD3 B;  2KAC A;  2WXI A;  3ZIM A;  1JRP A;  1ZXH A;  3KUC B;  3KYC D;  1YIW A;  4L2Y A;  4AP4 C;  4P6V F;  1EU3 A;  1TKY A;  2I38 A;  1L6V A;  5D2M B;  2LFI A;  5FR6 A;  1N6Z A;  3TCA A;  3ZJV A;  4ACF A;  2N1V A;  1KLV A;  3GS2 A;  5CHW A;  3OLM D;  2CU3 A;  3D32 A;  4RGM A;  4HVB A;  2LGD A;  1FM0 D;  3T3O A;  3UQA A;  3VVW B;  4DDI D;  1N63 A;  1EWY C;  1RRB A;  4AQ7 A;  4IM2 A;  2VRR B;  5IA7 A;  4WJO A;  3VAW A;  4HDO A;  5D3I B;  2L00 B;  1JW9 D;  4II3 B;  2M56 B;  1C79 A;  3P4Q B;  1WR6 E;  4G3X B;  4F1S A;  3PRP B;  2J4X A;  2N7J A;  2INC C;  2L0T A;  1PGB A;  2O6V B;  2V3S A;  2PEA A;  4P16 A;  2C7H A;  2C5L C;  2KN4 A;  1ENF A;  4RGO S;  3TSS A;  1C77 A;  1XF5 L;  5G55 A;  3FAH A;  4TMA B;  3PRZ A;  2KZR A;  1RYJ A;  2KAN A;  3JVZ X;  1YNT E;  1N60 A;  5MPO A;  4WWN A;  3WCQ A;  2KKC A;  2JSV X;  1E6E B;  1UGJ A;  3CIR B;  1Z5S B;  2FCQ A;  2VZK B;  3ZVV A;  1V86 A;  2N9L A;  2PVG C;  1NI3 A;  4XDD A;  2QIE B;  3HUI A;  4WUR A;  2NTT A;  1QZE A;  1HTO A;  2KO3 A;  3C8Y A;  2IO2 B;  2WHI A;  3OAW A;  1WX9 A;  4RH6 A;  4YXD B;  3V6E B;  3P42 A;  3CSF A;  2KFJ A;  3E9S A;  2KYW A;  2K39 A;  1X1M A;  2KN5 A;  2N9X A;  3V3X A;  4YTP B;  3MC0 B;  3N9Y C;  5DPR A;  2W9N A;  5LLI A;  1ZOY B;  3DHI C;  4ANX A;  3SDL C;  1LXD A;  3KWV A;  3RZF A;  2M19 A;  1Q5W B;  4HPL B;  1UEL A;  1WJ4 A;  1WXA A;  3DHG C;  2QIL A;  3EHV A;  4X57 B;  3AED B;  3BYT B;  2GBK A;  3PZD A;  3R7R A;  4HJG E;  3U52 E;  3APC A;  3GZN I;  3QX1 A;  3A4S C;  1Y56 A;  1AYF A;  1WFY A;  2IGH A;  3GP7 A;  4XWT A;  4GU2 A;  2WXH A;  4C4V B;  2LGS A;  2DYM A;  4ZRJ A;  4LNN A;  2LUM A;  4DDG D;  3ZQ4 A;  3L17 A;  1RWS A;  2Y3A A;  3RUI B;  3BZD B;  3Q3O C;  1PDX A;  2K0P A;  1L0X B;  3HVD A;  3ZXR A;  2ZCB A;  5BYS A;  2HTH A;  2MA9 B;  5JHA A;  3VTU A;  4GLS C;  2GBR A;  2MSE D;  2J0K A;  1UNS A;  2AEH A;  4FAD A;  4PT5 A;  1LGR A;  3K9O B;  2LVP A;  2Z0D B;  2YEP F;  5D7G A;  2WP9 B;  2KX3 A;  1R4N B;  2X8X X;  1I35 A;  4L1B A;  1KJT A;  2N7D A;  3OG5 A;  2DWQ A;  4K3B A;  5JHB A;  4YSZ B;  2W55 A;  1QLB B;  4RNA A;  4K7W A;  1WRI A;  4A6Q A;  1WX7 A;  4M02 A;  1ZXI A;  2FCS A;  3DBR I;  3RZW C;  3BK1 A;  2ON8 A;  3PZ7 A;  4LJO B;  4C7Y A;  1E0Z A;  3H6N A;  1XLP A;  5TSS A;  5KHO A;  4ICU A;  3V62 A;  3FIL A;  4WAF A;  2KDM A;  4FJV B;  3U2S C;  1V6E A;  2HTM E;  4EZK A;  3I63 C;  2D3B A;  2INN E;  2EMT A;  1D5Z C;  4ZRK A;  2LD9 A;  2WQY B;  1BT0 A;  3WAP A;  2K6D B;  4L23 A;  2LZ6 A;  4RMA A;  2OJW A;  2JQR B;  1VLB A;  1SEB D;  2CHZ A;  2MX2 A;  3A4R A;  1C76 A;  3J9C A;  4W9I A;  2KQ4 X;  3N32 A;  1FMA D;  2V4L A;  2ZPY A;  2LEK A;  2C7M B;  1Q10 A;  5EE3 A;  2CJN A;  4IUM B;  3PHW B;  4LDT B;  4MJS A;  5FKA C;  3WAO A;  2G9H D;  4MGI E;  2BKR B;  2C60 A;  4FHK A;  2DBY A;  3Q69 A;  2BYV E;  2LRU A;  3T3N A;  3GZN B;  1FIQ A;  3W1S C;  4KZ0 A;  2ZZP B;  3PRE A;  1V1O A;  2N9K A;  3GB1 A;  2A5U A;  2WXF A;  2L52 A;  4BZA A;  2NCN A;  5GXG B;  1BML C;  2ZW0 A;  3DQV A;  3QWZ B;  3OJ4 B;  4C56 C;  2JWZ A;  2HDE A;  2XBB C;  1TBE A;  1C4A A;  2MEK A;  4AWJ A;  1AAR A;  1L0Y B;  1DOX A;  2O2V B;  3RPF C;  4ZYS A;  4XZ4 A;  1TS5 A;  4PYU A;  3KW5 B;  3Q6B A;  5AUI A;  2FE8 A;  4REZ A;  1CJE A;  2MJ3 A;  2BS3 B;  1JWS D;  2K6Q A;  2WNM A;  3HHM A;  3A9J A;  1JWA D;  3GOE A;  1E90 A;  1OEY J;  2BYT A;  4BVU C;  5LNK 1;  2QSD A;  2JWU A;  1FPY A;  2W3R A;  2M8S A;  3VUX A;  4HXD A;  1WJU A;  4KSL C;  3DBR B;  3TEY A;  4KKJ A;  3AMZ A;  4JGH B;  3EFC A;  2Y5C A;  3ZYY X;  3DBL I;  1P9D U;  2PJH A;  1SJH D;  3AE3 B;  2KNB A;  1KTK A;  2WXO A;  2NBU A;  3RD2 A;  1E7P B;  4NZL B;  1WXQ A;  3Q8F A;  1T0Q C;  3R2I A;  5EE9 A;  2FUH B;  3AE7 B;  3MC8 A;  1I7H A;  3ONS A;  5CX3 A;  2KT7 A;  2XEW A;  2O6V D;  3B2F A;  3PV1 A;  1ESF A;  2BS2 B;  3ZLZ A;  2FCM A;  4PS7 A;  2KTF A;  4JX1 C;  2QJL A;  1EUV B;  2ZW1 A;  1FNV A;  4GDK A;  3HVZ A;  2PVO D;  4WAA A;  4M00 A;  3Q3N C;  1XO3 A;  2UYZ B;  2KHW B;  3UI3 A;  4PK1 A;  2KXJ A;  4URK A;  3KWL A;  4KGR A;  1BXT A;  2D3G A;  4EE2 A;  2CS4 A;  2D3A A;  5C3J B;  2L7R A;  2M0X A;  2Z8L A;  2VZK D;  5HFY A;  2MQJ A;  2N4F A;  4KSK C;  5IP4 D;  5H92 C;  1F0Z A;  1MG8 A;  4LNF A;  1GNU A;  5JXV A;  1OQQ A;  3DVG X;  3DOW A;  1WJN A;  3N20 C;  3NOB A;  3Q8B A;  1GAQ B;  4BBN C;  1YMH E;  1HEZ E;  4A3O A;  1H4R A;  4GGQ A;  1AWD A;  3RUL A;  4MAC A;  3IXS A;  2MJD A;  3PSE B;  2GBN A;  4W9G A;  2WXR A;  3AN1 A;  4JL9 A;  4RF0 A;  4MGY E;  4FUL A;  5BMI A;  1XT9 B;  2GI9 A;  4S0R A;  1JCK B;  1OFF A;  5AZH A;  3EA6 A;  4GSW A;  1GB4 A;  1R4M I;  1J8C A;  4ITK A;  1YX5 B;  3Q2A C;  2KMC A;  1D5X C;  2EKE C;  5AZF A;  3H7P B;  3RT3 B;  1IPG A;  2G4D B;  2FIF A;  5DPT A;  3B1L X;  2AQ1 B;  3TEZ A;  1UZX B;  5L95 C;  2EEL A;  3SEB A;  1UGM A;  1WXS A;  2V4I B;  4KGT A;  1WF9 A;  1P7F A;  1V5T A;  2CJO A;  3L13 A;  4DK5 A;  1I4Q A;  1JWB D;  1OTR B;  1WMH A;  5D94 A;  1J7C A;  2J0M A;  3IAM 1;  2AWT A;  5AUK A;  1V97 A;  2KFK A;  4IWO A;  3DBS A;  2DZI A;  4NAW B;  2KWC A;  3I5J C;  1U4A A;  2KX0 A;  3BII D;  2K5P A;  2N1W A;  4C80 A;  1M4V A;  2MLB A;  4BKT A;  1ISN A;  4WQM A;  1NVI D;  2LVQ A;  4KIK B;  2MBO A;  1ZDV A;  2XK5 B;  4RM8 A;  4NPN A;  1HZ6 A;  3TMP B;  1QF6 A;  1XQQ A;  1Q0W B;  4DQO C;  3ETR A;  1V9J A;  1EO6 A;  4F7Z A;  1NYR A;  1CZP A;  1HXY D;  3LB8 C;  3L54 A;  1C9F A;  1WGH A;  2V9H A;  4I6P A;  3N3K B;  1WXV A;  5C2T B;  1WM2 A;  2MBB B;  3M62 B;  1Q1O A;  2LGY A;  2WYQ A;  2K3U A;  4LNO A;  4XX5 A;  1EF5 A;  3N30 A;  4K1R B;  4ZRP A;  2FCN A;  4WQO B;  2WXK A;  4OVZ A;  3PO0 A;  4MEM A;  4MH8 A;  4W9J A;  4RGT A;  4WWP A;  3IHP C;  2YVC A;  5C23 A;  5DPW A;  1MFW A;  1R4M B;  2ZNV C;  3AEG B;  2BVC A;  4EOY A;  1T0R C;  3AM9 A;  4ZHP A;  4US9 A;  2CKH B;  4NQL B;  1TZ1 A;  3ZRC A;  2WXG A;  1LFD A;  2PE9 A;  3EFU A;  1YJJ A;  3H1U A;  3B0A A;  4MM3 B;  4C7Z A;  2NPT B;  1D5M C;  1PGX A;  4M8M A;  3W1S A;  5JH5 C;  2BB6 A;  5G5H A;  1VZ6 A;  2LVO A;  3MC9 A;  2KDE B;  2IYD B;  2WX1 A;  4CHK A;  1B1Z A;  5BMH A;  3TEW A;  1GPX A;  4NJ7 A;  3AEA B;  2MW5 A;  1UH6 A;  2W82 A;  3W9C B;  2L32 A;  2RD0 A;  1T6B X;  1VZ7 A;  3PZ8 A;  1ROE A;  1T5X D;  2D5G A;  5J18 A;  1XLN A;  3BVG A;  2WXN A;  3QAR A;  4ZHO A;  1FXA A;  1IGC A;  3QHT A;  5BYQ A;  4YT0 B;  1V1P A;  4OW0 A;  2BB5 A;  1F1H A;  2FNJ B;  4EZJ A;  4M0W B;  1WM3 A;  1CMX B;  4ZDV A;  5HG2 A;  1KOT A;  4IG7 B;  4N9F 4;  3O65 B;  1PFD A;  5EDS A;  4QAY A;  1P7E A;  3RNA C;  4IWP A;  5J17 A;  3TEX A;  1ZKH A;  4NQK E;  3NUH B;  4HJK A;  2D07 B;  4EUT A;  2J53 A;  1NI2 A;  3PLV A;  2IDY A;  3AU4 A;  2KVZ A;  2LWP A;  2BT6 A;  1TJE A;  1E7V A;  1C78 A;  1EWC A;  1ZW7 A;  3Q8E A;  4M01 A;  1FO4 A;  1FRD A;  1GOZ A;  2JXT A;  3AE1 B;  1SE2 A;  2G4S A;  4JWS C;  5EE0 A;  3KYD D;  2K25 A;  3JSV B;  1E8X A;  2QC8 A;  1WY8 A;  1WGD A;  3AE6 B;  4OZB A;  4HRS A;  4PYZ A;  1KFY B;  3Q8A A;  2L76 A;  1RAX A;  4ANW A;  1J19 A;  3DVN V;  3TJP A;  3IT6 B;  3NZS A;  1UBI A;  3VRB B;  3UIO B;  1P0R A;  2ICI A;  1SE3 A;  1A5R A;  2RR9 A;  5C1Z A;  1FCC C;  3KVF B;  3LXF A;  2BW2 A;  2RDH A;  4YSY B;  1HQR D;  3QJZ A;  3B08 A;  3WA0 A;  1RFA A;  1TKE A;  3BVM A;  4GDL B;  4E71 A;  3KH0 A;  1UD7 A;  4XWW A;  1FNU A;  1LO5 D;  2LGX A;  1YN3 A;  1MJD A;  3RNC C;  1LQB A;  2RSU A;  4D2K A;  2KOX A;  1WZ0 A;  1N62 A;  1C4P A;  4DHZ B;  3ALB A;  1F77 A;  3L0W B;  2V3P A;  3VHT C;  4HWI B;  1V80 A;  1KF6 B;  3X23 A;  1OQY A;  3SFE B;  3VDZ A;  4LK0 M;  2VH2 A;  1K8R B;  4A20 A;  1QOF A;  2OED A;  1V2Y A;  3M95 A;  2KTR B;  1I4X A;  2IGG A;  4E74 A;  4TUU A;  4KDL B;  4IOI E;  2L3Z A;  3ZRF A;  2V0G A;  4ARC A;  3DPD A;  3RNB C;  4A55 A;  3B9J A;  3PHX B;  3ECI A;  2O6V A;  2KC2 A;  1PUT A;  4KVG B;  1TT5 B;  3VR9 B;  3AE9 B;  4KKI A;  4BOZ B;  3PGE A;  4ZOH C;  2V1Y A;  3NVY A;  2MJE A;  3V6C B;  2PE6 B;  4OZC A;  4WJQ A;  2KJ6 A;  1PGA A;  3L16 A;  1FXT B;  1JRU A;  3AEB B;  5DPS A;  2KQS A;  1NEN B;  1IBX B;  2LHE A;  1S3S G;  3ZNI D;  3CF6 E;  3RYT A;  2PLP A;  1XLO A;  3A33 B;  4YWG G;  2JZP A;  3PS6 A;  2E6X A;  1ACC A;  3TBL D;  3TL5 A;  1YOV B;  3NG0 A;  2NS5 A;  4WJN A;  1K51 A;  3EEC A;  4N58 A;  1E7U A;  2JVC A;  1T0S C;  2MP2 B;  3A9K B;  5BMG A;  1GUA B;  2LHD A;  4LNK A;  2LMC A;  3NHE B;  1A70 A;  1WRD B;  2JUO A;  2OOB B;  3NVV A;  3C0R B;  1QKZ A;  3UGB B;  2KD0 A;  5G5G A;  3AEC B;  2BWF A;  2DX5 B;  1WGG A;  2JYE A;  2M1M A;  2BS4 B;  1WH3 A;  1FNW A;  5J2R A;  3WAN A;  4PS8 A;  2ZEQ A;  4IKG A;  5IOI A;  4MGZ E;  1E5W A;  4TKN A;  2BGF A;  2M0A A;  1RM6 C;  3Q14 C;  1XLQ A;  2BPS A;  4HCN B;  3LJ3 A;  4B0E A;  1HA5 A;  1SIF A;  5KHQ A;  3H7S A;  1YX6 B;  1WYG A;  1WJ6 A;  4MDK E;  4XC2 A;  2NTS A;  4C4V A;  5HKH A;  1F2R I;  3Q3J A;  1GC7 A;  2SEB D;  4OVU A;  4YTN B;  4P1B C;  3A1Q B;  3MJ5 A;  2CU1 A;  5IKC M;  1WR1 A;  1QQR A;  2K8C A;  3EUB 2;  1E8Z A;  1MHX A;  2OHF A;  1VCB A;  3MTN B;  3VQI A;  1AW7 A;  3URY A;  2CHW A;  4BKS A;  3PLU A;  1V81 A;  3APD A;  2KVR A;  3BIN A;  2W54 A;  4W9C A;  4BAX A;  1YJI A;  1B9R A;  1SIJ A;  3I9V 1;  4WWO A;  3ZXV A;  2C7N B;  2QDF A;  1XEE A;  4G50 A;  4IW0 A;  1SB3 C;  4KV2 A;  1TY0 A;  4OVV A;  3BYY B;  2NR2 A;  4HEA 1;  3AV8 A;  2M17 A;  3IBE A;  3VTW A;  5TR5 A;  1C1Y B;  1GB1 A;  3APF A;  1MPE A;  2LXC A;  1I4G A;  2IJ0 A;  3IVF A;  5LXH A;  4A9A A;  2JU6 X;  3HM6 X;  2AL3 A;  4A3P A;  4DBG A;  5H8Y E;  3NS1 A;  4ICV A;  2MBE A;  2NMQ A;  2WS3 B;  1KM7 A;  4FXC A;  3HRD D;  3SHQ A;  1SF0 A;  2JZ3 B;  2Y5P A;  2XNA C;  2Q5W D;  2DZJ A;  1N61 A;  3P4P B;  4RCO A;  4NNJ B;  1QIL A;  1UWX A;  4W9H A;  1RLF A;  2G1E A;  4FLH A;  4GOC A;  2KDB A;  4OHJ A;  2JX5 A;  4XDC A;  1YJ1 A;  1UBQ A;  3TIX A;  3V05 A;  3UIP B;  1I4R A;  5IAA C;  2DEN B;  3BK2 A;  3I3T B;  2REX A;  3WAM A;  1GG3 A;  4P7I A;  4IDI A;  2KWU B;  2I2Y A;  2KC1 A;  1L4Z B;  1TYG B;  2AX5 A;  2PPH A;  1JQ4 A;  3VH3 B;  3DBL B;  1T3Q A;  5AEK B;  5E6O A;  3VRA B;  1WZ3 A;  1L7Y A;  1TKG A;  4TSS A;  4EEW A;  2LJI A;  2D3C A;  3NY5 A;  4G0N B;  4EFO A;  4BKS D;  1FRR A;  4GMV A;  4CQN A;  3R3M A;  2O2V A;  3MJW A;  1AN8 A;  3KUD B;  1SE4 A;  1WGY A;  1WGK A;  2WX0 A;  3ZW3 A;  4ARI A;  2DAF A;  3RNG C;  2R61 A;  2IBI B;  3QA8 A;  3Q3F A;  1YD8 U;  1TGZ B;  1YQ4 B;  5G2N A;  1JML A;  2BWE S;  1ZDX A;  3ZDM C;  4ZYN A;  1KLU D;  4KGS A;  2AYO B;  3ZGZ A;  3DVG Y;  3L08 A;  2N0S B;  3U4E G;  2NBW B;  4RFB A;  2JRI B;  2DNF A;  1JAL A;  1RFK A;  1Z2M A;  3FC4 A;  4LNI A;  1ET6 A;  3P63 A;  1VR9 A;  2RPV A;  4NAM A; 
#chains in the Genus database with same CATH homology
 4I6N B;  4JIO U;  4FJY A;  1ZW7 A;  2JT4 B;  2KDI A;  4IUM B;  3PHW B;  4LDT B;  4MJS A;  3WAO A;  3U30 A;  1G6J A;  2R2O A;  4MGI E;  4KDI C;  2BKR B;  2C60 A;  2NBV B;  2JPH A;  4HPM B;  4NY0 A;  3VUY A;  2KDF B;  4FHK A;  4GIV A;  3ZTC A;  2BYV E;  2LRU A;  4AJW A;  3QAQ A;  2KTR A;  2G4S A;  3W1S C;  3KYD D;  4KZ0 A;  1WE6 A;  2K25 A;  2ZZP B;  1E8X A;  3JSV B;  3PRE A;  2B3A A;  1S1Q B;  1WY8 A;  5AZG A;  2HE7 A;  1WGD A;  4B95 A;  1WGR A;  4W9E A;  1M94 A;  2DYB A;  3RCZ A;  4PYZ A;  2A5U A;  4NJ6 A;  4MGK E;  2L76 A;  1RAX A;  3M63 B;  1OGW A;  4ANW A;  1J19 A;  2NCN A;  3DVN V;  3NS8 A;  3IFW B;  4AUQ C;  2L05 A;  3DQV A;  2ZVN A;  3OJ4 B;  1ZGU B;  3NZS A;  3QWZ B;  1UBI A;  3TJP A;  2JWZ A;  4YL8 A;  2LI5 A;  4W9F A;  2QHO A;  2XBB C;  3UIO B;  1P0R A;  2N7E A;  1TBE A;  1A5R A;  5JZE B;  2J0J A;  3ML8 A;  3ZNH B;  4AWJ A;  2RR9 A;  5C1Z A;  1AAR A;  3KVF B;  4B9K A;  1YQB A;  2KK8 A;  3WAL A;  4EKU A;  2O2V B;  1NDD A;  3EC8 A;  4LDT D;  3ZTD A;  3UF8 A;  4BFR A;  4XZ4 A;  4PYU A;  3KW5 B;  4MSM B;  2KWV B;  2GBJ A;  2DZK A;  3WAM A;  5GMV A;  3QJZ A;  4F8C B;  3MHS D;  3PVL A;  3B08 A;  3WA0 A;  4W9K A;  2K6Q A;  3PPA A;  1RFA A;  3HHM A;  1SGH A;  5L83 A;  3A9J A;  3HIZ A;  3GOE A;  4GDL B;  1IP9 A;  1E90 A;  1OEY J;  3KH0 A;  4E71 A;  1UD7 A;  2OJR A;  2BF8 B;  2KLG A;  5E6N A;  4LCD E;  2LGX A;  4BVU C;  2K8H A;  3M3J A;  1LQB A;  2J7Q B;  2RSU A;  4IWQ A;  3V61 A;  2M8S A;  3LDZ E;  3X0W A;  3VUX A;  2KOX A;  1WZ0 A;  1WJU A;  3KUZ A;  4HXD A;  4KSL C;  4AJY B;  3AUL A;  2N9E B;  3ZNG C;  4DHZ B;  4JGH B;  3ALB A;  3WIM A;  1F9J A;  3L0W B;  4K7S A;  4WJP A;  1R4N I;  2MP2 A;  3DBL I;  1P9D U;  3A9K A;  2PJH A;  3T8M A;  3VHT C;  4CO7 A;  4HWI B;  2KNB A;  1V80 A;  1D3Z A;  3X23 A;  1OQY A;  4DHJ D;  3AI5 A;  2NBU A;  1EF1 A;  5D6J B;  4IM3 A;  4MJS B;  3RD2 A;  3VDZ A;  1J0G A;  4TQ0 A;  1SE9 A;  1K8R B;  5CTR C;  4A20 A;  3ZDT A;  1WE7 A;  4EZL A;  3V60 A;  2CHX A;  2D11 A;  2K8B A;  2FUH B;  1V2Y A;  3M95 A;  2KTR B;  1E8Y A;  2KJH B;  2AL6 A;  4II2 B;  1T0Y A;  3ONS A;  5CX3 A;  1LM8 B;  4E74 A;  4TUU A;  4KDL B;  2IY1 B;  2XEW A;  2L3Z A;  3ZRF A;  4BOS C;  2O6V D;  3PV1 A;  4MEL A;  3DPD A;  3DVN U;  3ZLZ A;  1C3T A;  3PHX B;  3ECI A;  4HDQ A;  2FCM A;  4PS7 A;  1P3Q U;  2KC2 A;  2O6V A;  4KVG B;  2IO1 B;  2KTF A;  2RPQ A;  4K7U A;  2L0F A;  4BOZ B;  2GOW A;  1EUV B;  3PGE A;  2V1Y A;  3PRM B;  4GDK A;  3JW0 X;  4B6W A;  4WAA A;  3H7P A;  3QC8 B;  3V6C B;  2PE6 B;  2UYZ B;  2DAJ A;  2KHW B;  2BKF A;  2KXJ A;  4URK A;  4WJQ A;  2KJ6 A;  3L16 A;  2BYF A;  2D3G A;  1FXT B;  1JRU A;  3W1Y A;  5DPS A;  2CS4 A;  2KQS A;  2IO0 B;  2L7R A;  5CHF A;  3R7Q A;  2M0X A;  2D10 A;  2UWQ A;  2LAS A;  2C9W B;  3UIN B;  1S3S G;  2MQJ A;  3A1Q A;  3ZNI D;  3CF6 E;  3RYT A;  2L8J A;  5BO4 B;  2N4F A;  4KSK C;  3A9J B;  1XD3 B;  3A33 B;  1GC6 A;  3ZIM A;  3S2A A;  3KUC B;  1MG8 A;  3KYC D;  1YIW A;  3PS6 A;  1GNU A;  4AOF A;  4AP4 C;  3VXW A;  4FHJ A;  3DVG X;  3DOW A;  2KLC A;  3TBL D;  3TL5 A;  1P98 A;  4WJN A;  1V49 A;  2NS5 A;  5D2M B;  3SD5 A;  1WJN A;  3NOB A;  5FR6 A;  3ZNZ B;  2JZZ A;  2Z59 B;  4BBN C;  4NAW A;  2GMI C;  2LUE A;  1WIA A;  3EEC A;  3TCA A;  2ZPN A;  2EMS A;  1E7U A;  2DHZ A;  2JVC A;  2N1V A;  4A3O A;  1KLV A;  2MP2 B;  3A9K B;  1H4R A;  5CHW A;  3OLM D;  1GUA B;  2N9P C;  3D32 A;  3IG3 A;  4HVB A;  2LGD A;  4GGQ A;  4W9D A;  3NHE B;  3RUL A;  3UQA A;  3VVW B;  4DDI D;  1WRD B;  2JUO A;  2JXX A;  2OOB B;  3C0R B;  4KIK A;  3AXC A;  3PSE B;  1RRB A;  4DHJ B;  4GXB A;  3H9D A;  2MWS B;  1WI0 A;  2GBN A;  4W9G A;  3UGB B;  2KD0 A;  4JL9 A;  4IM2 A;  2VRR B;  4FUL A;  2GBM A;  4MGY E;  2BWF A;  2XK5 A;  1NBF C;  1XT9 B;  4WJO A;  5IA7 A;  3VAW A;  4HDO A;  2DX5 B;  2L00 B;  1WGG A;  4HCP B;  4II3 B;  4K81 A;  2M1M A;  4G3X B;  1WR6 E;  5AZH A;  2M4N A;  4F1S A;  3PRP B;  4E3C A;  1WH3 A;  4GSW A;  5J2R A;  1R4M I;  3K9P B;  2ZJD A;  3WAN A;  1J8C A;  2YLM A;  2L0T A;  1YX5 B;  2O6V B;  2CR5 A;  2ZEQ A;  4PS8 A;  2V3S A;  2PEA A;  2C7H A;  2C5L C;  4MGZ E;  2ZNV B;  1E5W A;  2KMC A;  4TKN A;  2BGF A;  4GDK B;  4MH0 E;  2EKE C;  5AZF A;  5G55 A;  3H7P B;  2BPS A;  3RT3 B;  1IPG A;  2G4D B;  2IY0 B;  4HCN B;  3LJ3 A;  2FIF A;  5DPT A;  4G11 A;  3B1L X;  3PRZ A;  2KZR A;  2Y5B B;  1SIF A;  3ZO5 B;  5KHQ A;  3H7S A;  3UQB A;  1YX6 B;  1UZX B;  1WJ6 A;  5L95 C;  4MDK E;  1I42 A;  2LXA A;  2KAN A;  4XC2 A;  1UGM A;  1WXS A;  3JVZ X;  5HKH A;  1TTN A;  3Q3J A;  3VH4 B;  4WWN A;  2RGF A;  1GC7 A;  4OVU A;  4I6L B;  2KKC A;  1WF9 A;  1V5T A;  3A1Q B;  2CU1 A;  1Z5S B;  1WR1 A;  2BYE A;  3L13 A;  4DK5 A;  2K8C A;  1OTR B;  1WMH A;  2FCQ A;  1E8Z A;  3ZVV A;  5D94 A;  3DBH I;  4FA6 A;  1VCB A;  1Y8R C;  3MTN B;  3ZKJ C;  3VQI A;  1V86 A;  4M8N A;  1IYF A;  2CHW A;  2J0M A;  4BKS A;  3PLU A;  2LJ5 A;  2AWT A;  4ANU A;  2MCN B;  4DWF A;  1V81 A;  4ZRI A;  3APD A;  4MSQ B;  2KVR A;  2KFK A;  4IWO A;  1QZE A;  3BIN A;  3DBS A;  2MBQ A;  2DZI A;  2KO3 A;  3ZRC A;  4W9C A;  4GN1 A;  2IO2 B;  4NAW B;  1VD2 A;  2KWC A;  1WX9 A;  3OAW A;  1U4A A;  2KX0 A;  4J6I A;  4WWO A;  2C7N B;  2IZV B;  3V6E B;  2N1W A;  3CSF A;  4G50 A;  4IW0 A;  4MM3 A;  2MLB A;  2KFJ A;  1ISN A;  3JYU A;  4BKT A;  4FBJ B;  5CHV C;  4FJZ A;  2NPT A;  5LXI B;  2LVQ A;  4KIK B;  4HLE A;  2K39 A;  2MBO A;  4KV2 A;  1X1M A;  1OEY A;  2KN5 A;  3ENE A;  4OVV A;  2N9X A;  5E6P A;  5DPR A;  2D2Q A;  2NR2 A;  2W9N A;  3VTV A;  2M17 A;  5LLI A;  2XK5 B;  3IBE A;  3VTW A;  3BY4 B;  4RM8 A;  4ANX A;  4DXA B;  5TR5 A;  4NPN A;  1C1Y B;  4DHZ E;  3SDL C;  3TMP B;  4ASW C;  1XQQ A;  1LXD A;  4PS3 A;  3APF A;  4JQW C;  3RZF A;  1Q5W B;  1P1A A;  4HPL B;  1UEL A;  1WJ4 A;  1WXA A;  3SU8 X;  2LXC A;  1Q0W B;  3IVF A;  1WXM A;  5LXH A;  3HM6 X;  2HD5 B;  2AL3 A;  4HK2 A;  3PTF C;  3HK0 A;  1V9J A;  1EO6 A;  3EHV A;  4X57 B;  4A3P A;  4F7Z A;  4DBG A;  2ZVO A;  2GBK A;  3L54 A;  4ICV A;  3PZD A;  2G45 B;  3R7R A;  2MBE A;  2JRH A;  2KJR A;  1WGH A;  3APC A;  4I6P A;  2ZCC A;  3GZN I;  1KM7 A;  2IO3 B;  1WXV A;  3N3K B;  2NVU I;  3A4S C;  3HM3 A;  3QX1 A;  1WFY A;  1WM2 A;  2K1F A;  2MBB B;  2JF5 A;  3M62 B;  4GU2 A;  1Q1O A;  2LGY A;  2DYM A;  2WYQ A;  4ZRJ A;  3R66 C;  3SHQ A;  3T9L A;  1L2N A;  4XX5 A;  1EF5 A;  2KQ7 A;  3N30 A;  4DDG D;  2JZ3 B;  4FN2 A;  3L17 A;  4K1R B;  2FCN A;  3QK0 A;  4RM9 A;  4WQO B;  4KZC A;  3RUI B;  1E8W A;  3ML9 A;  4CYE A;  2DZJ A;  3ZUN A;  1WMH B;  2JY6 A;  4MEM A;  4NNJ B;  4W9H A;  1RLF A;  2MBH A;  2FAZ A;  4FLH A;  4GOC A;  2KDB A;  3PT2 B;  3DDC B;  4IM0 A;  1WX8 A;  2ZCB A;  4TQ1 A;  4W9J A;  2WWZ A;  4WWP A;  1YJ1 A;  1UBQ A;  3TIX A;  2HTH A;  2MA9 B;  2YVC A;  3IHP C;  3UIP B;  5JHA A;  2KFK B;  5C23 A;  5DPW A;  5IAA C;  2ZNV C;  3VTU A;  4EOY A;  2DEN B;  5DCN A;  2HJ8 A;  2GBR A;  2MSE D;  3I3T B;  2J0K A;  1PQS A;  1GG3 A;  1TZ1 A;  2CKH B;  2R2Q A;  2REX A;  2AEH A;  3P2B A;  4NQL B;  2KWU B;  4P7I A;  4FAD A;  2KC1 A;  3QCA A;  1LFD A;  2ASQ A;  2PPH A;  3K9O B;  3U8Z A;  2LVP A;  2PE9 A;  2G3Q B;  2Z0D B;  3EFU A;  3H1U A;  3B0A A;  5D7G A;  4TV3 A;  2KX3 A;  2NPT B;  3VH3 B;  2DYO A;  3JSV A;  1I35 A;  1KJT A;  2N7D A;  3NZU A;  4M8M A;  5AEK B;  3W1S A;  5JH5 C;  5E6O A;  5JHB A;  1WZ3 A;  1L7Y A;  4K7W A;  2LVO A;  4EEW A;  1V5O A;  1WX7 A;  2IYD B;  2KDE B;  2WX1 A;  4CHK A;  1H8C A;  3NY5 A;  4G0N B;  2FCS A;  3DBR I;  3RZW C;  2WDT B;  2KMA A;  4EFO A;  4BKS D;  3OJ3 A;  4LJO B;  3AU5 A;  3H6N A;  3CST A;  4NJ7 A;  4GMV A;  1WYW B;  5KHO A;  2MW5 A;  3R3M A;  1UH6 A;  1GJZ A;  4ICU A;  3V62 A;  2RD0 A;  4FJV B;  1V6E A;  3CMM B;  3QQ8 B;  2O2V A;  3MJW A;  5J18 A;  4EZK A;  3KUD B;  3QAR A;  1WGY A;  3QHT A;  2WX0 A;  3ZW3 A;  4ANV A;  2EMT A;  2DAF A;  2I1J A;  4ZRK A;  2FNJ B;  2IBI B;  2LD9 A;  3QA8 A;  4LJP B;  4EZJ A;  3Q3F A;  1BT0 A;  1YD8 U;  4M0W B;  1WM3 A;  1TGZ B;  1CMX B;  3WAP A;  5G2N A;  4ZDV A;  2BWE S;  3U7D A;  1KOT A;  2K6D B;  4IG7 B;  2LZ6 A;  4RMA A;  3ZDM C;  3QIJ A;  3O65 B;  4GDL A;  4N9F 4;  2I1K A;  4ZYN A;  5EDS A;  2AYO B;  2DZM A;  2CHZ A;  3DVG Y;  2MX2 A;  3A4R A;  1HE8 A;  4W9I A;  3VUW A;  3L08 A;  3L10 B;  4IWP A;  5J17 A;  4W9L A;  1ZKH A;  4NQK E;  2NBW B;  3N32 A;  4GB9 A;  4HJK A;  2D07 B;  4EUT A;  2LRW A;  4BKG A;  4JLC A;  2Z0E B;  1NI2 A;  2V4L A;  2JRI B;  3VFK A;  4IC7 B;  3PLV A;  3DCG A;  2A4Z A;  1Z2M A;  2MRP A;  3AU4 A;  2FID A;  2ZPY A;  2LWP A;  2C7M B;  1E7V A;  4BBN F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...