4WQOB

Structure of vhl-elob-eloc-cul2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Von Hippel-Lindau disease tumor suppressor
publication title Insights into Cullin-RING E3 Ubiquitin Ligase Recruitment: Structure of the VHL-EloBC-Cul2 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 25
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wqoB00
4EFOA 2KOXA 1E7VA 3ALBA 2KC1A 2WYQA 3HM3A 2DENB 4EKUA 3L10B 1V9JA 2LRUA 2NPTB 2JZZA 4GGQA 4GDLB 4DBGA 2LVOA 2Z0DB 4HPLB 4IWPA 3BY4B 2JY6A 5J2RA 3HM6X 2QHOA 1GUAB 2KZRA 2M8SA 2O6VA 2DYOA 2DZJA 2AYOB 2MBOA 3PSEB 4AJWA 4ZYNA 2CHWA 3OLMD 2D3GA 2FAZA 3B1LX 4NAWB 4NY0A 3X23A 3A9JB 4P7IA 4EZLA 4MM3A 4WWPA 4ANWA 3DVGY 3PV1A 2Z0EB 2HD5B 4KZ0A 1L2NA 3S2AA 2LWPA 3UF8A 4W9LA 2C7NB 2M17A 2UYZB 1VCBA 3PHWB 3A4RA 2GBJA 1LQBA 3VUXA 3EHVA 3KUZA 3A1QA 3W1SA 1KOTA 1WE7A 4NAWA 1EF5A 1QZEA 5EDSA 2NVUI 3A9JA 1V49A 2D10A 4HVBA 3HIZA 1KLVA 4AOFA 1YD8U 5CHWA 4JGHB 2N9PC 2MCNB 3V60A 1WFYA 3H1UA 4GMVA 4HDQA 4OVUA 1WJNA 2Y5BB 1WIAA 4XX5A 2L00B 2KKCA 1UZXB 4IW0A 3VAWA 3DBSA 1KJTA 3TCAA 1S3SG 4URKA 2KK8A 4RM9A 1J0GA 3BINA 3R3MA 2ZVNA 4PYUA 2O2VA 3M63B 2BYEA 2EKEC 3PT2B 4K81A 4W9EA 3VQIA 4HCPB 1WXSA 4KDIC 2DYBA 2JPHA 3QARA 3APCA 2N4FA 4BOZB 3PHXB 3KW5B 2MW5A 1E5WA 2MRPA 3L17A 5CTRC 1WXAA 4W9DA 4DXAB 4JLCA 3I3TB 3K9OB 3ZTDA 1G6JA 2JXXA 3QAQA 2IO0B 2NCNA 5DPTA 3APDA 5AZHA 1GG3A 1NI2A 4RM8A 1Q0WB 1OEYJ 2BF8B 2LVQA 2R2OA 2WDTB 3ML9A 4II3B 4II2B 3ZTCA 5L83A 4NQLB 1WJUA 4AWJA 3ZKJC 2JRHA 4LDTD 4PS3A 2KC2A 5DPSA 2G4DB 4B6WA 2WWZA 4BKTA 4OVVA 1NBFC 3DBRI 2BWES 1X1MA 2KN5A 2PE6B 2FCMA 3K9PB 2GBRA 1Q5WB 2JRIB 1WI0A 4EOYA 3IHPC 5D6JB 1A5RA 3VXWA 3QC8B 2LJ5A 1WXVA 3VVWB 4FJZA 2C7MB 1WH3A 3A4SC 3N30A 3KH0A 1AARA 1SGHA 1SE9A 2KX3A 4DHJB 1E7UA 2FIFA 2LXCA 3V6EB 3ZNZB 4DWFA 2CS4A 4MSMB 2DZMA 4B95A 5LLIA 2M0XA 4WAAA 2NBUA 3MTNB 3IFWB 3PTFC 4HXDA 4CHKA 3DVNU 5C23A 3QHTA 4EZKA 4DDID 4MH0E 2HE7A 2PE9A 1J19A 3ZIMA 4MELA 2BYFA 2ZPNA 1WX8A 5IA7A 2MLBA 4FULA 1P9DU 1I35A 5LXIB 2LD9A 2DYMA 3JSVB 3NZUA 3ZVVA 1R4NI 4W9KA 3VH3B 1SIFA 2W9NA 2D2QA 2KLGA 4HLEA 5J18A 3A9KB 4W9GA 1H4RA 4M8MA 3UINB 2DZIA 2MP2A 3RZFA 4KVGB 3AU5A 2O6VB 1GNUA 1TGZB 2NBVB 5CHFA 4EEWA 1F9JA 2N1WA 3V6CB 3H9DA 3MHSD 4YL8A 5E6NA 3R7QA 2I1KA 4HWIB 4BVUC 2LGXA 3JW0X 4FA6A 2KQ7A 3JSVA 4F8CB 1KM7A 3R7RA 2EMTA 3QJZA 1PQSA 4WJQA 2MX2A 3SU8X 1OTRB 1WJ6A 1IYFA 2WX1A 1UBIA 4W9JA 3A9KA 3QIJA 2IYDB 3TJPA 2L05A 2ZZPB 1WZ0A 2KO3A 3A1QB 4NPNA 3NOBA 5L95C 2IZVB 1C1YB 2HTHA 1JRUA 4BKGA 3UIPB 2KFJA 4F7ZA 1WYWB 1NDDA 1R4MI 5FR6A 2ZJDA 1WMHA 2MBBB 2HJ8A 3KUDB 4MSQB 4IM0A 1Q1OA 2KD0A 2DZKA 1Y8RC 2LGYA 3PS6A 4LJPB 5CHVC 2J0JA 3DCGA 2OJRA 4BKSA 2DX5B 2V3SA 3AULA 3KUCB 3M62B 4GXBA 3QQ8B 4IM2A 4MEMA 4XZ4A 1IP9A 4IM3A 1WGYA 3WAPA 2O2VB 2C9WB 3HK0A 3WANA 2FCNA 2YVCA 3M95A 4ICVA 3B08A 4KIKA 2JVCA 2Z59B 1LFDA 4G0NB 4WWNA 3WA0A 2XK5B 4MJSB 4X57B 4FN2A 4G50A 2LUEA 2KDEB 4TQ1A 3H7PB 2KWCA 3R66C 3VTWA 1WGGA 4F1SA 5E6OA 1WRDB 3WAMA 2KQSA 1RFAA 4TV3A 4M8NA 1ZGUB 5JHAA 3L16A 2PPHA 2JF5A 1EUVB 3L0WB 5LXHA 1WM2A 3NHEB 1RRBA 2MQJA 4ASWC 4GSWA 2XK5A 4MJSA 1Z2MA 4PS7A 4GN1A 2MWSB 4FJVB 2UWQA 2CU1A 2M4NA 3H7PA 4MGZE 4MGIE 2RPQA 3ZO5B 2CKHB 4K1RB 4GDKA 5HKHA 1VD2A 4W9CA 5DPRA 2KWUB 1E8ZA 3LJ3A 1CMXB 4JIOU 2KDBA 2J7QB 2G45B 2LRWA 3N32A 3OAWA 3L13A 4KDLB 2C7HA 2ZEQA 1ZW7A 4E3CA 2ZCCA 4CO7A 3M3JA 4GIVA 1ISNA 3D32A 4I6NB 5J17A 3UGBB 4TQ0A 1E8YA 2J0MA 3TL5A 4NJ6A 3VHTC 3DPDA 2IO2B 3H6NA 1J8CA 4MDKE 3DBLI 4WQOB 1WR1A 4KSKC 2ASQA 4FADA 2K6QA 2KFKB 1GC7A 3P2BA 1UH6A 5IAAC 1LXDA 3CMMB 2O6VD 2PEAA 4LCDE 3NZSA 2KVRA 3RUIB 3DOWA 4MGKE 4IC7B 4ICUA 1YX5B 2RR9A 3C0RB 2BYVE 5D94A 3VH4B 2LXAA 2BGFA 3U7DA 3DQVA 1YX6B 2JWZA 2C60A 2KFKA 3QK0A 2K39A 1WM3A 2L76A 5KHOA 2MP2B 3EECA 4IWQA 2L0TA 1P98A 2FUHB 3CSTA 4EUTA 3LDZE 2N9EB 1M94A 4W9HA 1HE8A 1L7YA 2FCQA 2PJHA 2KTRB 3PRPB 1P3QU 2IY1B 1H8CA 2K1FA 5BO4B 4A20A 4AJYB 3VTUA 3PLVA 2KWVB 3ZNHB 2N1VA 2KTFA 1WGRA 4WJNA 3ZDMC 4A3PA 2NBWB 1XT9B 1WR6E 5JZEB 2IO1B 4FJYA 4IWOA 4NNJB 2K8HA 1OGWA 1FXTB 2IBIB 3JVZX 3RULA 2CR5A 3PGEA 5KHQA 4M0WB 3A33B 3GOEA 2KDFB 2KTRA 3ONSA 3DVNV 2BWFA 1WMHB 3PREA 4MGYE 5D2MB 2B3AA 3QX1A 2RD0A 1UELA 1WE6A 1WXMA 2KANA 2KXJA 2JZ3B 3QWZB 2REXA 2CHXA 3PLUA 3SDLC 4BBNF 2NS5A 4DHZB 4FHJA 2MBQA 3W1YA 2AWTA 3L08A 4BFRA 2K8CA 3Q3JA 4E74A 5G2NA 1GJZA 2NR2A 1U4AA 4HJKA 5AEKB 4G3XB 5DCNA 4KIKB 3ECIA 1WGDA 3ZLZA 2I1JA 1GC6A 3UIOB 3AU4A 2K6DB 2LZ6A 4FHKA 2XEWA 2N7DA 3DDCB 1OEYA 2EMSA 4HDOA 1YJ1A 5D7GA 2KMAA 4LJOB 3KYDD 5G55A 2KDIA 2A5UA 4TUUA 3UQAA 2V4LA 4ANVA 2RGFA 2JT4B 2BKFA 3IVFA 1P1AA 1D3ZA 2ZNVC 4ZRJA 2IO3B 3EC8A 4I6LB 3QCAA 2N9XA 2KLCA 4G11A 2NPTA 2VRRB 4HCNB 3VFKA 1V5TA 3WALA 4GDLA 3DBHI 1YQBA 1IPGA 1V86A 4E71A 1Z5SB 4GDKB 5AZFA 2MBHA 2MBEA 2A4ZA 2LGDA 1WZ3A 3SHQA 4FBJB 1WJ4A 2KJHB 2AEHA 3GZNI 2GBMA 3PVLA 3VTVA 4AUQC 4W9FA 2D11A 1TTNA 4WJPA 1OQYA 2GOWA 2C5LC 3L54A 1V81A 2GBNA 1RLFA 3VUWA 2IY0B 4FLHA 4N9F4 5TR5A 1WY8A 4DHJD 3KYCD 3W1SC 3ZW3A 1V6EA 2FIDA 2MSED 2ZCBA 1ZKHA 5C1ZA 5JH5C 1I42A 2LI5A 3UQBA 2L8JA 3T9LA 2KNBA 3PZDA 4BBNC 2MA9B 3ENEA 2G3QB 4ANUA 3OJ4B 4WWOA 2DAJA 2L7RA 4GU2A 4TKNA 2K25A 3TIXA 1LM8B 2KHWB 3RZWC 3JYUA 4PS8A 3HHMA 1UD7A 3WIMA 2DHZA 1V5OA 1WGHA 1BT0A 3ML8A 2OOBB 1UBQA 2BKRB 1YIWA 2G4SA 1WF9A 3ZNID 3AI5A 4NQKE 3OJ3A 2KJRA 2LASA 4XC2A 2RSUA 4GOCA 1E8XA 1V80A 2AL3A 5E6PA 2D07B 2JUOA 4IUMB 4JL9A 1P0RA 4K7SA 4B9KA 2LVPA 2CHZA 3SD5A 3ZRCA 2FCSA 3X0WA 3RT3B 5JHBA 2ZVOA 2AL6A 3V61A 3H7SA 2WX0A 4K7UA 3PRMB 3V62A 3U8ZA 3ZDTA 3NS8A 4WJOA 1WX9A 3RYTA 3N3KB 2KJ6A 4HPMB 4A3OA 2L0FA 3AXCA 3RD2A 3O65B 1TBEA 5DPWA 4IG7B 3TMPB 5GMVA 1E8WA 3CF6E 4EZJA 2K8BA 1T0YA 1MG8A 4CYEA 3PPAA 4BKSD 4DK5A 4ZRIA 1E90A 1K8RB 2M1MA 3EFUA 4GB9A 3NY5A 2DAFA 2FNJB 1S1QB 2L3ZA 3APFA 2GMIC 4DHZE 4DDGD 4I6PA 4J6IA 1TZ1A 1RAXA 3ZUNA 3ZRFA 2KX0A 3Q3FA 1V2YA 4KSLC 3U30A 3PRZA 3WAOA 4KV2A 4ZDVA 3RCZA 1XD3B 1EO6A 1XQQA 3KVFB 2BPSA 2R2QA 1UGMA 3IBEA 4PYZA 3IG3A 3CSFA 3TBLD 3B0AA 2XBBC 3VUYA 2J0KA 4AP4C 4LDTB 4W9IA 5AZGA 1C3TA 3MJWA 2ZNVB 4BOSC 2ZPYA 4JQWC 4ANXA 1WX7A 4NJ7A 4ZRKA 2YLMA 2V1YA 5CX3A 4KZCA 2N7EA 3VDZA 2KMCA 3T8MA 3ZNGC 4HK2A 4RMAA 3DVGX 2GBKA 1EF1A 4K7WA 3QA8A
chains in the Genus database with same CATH superfamily
3DBHB 2KOXA 3HM3A 4ITKA 2NMQA 1GUAB 2KZRA 2O6VA 4ZYNA 3A9JB 4MM3A 4ANWA 1K52A 2IGDA 2VZKD 5HG2A 1L2NA 3S2AA 3UF8A 3FC4A 4JX1C 2M17A 5E6JA 2PMVA 3VUXA 3EHVA 3KUZA 2XN9C 1DGJA 2OJWA 1QZEA 5EDSA 3BK2A 3HIZA 1KLVA 1YD8U 4MACA 3N1XC 2KVZA 3H1UA 5BMIA 4OVUA 4QAYA 3NG0A 1WIAA 4US9A 2YEPB 3DWGC 4URKA 1QOBA 1K53A 4C00A 3Q8CA 2EELA 4OHJA 2INNE 4HROA 1T6BX 1E5WA 2E3TA 3U7ZA 4W9DA 2WXOA 4JLCA 2Q5WD 1I4RA 1ZXHA 3QAQA 3N9YC 2NCNA 3BVMA 4RGMA 1GOZA 1JWBD 1OEYJ 3B2FA 1WJUA 4AWJA 4B6WA 4BKTA 1NBFC 1V1OA 2KN5A 2N0SB 4C80A 3K9PB 1WI0A 3IHPC 5D6JB 2LJ5A 1WXVA 4FJZA 1JCKB 1WH3A 3AEDB 1AARA 3VRBB 1EU4A 3P1MA 2LXCA 4DWFA 2CS4A 4MSMB 2M0XA 3GS2A 4HXDA 3QHTA 4EZKA 3I5JC 1YN5A 4MELA 1Q10A 1P9DU 1VZ8A 2J53A 4ZRPA 3NVYA 2OEDA 1SIFA 2W9NA 2LHDA 2AQ3B 3A9KB 2Y5CA 4HJGE 2WXPA 2NBVB 5CHFA 1C4PA 4HWIB 3JSVA 3R2IA 4WJQA 1CJEA 4A8XC 2BT6A 4NPNA 4ACFA 2HTHA 1JRUA 2Y5PA 3C19A 1WYWB 2LHEA 2HJ8A 4MSQB 2KD0A 3FILB 1P7EA 2RDHA 2OJRA 3AULA 1L0VB 1CQVA 1VZ7A 3Q2AC 1L0XB 2O2VB 2YVCA 4ICVA 1ESFA 4KIKA 2Z59B 4FN2A 3OWEB 2V3PA 3R66C 3VTWA 1WGGA 1WRDB 3WAMA 1TY2A 2E6XA 3L16A 2PPHA 3L0WB 1EUVB 4A90A 1WM2A 5BMHA 2D3BA 1FEHA 3DBRB 1V97A 2M4NA 2UWQA 4MGIE 2Y3AA 5T8IA 4K1RB 5HKHA 4P6VF 4W9CA 5DPRA 5BYQA 1V8CA 2G45B 1N60A 4LNNA 1MHHE 4CO7A 4GIVA 4YWGG 5J17A 3AEAB 3UGBB 2J0MA 4NJ6A 5G5HA 3DPDA 3ZYYX 2SAKA 4HEA1 4NJCA 4KSKC 2WDRB 1UH6A 3CMMB 2O6VD 2PEAA 4LCDE 4YT0B 3C8YA 3I57A 1YX5B 4D2KA 4RGNA 3PZ7A 2BYVE 3VH4B 1UUPA 3U7DA 4AQ7A 1I4PA 1XEEA 2JWZA 4IKGA 2JZPA 2MP2B 3EECA 1P98A 3AECB 3W5VB 2N9EB 3VR8B 2K5PA 2KTRB 3PRPB 5MPOA 4A20A 2JYEA 2KWVB 2N1VA 2KTFA 2NBWB 1WR6E 2KN4A 4IWOA 1WGKA 1OGWA 1FXTB 3JVZX 3RULA 1J7CA 3BVZA 3ONSA 4MGYE 3TSSA 1IBXA 3ABVB 3GP7A 1WXMA 3Q3OC 3QWZB 1FRRA 3CWIA 3SDLC 4FHJA 3L08A 4BFRA 4HJKA 5AEKB 1MI0A 2LZ6A 2QJLA 2WHIA 2N7DA 1QKZA 5C3JB 5D7GA 1VRAB 2L32A 3IAS1 5G55A 4A55A 2V4LA 2RGFA 3IT4B 2JT4B 4ZRJA 2WXRA 5BYRA 2N9XA 2FE8A 4HCNB 3VFKA 3URYA 1YQBA 4GDKB 5AZFA 2MBEA 2HJ1A 1XLOA 2A4ZA 3I63C 1B1ZA 3TEZA 2GBMA 1ZDXA 2I2YA 3VUWA 1RLFA 5TR5A 3W1SC 3UQBA 4M00A 2KNBA 3PZDA 1SJED 1YN3A 5FK9C 3TIXA 2BS2B 2KHWB 2W54A 1PDXA 1QLBB 4PS8A 4IDIA 2DHZA 1BT0A 3ML8A 3AMZA 2G4SA 3AI5A 4KGTA 3OJ3A 1E8XA 2JUOA 4K3CA 2RPVA 3Q8EA 3ZXVA 1TS2A 1KLUD 4WJOA 4GLSC 1QILA 4IG7B 2K8BA 1T0YA 1ZUD2 1FMAD 2BYTA 2GMIC 4DDGD 1PGXA 1FCLA 1TZ1A 1ACCA 1JWUD 4MH8A 4YXDB 2INCC 1JALA 2JYTA 4S0RA 4ZDVA 3RCZA 2BPSA 4DQOC 4C4VB 3IG3A 3B0AA 4LDTB 1DYQA 1V1PA 4W9IA 1C3TA 3MJWA 4BOSC 1WX7A 1FRDA 3GE8C 2V4IB 2BS3B 2WLBA 4K7WA 2BS4B 1XF5L 3L10B 2LRUA 1OQQA 2NPTB 4GDLB 4AS1A 2W3SA 4IWPA 2WQYB 5J2RA 2JY6A 2QHOA 2N9LA 2DZJA 2AYOB 4AJWA 2CHWA 2D3GA 2FAZA 1KTKA 4EZLA 1UWXA 3DVGY 2Z0EB 2HD5B 1FCCC 2LWPA 1JMLA 4W9LA 2C7NB 3P63A 1NI3A 1LQBA 3B2GA 1MG4A 4L23A 1JWSD 1VZ6A 1ZE3D 1WE7A 4NAWA 3AE4B 3LYYA 1V49A 4JGHB 5TSSA 4KGSA 3V60A 2WXIA 1WFYA 1HA5A 2LUMA 5IOIA 3MC9A 2L00B 5HI1A 4IW0A 1ET6A 3FKYA 3TCAA 3T3NA 3AE5B 4PYUA 2O2VA 3M63B 4WH4A 1NYQA 4HCPB 1TKYA 2WXJA 2FUG1 4KGRA 3QARA 3APCA 2N4FA 2KQ4X 5FKAC 1WXAA 4DXAB 3I3TB 3ZTDA 3KWVA 5AZHA 3NS1A 1HEZE 1Q0WB 2LVQA 2BF8B 4II3B 4II2B 2V9HA 3R2TA 4UDUC 4PS3A 2G4DB 2WWZA 2PE6B 2JRIB 1A5RA 3VXWA 1WSPA 2K0PA 1E10A 2L52A 1R4NB 2X38A 2C7MB 5H92C 2WXGA 4DHJB 3V6EB 1PGAA 3ZNZB 2DZMA 4WAAA 4CHKA 5C23A 1PGBA 4DDID 2NTSA 4MH0E 1J19A 3ZIMA 3HUIA 2W55A 1N61A 1WX8A 1F1HA 5LXIB 1R4NI 2PTLA 4RH6A 1F52A 4ZHPA 5J18A 1H4RA 2SEBD 4YSZB 2MP2A 1R4MB 3AM9A 3V6CB 1M4VA 3MHSD 4YL8A 2KT7A 3EFCA 3JW0X 4FA6A 2KQ7A 4F8CB 2UU7A 3R7RA 3QJZA 1OTRB 5IP4D 1KF6B 2WX1A 4N59A 3WCQA 1IYFA 3QIJA 2IYDB 2L05A 2ZZPB 1WZ0A 3NOBA 4USAA 1BXTA 4OW0A 1NDDA 1R4MI 1TIFA 2ZJDA 4IM0A 2DZKA 3BYTB 5IN7A 2LGYA 2WXFA 4LJPB 5CHVC 3DCGA 3M62B 5I4DA 1SSNA 3QQ8B 1WGYA 3RNFC 3SFEB 3HK0A 3WANA 2FCNA 3M95A 2JVCA 4WWNA 1LFDA 2JU6X 4G50A 3H7PB 1R7SA 2KWCA 4JPSA 1N63A 4TV3A 1RFAA 4LNFA 4JWSC 1ZDVA 3NHEB 2QC8A 4ASWC 2XK5A 4MJSA 3W5UB 4GN1A 1HTOA 4FJVB 4LNOA 2CKHB 4GDKA 3MHZA 1XCQL 3LJ3A 2WP9B 2J7QB 2QEJC 2LRWA 5D3DA 3L13A 3U2SC 1I7HA 2ZW1A 2H89B 4ARIA 4TQ0A 1ZP0B 3H6NA 1FD6A 3DBLI 1C77A 4WQOB 2KFKB 3RI7C 3P2BA 5IAAC 1LXDA 1JWMD 5EE9A 2KVRA 3RN9C 3RNEC 2RDBC 3RUIB 3DOWA 3RNAC 1TZOA 3E9SA 3C0RB 4YTMB 1D5MC 3N20C 3TUOA 2LXAA 2BGFA 4FXCA 1MJDA 3QK0A 1WM3A 5KHOA 4M01A 4IWQA 2L0TA 2BBCA 2FUHB 1QOGA 4REZA 2IY1B 1D5XC 1ZXIA 4AJYB 3ZNHB 2PVGC 1LGRA 3U4EG 2B76B 5JZEB 4FJYA 3ZJTA 1FO4A 3P42A 1HZ6A 2CR5A 3PGEA 4M0WB 1SJHD 2KDFB 1SB3C 3DVNV 3PREA 5D2MB 2RD0A 1UELA 3DHHC 3AE8B 2REXA 2CHXA 4DHZB 2PIAA 2V3NA 2M19A 5H8YE 2K8CA 1QT9A 1GJZA 2NR2A 1U4AA 4G3XB 5DCNA 3AEEB 1L0YB 1WGDA 3ZLZA 1L5PA 3UIOB 3AU4A 2K6DB 1VR9A 4FHKA 2OHFA 3DDCB 1OEYA 1YJ1A 2KMAA 1C78A 3GZNB 4XE0A 4ANVA 1N62A 2BKFA 3T3OA 3IVFA 1P1AA 1D3ZA 3IXSA 3EC8A 1RYJA 3LXFA 3GB1A 4G11A 2NPTA 2VRRB 4YTPB 4GDLA 1IPGA 1Z5SB 3IAM1 4ZHOA 2LGDA 3EA6A 3SHQA 4H2AA 1D5ZC 2AEHA 3GZNI 3PVLA 4W9FA 1TTNA 4WJPA 2GOWA 3L54A 1E9MA 4N9F4 2MJEA 1WY8A 2WXQA 2MSED 1ZKHA 5C1ZA 4C7ZA 4A9AA 2N9KA 3BYYB 1C4CA 4DXFA 4WWOA 3Q14C 4XWTA 2K25A 3RZWC 1KLGD 2TSSA 1QOAA 3CIRB 3HHMA 4RFBA 2QDFA 4Q2JA 1NENB 2G1EA 1PYWD 2OOBB 4NQKE 2HTME 2RSUA 2AL3A 5E6PA 4K7SA 2MJ3A 1P0RA 2CHZA 3SD5A 2ZVOA 2AL6A 1TYGB 1E7PB 1QOFA 2W82A 2WX0A 3U8ZA 1WX9A 5EE0A 2KJ6A 4A3OA 2L0FA 1C9FA 1TBEA 5DPWA 1MFWA 3KQ4A 4EZJA 1EWYC 4DK5A 1HTQA 4CYEA 1K8RB 3NY5A 3SR6A 2XNAC 3N1ZC 4I6PA 2AQ1B 1CZPA 4J6IA 3ZRFA 2WXMA 2KX0A 3Q3FA 1V2YA 1F77A 2V0GA 1PFDA 1XQQA 3LB8C 1UGMA 3IBEA 2BB5A 4PYZA 2XBBC 4EE2A 1RM6C 1F2RI 5AZGA 2ZNVB 1VDVA 4OZBA 4NJ7A 1A70A 2YLMA 2V1YA 2KMCA 3T8MA 3ZNGC 4HK2A 1EF1A 5DPTA 4YSYB 4EKUA 2KC1A 2DENB 4RF1A 2K22A 4GGQA 1EM7A 4KKJA 2Z0DB 4HPLB 1N6ZA 3BY4B 3HM6X 2DYOA 1C4AA 3OLMD 3TEYA 1YJJA 3Q69A 4LLGM 1NYRA 4WWPA 3Q8AA 4KZ0A 1VCBA 3A4RA 4KX6B 1P7FA 4JE3B 3W1SA 3AV8A 1KOTA 3A9JA 2D10A 1DOYA 4HVBA 5CHWA 3AE2B 2N9PC 1WJNA 1AN8A 3P4RB 4XX5A 4P16A 1EWCA 1UZXB 1Y56A 4XYCA 3VAWA 3Q8FA 1KJTA 2PW9A 2KK8A 2MH7A 2J4XA 4RM9A 3BINA 3R3MA 1J0GA 1STEA 2BYEA 1L4DB 3PT2B 3VQIA 2WU2B 2DYBA 1N5XA 1SEBD 3PHXB 2MRPA 3L17A 1DOXA 2JXTA 2VH2A 1G6JA 2IO0B 2D5GA 1I4XA 1GG3A 1NI2A 3ZTCA 2WDTB 2JRHA 4LDTD 1WWTA 2KC2A 1AW7A 4OVVA 1YQ4B 4K3BA 3GE3C 2M0AA 1UNSA 5LNK1 3QC8B 3VVWB 3N30A 3KH0A 1DOIA 1SGHA 1E7UA 2FIFA 1UGJA 2KAJA 3MTNB 3PTFC 3MP9A 1TT5B 1YJIA 2R61A 2PE9A 1TKGA 2FBWB 3MC8A 2ZPNA 4WAFA 2RMMA 2H88B 5IA7A 1KFYB 4FULA 1I35A 2DYMA 3JSVB 3NZUA 4W9KA 4R3DA 2D2QA 4HLEA 1TS3A 2PVOD 4M8MA 3UINB 4KVGB 2D3CA 4EEWA 1TY0A 2N1WA 3H9DA 4XGAB 5E6NA 3R7QA 2I1KA 4BVUC 1KM7A 2AX5A 1PQSA 1SF0A 2MX2A 3KWLA 1WJ6A 1SE4A 1UBIA 4W9JA 3A9KA 4KKIA 2IDYA 2KO3A 3A1QB 5L95C 2IZVB 1NVID 4M0WA 4F7ZA 2KFJA 5JXVA 2MBBB 1Q1OA 2WDQB 1BUIC 2LEKA 2DX5B 1IP9A 4GXBA 3KUCB 4XZ4A 4IM2A 4IM3A 3MJ5A 1PUTA 2C9WB 3UI3A 4G0NB 3WA0A 4X57B 3VR9B 2KDEB 4TQ1A 3FILA 1QF6A 2J42A 4RGOS 1SIJA 1ZGUB 2JF5A 5LXHA 2QIEB 1Z2MA 4PS7A 2MWSB 1FIQA 3ZJUA 4MGZE 2CU3A 1GB4A 2LJIA 2KWUB 1E8ZA 1MVKA 5AUIA 3NJTA 1VLBA 4JIOU 3N32A 4ZRQA 2KMMA 2C7HA 2ZEQA 1ZW7A 4E3CA 2ZCCA 3AN1A 4OVZA 1ISNA 3PZ8A 3J9CA 3TL5A 3R8BA 3AE7B 2WS3B 3NRZA 3VHTC 1J8CA 3N1YC 4MDKE 1FM0D 3Q6BA 1WR1A 3MFGA 4DXGA 4P1BC 3AE1B 3P4SB 2DBYA 4MGKE 4IC7B 2RR9A 3AE3B 2N7JA 1HZ5A 1WYGA 3DQVA 1T3QA 4PT5A 3AB5A 4XDDA 3CSTA 4NAMA 4EUTA 3AE6B 3LDZE 5BYSA 1M94A 4W9HA 1T0QC 1HE8A 2FCQA 1P3QU 4XWWA 2K1FA 5BO4B 4A6QA 3VTUA 3PLVA 2IGHA 1IBXB 4HRSA 1J7BA 1WGRA 4A3PA 3ZJVA 1XT9B 2L83A 4NNJB 2K8HA 2LMCA 4ZYSA 5KHQA 1L4ZB 2KTRA 1JQ4A 3TEXA 1WMHB 4WWMA 2BQQA 3EUB2 1ENFA 1K51A 2KANA 2KXJA 2JZ3B 3NVWA 1F2RC 4BBNF 2MBQA 3W1YA 1YN4A 2WXKA 4E74A 3KLSX 3ECIA 4JWUC 5D3IB 2I1JA 2KDMA 3BIID 1FXIA 2Z8LA 2KDIA 3UQAA 1JROA 2QCZA 1K50A 2ZNVC 3QCAA 3WALA 1FNUA 3DBHI 3H8HA 2JX5A 1WZ3A 4FBJB 4PK1A 1WJ4A 3DHIC 3AEBB 2JWUA 4AUQC 1FNWA 3DBLB 3W2DA 2GBNA 4FLHA 4LNKA 4B0EA 3ZXRA 3ZW3A 1V6EA 2FIDA 5JH5C 1I42A 2KWDA 5AUKA 3T9LA 1FXAA 2MA9B 4ANUA 2G3QB 2DAJA 4GU2A 4TKNA 3RFZB 1LM8B 3JYUA 2VZKB 4OZAA 3WIMA 1E0ZA 1V5OA 1WGHA 2BKRB 4XC2A 1F0ZA 1QQRA 4IUMB 2D07B 1SXTA 2LVPA 1JRPA 4K7UA 3PRMB 3V62A 3NS8A 2WXHA 3N3KB 5HHDG 1MHXA 2WU5B 5GMVA 3OG5A 1E90A 2M1MA 3EFUA 4GB9A 4US8A 3Q3MC 1FPYA 1S1QB 3HVDA 2INPE 3W9CB 4DHZE 1TJEA 1L6UA 2IGGA 1V1PB 3ZUNA 4KSLC 3WAOA 1JWAD 1EO6A 1T5XD 2WXLA 1I4GA 3KVFB 3DHGC 4S17A 3BK1A 2R2QA 3TBLD 3CSFA 4L1BA 2J0KA 2WGSA 1KRHA 3V05A 2QMTA 4JQWC 4ANXA 4ZRKA 2EKIA 2ONQA 5CX3A 3DVGX 2GBKA 4C4VA 4EFOA 1XO3A 1E7VA 1N5WA 2GB1A 2MHJA 2WYQA 3ALBA 3FAHA 1V9JA 2JZZA 4DBGA 4RGTA 2LVOA 2L1AA 2JQRB 1HXYD 2M8SA 4YSXB 2MBOA 3PSEB 4NAWB 3B1LX 4NY0A 3X23A 4P7IA 1I4HA 3PV1A 4P1CC 5EE3A 3RPFC 3MC0B 2UYZB 3PHWB 2GBJA 5G5GA 1OFFA 3Q8BA 1CK1A 3A1QA 3EGRA 3TEWA 1MPEA 1EF5A 1UF0A 2NVUI 1C76A 4AOFA 1BMLC 2MCNB 4GMVA 1FFVA 4HDQA 2Y5BB 1ZPSA 3HRDD 2KKCA 2ZW0A 1FFUA 3DBSA 1L6VA 2IPKD 1S3SG 2GLSA 4J3OD 2ZVNA 2EKEC 4K81A 4W9EA 1WXSA 4KDIC 5EE1A 2ON8A 2JPHA 2LGIA 4BOZB 1YOVB 2K9XA 3KW5B 2MW5A 1SE2A 5CTRC 1YQ3B 3K9OB 5C2TB 1GAQB 2JXXA 3APDA 3HVZA 4RM8A 3O13A 2R2OA 3ML9A 2IJ0A 5L83A 4NQLB 3ZKJC 4LTUA 5DPSA 1GB1A 3DBRI 2BWES 1X1MA 4C7YA 2M56B 2FCMA 2GBRA 1Q5WB 4EOYA 4CQNA 1XLPA 3NUHB 5IKCM 2AQ2B 2G9HD 3A4SC 2KX3A 1SE9A 5BMGA 4B95A 5LLIA 2NBUA 3IFWB 2PKOA 3DVNU 2HE7A 3BZDB 3E56A 1SBBB 2BYFA 1D4BA 1D6EC 2MLBA 2LD9A 3DWMA 3ZVVA 3VH3B 2KLGA 4W9GA 1I4QA 2WDVB 2DZIA 3RZFA 2ACZB 2INDC 3AU5A 2O6VB 3NZ3A 5HFYA 1GNUA 1TGZB 3NVVA 4B0MA 1F9JA 2ICIA 1XLQA 4C56C 4MM3B 2MJDA 4N58A 2LGXA 2EMTA 2W3RA 3P4QB 3SU8X 3TJPA 1C1YB 4BKGA 3UIPB 1XXGA 5FR6A 1WMHA 3KUDB 3V3XA 1Y8RC 3PS6A 2J0JA 4BKSA 4LK0M 2V3SA 4MEMA 1LO5D 3WAPA 5GXGB 3RNCC 1IGCA 3B08A 2XK5B 4MJSB 2LUEA 1WXQA 3NVZA 1JW9D 4F1SA 5E6OA 1T0RC 2KQSA 4M8NA 5JHAA 2JSVX 5FR3A 4TMAB 4OZCA 1RRBA 2MQJA 4GSWA 1IUEA 2MEKA 2WXNA 2CU1A 3IT6B 3H7PA 3ZO5B 2RPQA 2DNFA 4L2YA 1ROEA 1ZOYB 1VD2A 1CMXB 2KDBA 3OAWA 4KDLB 3M3JA 3D32A 4I6NB 1E8YA 2IO2B 2CJOA 3AH7A 1E6EB 2ASQA 4FADA 2K6QA 1GC7A 1IGDA 2BVCA 3NZSA 4ICUA 1YMHE 4XDCA 4HKZE 1NEKB 3B9JA 5D94A 2HDEA 1YX6B 2RDGA 1XLNA 2C60A 2KFKA 2K39A 2L76A 2K3UA 3RMKC 1GPXA 2VH1A 2DLBA 1WRIA 1C79A 1L7YA 2PJHA 3ETRA 1H8CA 2D3AA 4RCOA 4WJNA 3ZDMC 4M02A 3U52E 3SFDB 2IO1B 2KYWA 2IBIB 4ARCA 1EU3A 4MT5A 3A33B 3GOEA 2GI9A 1UWMA 4HPPA 4WIPA 2BWFA 2B3AA 3QX1A 1AYFA 1WE6A 3PO0A 3Q3NC 1OQRA 3PLUA 4RNAA 2NS5A 3AE9B 3RNBC 2AWTA 3Q3JA 5G2NA 2GRIA 4N6EB 4KIKB 1RWSA 4BZAA 1GC6A 2J52A 2XEWA 4HDOA 2EMSA 4NZLB 4LJOB 3KYDD 4WQMA 2A5UA 4TUUA 4ZOHC 2YEPF 2IO3B 4I6LB 2KLCA 1B9RA 1AWDA 1V5TA 1SE3A 3AEFB 1V86A 4E71A 1T0SC 2MBHA 2LFIA 2PLPA 4HKQA 2LGSA 3BVGA 2KJHB 2I38A 3VTVA 1VJKA 3RNGC 1TS5A 2D11A 1OQYA 2C5LC 1V81A 2IY0B 4DHJD 2KACA 3KYCD 2ZCBA 2LI5A 2L8JA 4WURA 4BBNC 3ENEA 3OJ4B 1RFKA 3P4PB 4O1NA 2BTEA 2L7RA 2CJNA 1TS4A 4BAXA 1UD7A 2WNMA 1HQRD 1UBQA 1YIWA 3I9V1 1WF9A 3ZNID 4IOIE 2KJRA 2LASA 3SEBA 4GOCA 4LNIA 1V80A 4B9KA 1YNTE 4JL9A 2NTTA 3ZRCA 2FCSA 2X8XX 3RT3B 3X0WA 5JHBA 4YTNB 3V61A 3H7SA 3ZDTA 3RYTA 1J7AA 4HPMB 3VRAB 3AXCA 3RD2A 3O65B 2QSDA 3TMPB 2DWQA 1E8WA 3CF6E 1MG8A 3BWUD 3PPAA 4BKSD 4ZRIA 2DAFA 2FNJB 2L3ZA 1KH0A 3APFA 2QILA 1TKEA 1ET9A 1RAXA 2BB6A 5IO9A 3U30A 3PRZA 3L4PA 4KV2A 4TSSA 1XD3B 1FNVA 2BW2A 3VUYA 4AP4C 2ZPYA 1XCTL 4RF0A 4KZCA 2N7EA 3ZGZA 3VDZA 4RMAA 3ZQ4A 3QA8A 3AEGB
chains in the Genus database with same CATH topology
4EFOA 2KOXA 1E7VA 3ALBA 2KC1A 2WYQA 3HM3A 2DENB 4EKUA 3L10B 1V9JA 2LRUA 2NPTB 2JZZA 4GGQA 4GDLB 4DBGA 2LVOA 2Z0DB 4HPLB 4IWPA 3BY4B 2JY6A 5J2RA 3HM6X 2QHOA 1GUAB 2KZRA 2M8SA 2O6VA 2DYOA 2DZJA 2AYOB 2MBOA 3PSEB 4AJWA 4ZYNA 2CHWA 3OLMD 2D3GA 2FAZA 3B1LX 4NAWB 4NY0A 3X23A 3A9JB 4P7IA 4EZLA 4MM3A 4WWPA 4ANWA 3DVGY 3PV1A 2Z0EB 2HD5B 4KZ0A 1L2NA 3S2AA 2LWPA 3UF8A 4W9LA 2C7NB 2M17A 2UYZB 1VCBA 3PHWB 3A4RA 2GBJA 1LQBA 3VUXA 3EHVA 3KUZA 3A1QA 3W1SA 1KOTA 1WE7A 4NAWA 1EF5A 1QZEA 5EDSA 2NVUI 3A9JA 1V49A 2D10A 4HVBA 3HIZA 1KLVA 4AOFA 1YD8U 5CHWA 4JGHB 2N9PC 2MCNB 3V60A 1WFYA 3H1UA 4GMVA 4HDQA 4OVUA 1WJNA 2Y5BB 1WIAA 4XX5A 2L00B 2KKCA 1UZXB 4IW0A 3VAWA 3DBSA 1KJTA 3TCAA 1S3SG 4URKA 2KK8A 4RM9A 1J0GA 3BINA 3R3MA 2ZVNA 4PYUA 2O2VA 3M63B 2BYEA 2EKEC 3PT2B 4K81A 4W9EA 3VQIA 4HCPB 1WXSA 4KDIC 2DYBA 2JPHA 3QARA 3APCA 2N4FA 4BOZB 3PHXB 3KW5B 2MW5A 1E5WA 2MRPA 3L17A 5CTRC 1WXAA 4W9DA 4DXAB 4JLCA 3I3TB 3K9OB 3ZTDA 1G6JA 2JXXA 3QAQA 2IO0B 2NCNA 5DPTA 3APDA 5AZHA 1GG3A 1NI2A 4RM8A 1Q0WB 1OEYJ 2BF8B 2LVQA 2R2OA 2WDTB 3ML9A 4II3B 4II2B 3ZTCA 5L83A 4NQLB 1WJUA 4AWJA 3ZKJC 2JRHA 4LDTD 4PS3A 2KC2A 5DPSA 2G4DB 4B6WA 2WWZA 4BKTA 4OVVA 1NBFC 3DBRI 2BWES 1X1MA 2KN5A 2PE6B 2FCMA 3K9PB 2GBRA 1Q5WB 2JRIB 1WI0A 4EOYA 3IHPC 5D6JB 1A5RA 3VXWA 3QC8B 2LJ5A 1WXVA 3VVWB 4FJZA 2C7MB 1WH3A 3A4SC 3N30A 3KH0A 1AARA 1SGHA 1SE9A 2KX3A 4DHJB 1E7UA 2FIFA 2LXCA 3V6EB 3ZNZB 4DWFA 2CS4A 4MSMB 2DZMA 4B95A 5LLIA 2M0XA 4WAAA 2NBUA 3MTNB 3IFWB 3PTFC 4HXDA 4CHKA 3DVNU 5C23A 3QHTA 4EZKA 4DDID 4MH0E 2HE7A 2PE9A 1J19A 3ZIMA 4MELA 2BYFA 2ZPNA 1WX8A 5IA7A 2MLBA 4FULA 1P9DU 1I35A 5LXIB 2LD9A 2DYMA 3JSVB 3NZUA 3ZVVA 1R4NI 4W9KA 3VH3B 1SIFA 2W9NA 2D2QA 2KLGA 4HLEA 5J18A 3A9KB 4W9GA 1H4RA 4M8MA 3UINB 2DZIA 2MP2A 3RZFA 4KVGB 3AU5A 2O6VB 1GNUA 1TGZB 2NBVB 5CHFA 4EEWA 1F9JA 2N1WA 3V6CB 3H9DA 3MHSD 4YL8A 5E6NA 3R7QA 2I1KA 4HWIB 4BVUC 2LGXA 3JW0X 4FA6A 2KQ7A 3JSVA 4F8CB 1KM7A 3R7RA 2EMTA 3QJZA 1PQSA 4WJQA 2MX2A 3SU8X 1OTRB 1WJ6A 1IYFA 2WX1A 1UBIA 4W9JA 3A9KA 3QIJA 2IYDB 3TJPA 2L05A 2ZZPB 1WZ0A 2KO3A 3A1QB 4NPNA 3NOBA 5L95C 2IZVB 1C1YB 2HTHA 1JRUA 4BKGA 3UIPB 2KFJA 4F7ZA 1WYWB 1NDDA 1R4MI 5FR6A 2ZJDA 1WMHA 2MBBB 2HJ8A 3KUDB 4MSQB 4IM0A 1Q1OA 2KD0A 2DZKA 1Y8RC 2LGYA 3PS6A 4LJPB 5CHVC 2J0JA 3DCGA 2OJRA 4BKSA 2DX5B 2V3SA 3AULA 3KUCB 3M62B 4GXBA 3QQ8B 4IM2A 4MEMA 4XZ4A 1IP9A 4IM3A 1WGYA 3WAPA 2O2VB 2C9WB 3HK0A 3WANA 2FCNA 2YVCA 3M95A 4ICVA 3B08A 4KIKA 2JVCA 2Z59B 1LFDA 4G0NB 4WWNA 3WA0A 2XK5B 4MJSB 4X57B 4FN2A 4G50A 2LUEA 2KDEB 4TQ1A 3H7PB 2KWCA 3R66C 3VTWA 1WGGA 4F1SA 5E6OA 1WRDB 3WAMA 2KQSA 1RFAA 4TV3A 4M8NA 1ZGUB 5JHAA 3L16A 2PPHA 2JF5A 1EUVB 3L0WB 5LXHA 1WM2A 3NHEB 1RRBA 2MQJA 4ASWC 4GSWA 2XK5A 4MJSA 1Z2MA 4PS7A 4GN1A 2MWSB 4FJVB 2UWQA 2CU1A 2M4NA 3H7PA 4MGZE 4MGIE 2RPQA 3ZO5B 2CKHB 4K1RB 4GDKA 5HKHA 1VD2A 4W9CA 5DPRA 2KWUB 1E8ZA 3LJ3A 1CMXB 4JIOU 2KDBA 2J7QB 2G45B 2LRWA 3N32A 3OAWA 3L13A 4KDLB 2C7HA 2ZEQA 1ZW7A 4E3CA 2ZCCA 4CO7A 3M3JA 4GIVA 1ISNA 3D32A 4I6NB 5J17A 3UGBB 4TQ0A 1E8YA 2J0MA 3TL5A 4NJ6A 3VHTC 3DPDA 2IO2B 3H6NA 1J8CA 4MDKE 3DBLI 4WQOB 1WR1A 4KSKC 2ASQA 4FADA 2K6QA 2KFKB 1GC7A 3P2BA 1UH6A 5IAAC 1LXDA 3CMMB 2O6VD 2PEAA 4LCDE 3NZSA 2KVRA 3RUIB 3DOWA 4MGKE 4IC7B 4ICUA 1YX5B 2RR9A 3C0RB 2BYVE 5D94A 3VH4B 2LXAA 2BGFA 3U7DA 3DQVA 1YX6B 2JWZA 2C60A 2KFKA 3QK0A 2K39A 1WM3A 2L76A 5KHOA 2MP2B 3EECA 4IWQA 2L0TA 1P98A 2FUHB 3CSTA 4EUTA 3LDZE 2N9EB 1M94A 4W9HA 1HE8A 1L7YA 2FCQA 2PJHA 2KTRB 3PRPB 1P3QU 2IY1B 1H8CA 2K1FA 5BO4B 4A20A 4AJYB 3VTUA 3PLVA 2KWVB 3ZNHB 2N1VA 2KTFA 1WGRA 4WJNA 3ZDMC 4A3PA 2NBWB 1XT9B 1WR6E 5JZEB 2IO1B 4FJYA 4IWOA 4NNJB 2K8HA 1OGWA 1FXTB 2IBIB 3JVZX 3RULA 2CR5A 3PGEA 5KHQA 4M0WB 3A33B 3GOEA 2KDFB 2KTRA 3ONSA 3DVNV 2BWFA 1WMHB 3PREA 4MGYE 5D2MB 2B3AA 3QX1A 2RD0A 1UELA 1WE6A 1WXMA 2KANA 2KXJA 2JZ3B 3QWZB 2REXA 2CHXA 3PLUA 3SDLC 4BBNF 2NS5A 4DHZB 4FHJA 2MBQA 3W1YA 2AWTA 3L08A 4BFRA 2K8CA 3Q3JA 4E74A 5G2NA 1GJZA 2NR2A 1U4AA 4HJKA 5AEKB 4G3XB 5DCNA 4KIKB 3ECIA 1WGDA 3ZLZA 2I1JA 1GC6A 3UIOB 3AU4A 2K6DB 2LZ6A 4FHKA 2XEWA 2N7DA 3DDCB 1OEYA 2EMSA 4HDOA 1YJ1A 5D7GA 2KMAA 4LJOB 3KYDD 5G55A 2KDIA 2A5UA 4TUUA 3UQAA 2V4LA 4ANVA 2RGFA 2JT4B 2BKFA 3IVFA 1P1AA 1D3ZA 2ZNVC 4ZRJA 2IO3B 3EC8A 4I6LB 3QCAA 2N9XA 2KLCA 4G11A 2NPTA 2VRRB 4HCNB 3VFKA 1V5TA 3WALA 4GDLA 3DBHI 1YQBA 1IPGA 1V86A 4E71A 1Z5SB 4GDKB 5AZFA 2MBHA 2MBEA 2A4ZA 2LGDA 1WZ3A 3SHQA 4FBJB 1WJ4A 2KJHB 2AEHA 3GZNI 2GBMA 3PVLA 3VTVA 4AUQC 4W9FA 2D11A 1TTNA 4WJPA 1OQYA 2GOWA 2C5LC 3L54A 1V81A 2GBNA 1RLFA 3VUWA 2IY0B 4FLHA 4N9F4 5TR5A 1WY8A 4DHJD 3KYCD 3W1SC 3ZW3A 1V6EA 2FIDA 2MSED 2ZCBA 1ZKHA 5C1ZA 5JH5C 1I42A 2LI5A 3UQBA 2L8JA 3T9LA 2KNBA 3PZDA 4BBNC 2MA9B 3ENEA 2G3QB 4ANUA 3OJ4B 4WWOA 2DAJA 2L7RA 4GU2A 4TKNA 2K25A 3TIXA 1LM8B 2KHWB 3RZWC 3JYUA 4PS8A 3HHMA 1UD7A 3WIMA 2DHZA 1V5OA 1WGHA 1BT0A 3ML8A 2OOBB 1UBQA 2BKRB 1YIWA 2G4SA 1WF9A 3ZNID 3AI5A 4NQKE 3OJ3A 2KJRA 2LASA 4XC2A 2RSUA 4GOCA 1E8XA 1V80A 2AL3A 5E6PA 2D07B 2JUOA 4IUMB 4JL9A 1P0RA 4K7SA 4B9KA 2LVPA 2CHZA 3SD5A 3ZRCA 2FCSA 3X0WA 3RT3B 5JHBA 2ZVOA 2AL6A 3V61A 3H7SA 2WX0A 4K7UA 3PRMB 3V62A 3U8ZA 3ZDTA 3NS8A 4WJOA 1WX9A 3RYTA 3N3KB 2KJ6A 4HPMB 4A3OA 2L0FA 3AXCA 3RD2A 3O65B 1TBEA 5DPWA 4IG7B 3TMPB 5GMVA 1E8WA 3CF6E 4EZJA 2K8BA 1T0YA 1MG8A 4CYEA 3PPAA 4BKSD 4DK5A 4ZRIA 1E90A 1K8RB 2M1MA 3EFUA 4GB9A 3NY5A 2DAFA 2FNJB 1S1QB 2L3ZA 3APFA 2GMIC 4DHZE 4DDGD 4I6PA 4J6IA 1TZ1A 1RAXA 3ZUNA 3ZRFA 2KX0A 3Q3FA 1V2YA 4KSLC 3U30A 3PRZA 3WAOA 4KV2A 4ZDVA 3RCZA 1XD3B 1EO6A 1XQQA 3KVFB 2BPSA 2R2QA 1UGMA 3IBEA 4PYZA 3IG3A 3CSFA 3TBLD 3B0AA 2XBBC 3VUYA 2J0KA 4AP4C 4LDTB 4W9IA 5AZGA 1C3TA 3MJWA 2ZNVB 4BOSC 2ZPYA 4JQWC 4ANXA 1WX7A 4NJ7A 4ZRKA 2YLMA 2V1YA 5CX3A 4KZCA 2N7EA 3VDZA 2KMCA 3T8MA 3ZNGC 4HK2A 4RMAA 3DVGX 2GBKA 1EF1A 4K7WA 3QA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EFO A;  2KOX A;  1E7V A;  3ALB A;  2KC1 A;  2WYQ A;  3HM3 A;  2DEN B;  4EKU A;  3L10 B;  1V9J A;  2LRU A;  2NPT B;  2JZZ A;  4GGQ A;  4GDL B;  4DBG A;  2LVO A;  2Z0D B;  4HPL B;  4IWP A;  3BY4 B;  2JY6 A;  5J2R A;  3HM6 X;  2QHO A;  1GUA B;  2KZR A;  2M8S A;  2O6V A;  2DYO A;  2DZJ A;  2AYO B;  2MBO A;  3PSE B;  4AJW A;  4ZYN A;  2CHW A;  3OLM D;  2D3G A;  2FAZ A;  3B1L X;  4NAW B;  4NY0 A;  3X23 A;  3A9J B;  4P7I A;  4EZL A;  4MM3 A;  4WWP A;  4ANW A;  3DVG Y;  3PV1 A;  2Z0E B;  2HD5 B;  4KZ0 A;  1L2N A;  3S2A A;  2LWP A;  3UF8 A;  4W9L A;  2C7N B;  2M17 A;  2UYZ B;  1VCB A;  3PHW B;  3A4R A;  2GBJ A;  1LQB A;  3VUX A;  3EHV A;  3KUZ A;  3A1Q A;  3W1S A;  1KOT A;  1WE7 A;  4NAW A;  1EF5 A;  1QZE A;  5EDS A;  2NVU I;  3A9J A;  1V49 A;  2D10 A;  4HVB A;  3HIZ A;  1KLV A;  4AOF A;  1YD8 U;  5CHW A;  4JGH B;  2N9P C;  2MCN B;  3V60 A;  1WFY A;  3H1U A;  4GMV A;  4HDQ A;  4OVU A;  1WJN A;  2Y5B B;  1WIA A;  4XX5 A;  2L00 B;  2KKC A;  1UZX B;  4IW0 A;  3VAW A;  3DBS A;  1KJT A;  3TCA A;  1S3S G;  4URK A;  2KK8 A;  4RM9 A;  1J0G A;  3BIN A;  3R3M A;  2ZVN A;  4PYU A;  2O2V A;  3M63 B;  2BYE A;  2EKE C;  3PT2 B;  4K81 A;  4W9E A;  3VQI A;  4HCP B;  1WXS A;  4KDI C;  2DYB A;  2JPH A;  3QAR A;  3APC A;  2N4F A;  4BOZ B;  3PHX B;  3KW5 B;  2MW5 A;  1E5W A;  2MRP A;  3L17 A;  5CTR C;  1WXA A;  4W9D A;  4DXA B;  4JLC A;  3I3T B;  3K9O B;  3ZTD A;  1G6J A;  2JXX A;  3QAQ A;  2IO0 B;  2NCN A;  5DPT A;  3APD A;  5AZH A;  1GG3 A;  1NI2 A;  4RM8 A;  1Q0W B;  1OEY J;  2BF8 B;  2LVQ A;  2R2O A;  2WDT B;  3ML9 A;  4II3 B;  4II2 B;  3ZTC A;  5L83 A;  4NQL B;  1WJU A;  4AWJ A;  3ZKJ C;  2JRH A;  4LDT D;  4PS3 A;  2KC2 A;  5DPS A;  2G4D B;  4B6W A;  2WWZ A;  4BKT A;  4OVV A;  1NBF C;  3DBR I;  2BWE S;  1X1M A;  2KN5 A;  2PE6 B;  2FCM A;  3K9P B;  2GBR A;  1Q5W B;  2JRI B;  1WI0 A;  4EOY A;  3IHP C;  5D6J B;  1A5R A;  3VXW A;  3QC8 B;  2LJ5 A;  1WXV A;  3VVW B;  4FJZ A;  2C7M B;  1WH3 A;  3A4S C;  3N30 A;  3KH0 A;  1AAR A;  1SGH A;  1SE9 A;  2KX3 A;  4DHJ B;  1E7U A;  2FIF A;  2LXC A;  3V6E B;  3ZNZ B;  4DWF A;  2CS4 A;  4MSM B;  2DZM A;  4B95 A;  5LLI A;  2M0X A;  4WAA A;  2NBU A;  3MTN B;  3IFW B;  3PTF C;  4HXD A;  4CHK A;  3DVN U;  5C23 A;  3QHT A;  4EZK A;  4DDI D;  4MH0 E;  2HE7 A;  2PE9 A;  1J19 A;  3ZIM A;  4MEL A;  2BYF A;  2ZPN A;  1WX8 A;  5IA7 A;  2MLB A;  4FUL A;  1P9D U;  1I35 A;  5LXI B;  2LD9 A;  2DYM A;  3JSV B;  3NZU A;  3ZVV A;  1R4N I;  4W9K A;  3VH3 B;  1SIF A;  2W9N A;  2D2Q A;  2KLG A;  4HLE A;  5J18 A;  3A9K B;  4W9G A;  1H4R A;  4M8M A;  3UIN B;  2DZI A;  2MP2 A;  3RZF A;  4KVG B;  3AU5 A;  2O6V B;  1GNU A;  1TGZ B;  2NBV B;  5CHF A;  4EEW A;  1F9J A;  2N1W A;  3V6C B;  3H9D A;  3MHS D;  4YL8 A;  5E6N A;  3R7Q A;  2I1K A;  4HWI B;  4BVU C;  2LGX A;  3JW0 X;  4FA6 A;  2KQ7 A;  3JSV A;  4F8C B;  1KM7 A;  3R7R A;  2EMT A;  3QJZ A;  1PQS A;  4WJQ A;  2MX2 A;  3SU8 X;  1OTR B;  1WJ6 A;  1IYF A;  2WX1 A;  1UBI A;  4W9J A;  3A9K A;  3QIJ A;  2IYD B;  3TJP A;  2L05 A;  2ZZP B;  1WZ0 A;  2KO3 A;  3A1Q B;  4NPN A;  3NOB A;  5L95 C;  2IZV B;  1C1Y B;  2HTH A;  1JRU A;  4BKG A;  3UIP B;  2KFJ A;  4F7Z A;  1WYW B;  1NDD A;  1R4M I;  5FR6 A;  2ZJD A;  1WMH A;  2MBB B;  2HJ8 A;  3KUD B;  4MSQ B;  4IM0 A;  1Q1O A;  2KD0 A;  2DZK A;  1Y8R C;  2LGY A;  3PS6 A;  4LJP B;  5CHV C;  2J0J A;  3DCG A;  2OJR A;  4BKS A;  2DX5 B;  2V3S A;  3AUL A;  3KUC B;  3M62 B;  4GXB A;  3QQ8 B;  4IM2 A;  4MEM A;  4XZ4 A;  1IP9 A;  4IM3 A;  1WGY A;  3WAP A;  2O2V B;  2C9W B;  3HK0 A;  3WAN A;  2FCN A;  2YVC A;  3M95 A;  4ICV A;  3B08 A;  4KIK A;  2JVC A;  2Z59 B;  1LFD A;  4G0N B;  4WWN A;  3WA0 A;  2XK5 B;  4MJS B;  4X57 B;  4FN2 A;  4G50 A;  2LUE A;  2KDE B;  4TQ1 A;  3H7P B;  2KWC A;  3R66 C;  3VTW A;  1WGG A;  4F1S A;  5E6O A;  1WRD B;  3WAM A;  2KQS A;  1RFA A;  4TV3 A;  4M8N A;  1ZGU B;  5JHA A;  3L16 A;  2PPH A;  2JF5 A;  1EUV B;  3L0W B;  5LXH A;  1WM2 A;  3NHE B;  1RRB A;  2MQJ A;  4ASW C;  4GSW A;  2XK5 A;  4MJS A;  1Z2M A;  4PS7 A;  4GN1 A;  2MWS B;  4FJV B;  2UWQ A;  2CU1 A;  2M4N A;  3H7P A;  4MGZ E;  4MGI E;  2RPQ A;  3ZO5 B;  2CKH B;  4K1R B;  4GDK A;  5HKH A;  1VD2 A;  4W9C A;  5DPR A;  2KWU B;  1E8Z A;  3LJ3 A;  1CMX B;  4JIO U;  2KDB A;  2J7Q B;  2G45 B;  2LRW A;  3N32 A;  3OAW A;  3L13 A;  4KDL B;  2C7H A;  2ZEQ A;  1ZW7 A;  4E3C A;  2ZCC A;  4CO7 A;  3M3J A;  4GIV A;  1ISN A;  3D32 A;  4I6N B;  5J17 A;  3UGB B;  4TQ0 A;  1E8Y A;  2J0M A;  3TL5 A;  4NJ6 A;  3VHT C;  3DPD A;  2IO2 B;  3H6N A;  1J8C A;  4MDK E;  3DBL I;  4WQO B;  1WR1 A;  4KSK C;  2ASQ A;  4FAD A;  2K6Q A;  2KFK B;  1GC7 A;  3P2B A;  1UH6 A;  5IAA C;  1LXD A;  3CMM B;  2O6V D;  2PEA A;  4LCD E;  3NZS A;  2KVR A;  3RUI B;  3DOW A;  4MGK E;  4IC7 B;  4ICU A;  1YX5 B;  2RR9 A;  3C0R B;  2BYV E;  5D94 A;  3VH4 B;  2LXA A;  2BGF A;  3U7D A;  3DQV A;  1YX6 B;  2JWZ A;  2C60 A;  2KFK A;  3QK0 A;  2K39 A;  1WM3 A;  2L76 A;  5KHO A;  2MP2 B;  3EEC A;  4IWQ A;  2L0T A;  1P98 A;  2FUH B;  3CST A;  4EUT A;  3LDZ E;  2N9E B;  1M94 A;  4W9H A;  1HE8 A;  1L7Y A;  2FCQ A;  2PJH A;  2KTR B;  3PRP B;  1P3Q U;  2IY1 B;  1H8C A;  2K1F A;  5BO4 B;  4A20 A;  4AJY B;  3VTU A;  3PLV A;  2KWV B;  3ZNH B;  2N1V A;  2KTF A;  1WGR A;  4WJN A;  3ZDM C;  4A3P A;  2NBW B;  1XT9 B;  1WR6 E;  5JZE B;  2IO1 B;  4FJY A;  4IWO A;  4NNJ B;  2K8H A;  1OGW A;  1FXT B;  2IBI B;  3JVZ X;  3RUL A;  2CR5 A;  3PGE A;  5KHQ A;  4M0W B;  3A33 B;  3GOE A;  2KDF B;  2KTR A;  3ONS A;  3DVN V;  2BWF A;  1WMH B;  3PRE A;  4MGY E;  5D2M B;  2B3A A;  3QX1 A;  2RD0 A;  1UEL A;  1WE6 A;  1WXM A;  2KAN A;  2KXJ A;  2JZ3 B;  3QWZ B;  2REX A;  2CHX A;  3PLU A;  3SDL C;  4BBN F;  2NS5 A;  4DHZ B;  4FHJ A;  2MBQ A;  3W1Y A;  2AWT A;  3L08 A;  4BFR A;  2K8C A;  3Q3J A;  4E74 A;  5G2N A;  1GJZ A;  2NR2 A;  1U4A A;  4HJK A;  5AEK B;  4G3X B;  5DCN A;  4KIK B;  3ECI A;  1WGD A;  3ZLZ A;  2I1J A;  1GC6 A;  3UIO B;  3AU4 A;  2K6D B;  2LZ6 A;  4FHK A;  2XEW A;  2N7D A;  3DDC B;  1OEY A;  2EMS A;  4HDO A;  1YJ1 A;  5D7G A;  2KMA A;  4LJO B;  3KYD D;  5G55 A;  2KDI A;  2A5U A;  4TUU A;  3UQA A;  2V4L A;  4ANV A;  2RGF A;  2JT4 B;  2BKF A;  3IVF A;  1P1A A;  1D3Z A;  2ZNV C;  4ZRJ A;  2IO3 B;  3EC8 A;  4I6L B;  3QCA A;  2N9X A;  2KLC A;  4G11 A;  2NPT A;  2VRR B;  4HCN B;  3VFK A;  1V5T A;  3WAL A;  4GDL A;  3DBH I;  1YQB A;  1IPG A;  1V86 A;  4E71 A;  1Z5S B;  4GDK B;  5AZF A;  2MBH A;  2MBE A;  2A4Z A;  2LGD A;  1WZ3 A;  3SHQ A;  4FBJ B;  1WJ4 A;  2KJH B;  2AEH A;  3GZN I;  2GBM A;  3PVL A;  3VTV A;  4AUQ C;  4W9F A;  2D11 A;  1TTN A;  4WJP A;  1OQY A;  2GOW A;  2C5L C;  3L54 A;  1V81 A;  2GBN A;  1RLF A;  3VUW A;  2IY0 B;  4FLH A;  4N9F 4;  5TR5 A;  1WY8 A;  4DHJ D;  3KYC D;  3W1S C;  3ZW3 A;  1V6E A;  2FID A;  2MSE D;  2ZCB A;  1ZKH A;  5C1Z A;  5JH5 C;  1I42 A;  2LI5 A;  3UQB A;  2L8J A;  3T9L A;  2KNB A;  3PZD A;  4BBN C;  2MA9 B;  3ENE A;  2G3Q B;  4ANU A;  3OJ4 B;  4WWO A;  2DAJ A;  2L7R A;  4GU2 A;  4TKN A;  2K25 A;  3TIX A;  1LM8 B;  2KHW B;  3RZW C;  3JYU A;  4PS8 A;  3HHM A;  1UD7 A;  3WIM A;  2DHZ A;  1V5O A;  1WGH A;  1BT0 A;  3ML8 A;  2OOB B;  1UBQ A;  2BKR B;  1YIW A;  2G4S A;  1WF9 A;  3ZNI D;  3AI5 A;  4NQK E;  3OJ3 A;  2KJR A;  2LAS A;  4XC2 A;  2RSU A;  4GOC A;  1E8X A;  1V80 A;  2AL3 A;  5E6P A;  2D07 B;  2JUO A;  4IUM B;  4JL9 A;  1P0R A;  4K7S A;  4B9K A;  2LVP A;  2CHZ A;  3SD5 A;  3ZRC A;  2FCS A;  3X0W A;  3RT3 B;  5JHB A;  2ZVO A;  2AL6 A;  3V61 A;  3H7S A;  2WX0 A;  4K7U A;  3PRM B;  3V62 A;  3U8Z A;  3ZDT A;  3NS8 A;  4WJO A;  1WX9 A;  3RYT A;  3N3K B;  2KJ6 A;  4HPM B;  4A3O A;  2L0F A;  3AXC A;  3RD2 A;  3O65 B;  1TBE A;  5DPW A;  4IG7 B;  3TMP B;  5GMV A;  1E8W A;  3CF6 E;  4EZJ A;  2K8B A;  1T0Y A;  1MG8 A;  4CYE A;  3PPA A;  4BKS D;  4DK5 A;  4ZRI A;  1E90 A;  1K8R B;  2M1M A;  3EFU A;  4GB9 A;  3NY5 A;  2DAF A;  2FNJ B;  1S1Q B;  2L3Z A;  3APF A;  2GMI C;  4DHZ E;  4DDG D;  4I6P A;  4J6I A;  1TZ1 A;  1RAX A;  3ZUN A;  3ZRF A;  2KX0 A;  3Q3F A;  1V2Y A;  4KSL C;  3U30 A;  3PRZ A;  3WAO A;  4KV2 A;  4ZDV A;  3RCZ A;  1XD3 B;  1EO6 A;  1XQQ A;  3KVF B;  2BPS A;  2R2Q A;  1UGM A;  3IBE A;  4PYZ A;  3IG3 A;  3CSF A;  3TBL D;  3B0A A;  2XBB C;  3VUY A;  2J0K A;  4AP4 C;  4LDT B;  4W9I A;  5AZG A;  1C3T A;  3MJW A;  2ZNV B;  4BOS C;  2ZPY A;  4JQW C;  4ANX A;  1WX7 A;  4NJ7 A;  4ZRK A;  2YLM A;  2V1Y A;  5CX3 A;  4KZC A;  2N7E A;  3VDZ A;  2KMC A;  3T8M A;  3ZNG C;  4HK2 A;  4RMA A;  3DVG X;  2GBK A;  1EF1 A;  4K7W A;  3QA8 A; 
#chains in the Genus database with same CATH topology
 3DBH B;  2KOX A;  3HM3 A;  4ITK A;  2NMQ A;  1GUA B;  2KZR A;  2O6V A;  4ZYN A;  3A9J B;  4MM3 A;  4ANW A;  1K52 A;  2IGD A;  2VZK D;  5HG2 A;  1L2N A;  3S2A A;  3UF8 A;  3FC4 A;  4JX1 C;  2M17 A;  5E6J A;  2PMV A;  3VUX A;  3EHV A;  3KUZ A;  2XN9 C;  1DGJ A;  2OJW A;  1QZE A;  5EDS A;  3BK2 A;  3HIZ A;  1KLV A;  1YD8 U;  4MAC A;  3N1X C;  2KVZ A;  3H1U A;  5BMI A;  4OVU A;  4QAY A;  3NG0 A;  1WIA A;  4US9 A;  2YEP B;  3DWG C;  4URK A;  1QOB A;  1K53 A;  4C00 A;  3Q8C A;  2EEL A;  4OHJ A;  2INN E;  4HRO A;  1T6B X;  1E5W A;  2E3T A;  3U7Z A;  4W9D A;  2WXO A;  4JLC A;  2Q5W D;  1I4R A;  1ZXH A;  3QAQ A;  3N9Y C;  2NCN A;  3BVM A;  4RGM A;  1GOZ A;  1JWB D;  1OEY J;  3B2F A;  1WJU A;  4AWJ A;  4B6W A;  4BKT A;  1NBF C;  1V1O A;  2KN5 A;  2N0S B;  4C80 A;  3K9P B;  1WI0 A;  3IHP C;  5D6J B;  2LJ5 A;  1WXV A;  4FJZ A;  1JCK B;  1WH3 A;  3AED B;  1AAR A;  3VRB B;  1EU4 A;  3P1M A;  2LXC A;  4DWF A;  2CS4 A;  4MSM B;  2M0X A;  3GS2 A;  4HXD A;  3QHT A;  4EZK A;  3I5J C;  1YN5 A;  4MEL A;  1Q10 A;  1P9D U;  1VZ8 A;  2J53 A;  4ZRP A;  3NVY A;  2OED A;  1SIF A;  2W9N A;  2LHD A;  2AQ3 B;  3A9K B;  2Y5C A;  4HJG E;  2WXP A;  2NBV B;  5CHF A;  1C4P A;  4HWI B;  3JSV A;  3R2I A;  4WJQ A;  1CJE A;  4A8X C;  2BT6 A;  4NPN A;  4ACF A;  2HTH A;  1JRU A;  2Y5P A;  3C19 A;  1WYW B;  2LHE A;  2HJ8 A;  4MSQ B;  2KD0 A;  3FIL B;  1P7E A;  2RDH A;  2OJR A;  3AUL A;  1L0V B;  1CQV A;  1VZ7 A;  3Q2A C;  1L0X B;  2O2V B;  2YVC A;  4ICV A;  1ESF A;  4KIK A;  2Z59 B;  4FN2 A;  3OWE B;  2V3P A;  3R66 C;  3VTW A;  1WGG A;  1WRD B;  3WAM A;  1TY2 A;  2E6X A;  3L16 A;  2PPH A;  3L0W B;  1EUV B;  4A90 A;  1WM2 A;  5BMH A;  2D3B A;  1FEH A;  3DBR B;  1V97 A;  2M4N A;  2UWQ A;  4MGI E;  2Y3A A;  5T8I A;  4K1R B;  5HKH A;  4P6V F;  4W9C A;  5DPR A;  5BYQ A;  1V8C A;  2G45 B;  1N60 A;  4LNN A;  1MHH E;  4CO7 A;  4GIV A;  4YWG G;  5J17 A;  3AEA B;  3UGB B;  2J0M A;  4NJ6 A;  5G5H A;  3DPD A;  3ZYY X;  2SAK A;  4HEA 1;  4NJC A;  4KSK C;  2WDR B;  1UH6 A;  3CMM B;  2O6V D;  2PEA A;  4LCD E;  4YT0 B;  3C8Y A;  3I57 A;  1YX5 B;  4D2K A;  4RGN A;  3PZ7 A;  2BYV E;  3VH4 B;  1UUP A;  3U7D A;  4AQ7 A;  1I4P A;  1XEE A;  2JWZ A;  4IKG A;  2JZP A;  2MP2 B;  3EEC A;  1P98 A;  3AEC B;  3W5V B;  2N9E B;  3VR8 B;  2K5P A;  2KTR B;  3PRP B;  5MPO A;  4A20 A;  2JYE A;  2KWV B;  2N1V A;  2KTF A;  2NBW B;  1WR6 E;  2KN4 A;  4IWO A;  1WGK A;  1OGW A;  1FXT B;  3JVZ X;  3RUL A;  1J7C A;  3BVZ A;  3ONS A;  4MGY E;  3TSS A;  1IBX A;  3ABV B;  3GP7 A;  1WXM A;  3Q3O C;  3QWZ B;  1FRR A;  3CWI A;  3SDL C;  4FHJ A;  3L08 A;  4BFR A;  4HJK A;  5AEK B;  1MI0 A;  2LZ6 A;  2QJL A;  2WHI A;  2N7D A;  1QKZ A;  5C3J B;  5D7G A;  1VRA B;  2L32 A;  3IAS 1;  5G55 A;  4A55 A;  2V4L A;  2RGF A;  3IT4 B;  2JT4 B;  4ZRJ A;  2WXR A;  5BYR A;  2N9X A;  2FE8 A;  4HCN B;  3VFK A;  3URY A;  1YQB A;  4GDK B;  5AZF A;  2MBE A;  2HJ1 A;  1XLO A;  2A4Z A;  3I63 C;  1B1Z A;  3TEZ A;  2GBM A;  1ZDX A;  2I2Y A;  3VUW A;  1RLF A;  5TR5 A;  3W1S C;  3UQB A;  4M00 A;  2KNB A;  3PZD A;  1SJE D;  1YN3 A;  5FK9 C;  3TIX A;  2BS2 B;  2KHW B;  2W54 A;  1PDX A;  1QLB B;  4PS8 A;  4IDI A;  2DHZ A;  1BT0 A;  3ML8 A;  3AMZ A;  2G4S A;  3AI5 A;  4KGT A;  3OJ3 A;  1E8X A;  2JUO A;  4K3C A;  2RPV A;  3Q8E A;  3ZXV A;  1TS2 A;  1KLU D;  4WJO A;  4GLS C;  1QIL A;  4IG7 B;  2K8B A;  1T0Y A;  1ZUD 2;  1FMA D;  2BYT A;  2GMI C;  4DDG D;  1PGX A;  1FCL A;  1TZ1 A;  1ACC A;  1JWU D;  4MH8 A;  4YXD B;  2INC C;  1JAL A;  2JYT A;  4S0R A;  4ZDV A;  3RCZ A;  2BPS A;  4DQO C;  4C4V B;  3IG3 A;  3B0A A;  4LDT B;  1DYQ A;  1V1P A;  4W9I A;  1C3T A;  3MJW A;  4BOS C;  1WX7 A;  1FRD A;  3GE8 C;  2V4I B;  2BS3 B;  2WLB A;  4K7W A;  2BS4 B;  1XF5 L;  3L10 B;  2LRU A;  1OQQ A;  2NPT B;  4GDL B;  4AS1 A;  2W3S A;  4IWP A;  2WQY B;  5J2R A;  2JY6 A;  2QHO A;  2N9L A;  2DZJ A;  2AYO B;  4AJW A;  2CHW A;  2D3G A;  2FAZ A;  1KTK A;  4EZL A;  1UWX A;  3DVG Y;  2Z0E B;  2HD5 B;  1FCC C;  2LWP A;  1JML A;  4W9L A;  2C7N B;  3P63 A;  1NI3 A;  1LQB A;  3B2G A;  1MG4 A;  4L23 A;  1JWS D;  1VZ6 A;  1ZE3 D;  1WE7 A;  4NAW A;  3AE4 B;  3LYY A;  1V49 A;  4JGH B;  5TSS A;  4KGS A;  3V60 A;  2WXI A;  1WFY A;  1HA5 A;  2LUM A;  5IOI A;  3MC9 A;  2L00 B;  5HI1 A;  4IW0 A;  1ET6 A;  3FKY A;  3TCA A;  3T3N A;  3AE5 B;  4PYU A;  2O2V A;  3M63 B;  4WH4 A;  1NYQ A;  4HCP B;  1TKY A;  2WXJ A;  2FUG 1;  4KGR A;  3QAR A;  3APC A;  2N4F A;  2KQ4 X;  5FKA C;  1WXA A;  4DXA B;  3I3T B;  3ZTD A;  3KWV A;  5AZH A;  3NS1 A;  1HEZ E;  1Q0W B;  2LVQ A;  2BF8 B;  4II3 B;  4II2 B;  2V9H A;  3R2T A;  4UDU C;  4PS3 A;  2G4D B;  2WWZ A;  2PE6 B;  2JRI B;  1A5R A;  3VXW A;  1WSP A;  2K0P A;  1E10 A;  2L52 A;  1R4N B;  2X38 A;  2C7M B;  5H92 C;  2WXG A;  4DHJ B;  3V6E B;  1PGA A;  3ZNZ B;  2DZM A;  4WAA A;  4CHK A;  5C23 A;  1PGB A;  4DDI D;  2NTS A;  4MH0 E;  1J19 A;  3ZIM A;  3HUI A;  2W55 A;  1N61 A;  1WX8 A;  1F1H A;  5LXI B;  1R4N I;  2PTL A;  4RH6 A;  1F52 A;  4ZHP A;  5J18 A;  1H4R A;  2SEB D;  4YSZ B;  2MP2 A;  1R4M B;  3AM9 A;  3V6C B;  1M4V A;  3MHS D;  4YL8 A;  2KT7 A;  3EFC A;  3JW0 X;  4FA6 A;  2KQ7 A;  4F8C B;  2UU7 A;  3R7R A;  3QJZ A;  1OTR B;  5IP4 D;  1KF6 B;  2WX1 A;  4N59 A;  3WCQ A;  1IYF A;  3QIJ A;  2IYD B;  2L05 A;  2ZZP B;  1WZ0 A;  3NOB A;  4USA A;  1BXT A;  4OW0 A;  1NDD A;  1R4M I;  1TIF A;  2ZJD A;  4IM0 A;  2DZK A;  3BYT B;  5IN7 A;  2LGY A;  2WXF A;  4LJP B;  5CHV C;  3DCG A;  3M62 B;  5I4D A;  1SSN A;  3QQ8 B;  1WGY A;  3RNF C;  3SFE B;  3HK0 A;  3WAN A;  2FCN A;  3M95 A;  2JVC A;  4WWN A;  1LFD A;  2JU6 X;  4G50 A;  3H7P B;  1R7S A;  2KWC A;  4JPS A;  1N63 A;  4TV3 A;  1RFA A;  4LNF A;  4JWS C;  1ZDV A;  3NHE B;  2QC8 A;  4ASW C;  2XK5 A;  4MJS A;  3W5U B;  4GN1 A;  1HTO A;  4FJV B;  4LNO A;  2CKH B;  4GDK A;  3MHZ A;  1XCQ L;  3LJ3 A;  2WP9 B;  2J7Q B;  2QEJ C;  2LRW A;  5D3D A;  3L13 A;  3U2S C;  1I7H A;  2ZW1 A;  2H89 B;  4ARI A;  4TQ0 A;  1ZP0 B;  3H6N A;  1FD6 A;  3DBL I;  1C77 A;  4WQO B;  2KFK B;  3RI7 C;  3P2B A;  5IAA C;  1LXD A;  1JWM D;  5EE9 A;  2KVR A;  3RN9 C;  3RNE C;  2RDB C;  3RUI B;  3DOW A;  3RNA C;  1TZO A;  3E9S A;  3C0R B;  4YTM B;  1D5M C;  3N20 C;  3TUO A;  2LXA A;  2BGF A;  4FXC A;  1MJD A;  3QK0 A;  1WM3 A;  5KHO A;  4M01 A;  4IWQ A;  2L0T A;  2BBC A;  2FUH B;  1QOG A;  4REZ A;  2IY1 B;  1D5X C;  1ZXI A;  4AJY B;  3ZNH B;  2PVG C;  1LGR A;  3U4E G;  2B76 B;  5JZE B;  4FJY A;  3ZJT A;  1FO4 A;  3P42 A;  1HZ6 A;  2CR5 A;  3PGE A;  4M0W B;  1SJH D;  2KDF B;  1SB3 C;  3DVN V;  3PRE A;  5D2M B;  2RD0 A;  1UEL A;  3DHH C;  3AE8 B;  2REX A;  2CHX A;  4DHZ B;  2PIA A;  2V3N A;  2M19 A;  5H8Y E;  2K8C A;  1QT9 A;  1GJZ A;  2NR2 A;  1U4A A;  4G3X B;  5DCN A;  3AEE B;  1L0Y B;  1WGD A;  3ZLZ A;  1L5P A;  3UIO B;  3AU4 A;  2K6D B;  1VR9 A;  4FHK A;  2OHF A;  3DDC B;  1OEY A;  1YJ1 A;  2KMA A;  1C78 A;  3GZN B;  4XE0 A;  4ANV A;  1N62 A;  2BKF A;  3T3O A;  3IVF A;  1P1A A;  1D3Z A;  3IXS A;  3EC8 A;  1RYJ A;  3LXF A;  3GB1 A;  4G11 A;  2NPT A;  2VRR B;  4YTP B;  4GDL A;  1IPG A;  1Z5S B;  3IAM 1;  4ZHO A;  2LGD A;  3EA6 A;  3SHQ A;  4H2A A;  1D5Z C;  2AEH A;  3GZN I;  3PVL A;  4W9F A;  1TTN A;  4WJP A;  2GOW A;  3L54 A;  1E9M A;  4N9F 4;  2MJE A;  1WY8 A;  2WXQ A;  2MSE D;  1ZKH A;  5C1Z A;  4C7Z A;  4A9A A;  2N9K A;  3BYY B;  1C4C A;  4DXF A;  4WWO A;  3Q14 C;  4XWT A;  2K25 A;  3RZW C;  1KLG D;  2TSS A;  1QOA A;  3CIR B;  3HHM A;  4RFB A;  2QDF A;  4Q2J A;  1NEN B;  2G1E A;  1PYW D;  2OOB B;  4NQK E;  2HTM E;  2RSU A;  2AL3 A;  5E6P A;  4K7S A;  2MJ3 A;  1P0R A;  2CHZ A;  3SD5 A;  2ZVO A;  2AL6 A;  1TYG B;  1E7P B;  1QOF A;  2W82 A;  2WX0 A;  3U8Z A;  1WX9 A;  5EE0 A;  2KJ6 A;  4A3O A;  2L0F A;  1C9F A;  1TBE A;  5DPW A;  1MFW A;  3KQ4 A;  4EZJ A;  1EWY C;  4DK5 A;  1HTQ A;  4CYE A;  1K8R B;  3NY5 A;  3SR6 A;  2XNA C;  3N1Z C;  4I6P A;  2AQ1 B;  1CZP A;  4J6I A;  3ZRF A;  2WXM A;  2KX0 A;  3Q3F A;  1V2Y A;  1F77 A;  2V0G A;  1PFD A;  1XQQ A;  3LB8 C;  1UGM A;  3IBE A;  2BB5 A;  4PYZ A;  2XBB C;  4EE2 A;  1RM6 C;  1F2R I;  5AZG A;  2ZNV B;  1VDV A;  4OZB A;  4NJ7 A;  1A70 A;  2YLM A;  2V1Y A;  2KMC A;  3T8M A;  3ZNG C;  4HK2 A;  1EF1 A;  5DPT A;  4YSY B;  4EKU A;  2KC1 A;  2DEN B;  4RF1 A;  2K22 A;  4GGQ A;  1EM7 A;  4KKJ A;  2Z0D B;  4HPL B;  1N6Z A;  3BY4 B;  3HM6 X;  2DYO A;  1C4A A;  3OLM D;  3TEY A;  1YJJ A;  3Q69 A;  4LLG M;  1NYR A;  4WWP A;  3Q8A A;  4KZ0 A;  1VCB A;  3A4R A;  4KX6 B;  1P7F A;  4JE3 B;  3W1S A;  3AV8 A;  1KOT A;  3A9J A;  2D10 A;  1DOY A;  4HVB A;  5CHW A;  3AE2 B;  2N9P C;  1WJN A;  1AN8 A;  3P4R B;  4XX5 A;  4P16 A;  1EWC A;  1UZX B;  1Y56 A;  4XYC A;  3VAW A;  3Q8F A;  1KJT A;  2PW9 A;  2KK8 A;  2MH7 A;  2J4X A;  4RM9 A;  3BIN A;  3R3M A;  1J0G A;  1STE A;  2BYE A;  1L4D B;  3PT2 B;  3VQI A;  2WU2 B;  2DYB A;  1N5X A;  1SEB D;  3PHX B;  2MRP A;  3L17 A;  1DOX A;  2JXT A;  2VH2 A;  1G6J A;  2IO0 B;  2D5G A;  1I4X A;  1GG3 A;  1NI2 A;  3ZTC A;  2WDT B;  2JRH A;  4LDT D;  1WWT A;  2KC2 A;  1AW7 A;  4OVV A;  1YQ4 B;  4K3B A;  3GE3 C;  2M0A A;  1UNS A;  5LNK 1;  3QC8 B;  3VVW B;  3N30 A;  3KH0 A;  1DOI A;  1SGH A;  1E7U A;  2FIF A;  1UGJ A;  2KAJ A;  3MTN B;  3PTF C;  3MP9 A;  1TT5 B;  1YJI A;  2R61 A;  2PE9 A;  1TKG A;  2FBW B;  3MC8 A;  2ZPN A;  4WAF A;  2RMM A;  2H88 B;  5IA7 A;  1KFY B;  4FUL A;  1I35 A;  2DYM A;  3JSV B;  3NZU A;  4W9K A;  4R3D A;  2D2Q A;  4HLE A;  1TS3 A;  2PVO D;  4M8M A;  3UIN B;  4KVG B;  2D3C A;  4EEW A;  1TY0 A;  2N1W A;  3H9D A;  4XGA B;  5E6N A;  3R7Q A;  2I1K A;  4BVU C;  1KM7 A;  2AX5 A;  1PQS A;  1SF0 A;  2MX2 A;  3KWL A;  1WJ6 A;  1SE4 A;  1UBI A;  4W9J A;  3A9K A;  4KKI A;  2IDY A;  2KO3 A;  3A1Q B;  5L95 C;  2IZV B;  1NVI D;  4M0W A;  4F7Z A;  2KFJ A;  5JXV A;  2MBB B;  1Q1O A;  2WDQ B;  1BUI C;  2LEK A;  2DX5 B;  1IP9 A;  4GXB A;  3KUC B;  4XZ4 A;  4IM2 A;  4IM3 A;  3MJ5 A;  1PUT A;  2C9W B;  3UI3 A;  4G0N B;  3WA0 A;  4X57 B;  3VR9 B;  2KDE B;  4TQ1 A;  3FIL A;  1QF6 A;  2J42 A;  4RGO S;  1SIJ A;  1ZGU B;  2JF5 A;  5LXH A;  2QIE B;  1Z2M A;  4PS7 A;  2MWS B;  1FIQ A;  3ZJU A;  4MGZ E;  2CU3 A;  1GB4 A;  2LJI A;  2KWU B;  1E8Z A;  1MVK A;  5AUI A;  3NJT A;  1VLB A;  4JIO U;  3N32 A;  4ZRQ A;  2KMM A;  2C7H A;  2ZEQ A;  1ZW7 A;  4E3C A;  2ZCC A;  3AN1 A;  4OVZ A;  1ISN A;  3PZ8 A;  3J9C A;  3TL5 A;  3R8B A;  3AE7 B;  2WS3 B;  3NRZ A;  3VHT C;  1J8C A;  3N1Y C;  4MDK E;  1FM0 D;  3Q6B A;  1WR1 A;  3MFG A;  4DXG A;  4P1B C;  3AE1 B;  3P4S B;  2DBY A;  4MGK E;  4IC7 B;  2RR9 A;  3AE3 B;  2N7J A;  1HZ5 A;  1WYG A;  3DQV A;  1T3Q A;  4PT5 A;  3AB5 A;  4XDD A;  3CST A;  4NAM A;  4EUT A;  3AE6 B;  3LDZ E;  5BYS A;  1M94 A;  4W9H A;  1T0Q C;  1HE8 A;  2FCQ A;  1P3Q U;  4XWW A;  2K1F A;  5BO4 B;  4A6Q A;  3VTU A;  3PLV A;  2IGH A;  1IBX B;  4HRS A;  1J7B A;  1WGR A;  4A3P A;  3ZJV A;  1XT9 B;  2L83 A;  4NNJ B;  2K8H A;  2LMC A;  4ZYS A;  5KHQ A;  1L4Z B;  2KTR A;  1JQ4 A;  3TEX A;  1WMH B;  4WWM A;  2BQQ A;  3EUB 2;  1ENF A;  1K51 A;  2KAN A;  2KXJ A;  2JZ3 B;  3NVW A;  1F2R C;  4BBN F;  2MBQ A;  3W1Y A;  1YN4 A;  2WXK A;  4E74 A;  3KLS X;  3ECI A;  4JWU C;  5D3I B;  2I1J A;  2KDM A;  3BII D;  1FXI A;  2Z8L A;  2KDI A;  3UQA A;  1JRO A;  2QCZ A;  1K50 A;  2ZNV C;  3QCA A;  3WAL A;  1FNU A;  3DBH I;  3H8H A;  2JX5 A;  1WZ3 A;  4FBJ B;  4PK1 A;  1WJ4 A;  3DHI C;  3AEB B;  2JWU A;  4AUQ C;  1FNW A;  3DBL B;  3W2D A;  2GBN A;  4FLH A;  4LNK A;  4B0E A;  3ZXR A;  3ZW3 A;  1V6E A;  2FID A;  5JH5 C;  1I42 A;  2KWD A;  5AUK A;  3T9L A;  1FXA A;  2MA9 B;  4ANU A;  2G3Q B;  2DAJ A;  4GU2 A;  4TKN A;  3RFZ B;  1LM8 B;  3JYU A;  2VZK B;  4OZA A;  3WIM A;  1E0Z A;  1V5O A;  1WGH A;  2BKR B;  4XC2 A;  1F0Z A;  1QQR A;  4IUM B;  2D07 B;  1SXT A;  2LVP A;  1JRP A;  4K7U A;  3PRM B;  3V62 A;  3NS8 A;  2WXH A;  3N3K B;  5HHD G;  1MHX A;  2WU5 B;  5GMV A;  3OG5 A;  1E90 A;  2M1M A;  3EFU A;  4GB9 A;  4US8 A;  3Q3M C;  1FPY A;  1S1Q B;  3HVD A;  2INP E;  3W9C B;  4DHZ E;  1TJE A;  1L6U A;  2IGG A;  1V1P B;  3ZUN A;  4KSL C;  3WAO A;  1JWA D;  1EO6 A;  1T5X D;  2WXL A;  1I4G A;  3KVF B;  3DHG C;  4S17 A;  3BK1 A;  2R2Q A;  3TBL D;  3CSF A;  4L1B A;  2J0K A;  2WGS A;  1KRH A;  3V05 A;  2QMT A;  4JQW C;  4ANX A;  4ZRK A;  2EKI A;  2ONQ A;  5CX3 A;  3DVG X;  2GBK A;  4C4V A;  4EFO A;  1XO3 A;  1E7V A;  1N5W A;  2GB1 A;  2MHJ A;  2WYQ A;  3ALB A;  3FAH A;  1V9J A;  2JZZ A;  4DBG A;  4RGT A;  2LVO A;  2L1A A;  2JQR B;  1HXY D;  2M8S A;  4YSX B;  2MBO A;  3PSE B;  4NAW B;  3B1L X;  4NY0 A;  3X23 A;  4P7I A;  1I4H A;  3PV1 A;  4P1C C;  5EE3 A;  3RPF C;  3MC0 B;  2UYZ B;  3PHW B;  2GBJ A;  5G5G A;  1OFF A;  3Q8B A;  1CK1 A;  3A1Q A;  3EGR A;  3TEW A;  1MPE A;  1EF5 A;  1UF0 A;  2NVU I;  1C76 A;  4AOF A;  1BML C;  2MCN B;  4GMV A;  1FFV A;  4HDQ A;  2Y5B B;  1ZPS A;  3HRD D;  2KKC A;  2ZW0 A;  1FFU A;  3DBS A;  1L6V A;  2IPK D;  1S3S G;  2GLS A;  4J3O D;  2ZVN A;  2EKE C;  4K81 A;  4W9E A;  1WXS A;  4KDI C;  5EE1 A;  2ON8 A;  2JPH A;  2LGI A;  4BOZ B;  1YOV B;  2K9X A;  3KW5 B;  2MW5 A;  1SE2 A;  5CTR C;  1YQ3 B;  3K9O B;  5C2T B;  1GAQ B;  2JXX A;  3APD A;  3HVZ A;  4RM8 A;  3O13 A;  2R2O A;  3ML9 A;  2IJ0 A;  5L83 A;  4NQL B;  3ZKJ C;  4LTU A;  5DPS A;  1GB1 A;  3DBR I;  2BWE S;  1X1M A;  4C7Y A;  2M56 B;  2FCM A;  2GBR A;  1Q5W B;  4EOY A;  4CQN A;  1XLP A;  3NUH B;  5IKC M;  2AQ2 B;  2G9H D;  3A4S C;  2KX3 A;  1SE9 A;  5BMG A;  4B95 A;  5LLI A;  2NBU A;  3IFW B;  2PKO A;  3DVN U;  2HE7 A;  3BZD B;  3E56 A;  1SBB B;  2BYF A;  1D4B A;  1D6E C;  2MLB A;  2LD9 A;  3DWM A;  3ZVV A;  3VH3 B;  2KLG A;  4W9G A;  1I4Q A;  2WDV B;  2DZI A;  3RZF A;  2ACZ B;  2IND C;  3AU5 A;  2O6V B;  3NZ3 A;  5HFY A;  1GNU A;  1TGZ B;  3NVV A;  4B0M A;  1F9J A;  2ICI A;  1XLQ A;  4C56 C;  4MM3 B;  2MJD A;  4N58 A;  2LGX A;  2EMT A;  2W3R A;  3P4Q B;  3SU8 X;  3TJP A;  1C1Y B;  4BKG A;  3UIP B;  1XXG A;  5FR6 A;  1WMH A;  3KUD B;  3V3X A;  1Y8R C;  3PS6 A;  2J0J A;  4BKS A;  4LK0 M;  2V3S A;  4MEM A;  1LO5 D;  3WAP A;  5GXG B;  3RNC C;  1IGC A;  3B08 A;  2XK5 B;  4MJS B;  2LUE A;  1WXQ A;  3NVZ A;  1JW9 D;  4F1S A;  5E6O A;  1T0R C;  2KQS A;  4M8N A;  5JHA A;  2JSV X;  5FR3 A;  4TMA B;  4OZC A;  1RRB A;  2MQJ A;  4GSW A;  1IUE A;  2MEK A;  2WXN A;  2CU1 A;  3IT6 B;  3H7P A;  3ZO5 B;  2RPQ A;  2DNF A;  4L2Y A;  1ROE A;  1ZOY B;  1VD2 A;  1CMX B;  2KDB A;  3OAW A;  4KDL B;  3M3J A;  3D32 A;  4I6N B;  1E8Y A;  2IO2 B;  2CJO A;  3AH7 A;  1E6E B;  2ASQ A;  4FAD A;  2K6Q A;  1GC7 A;  1IGD A;  2BVC A;  3NZS A;  4ICU A;  1YMH E;  4XDC A;  4HKZ E;  1NEK B;  3B9J A;  5D94 A;  2HDE A;  1YX6 B;  2RDG A;  1XLN A;  2C60 A;  2KFK A;  2K39 A;  2L76 A;  2K3U A;  3RMK C;  1GPX A;  2VH1 A;  2DLB A;  1WRI A;  1C79 A;  1L7Y A;  2PJH A;  3ETR A;  1H8C A;  2D3A A;  4RCO A;  4WJN A;  3ZDM C;  4M02 A;  3U52 E;  3SFD B;  2IO1 B;  2KYW A;  2IBI B;  4ARC A;  1EU3 A;  4MT5 A;  3A33 B;  3GOE A;  2GI9 A;  1UWM A;  4HPP A;  4WIP A;  2BWF A;  2B3A A;  3QX1 A;  1AYF A;  1WE6 A;  3PO0 A;  3Q3N C;  1OQR A;  3PLU A;  4RNA A;  2NS5 A;  3AE9 B;  3RNB C;  2AWT A;  3Q3J A;  5G2N A;  2GRI A;  4N6E B;  4KIK B;  1RWS A;  4BZA A;  1GC6 A;  2J52 A;  2XEW A;  4HDO A;  2EMS A;  4NZL B;  4LJO B;  3KYD D;  4WQM A;  2A5U A;  4TUU A;  4ZOH C;  2YEP F;  2IO3 B;  4I6L B;  2KLC A;  1B9R A;  1AWD A;  1V5T A;  1SE3 A;  3AEF B;  1V86 A;  4E71 A;  1T0S C;  2MBH A;  2LFI A;  2PLP A;  4HKQ A;  2LGS A;  3BVG A;  2KJH B;  2I38 A;  3VTV A;  1VJK A;  3RNG C;  1TS5 A;  2D11 A;  1OQY A;  2C5L C;  1V81 A;  2IY0 B;  4DHJ D;  2KAC A;  3KYC D;  2ZCB A;  2LI5 A;  2L8J A;  4WUR A;  4BBN C;  3ENE A;  3OJ4 B;  1RFK A;  3P4P B;  4O1N A;  2BTE A;  2L7R A;  2CJN A;  1TS4 A;  4BAX A;  1UD7 A;  2WNM A;  1HQR D;  1UBQ A;  1YIW A;  3I9V 1;  1WF9 A;  3ZNI D;  4IOI E;  2KJR A;  2LAS A;  3SEB A;  4GOC A;  4LNI A;  1V80 A;  4B9K A;  1YNT E;  4JL9 A;  2NTT A;  3ZRC A;  2FCS A;  2X8X X;  3RT3 B;  3X0W A;  5JHB A;  4YTN B;  3V61 A;  3H7S A;  3ZDT A;  3RYT A;  1J7A A;  4HPM B;  3VRA B;  3AXC A;  3RD2 A;  3O65 B;  2QSD A;  3TMP B;  2DWQ A;  1E8W A;  3CF6 E;  1MG8 A;  3BWU D;  3PPA A;  4BKS D;  4ZRI A;  2DAF A;  2FNJ B;  2L3Z A;  1KH0 A;  3APF A;  2QIL A;  1TKE A;  1ET9 A;  1RAX A;  2BB6 A;  5IO9 A;  3U30 A;  3PRZ A;  3L4P A;  4KV2 A;  4TSS A;  1XD3 B;  1FNV A;  2BW2 A;  3VUY A;  4AP4 C;  2ZPY A;  1XCT L;  4RF0 A;  4KZC A;  2N7E A;  3ZGZ A;  3VDZ A;  4RMA A;  3ZQ4 A;  3QA8 A;  3AEG B; 
#chains in the Genus database with same CATH homology
 4EFO A;  2KOX A;  1E7V A;  3ALB A;  2KC1 A;  2WYQ A;  3HM3 A;  2DEN B;  4EKU A;  3L10 B;  1V9J A;  2LRU A;  2NPT B;  2JZZ A;  4GGQ A;  4GDL B;  4DBG A;  2LVO A;  2Z0D B;  4HPL B;  4IWP A;  3BY4 B;  2JY6 A;  5J2R A;  3HM6 X;  2QHO A;  1GUA B;  2KZR A;  2M8S A;  2O6V A;  2DYO A;  2DZJ A;  2AYO B;  2MBO A;  3PSE B;  4AJW A;  4ZYN A;  2CHW A;  3OLM D;  2D3G A;  2FAZ A;  3B1L X;  4NAW B;  4NY0 A;  3X23 A;  3A9J B;  4P7I A;  4EZL A;  4MM3 A;  4WWP A;  4ANW A;  3DVG Y;  3PV1 A;  2Z0E B;  2HD5 B;  4KZ0 A;  1L2N A;  3S2A A;  2LWP A;  3UF8 A;  4W9L A;  2C7N B;  2M17 A;  2UYZ B;  1VCB A;  3PHW B;  3A4R A;  2GBJ A;  1LQB A;  3VUX A;  3EHV A;  3KUZ A;  3A1Q A;  3W1S A;  1KOT A;  1WE7 A;  4NAW A;  1EF5 A;  1QZE A;  5EDS A;  2NVU I;  3A9J A;  1V49 A;  2D10 A;  4HVB A;  3HIZ A;  1KLV A;  4AOF A;  1YD8 U;  5CHW A;  4JGH B;  2N9P C;  2MCN B;  3V60 A;  1WFY A;  3H1U A;  4GMV A;  4HDQ A;  4OVU A;  1WJN A;  2Y5B B;  1WIA A;  4XX5 A;  2L00 B;  2KKC A;  1UZX B;  4IW0 A;  3VAW A;  3DBS A;  1KJT A;  3TCA A;  1S3S G;  4URK A;  2KK8 A;  4RM9 A;  1J0G A;  3BIN A;  3R3M A;  2ZVN A;  4PYU A;  2O2V A;  3M63 B;  2BYE A;  2EKE C;  3PT2 B;  4K81 A;  4W9E A;  3VQI A;  4HCP B;  1WXS A;  4KDI C;  2DYB A;  2JPH A;  3QAR A;  3APC A;  2N4F A;  4BOZ B;  3PHX B;  3KW5 B;  2MW5 A;  1E5W A;  2MRP A;  3L17 A;  5CTR C;  1WXA A;  4W9D A;  4DXA B;  4JLC A;  3I3T B;  3K9O B;  3ZTD A;  1G6J A;  2JXX A;  3QAQ A;  2IO0 B;  2NCN A;  5DPT A;  3APD A;  5AZH A;  1GG3 A;  1NI2 A;  4RM8 A;  1Q0W B;  1OEY J;  2BF8 B;  2LVQ A;  2R2O A;  2WDT B;  3ML9 A;  4II3 B;  4II2 B;  3ZTC A;  5L83 A;  4NQL B;  1WJU A;  4AWJ A;  3ZKJ C;  2JRH A;  4LDT D;  4PS3 A;  2KC2 A;  5DPS A;  2G4D B;  4B6W A;  2WWZ A;  4BKT A;  4OVV A;  1NBF C;  3DBR I;  2BWE S;  1X1M A;  2KN5 A;  2PE6 B;  2FCM A;  3K9P B;  2GBR A;  1Q5W B;  2JRI B;  1WI0 A;  4EOY A;  3IHP C;  5D6J B;  1A5R A;  3VXW A;  3QC8 B;  2LJ5 A;  1WXV A;  3VVW B;  4FJZ A;  2C7M B;  1WH3 A;  3A4S C;  3N30 A;  3KH0 A;  1AAR A;  1SGH A;  1SE9 A;  2KX3 A;  4DHJ B;  1E7U A;  2FIF A;  2LXC A;  3V6E B;  3ZNZ B;  4DWF A;  2CS4 A;  4MSM B;  2DZM A;  4B95 A;  5LLI A;  2M0X A;  4WAA A;  2NBU A;  3MTN B;  3IFW B;  3PTF C;  4HXD A;  4CHK A;  3DVN U;  5C23 A;  3QHT A;  4EZK A;  4DDI D;  4MH0 E;  2HE7 A;  2PE9 A;  1J19 A;  3ZIM A;  4MEL A;  2BYF A;  2ZPN A;  1WX8 A;  5IA7 A;  2MLB A;  4FUL A;  1P9D U;  1I35 A;  5LXI B;  2LD9 A;  2DYM A;  3JSV B;  3NZU A;  3ZVV A;  1R4N I;  4W9K A;  3VH3 B;  1SIF A;  2W9N A;  2D2Q A;  2KLG A;  4HLE A;  5J18 A;  3A9K B;  4W9G A;  1H4R A;  4M8M A;  3UIN B;  2DZI A;  2MP2 A;  3RZF A;  4KVG B;  3AU5 A;  2O6V B;  1GNU A;  1TGZ B;  2NBV B;  5CHF A;  4EEW A;  1F9J A;  2N1W A;  3V6C B;  3H9D A;  3MHS D;  4YL8 A;  5E6N A;  3R7Q A;  2I1K A;  4HWI B;  4BVU C;  2LGX A;  3JW0 X;  4FA6 A;  2KQ7 A;  3JSV A;  4F8C B;  1KM7 A;  3R7R A;  2EMT A;  3QJZ A;  1PQS A;  4WJQ A;  2MX2 A;  3SU8 X;  1OTR B;  1WJ6 A;  1IYF A;  2WX1 A;  1UBI A;  4W9J A;  3A9K A;  3QIJ A;  2IYD B;  3TJP A;  2L05 A;  2ZZP B;  1WZ0 A;  2KO3 A;  3A1Q B;  4NPN A;  3NOB A;  5L95 C;  2IZV B;  1C1Y B;  2HTH A;  1JRU A;  4BKG A;  3UIP B;  2KFJ A;  4F7Z A;  1WYW B;  1NDD A;  1R4M I;  5FR6 A;  2ZJD A;  1WMH A;  2MBB B;  2HJ8 A;  3KUD B;  4MSQ B;  4IM0 A;  1Q1O A;  2KD0 A;  2DZK A;  1Y8R C;  2LGY A;  3PS6 A;  4LJP B;  5CHV C;  2J0J A;  3DCG A;  2OJR A;  4BKS A;  2DX5 B;  2V3S A;  3AUL A;  3KUC B;  3M62 B;  4GXB A;  3QQ8 B;  4IM2 A;  4MEM A;  4XZ4 A;  1IP9 A;  4IM3 A;  1WGY A;  3WAP A;  2O2V B;  2C9W B;  3HK0 A;  3WAN A;  2FCN A;  2YVC A;  3M95 A;  4ICV A;  3B08 A;  4KIK A;  2JVC A;  2Z59 B;  1LFD A;  4G0N B;  4WWN A;  3WA0 A;  2XK5 B;  4MJS B;  4X57 B;  4FN2 A;  4G50 A;  2LUE A;  2KDE B;  4TQ1 A;  3H7P B;  2KWC A;  3R66 C;  3VTW A;  1WGG A;  4F1S A;  5E6O A;  1WRD B;  3WAM A;  2KQS A;  1RFA A;  4TV3 A;  4M8N A;  1ZGU B;  5JHA A;  3L16 A;  2PPH A;  2JF5 A;  1EUV B;  3L0W B;  5LXH A;  1WM2 A;  3NHE B;  1RRB A;  2MQJ A;  4ASW C;  4GSW A;  2XK5 A;  4MJS A;  1Z2M A;  4PS7 A;  4GN1 A;  2MWS B;  4FJV B;  2UWQ A;  2CU1 A;  2M4N A;  3H7P A;  4MGZ E;  4MGI E;  2RPQ A;  3ZO5 B;  2CKH B;  4K1R B;  4GDK A;  5HKH A;  1VD2 A;  4W9C A;  5DPR A;  2KWU B;  1E8Z A;  3LJ3 A;  1CMX B;  4JIO U;  2KDB A;  2J7Q B;  2G45 B;  2LRW A;  3N32 A;  3OAW A;  3L13 A;  4KDL B;  2C7H A;  2ZEQ A;  1ZW7 A;  4E3C A;  2ZCC A;  4CO7 A;  3M3J A;  4GIV A;  1ISN A;  3D32 A;  4I6N B;  5J17 A;  3UGB B;  4TQ0 A;  1E8Y A;  2J0M A;  3TL5 A;  4NJ6 A;  3VHT C;  3DPD A;  2IO2 B;  3H6N A;  1J8C A;  4MDK E;  3DBL I;  4WQO B;  1WR1 A;  4KSK C;  2ASQ A;  4FAD A;  2K6Q A;  2KFK B;  1GC7 A;  3P2B A;  1UH6 A;  5IAA C;  1LXD A;  3CMM B;  2O6V D;  2PEA A;  4LCD E;  3NZS A;  2KVR A;  3RUI B;  3DOW A;  4MGK E;  4IC7 B;  4ICU A;  1YX5 B;  2RR9 A;  3C0R B;  2BYV E;  5D94 A;  3VH4 B;  2LXA A;  2BGF A;  3U7D A;  3DQV A;  1YX6 B;  2JWZ A;  2C60 A;  2KFK A;  3QK0 A;  2K39 A;  1WM3 A;  2L76 A;  5KHO A;  2MP2 B;  3EEC A;  4IWQ A;  2L0T A;  1P98 A;  2FUH B;  3CST A;  4EUT A;  3LDZ E;  2N9E B;  1M94 A;  4W9H A;  1HE8 A;  1L7Y A;  2FCQ A;  2PJH A;  2KTR B;  3PRP B;  1P3Q U;  2IY1 B;  1H8C A;  2K1F A;  5BO4 B;  4A20 A;  4AJY B;  3VTU A;  3PLV A;  2KWV B;  3ZNH B;  2N1V A;  2KTF A;  1WGR A;  4WJN A;  3ZDM C;  4A3P A;  2NBW B;  1XT9 B;  1WR6 E;  5JZE B;  2IO1 B;  4FJY A;  4IWO A;  4NNJ B;  2K8H A;  1OGW A;  1FXT B;  2IBI B;  3JVZ X;  3RUL A;  2CR5 A;  3PGE A;  5KHQ A;  4M0W B;  3A33 B;  3GOE A;  2KDF B;  2KTR A;  3ONS A;  3DVN V;  2BWF A;  1WMH B;  3PRE A;  4MGY E;  5D2M B;  2B3A A;  3QX1 A;  2RD0 A;  1UEL A;  1WE6 A;  1WXM A;  2KAN A;  2KXJ A;  2JZ3 B;  3QWZ B;  2REX A;  2CHX A;  3PLU A;  3SDL C;  4BBN F;  2NS5 A;  4DHZ B;  4FHJ A;  2MBQ A;  3W1Y A;  2AWT A;  3L08 A;  4BFR A;  2K8C A;  3Q3J A;  4E74 A;  5G2N A;  1GJZ A;  2NR2 A;  1U4A A;  4HJK A;  5AEK B;  4G3X B;  5DCN A;  4KIK B;  3ECI A;  1WGD A;  3ZLZ A;  2I1J A;  1GC6 A;  3UIO B;  3AU4 A;  2K6D B;  2LZ6 A;  4FHK A;  2XEW A;  2N7D A;  3DDC B;  1OEY A;  2EMS A;  4HDO A;  1YJ1 A;  5D7G A;  2KMA A;  4LJO B;  3KYD D;  5G55 A;  2KDI A;  2A5U A;  4TUU A;  3UQA A;  2V4L A;  4ANV A;  2RGF A;  2JT4 B;  2BKF A;  3IVF A;  1P1A A;  1D3Z A;  2ZNV C;  4ZRJ A;  2IO3 B;  3EC8 A;  4I6L B;  3QCA A;  2N9X A;  2KLC A;  4G11 A;  2NPT A;  2VRR B;  4HCN B;  3VFK A;  1V5T A;  3WAL A;  4GDL A;  3DBH I;  1YQB A;  1IPG A;  1V86 A;  4E71 A;  1Z5S B;  4GDK B;  5AZF A;  2MBH A;  2MBE A;  2A4Z A;  2LGD A;  1WZ3 A;  3SHQ A;  4FBJ B;  1WJ4 A;  2KJH B;  2AEH A;  3GZN I;  2GBM A;  3PVL A;  3VTV A;  4AUQ C;  4W9F A;  2D11 A;  1TTN A;  4WJP A;  1OQY A;  2GOW A;  2C5L C;  3L54 A;  1V81 A;  2GBN A;  1RLF A;  3VUW A;  2IY0 B;  4FLH A;  4N9F 4;  5TR5 A;  1WY8 A;  4DHJ D;  3KYC D;  3W1S C;  3ZW3 A;  1V6E A;  2FID A;  2MSE D;  2ZCB A;  1ZKH A;  5C1Z A;  5JH5 C;  1I42 A;  2LI5 A;  3UQB A;  2L8J A;  3T9L A;  2KNB A;  3PZD A;  4BBN C;  2MA9 B;  3ENE A;  2G3Q B;  4ANU A;  3OJ4 B;  4WWO A;  2DAJ A;  2L7R A;  4GU2 A;  4TKN A;  2K25 A;  3TIX A;  1LM8 B;  2KHW B;  3RZW C;  3JYU A;  4PS8 A;  3HHM A;  1UD7 A;  3WIM A;  2DHZ A;  1V5O A;  1WGH A;  1BT0 A;  3ML8 A;  2OOB B;  1UBQ A;  2BKR B;  1YIW A;  2G4S A;  1WF9 A;  3ZNI D;  3AI5 A;  4NQK E;  3OJ3 A;  2KJR A;  2LAS A;  4XC2 A;  2RSU A;  4GOC A;  1E8X A;  1V80 A;  2AL3 A;  5E6P A;  2D07 B;  2JUO A;  4IUM B;  4JL9 A;  1P0R A;  4K7S A;  4B9K A;  2LVP A;  2CHZ A;  3SD5 A;  3ZRC A;  2FCS A;  3X0W A;  3RT3 B;  5JHB A;  2ZVO A;  2AL6 A;  3V61 A;  3H7S A;  2WX0 A;  4K7U A;  3PRM B;  3V62 A;  3U8Z A;  3ZDT A;  3NS8 A;  4WJO A;  1WX9 A;  3RYT A;  3N3K B;  2KJ6 A;  4HPM B;  4A3O A;  2L0F A;  3AXC A;  3RD2 A;  3O65 B;  1TBE A;  5DPW A;  4IG7 B;  3TMP B;  5GMV A;  1E8W A;  3CF6 E;  4EZJ A;  2K8B A;  1T0Y A;  1MG8 A;  4CYE A;  3PPA A;  4BKS D;  4DK5 A;  4ZRI A;  1E90 A;  1K8R B;  2M1M A;  3EFU A;  4GB9 A;  3NY5 A;  2DAF A;  2FNJ B;  1S1Q B;  2L3Z A;  3APF A;  2GMI C;  4DHZ E;  4DDG D;  4I6P A;  4J6I A;  1TZ1 A;  1RAX A;  3ZUN A;  3ZRF A;  2KX0 A;  3Q3F A;  1V2Y A;  4KSL C;  3U30 A;  3PRZ A;  3WAO A;  4KV2 A;  4ZDV A;  3RCZ A;  1XD3 B;  1EO6 A;  1XQQ A;  3KVF B;  2BPS A;  2R2Q A;  1UGM A;  3IBE A;  4PYZ A;  3IG3 A;  3CSF A;  3TBL D;  3B0A A;  2XBB C;  3VUY A;  2J0K A;  4AP4 C;  4LDT B;  4W9I A;  5AZG A;  1C3T A;  3MJW A;  2ZNV B;  4BOS C;  2ZPY A;  4JQW C;  4ANX A;  1WX7 A;  4NJ7 A;  4ZRK A;  2YLM A;  2V1Y A;  5CX3 A;  4KZC A;  2N7E A;  3VDZ A;  2KMC A;  3T8M A;  3ZNG C;  4HK2 A;  4RMA A;  3DVG X;  2GBK A;  1EF1 A;  4K7W A;  3QA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...