4WU3A

Structure of the ptp-like myo-inositol phosphatase from mitsuokella multacida in complex with myo-inositol-(1,3,4,5)-tetrakisphosphate
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
590
structure length
590
Chain Sequence
PAVVKNPPKLALKIDRADVNQLPRNFRMGSDKYVGVTKTGIMPTRKGMDTMNVSASSCFSEKELEAILKKVPVKPSQFYDVDLRGESHGYLNGTAVSWFANHDWGNDGRTEDIIIPLEKEQLASLKGSTVKSIYRFDDKKNVILSPVYVNYNKVRTEEEMVKQHGANYFRLTLQDHFRPDDPDVDKFLEFYKSLPKDAWLHYHSYAGMGRTTIFMVMHDILKNAKDVSFDDIIQRQKLIGIVDLSEIPDKKKNYGRKAYIERYQFVQHFYDYVKENPDLKTPYSVWAKKNKVNSWEPDYNGYIWRLDTKDRNQLPRNFRTMNSAFRTDVNVKKTGKGFTPTPTRKGLDTLYMSGSAEFSNGELQAMLPVLKQQAKGPIYIMDLRQETHGVFNGNAVSWYGLRDWGNLGKNKAEVLKDENSRLNAARGKSLIVAELDKDKMPIDPKPVKIESVMTEQQLVEKNGLHYYRIAATDHIWPSAANIDEFINFTRTMPANAWLHFHSQAGAGRTTAYMAMYDMMKNPDVSLGDILSRQYLLGGNYVAYEIAKPKPDQWKADYYHQKAHMIEKFYQYVQENHADGFKTSWSQWLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the PTP-like phytase from Selenomonas ruminantium in complex with myo-inositol-(1,3,4,5)-tetrakisphosphate
rcsb
source organism Mitsuokella multacida
molecule tags Hydrolase
molecule keywords MYO-INOSITOL PHOSPHOHYDROLASE
total genus 205
structure length 590
sequence length 590
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2014-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wu3A02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4wu3A03
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4wu3A01
1BZHA 2GP0A 4GFVA 4GE2A 2HVLA 5IBMA 1GWZA 2A8BA 5BX1A 3BLTA 5BZXA 5K22A 2F6VA 2I6PA 3NMEA 4GE5A 1RXDA 2CFVA 3I36A 2P6XA 1FPRA 4JMJA 3QCEA 5KA0A 3OMHA 3ZMQA 1C87A 1ONZA 4ZN5A 2CMCA 3S4EA 2QBPA 1Q1MA 4NWGA 3LJ8A 2B49A 1L8KA 3AWEA 4OHHA 2QDPA 1PTTA 2I42A 3H2XA 3QCCA 3V0FA 2VEWA 2H02A 2H03A 4OHEA 1ZC0A 2IMGA 5J8RA 3QCGA 4WTYA 2QDCA 1Q6NA 4IKCA 4WOHA 4GS0A 4QUMA 1A5YA 4D3QA 1V3AA 2FJMA 3I7ZA 2H4KA 3AWGA 5KA2A 2CM3A 3F41A 1JLNA 2CNIA 1BZCA 2DXPA 2QBQA 3EU0A 3S4OA 3O4SA 1D5RA 3D1OA 2HNPA 4OHIA 2NV5A 1PH0A 2BGDA 1NNYA 4I8NA 3EZZA 3QCDA 1C86A 2CM7A 1OEVA 1U25A 1OHCA 2FJNA 5KADA 3I80A 3F9BA 2B4PA 3S3KA 1YTWA 4JNBA 2QEPA 5KAAA 2E0TA 3ZM3A 1I9SA 2J16A 2PT0A 4YR8B 5M43A 4DGPA 2Y96A 5K23A 3MMJA 2HXPA 1U26A 3ZM0A 1XBOA 3OLRA 3EB1A 4GRZA 2Y2FA 3V0JA 3F9AA 4NYHA 1FQ1A 1ZZWA 1YGUA 1J4XA 1T4JA 3V0GA 5KA7A 1NWLA 4YAAA 4GWFA 1OHDA 2PQ5A 4RKKA 5K25A 4Z6BA 4R30A 5K24A 3QCHA 4R0TA 4ZI4A 2J17A 2I6IA 5EHPA 1WRMA 1YWFA 2HCMA 2OUDA 3S3HA 2QCJA 3D42A 1Q6SA 3CM3A 2Q47A 1PTYA 2A3KA 2B4UA 1P15A 2MBCA 1OHEA 3D1QA 5KACA 2HC2A 2NT7A 5AWXA 3V0DA 3AWFA 3O4TA 3V0HA 2F6YA 1C85A 2F6ZA 2HNQA 5GTJA 4QBWA 1G7FA 1LYVA 4NWFA 1XXPA 1X24A 2OC3A 2HY3A 3QCIA 5K9WA 4ERCA 2QBSA 4RH5A 1Q6PA 5KA3A 2Q05A 2PA5A 4WU2A 1Q6JA 4JMKA 1SUGA 1OEOX 4ZRTA 2F6WA 2F46A 2F70A 4PYHA 2BGEA 2NT2A 4RH9A 4ICZA 3N0AA 2CJZA 3U96A 2NTAA 3V0IA 5EHRA 1KAVA 3ZV2A 1PA1A 3SMEA 3MOZA 2P4DA 4H34A 1Q6TA 2CM2A 4S0GA 3F81A 1C83A 3ZM2A 1G1GA 4HRFA 3EAXA 3QCBA 4HJPA 1OESA 1OETA 1L8GA 4JBCA 2VEXA 4OHDA 1T49A 3GXGA 4RI4A 5KA1A 1QZ0A 2C46A 2JJDA 3RZ2A 4BJOA 1LARA 2QCTA 4WU3A 2I75A 4D3PA 4RDDA 4NX8A 2I5XA 2ZN7A 3O5XA 1G1FA 1G1HA 1PXHA 1WAXA 1NZ7A 2SHPA 3QCNA 3A5KA 1YTNA 3M4UA 4KYQA 3S3EA 1G7GA 2G59A 3ZM1A 3D1HA 1M3GA 4RI5A 2OOQA 2QBRA 4H1OA 4HJQA 2B4OA 2HC1A 1OEMX 2YDUA 2I1YA 2B07A 1KAKA 3A5JA 3D44A 2F71A 2AZRA 2H4VA 4B04A 1YPTA 2I4HA 2GJTA 4GE6A 2I3RA 1PTUA 4Y14A 4KI9A 1ZCKA 1GFYA 2I4GA 5KA9A 3D9CA 2CMBA 1I57A 3S3FA 2FH7A 1YZ4A 2VEYA 4PVGA 3EMUA 4QUNA 1FPZA 1NWEA 2C7SA 2GWOA 4NNDA 2PBNA 2PSZA 2B4SA 1YTSA 3QCMA 2WGPA 4QBEA 4TVVA 4RHGA 2M3VA 4BPCA 3QKPA 4GRYA 3PS5A 2CM8A 2NZ6A 3V0EA 1Q6MA 1OEUA 3BLUA 2I6JA 2BIJA 1EENA 1YFOA 2I4EA 1NL9A 2PI7A 5KA4A 1YN9A 3QCJA 2ESBA 1ONYA 3F99A 4D3RA 2QDMA 2BV5A 3RGQA 1C88A 1EEOA 2F6TA 2J16B 1AAXA 2CNFA 1LQFA 1PA9A 2CNGA 4GFUA 2H4GA 4AZ1A 1WCHA 2CNEA 1C84A 1XM2A 3QKQA 2RF6A 5IBSA 4DGXA 3O3LA 3QCLA 2OZ5A 2I6OA 4QAHA 1YGRA 1ECVA 1JF7A 1BZJA 2I6MA 3O4UA 1PTVA 1VHRA 5I6VA 1MKPA 2HB1A 1T48A 2NLKA 1I9TA 3SR9A 1R6HA 3RO1A 2G6ZA 2R0BA 4Y2EA 3GXHA 3MOWA 2F6FA 5HDEA 4KYRA 5K9VA 4MBBA 3CWEA 2I3UA 5KABA 2H04A 5KA8A 1G4WR 5BUGA 3QCKA 2AHSA 3BRHA 3ZMPA 5LXQB 2CNHA 3BM8A 5BZZA 2ZMMA 2VEUA 1U24A 4QAPA 3RGOA 3QCFA 2B3OA 1XRIA 1ZCLA 4OHLA 1XXVA 4J51A 1NO6A 3B7OA 5MMZB 1QXKA 1RPMA 1PYNA 2VEVA 2CMAA 2BZLA 4R0SA 1G4US
chains in the Genus database with same CATH superfamily
5C25B 4R5PA 2R7SA 2CPYA 1Z4UA 1SJQA 2POKA 3JSYA 3MEDB 1ZZNA 1JKHA 5EX0A 3M8YA 4R8UA 1LQ9A 2HVIA 1KHWA 3BO4A 1O51A 1RSCA 2KZZA 1K1SA 2HVLA 2LP4A 1NK7A 2C2KB 4KC5A 2ASYA 2VL1A 2CAJA 2QLWA 1RTZA 2H9ZA 3DOLB 3MECA 5I3PA 1RB0A 4HT5A 2YWHA 2GIFA 3W8GA 5A8WB 1MW7A 4RUHA 4GE5A 3ET6A 5K22A 2ZH3A 5AT1B 1VC0A 1RXDA 3ICLA 2BQUA 3Q8UA 2GMLA 2YPZA 2QL7B 3IAS9 4LBPA 2NXEA 3WQPA 4YMEA 2UUWA 4DL6A 2FY1A 2C3MA 2MQLA 1GNKA 1P8GA 4FYWB 4ZVFA 4KY3A 5BYRA 1U1OA 5KFVA 3KWMA 4JMJA 2MYFA 3G2XA 5KFAA 4WFYA 4IOBA 4M5IA 5E3AA 3BQ1A 1RU1A 3DDKA 3ZMQA 4OZNA 4UZCA 1IKYB 1CJKA 4J90A 2E7WA 3KJQB 4WE1B 3D0IE 1FJGF 1ONZA 1U8WA 5KT6A 1N33J 2P8IA 4NLQA 2B49A 5DDRC 2OTLS 4ZK7M 3MTJA 3OT9A 4UT4A 3AB2B 2HS4A 4NYPA 1S9GB 5E2QA 3H2XA 4LQ9A 4OI2A 4GVBA 4X4UA 2BZ2A 2HNYA 3V0FA 3LP0B 3RRHA 2R3VA 2CPFA 3DU5A 3I0SB 2CQBA 3GYGA 4CLFA 3R27A 4Y2CA 2CNOB 4UY85 2BM1A 4IFYB 3M2VB 3R5GA 4L3KA 2XMTA 4JI6F 4R0JA 2L41A 2HYIB 1XNQF 3FFIA 5KFIA 4AL7A 2A1BA 3Q8QB 2H03A 2XG8A 1SJ3P 4UY8T 1ZC0A 2IMGA 2VQEJ 3OHBA 4WTYA 2R9LA 3RGIA 3H5XA 2BJ8A 3T41A 2QGFB 1AYEA 4EU0A 2ZVIA 4K7QA 1QVFR 4G1QB 2DNQA 1HKAA 3I87A 3HHKA 4DU8A 3JTPA 2LMIA 2U2FA 3VGTA 4DPWA 4F04B 2RKIB 3TYTA 3I7ZA 1TU0B 3QCCA 2PIIA 2H4KA 3BB5A 4OJ3A 4MYUA 2AGQA 1TUWA 3H0PA 2CM3A 3FC9A 2VKZG 2PEBA 2ACMA 3QRQA 1FXLA 1W7KA 3LPEA 4RBTA 3LK7A 4O0NA 2U1AA 1REVA 3ISNC 4DQIA 4OHVA 4JI7J 2DXPA 2XPCA 1RQ0A 2EBEA 5KFZA 1LWEB 3CC4S 5DZ6A 1RTDA 3HJVA 2VKRA 3TAMB 5FLXY 1FDDA 5HJXA 5HVHA 3D1OA 5M2RA 1RT4B 4L74A 2HNPA 2NV5A 3MM8B 5HQMA 1GMWD 2IMWP 1N6QB 1PJ5A 4JUZA 3FRZA 1KVKA 4TY8B 4LFBJ 4Y2AA 3N6NA 1U1LA 1QDUB 4URSA 2HAIA 4ZA1A 1A0OB 1R0AB 2VG7A 2GVDA 2DYAA 3BREA 4LRCA 1DTTB 6AT1B 1VBXA 2YTCA 1S0NA 2APOA 1RWOB 4LFAJ 4UTGA 1OEVA 1RADB 4P7TA 3LH2S 4AT1B 3ETMA 2NS1B 3FEYB 1H7WA 5KADA 1FJCA 5J2MA 1IN0A 4PWWA 4RO0A 4ANCA 4ZKAA 3I80A 3EZZA 3QRPA 2X5OA 3J81j 1HR0J 4WWSA 5EGYA 3T5JA 2E66A 3MF5A 3OTEA 4OZ2A 1IKXA 3UW1A 1R6VA 1VK8A 2UXDF 4PWDB 4W90B 3F9BA 2VBYA 3QO9B 3TJAA 2D9PA 5KFEA 1PC4A 4C98A 1APSA 1IBLF 4ZVTB 1FRMA 2FJAB 2GIRA 2E0TA 2MZSA 1KS2A 3LF0A 4CO0A 2WCXA 2KM8C 1F60B 1X31C 2X1AA 3DOLA 1VOMA 3IC1A 1EP4A 2E1MC 1NLKL 3MECB 1B4SA 3G8QA 4DCOB 3MMJA 2BJ9A 4HHJA 4DMZA 5A8WA 3SZ2A 3NKYA 5K23A 1RISA 3ZM0A 2DIVA 2W01A 3HFKA 3O44A 2ZH5A 3D28A 4OX7A 5C7PA 2ATCB 4GRZA 4B3MF 3R5AA 4IG3A 2HHVA 1HBUB 1VHIA 4P7VA 5E41A 4EEYA 4X4RA 2JEGA 2BACA 1T05A 4F26A 1ZZWA 3M32A 3TA2A 2BQRA 3EZ5A 2AW0A 2N82B 3AB4B 2NREA 4FF1A 2DK2A 4GO7X 5B0FA 5LSOA 4IRDA 2H5IB 1J4XA 1IKYA 1HHSA 3LGMA 3CJ2A 1KOHA 3FEZA 1QUPA 4I2PB 4RNMA 1NH7A 4NI2A 4DPTA 1OJ4A 3CB4A 5KFNA 1S9EA 1MN9A 4LSNB 2XO7A 4AL6A 2GO8A 3EUNA 2LQ5A 4PYAA 2MSTA 9ATCB 1AFJA 4KH0B 1NXIA 2DCUB 3GFZA 1TK8A 4F4AA 2ZH6A 5KFGA 5K24A 2GC6A 2OPQA 4ZVRB 3QCHA 5E5NA 2KKHA 2VPXB 3IBWA 2DH7A 1R27B 2YNHB 1PC5A 1DY3A 4B9MA 3HT0A 1R7IA 4QWBA 1CG2A 3KUGA 1FERA 2WSCC 3D42A 3CCVS 3W2WA 4NRTA 2A0FB 1QAJA 1WG4A 4NCBA 5CYQB 1CEZA 2MDAA 4WZQA 1FHTA 3FSXA 2DVIA 1UFWA 1KFDA 1RT5B 2HPUA 3WX4A 1PTYA 4IKAA 1P15A 3TZYA 5A8KA 3G96A 2DISA 3K5MA 3PO5A 3LGHA 3IM8A 3Q86A 4RW7B 2YQ1A 1MG7A 4PG6A 2CQ0A 2CPJA 2K3KA 1WC5A 2YX4A 4USHA 3KJVA 4ZCLA 1N48A 4ELTA 3ADAC 4DR4J 5AWXA 3V0DA 4IRKA 2LA6A 1TVRB 2I1RA 3AA8A 3V0HA 5CCMA 4O4RA 2HHHJ 1M5KC 1G7FA 3SQGB 3ZL8A 2KRBA 3CMAS 1UFLA 3BEGB 3ILIA 3HXMA 3J7AN 1FK9A 2MLYA 2XMVA 4LF1A 4PCQA 2ATLA 2F4VF 2QC3A 1VIOA 1S1XB 4Y6IA 1YGYA 2WVDA 4MYTA 1SIZA 4C8OA 3K0JA 4XIUA 1Q6PA 2OMOA 1FTCA 4DFMA 1HBNB 4A8FA 5GAGI 1CJUB 4DPYA 3THPA 3D0GE 4ZCKA 2F8HA 4ZCIA 2AZ3A 2H1YA 2GQ2A 1RXOB 2D1CA 3FNNA 3KKFA 2I8EA 3N28A 3O1LA 4O0IA 4QU7A 2W7AA 4TNOA 2J6SA 4K0KF 2F6WA 3MEDA 2F70A 2RU3A 2CG8A 4QDIA 1U1RA 1PKUA 1D9AA 5HO4A 3IRWP 2BGEA 5KG4A 4X66J 1HWIA 2ZM6J 5C42B 5KFWA 1W2BR 2JLFA 4AD6A 3HLUA 2OPRA 1QTNB 5KFRA 3SV4A 3IFEA 3N5BA 3LP2B 1Y11A 1VS3A 5G0RA 4ICZA 3AOBA 1H0HB 2CRLA 5A0YB 2JEFA 3P5BP 2CQHA 4DR7J 3OPKA 3NLCA 2LDYA 2RQ4A 2YY3A 4ANEA 1JQGA 3E3XA 3VGUA 3CPWR 1TK0A 4BCAA 4J91A 2XQCA 2XMWA 2N7CA 5IXUA 2OGUA 3DLKA 1I6JA 1EX8A 3RUBL 4HLBA 3KLVA 4ECYA 1J27A 3W62A 1OY8A 3I6PA 3TVZA 2MXYA 2WTZA 4OJ1A 2HW3A 2RAQA 1KFSA 2IMOA 2VDHA 4WP8A 1HD1A 3DC2A 1PCAA 1NPPA 3FCHA 1G3OA 1NK9A 1VBYA 4OHWA 1TELA 2EG2A 4YDXA 2HFSA 1SL2A 2ZH8A 1QAXA 1SJ4P 3I0SA 4K4WA 1DTQA 3TRGA 1AZSA 3BH7B 5IT9U 1SL0A 1LNQA 1L8GA 1TR0A 1CJTA 2HBRB 1FJEB 4K4UA 4J5OA 4ED7A 4QW8A 4OX9F 1RHMB 3J81U 3MUVP 2R7XA 4TU7A 5KA1A 4C9DA 2C46A 4HDHA 3OHAA 3V2UC 1OS5A 4O3QA 4BJOA 2BV3A 4FKXA 4PPZA 1LK5A 4UOHA 1T9UA 2X3DA 2CQ4A 3QNWB 1ZTTA 1SKRA 1RWVB 4D3PA 3NG8A 1SPBP 2B9EA 3ZZYA 4KGXB 5CCLA 1X4HA 4CO3A 2OMLA 5BR8J 5L39A 2I5XA 3DRPA 3GIMA 3P5TL 3EYZA 2DGOA 2RD5C 4KAIA 2CXEA 2MJNA 1Y00A 1SVDA 3BGRA 5E3QA 1U6FA 2IVFB 4CO5A 4OI0A 1G1HA 3CCMS 2Q43A 3WIVA 4ZN3A 2GGPB 3OL6A 5B0BA 4LF8F 5AE2A 2HSEB 3LWLA 2QMUB 3A5KA 1RCXB 3DFEA 1UW4A 1YTNA 3JYTB 2YKMA 4K59A 3MMBB 3R3TA 4KYQA 1N5VA 3M6UA 4ZVUB 4F36A 2MQOA 3DDNA 3OSNA 2HLUA 3VVUA 2W2QP 2UVWA 2HHQA 2PMHA 2CWKA 4DPXA 4QIEA 4LF6F 4RI5A 4ZS6A 3GP9A 5EWEA 3P4UB 3C66A 2DGUA 1U1KA 3H98A 1S1TA 3NRBA 4KH1B 1KR4A 3CO9A 4NPOA 4CNZA 4I68A 3MZIA 2QBRA 4RUAA 4HJQA 4IQMA 4DV2F 1FKOA 2Z2MA 3B6BA 3D67A 2BXJA 3FDSA 1FEHA 2QSWA 5DJBA 2HIQA 2B4OA 2D74B 2JL9A 3M8PA 3RBXA 2EW9A 3CCTA 5CH7B 3TAQA 3RR7A 1URRA 2B8PA 1MROA 1WEXA 1VQNS 1DHMA 5CZXA 2P5VA 2XMKA 3HFZB 3TNVA 3BKUA 3C6UB 4LVNP 1NDKA 1T7PA 4KO0B 2KFZA 1FWPA 1IKVA 2RRBA 3W7BA 1K73T 1GMVA 2EXUA 4DV6J 2IDEA 3GZ7A 1HNZJ 1H7XA 1FE0A 4OIXA 3A5JA 1NSAA 1GT8A 5LMUJ 4OV1A 3D44A 4IR1A 1CPZA 2R7RA 4B04A 2P6SA 3R7BB 3IM9A 4MMOA 2HS3A 3SCJE 4QWEA 4WJBA 3POTB 1Q53A 4U8VA 3CJKB 4NA2A 1LXNA 4M94A 2BEFA 3E51A 3FSIA 3N9UC 1LW0A 4X66F 1REGX 2ZM6F 3KLEA 2LEBA 2JSXA 1PTUA 4OZ1A 1WTFA 1V9OA 2BRLA 3QAUA 4H4OB 1CC7A 1ZCKA 2I4GA 2JC0A 2EFOA 3H8YA 2D7SA 4MIAA 2NZCA 1S72S 3D9CA 2C2OB 3ZTQA 1WG5A 2DEIA 2XZTB 3OR1A 1YDLA 1BQXA 3BBBA 5D4OA 3W9HA 4HL9A 3SDEA 4YHHF 4MIBA 2XI3A 3VAHA 3HFVA 3I0RB 5L9XA 4DL3A 4PVGA 3KHGA 4FBUA 2W9BB 3EMUA 2WHOA 1U7LA 1HFEL 2I38A 4KFBA 5BYQA 4ED6A 2C7SA 1VI7A 3O8WA 4BC7A 1CVJA 3TX0A 1CS4B 3UDVA 1XNRF 2V4JB 3CVKA 3MR5A 2WJPA 2HFZA 1S5ZA 2D3UA 2XM3A 4M5DA 4LIWA 2J9CA 2VHGA 3C8YA 2ZVSA 2GWOA 1NCLA 2CQ2A 2H48B 3Q8VA 4G1QA 4OMFG 2B4SA 2G0IA 5GADU 4DN9A 1Y7PA 2WVCA 3DGPB 4DUTA 4TU9A 1I51B 1S57A 2K1RA 4KT0C 4Y3CA 4BC9A 5DRKA 3R97A 1FRLA 3AHPA 2E9ZA 1L3TA 2DRBA 2RDDA 3EZOA 2Y1RI 3T6JA 1ZBTA 4EYHB 4K5RA 1Q0NA 2ZHBA 2IA6A 3DLBA 3N6MA 3MGJA 3MM7B 4TKTA 4WYLA 4ZPVR 4FS2A 1S1VA 4B9UA 2Z2YB 2HBQB 3QJPA 1QAYA 4B3SJ 3RU0A 1U02A 3HD2A 2V9WA 2QA4S 1IUJA 1YJNS 4OZJA 5KFSA 2MKCA 3KYLA 1SXLA 4EK2A 4B9LA 3HP6A 1U0HB 1X0FA 4LMZA 5IT0A 1F0XA 1GX5A 1BQNB 4OYBA 5IT4A 3V0EA 4HVZA 2QT7A 1VJQA 1HQEA 3DLEA 4S0MA 1FK9B 4DL0C 4CLUA 5L46A 3L09A 4KHRA 2MZRA 5KG5A 1NAQA 3BKFA 2XGQA 2I6JA 3OD2A 4R8UB 1FT8A 4NZ6A 4PZVA 2MB0B 2Y1OA 1HQUB 2RS8A 2X1BA 2PI7A 1O5ZA 2AJ0A 4CLWA 4DX7A 2EFVA 1F2GA 3KNGA 3QCJA 1HD0A 5J2MB 1NHVA 4AXJA 1LWFA 5KFUA 3V4IB 1NJWA 4LF2A 1ONYA 2G13A 2KJVA 2P9GA 3F56A 4X4SA 2UP1A 2R8JA 3HT3A 4PWUA 5B08A 1XR7A 2MZTA 3V6DA 2WBRA 2X3GA 2RRNA 1EEOA 1N88A 3A3OB 3QIDA 1LEOA 1RKIA 3AD8C 3G82B 3GLJA 1JLAA 5C24B 5HN0A 2RQCA 4DV2J 2GC5A 3GFXA 1KQFB 1HNVA 1F9HA 1R43A 3CJ8A 2CNFA 1TUGB 2B7CB 3NY0A 2J7KA 1PG5B 1JJ2R 4RBUA 4JI8F 1ZAWA 4RHGA 2R2SA 2CNGA 2H4GA 5H9FJ 1U1PA 2MPUA 2YKQA 4NLXA 2JVRA 2CQCA 4W98A 3VAIA 3ZFVA 2R7VA 2CNEA 4D3HA 4AZ1A 3PCOB 2MLXA 2XMMA 4ER8A 3FBCA 5H1SV 2VQFJ 4F4ZA 3N6LA 4I2QB 1S6PB 3ETOA 2FLLA 2AJFE 4U8YA 4N7TA 3M2UA 3DHXA 2UU9F 5ITHA 2UVUA 3QT7A 4OV6A 4J9PA 1JF7A 1HWJA 1MWQA 3K5OA 3Q8SB 1WEYA 2ADCA 4B3TF 2P9CA 4HEA9 4QIFA 4ZIYA 5I6VA 2D3OR 1HPZB 1PILA 1X4DA 3GE9A 1RI7A 2FVRA 1MKPA 2CPEA 4ECWA 2E1AA 3Q83A 4HACA 4ICLA 1P31A 2EBGA 1N34F 3JB9k 1VRTB 1WC1A 2VFVA 2RSQA 1C0UA 4DN0A 3Q24A 2UUBJ 4QIGA 3T1YJ 1R6HA 3AY0A 2RDIA 2ROGA 1Q1KA 1JLBA 2BVZA 5CZVA 4N47A 1U45A 2VTEA 3RO1A 2C2MB 1ICEB 2BE9B 2CJBA 3CJRA 2KVQE 2EI5A 2MGZB 2R7TA 1UFKA 4QYZK 3IWXA 3NEKA 3PRDA 3OLBA 2VFRA 3NGRA 4I6AA 1KQKA 5HDEA 3W60A 3J7A1 4B3TJ 1IR1A 5CABA 2E29A 2MZ1A 2XY5A 2FVQA 1XQIA 2DGWA 3EM1A 1HBOB 4ETZA 2FZKB 4ZPBA 1R6YA 5HMWA 1UWBB 1FX2A 5AJ3J 2DNKA 5LMNJ 2DXFA 2UZAA 1OPIA 3GYNA 4ZP6A 5A8KB 4ED1A 2E1CA 2BDPA 1Q16B 2QTWA 1SB6A 4ZVPB 2V8GA 3BPSP 5BUGA 3SI8A 2AHSA 2CJXB 3MEEA 3RW7A 2R4FA 1FNOA 1S1UB 2AF6A 2C42A 2KG1A 3DRXA 4BLGA 3LA0A 3OTOF 5FDLA 1N6QA 1TKTB 4UF4A 3TQEA 4NLGA 1QLNA 2H65B 3ITHA 2CNHA 3BS9A 4DI6A 4TQSA 2MMYA 3NNHA 2VEUA 3DNCA 3FUYA 2I5JA 3BR8A 1ULRA 1UW9A 2J5AA 3Q22A 1XNRJ 4Q0BB 2MQMA 1VBKA 4YQWA 3QCIA 3QCFA 4ECQA 1HI8A 3CIZA 4QQBA 1WI6A 3Q8PB 5ETSA 2M4MA 3PW7A 1A6LA 1NO6A 2OH2A 3IR7B 3PFOA 1M90T 3PTWA 1RPMA 1PYNA 4WFAQ 4TYAA 3AXKA 1FEEA 4LRBA 1Q8BA 3UAGA 2CMAA 4QPTA 2BZLA 2ASJA 4R0SA 3WC2A 1T3NA 1JBVA 3IS9A 1FD2A 1BZHA 3QO9A 2GP0A 2IBOA 4GE2A 2M9KA 2VG5B 4G3IA 2ZH2A 5IBMA 5KFMA 3EXCX 4YP3A 3G4SS 2A8BA 1MROB 1KN6A 1I57A 1VLOA 3PYDA 1IQZA 1H72C 2BOAA 4CM2A 1WTBA 3BLTA 3EICA 2NXCA 2VU5A 3K8WA 4J9NA 5HLFB 2V0NA 4J9SA 1ZTWA 2ASDA 1T02A 3FZ2A 3RBDA 2AJ4A 2YKAA 2YQ3A 5A0YA 1L3UA 1NDLA 3HSDA 4E8UA 2DR6A 2LXFA 2HAFA 4IG3B 4DL4A 1X4AA 3ZXWA 3KTQA 4F2RA 1PAUB 3AA9A 5K14A 5DQGA 5D78A 2WVFA 4NMXA 3W2VA 4YR2A 4K4YA 1GMWA 4ZP9A 1YJTA 2W2MP 1FXDA 2BABA 1LFWA 4ATNA 3UFCX 4JI0J 3J7YU 3CXCR 1B7YB 4LF7J 2DHXA 3OMHA 3C15B 4ZN5A 2JZ5A 3TQ1A 5C5JA 2IM3A 2UXCJ 4K2XA 1TZ0A 1L8KA 4B3RJ 3FKBA 4LRAA 2XHWA 3Q89A 4F25A 2VPYB 3CMQA 1PTTA 2FY8A 2OD4A 3HZEA 5KFJA 3G86A 2I42A 5A5EA 1IKWA 2VA3A 5KTQA 4Q44A 1ZM2A 3OTBA 2AM1A 1RU2A 2EFGA 3A8EA 5MLCV 4Q2MA 4NCGB 4CM0A 4DBQA 5J1PA 2R8KA 1BQMB 5K8OA 1QSSA 4S0GA 3B78A 2KZMA 1YZ6A 4ZITA 4JI1J 3DLGB 2RT3A 2QDCA 2DT9A 4U7UK 4GS0A 2V8VA 4HHUA 2KU7A 2KN4A 2BBEA 4B02A 1UZDA 4D3QA 2HFNA 1A9NB 4PEOA 1B3TA 1HI0P 3PJXA 4QYRA 1KLNA 2XS2A 2J8SA 2CDRB 4OZ5A 4BDPA 2V4RA 1S0VA 3SEOA 1E6VA 5LXYA 1U1NA 3IWLA 4RNFA 2XNRA 1VHFA 3HF5A 2VONA 4LFBF 5KA2A 1YK9A 2KM8B 5D77A 3KLHB 4DSJA 1EKRA 1YZ7A 1BZCA 1FO1A 1WSRA 4JV1A 1M5OC 5KG2A 2NR0A 2EK1A 2FJNA 1ZPWX 2CPXA 2YX7A 1CULA 3AXMA 3O4SA 3A13A 3VAFA 3M05A 4JYAJ 3U1NA 2UUOA 2J9EA 2K06A 2FIUA 1K0TA 4G1PA 3VAMA 1QUVA 3KHLA 1HNZF 2VDIA 5FDLB 2UUAF 2XS5A 3NBPB 5A8RA 3QJJA 2FD2A 3NGKA 4ZPCA 3THTA 1XMQF 2IAJB 3VGSA 5M2PA 1S1TB 3KNAA 5D8HB 2ZZTA 3DLEB 1HNIA 1GX6A 4FVCA 5JUMA 4G6VB 1D8ZA 3NGTA 3SSSA 2KHCA 2N3LA 4DSEA 3BBFA 4N41A 1Q78A 1WC6A 3QSIA 3PEHA 3D7SB 2RHQB 3GB0A 5HBMB 1U25A 1ZAXA 2VBXA 2MQPA 5L1IA 1WNEA 2GQQA 3BQ0A 1OHCA 4Y2MA 2CQDA 2F3JA 5SZTA 1VC6A 3KUHA 2ZH7A 2C28A 3LP1A 3NWGA 3H90A 4USMA 3UVJA 4D3GA 1JLFB 4NLTA 1KD1T 1IBKJ 3BSCA 4KHMA 3JSRA 3GQCA 2OO4A 2X1GA 2AWZA 4YY3J 3IS9B 3QFWA 3OBIA 2B4PA 3S3KA 1YTWA 3MEKA 1YRTA 2OELA 3WBZA 2ZZMA 1KC8T 4PRFA 3HX9A 2QEPA 5KAAA 3QIPB 1XTZA 3WHIA 3OL7A 1YTYA 1BC6A 2J16A 1HW8A 2KJWA 3A8KA 1UETA 2PT0A 2VG6B 4IG0A 4NZ0A 5D0HA 1MWYA 4OX6A 3VZIA 1IJFB 1X9SA 1U26A 2XMAA 3CDAA 5KFQA 4JI3F 2XY7A 4OI4A 3SSRA 3M9MB 2Q79A 3OLRA 1D0EA 4DGXA 1M5HA 1BY9A 2ZUAA 1GXLA 4DV4J 1IBKF 1JBWA 4IDKB 2E1RA 2UAGA 4ECVA 4NYHA 4BUBA 2CFXA 1GXTA 4I2QA 3W61A 1X4GA 3SDEB 5EHHA 4AQYF 4WXWA 1S6OA 4OL8A 3GSIA 4AYBD 2XYPB 4F4YA 1YKWA 3KJNB 2QLFB 3CEDA 4WE1A 3AT1B 1HHTP 1CBKA 1OIAA 1F3FA 4ZLNA 4CZCA 4IR9A 1NWLA 4YAAA 1X7VA 4DQPA 5B0AA 2KT3A 1Q81T 1NEEA 5EWFA 1VRUA 4B3SF 3OL9A 3HSJA 4RW9A 1YJVA 2CJYB 3C14A 3EVOA 3GR0A 2P6XA 2HQFA 4RKKA 2PA8D 5K25A 4J9RA 2A2DA 1UAGA 3HO1A 3MAHA 2I0XA 1BMQB 3CNQP 3DYAB 3MHYA 5IFMA 2C22A 2HVEA 2DR7A 3CD5A 3NGUA 2H02A 3DGPA 2G1DA 4RUBA 1RT6A 4OYZA 1YWFA 3QPIA 1GMUA 1JXEA 1PBUA 2EG1A 5AE3A 2X51A 5GAHI 3S3HA 1J6UA 3QQCD 1UVLA 5E33A 1ELOA 3BGRB 1U2RA 4RJVA 2CDQA 1XNQJ 4EZ6A 1RHJB 1NZ8A 3CM3A 4ECUA 3KOAA 3KK1B 4USWA 2VQEF 5U47A 3MM7A 3E2EA 1RT1B 1HQ2A 3C16A 1X4BA 2BKOA 4F0HA 2UUCJ 3TANA 1H98A 5KACA 2OPPA 1WELA 4MKYA 4LR7A 2V63A 4ZIWA 2NT7A 4N77A 4ID8A 1FRHA 3AWFA 3BO3A 4DV6F 3CD7A 4DF8A 2NSBA 3L9ZA 5RUBA 2F6YA 2F6ZA 4NWFA 2WSEC 4OYXA 1N0VC 5JVHQ 4JV0A 2VOOA 2VASA 3QRRA 1YVFA 2WBMA 3NCPA 4WYWA 2Y8YA 2XCPA 3UNGC 1PBAA 2QLJB 3MDFA 2VBZA 2BQ3A 4YEAA 5DDPC 2Q05A 5GAEI 2AIRB 2ABYA 3O6QA 4TYBA 3NBPA 4DLGA 2BA9A 2C3PA 3J7Z5 4QWDA 4OLPA 3CCRS 1VMBA 1SUGA 2XWXA 2F6VA 2CQ1A 2Y2FA 2XSJA 2HQIA 1HWKA 1QE1B 1OEOX 5LL6d 4ZRTA 3SIPB 4ZJLA 3V6DB 4TU8A 4K4XA 2F46A 3Q2SC 4URQU 4F0MA 1JKHB 4CRJA 4A46A 3ZNUA 1JLAB 2VFUA 2NT2A 3VV2B 4Y2IA 1ROFA 3ENVA 2V5HG 2ROPA 2Z57B 2LQ8A 1PO6A 2B5JA 3NGDA 4M5LA 4Q7AA 3MD1A 1TL4A 1J5EF 4GRSA 4KQZA 4DPOA 2MQ8A 2G1HA 4P2FA 3TUIC 3EPIA 3NAIA 2ZFHA 2AJ1A 2ZJRQ 2BE2A 5J2NA 1VQMS 3CIMA 3EGZA 5EHRA 3A12A 4DZDA 2UXDJ 1Y0HA 4DV1F 4GKJJ 1VLYA 2YKOA 2HHTA 2DGSA 2V2KA 2OD6A 3EMTA 5CD4H 1IBLJ 4MJKA 2AYEA 1S99A 4OX9J 3VCDA 5EUHA 4C3KA 2AKWB 5DDOC 2CUYA 3EDRB 4H34A 1XJWB 1CQNA 1ZOTA 2HGNA 4OI3A 1HPZA 3FMBA 1HBUA 5ETOA 1HA1A 1VJWA 2XEXA 4C8NA 1AFIA 2M70A 3VHQA 4YR0A 2R2TA 1T05B 1S9GA 2XMUA 3RB6A 3BGLA 3HM9A 1KQGB 1RAEB 1SUQB 2E1PA 3CJSA 2EVZA 1C0UB 4GVBB 2QYCA 4NLWA 4HYKA 2ZBCA 1RAFB 4Y28C 2V4QA 3ZZOA 4DV3J 3K8VA 1JLQB 3MPWA 1SQEA 8RUCA 1OYEA 1OETA 2IVYA 3IG1B 3KK3B 4JBCA 2DNHA 4PG7A 4RBVA 4O3SA 2F8EX 3IR5B 4P2SA 5ETPA 3EVMA 4L72B 5A6PA 1T9XA 1Y3KA 2PMZD 4ECSA 3C2PA 1T49A 1QZ0A 3GXGA 2E5HA 2FJXA 2VOPA 4O4GB 3DOKA 4P52A 2PI4A 3US5A 1V5IB 4O23A 2BJ7A 4DV7J 2AYBA 1LW2A 2FYXA 3PZPA 1KQSR 4USVA 2QZ8A 3PW5A 3D4JA 4RDDA 4CH0S 1F5CA 2JFHA 2Z4PA 2E7XA 1IM6A 4NEZA 4NLSA 3JAMY 2ZN7A 5DETA 1S6UA 1U0SA 3TVKA 2HNZB 1KTVA 5ETRA 5AXMA 4CO1A 4WF9Q 1PJ6A 1CJVA 1TKTA 3K7RA 1NZ7A 4J9OA 3NAHA 4RNHA 3C6TB 4BBYA 3ZZTA 3DN9A 3ZM2A 2YWFA 3QAEA 4WCEQ 5H9EK 4C13A 3K5NA 5E0OA 5BYSA 5KG6A 4X4PA 1PYSB 5F9NA 3M4UA 3AFGA 2Z2LA 5J1EB 1SBRA 1SKUB 3J7ZT 1RYRA 1KP6A 2LKZA 1N36J 2GMJA 4WIIA 1XC9A 1GQEA 1G7GA 1H2UX 1IJEB 4PPDA 2J17A 3TR5A 2OSQA 1QD1A 5HI7A 2ZH1A 4M8LA 1KKHA 1KWMA 3D1HA 4URGA 3PW4A 2DNZA 3UN2A 5DG8A 3CD6S 4NLOA 1M3GA 2GHVC 2WB1D 1LWCA 1Y10A 2LU2A 4OJHA 1X4CA 4CNYA 4CYUB 5I3UA 4JI4J 2OOQA 2R7UA 4W92B 4EO6A 5C25A 9RUBA 2DXEA 2HRUA 5K8MA 1RBLA 1IBMF 2VBWA 4ANDA 1YSJA 2DB1A 4BWJA 4MFBB 4FF4A 4EBCA 2NPIA 2K8GA 2HHXA 2V68A 2GJ2A 3MTKA 4P71A 2YDUA 3M6VA 4KGMA 4J7CA 5HMYA 3LP1B 4JV5J 4Z2XA 5B09A 2WZ1A 3CCLS 2B07A 2I1YA 1U49A 1S97A 2M88A 4N8NA 3ZTOA 3RAXA 8ATCB 2IJNA 1YRUA 4PG4A 1C4AA 3KUEA 4KSEB 1AROP 2AZRA 3MR7A 4D3RA 4WFBQ 4A8MP 4F4WA 1OSDA 3UN3A 2P2CB 4NEYA 1YWXA 1S6PA 2Q3PA 3UNYA 3NS6A 1NSQA 2OLWA 2VG6A 4M95A 2WTFA 5ETNA 3GV5B 3PM9A 1L3SA 2EC0A 2VC1A 1TL3B 3C15A 2VJVA 3CCWA 2DRDA 3SCIE 4CDIA 3R1HA 2MHEA 4IFVA 2MKKA 1NZAA 1RWUA 2BE2B 3BN7A 4FBTA 1WC0A 4QOTA 1PYOB 2IC3B 4XDCA 2Y66A 1CC8A 4ZMMA 1HWUA 2HEKA 1VRTA 4F4XA 1IM4A 1YZ4A 2YXLA 3CJ5A 3L7UA 4U9RA 5KOXA 3CTRA 2HBYB 4NCGA 1Q5YA 2Z58B 1X4FA 3MFHA 3EGNA 3HMJG 4NCAA 4ILLA 4QYZJ 3HHNB 3PXGa 3TARA 4I6WA 1U6ZA 1OY6A 2G9OA 2QRRA 1WEZA 2DNLA 3BR9A 4LVOP 2PDAA 4TLRA 3MFIA 3CUNA 3FCVA 1U2CA 1SUQA 2YX1A 5CYJA 2PBNA 1G6BA 3B4MA 3FSYA 5K20B 3S8SA 1YTSA 1I5OB 2OPQB 2OEMA 2DXDA 3I9ZA 4Y0FA 1AUSL 2FHJD 1YITS 4DQRA 5CA5A 3W3SA 3HKZD 1FFGB 4YHHJ 2WGPA 4RR5A 2N7YA 1NB7A 4I1TA 1RT7B 4A8YA 3C3LA 3AAWB 5EN1A 1Q7LB 3IA0A 2PN6A 1BD6A 2DHSA 1WC3A 2L48A 2QA1A 2IVMA 3DOKB 5KFOA 4KHPF 2O66A 3NOCA 1GQYA 2Y1IA 1LW2B 2R7OA 3BSAA 3CJ3A 3D3BJ 4OI6A 3ZZZA 4ZVGA 5L9NA 1NKEA 1OQ6A 2K7KA 1RTDB 2GAHC 2OPPB 4X4OA 4F0KA 1TQLA 1EQ0A 3R7NB 4DXLA 1HNXJ 1HR0F 5KFLA 2NZ6A 2G4BA 1RTHA 2HNZA 1K47A 3B8HA 2W9CB 4KPCA 4KYZA 3UCGA 2H4WB 3C19A 1FX4A 3MR2A 4NLRA 4A8SA 2RB7A 2ZJPQ 3V6KA 2HZVA 1OESA 3BDEA 2O5DA 3M8WA 1S0OA 1OEUA 4KHPJ 1X5OA 3AJ1A 4RW8B 1MNEA 3OQ2A 2LQBA 2W25A 1S1XA 5IOLA 1EENA 2BIJA 2I4EA 1NL9A 2YBVA 2AP6A 2CYYA 5KA4A 2BRKA 2UUCF 1N36F 1RTJA 2C3YA 4WTOB 2AQ4A 2NZ4A 2Y1LB 2UUTA 4A8OA 4DOZA 2B9YA 3ONQA 4K5SA 3N4WA 3F99A 2OUGA 4DL2A 1SV5B 4TXSA 4CYUA 3CO0P 5IC4B 1QJHA 2RDJA 2XSJB 4QR0A 5DLGA 4Y34A 1EIYB 3OJUA 5KG0A 3MM6A 3ZTPA 2V8DA 4ZIVA 1WKLA 3T5KA 4JI5F 1DURA 1K44A 2FJDB 3DLHA 3L7OA 4ECXA 4DFPA 1H6KX 3G6ES 4LR8A 3QIPA 3N5FA 4LR9A 4I4BA 5A2QU 2F6TA 4TLQA 1R8BA 2BKPA 4LF5F 2F4VJ 1LQFA 4FYXB 1PA9A 2CPIA 1FVQA 2ACYA 3AODA 2FGOA 4QIVA 5EX3A 1H74A 5D6GA 1KNZA 3N2AA 4GFUA 4C8ZA 1NRKA 3FBBA 3BSOA 1N34J 1DLOB 1C84A 3QKQA 2RF6A 3PKYA 1UPMB 3UN5A 4X64F 1BLUA 3ZTSA 3QCLA 5DG7A 2MTLA 4JI5J 2OZ5A 4QAHA 3HPOA 2G2ZA 3MD3A 1VQ6S 2Y0SD 4PUOA 2KHDA 3LP0A 3R5BA 1LW0B 1MSWD 1YGRA 4YB5A 5IS2A 3PY8A 1TL3A 2GMHA 5DQHA 2VC0A 3W2VB 1BQMA 3FVYA 5KOWA 2JFKA 4IFVB 1S9EB 3A8IA 1PTVA 2FC9A 4L6V3 4OYPA 4N5SA 1TKZA 3PJ9A 5T7LA 3DLGA 3HULA 1SIWB 4X65J 2FLNA 2VFSA 4GC7A 2Y67A 1RWXB 5FD1A 1TMMA 2H5JB 1Q5VA 2QO3A 3DM2B 5D4NA 1RT6B 3PW0A 2R0BA 4M5JA 1X9WA 1WACA 3H20A 1QTMA 2YNHA 4GKJF 1ZYQA 3GXHA 1TKXA 2DNGA 2Y1JA 4OQJA 4DR6F 1E8CA 2B9WA 2V4JA 4DSFA 4H4KC 3J80Y 5KT2A 3I82A 2C2RA 3TUZC 1HLWA 4ZJOA 3EX7B 4NASA 5HK4A 3A8JA 1EJ7L 4L3NA 4C4WA 4RW7A 1SH0A 2DNNA 1ZA1B 2L9NA 1ZAVA 1RT4A 3QCKA 4J9VA 4WFXA 1T94A 3I32A 3GIKA 3UR3C 4QBUA 1GAOA 2HZCA 3AD7C 4ZDNA 4TY8A 3SV3A 1ZETA 1S1WA 1G1XA 4FPIA 4QWAA 5IQQA 3KHRA 1VFJA 1T9TA 1QY7A 4QAPA 3EGVA 3HJFA 4C11A 2JNJA 4ILMA 4M5NA 1JLGA 3RGOA 3GR1A 4NXMF 2B3OA 1G1FA 4FZVA 1NPRA 2AYGA 2E44A 3CWJA 3H25A 2JEJA 4PQUB 2W9CA 4FXVA 4OZLA 1XXVA 1YX2A 4KPYA 1FGSA 3M1VA 2ILYA 4ZLPA 3UO0A 1BQNA 4Y2KA 1TL1B 3H59A 5JMNA 2QX0A 2DNMA 3JTNA 4RPFA 4V1Ak 5DO2A 5AXNA 2ZBQA 1NWEA 4OYMA 4UZBA 3M8SA 1IR2A 1W7WA 2BANB 3WIUA 2ZKUA 3OFGA 3TP2A 5HSPA 5DM6Q 5HVGA 3V6HA 1GWZA 5A76A 3PX6A 5BX1A 2C2DA 4ENOA 3GILA 3PV8A 1P1TA 4IG0B 1DQAA 2ZOFA 5HMZA 2ALYB 2BKNA 3GJTB 1FWKA 3LP2A 1RAJA 5G0RB 1RAAB 4DV4F 3CMES 2I6PA 3DXBA 2V2VA 2Z0GA 3I36A 3GG0A 3MAQA 3MOJB 6FDRA 1T03B 4YB7A 4Z7CA 3W5YA 2BUNA 3UQSA 2XSFA 2DNRA 2IJFA 2CWXA 3M8QA 1FPRA 4TVAB 1NKCA 1SC6A 3DCAA 3TEHB 3N79A 2E5LJ 3QT8A 3CJKA 4F67A 5DGBA 4F2SA 4B3OA 1HNVB 1ZM3A 2ZKTA 3AOAA 3OLAA 5L1JA 4HH0A 3OTDA 3RZAA 4DR5F 2K2PA 4MH8A 5IM0A 4DR3J 4H4OA 2QBPA 3MMAA 1Q1MA 4J9QA 3LJ8A 4LSNA 3K17A 3M30A 1NJIT 3GMGA 3K58A 3AWEA 1SC3B 2QDPA 3D0HE 1DQ9A 4OHHA 2HHWA 4UOGA 1B70B 2VJUA 2DR8A 2BE7D 2FB0A 2Y9HA 1RABB 3MUTP 3DYAA 2VD3A 2L9WA 2X7IA 3R6GB 2EK6A 4XTTA 3GV7B 4RU2A 3DMJB 3UWTA 3RG6A 2ZDPA 4EBDA 2CJQA 2HLTA 2NXUA 4RW4B 3R5CA 1JLCA 2GCBA 2N3OA 1FNXH 2QSFA 3NCQA 2BYCA 3UD3P 1S0MA 2MHNA 3GYXB 1OO0B 4RNNA 1IQTA 3QCGA 1Q6NA 1FFWB 1GTHA 1FRKA 4QUMA 1VC5A 2RQKA 3K89A 5L8RC 3NGSA 1A5YA 3SCLE 1RE1B 2GA7A 4CT8A 1XIQA 4DR4F 1V3AA 4LUBA 2FJMA 4LRFA 2VIHA 4KGKA 1NK8A 1V3ZA 3R6LB 1GH8A 1RT2B 4CLZA 2MGZA 5DLFA 1FTRA 1KLMB 2HMIA 2DGTA 3FMWA 4YB1P 1RT7A 3DI6A 3FBFA 5EDWA 2N4DA 1MMLA 2GX8A 3FBEA 4O3PA 4NLPA 3F41A 1WHVA 2OP5A 1KBRA 1HBOA 1OQ3A 2XY6A 1JLNA 3D6TB 3KG1A 1SH3A 3FK4A 2QBQA 4CTAA 4P2MA 2D41A 5M2UA 1S9FA 1ZH5A 2JFGA 3IRXA 3S4OA 2YWKA 3J7YI 1NK4A 1C1CA 1PH0A 3MMCA 1JNRB 2BW7A 2FLOA 3U1LA 2OIHA 2UVVA 1B7FA 1UVJA 2IRYA 2FUG9 4EFAC 1CJUA 2BGDA 3PW2A 3BH6B 1NNYA 4K0KJ 4QWCA 2RE1A 2JLGA 1JB0C 1S1WB 3OXGA 1Y5IB 4CLLA 4NA3A 3IO1A 3PG9A 3RAMA 1VIXA 3P96A 1O8BA 3UD5A 3OTOJ 5HL7Q 3OL8A 2KYZA 3TOQA 1RHQB 2GHPA 2B56A 3ELHA 3VZHA 1C86A 5KFPA 2FHJA 5F8NA 1NK6A 4H4MB 5L1KA 2V67A 3P8BB 2E5GA 2GCFA 4U7UD 5LMNF 1NDPA 4X4VA 1Q8KA 3CCJS 3BGUA 2CG4A 4KKOA 2WRMA 3T9ZA 4DV0J 1IXKA 1RKJA 2DGXA 2QFIA 1H2VZ 4CH7A 2DKOB 2B5JB 3JTOA 4CLSA 4X62F 3CF5Q 2RF2B 2W2OP 3JXOA 5HQ8A 1J5OB 1FVSA 4EBEA 1F2HA 2DY9A 4UUXA 1HIYA 3TZWA 3V4MA 2F00A 2CIMA 1DAXA 3DLJA 3SFGA 2CQPA 5BXIA 4A8WA 2KT2A 5AXKA 3ZM3A 5F8JA 2ZE2B 2GW8A 1I9SA 4ED0A 1Y4ZB 4B9SA 2CPZA 3T1YF 3HHLB 4N76A 5M43A 4RX6A 2Y96A 3BJYA 5HP1B 2Y8WA 3CCQS 2Q66A 2CQGA 4GKKF 1XBOA 4L73A 3EB1A 2V6AA 2KYXA 2GCAA 3RAQA 3SXLA 2EFNA 3W5ZA 5AXLA 3G8SA 2ERRA 1Q8LA 3F9AA 3V0JA 2IC3A 2VZ9A 3PYEA 1FQ1A 1Q95G 4OX8A 2A10A 3UE2A 4C8YA 4JV2A 2CZ9A 2AGOA 1VQPS 5DQIA 5KA7A 1T4JA 1FKPB 1LFPA 3QLHA 2AZ1A 2OFGX 2L9DA 1CJTB 2W4CA 2YH0A 4LF8J 4Y00A 3I5AA 1T9WA 3DKDA 4JI2F 3JQJA 3K5PA 4BHQA 3W63A 3PO4A 4GWFA 3FCWA 4EO8A 3W9IA 3MPVA 3KLFB 1KVIA 3LGNA 4R30A 2JHEA 1IKWB 5ADZA 1KOOA 1GEHA 1C1BB 3W9JA 5IWAJ 2J0SD 2I6IA 2NYHA 2JC1A 3MCNA 4JP8A 1M5PC 4U7CA 2XNQA 3DLLQ 4C3MA 2HCMA 2B6AB 1PSDA 4EMDA 1LV5A 1JXVA 3DRPB 4BWMA 2B51A 3JQKA 4LF7F 1UP1A 3TZXA 3PR5B 1I94F 1NM2A 2LEPA 4Z37A 2AGPA 1FJGJ 2CNKB 1UWBA 2GGPA 2GO9A 2CA9A 4EI2A 2A3KA 5T41A 1HHQA 2KT5A 5KT5A 1QSYA 1WSVA 2FHKA 3D1QA 3OFEA 3MPUB 4LSLB 1DRZA 1VQKS 3T5HA 4LF4J 1FI4A 3MMBA 1E6YB 2HC2A 1B64A 4N56A 2DPIA 2F9JA 2VV5A 4IO1A 1V3RA 3M8RA 3O4TA 1C85A 4F02A 2HNQA 2QN6B 1U0HA 4HH1A 4QBWA 2HGLA 5B0GA 2Y68A 4LSZB 3C46A 3VWSA 4F3QA 3OJSA 3CDWA 2QL9B 1XXPA 2KG0A 2MKSA 1VQ5S 3IRXB 2OC3A 2R8IA 2YH1A 1UVNA 4O44B 1S12A 3M6XA 2YWEA 4RKUC 4UQTA 3W64A 1P1LA 1KEKA 3M8PB 3PYZA 2QBSA 4ERCA 4MK9A 5K9WA 3TA1A 3NL0A 3SCKE 1XR6A 1OWXA 2HQDA 1WF2A 3HK2A 1EHWA 3KFWX 2DY1A 2Q1LA 2V2QA 3NWRA 4WU2A 2HIYA 3NP5A 4ZVOB 4TN2A 3EWGA 4ZPWR 2WB4A 3GIIA 2HHHF 1TAQA 3K59A 2UXBF 1RHRB 2XJAA 3MURP 2FGCA 2YKNA 2UU9J 1G4CA 3W5XA 2Y3YA 2UVRA 3RBEA 1MWZA 1YBTA 5C24A 3E01A 2CZ4A 3LAMA 1JIHA 1SI9A 4C8KA 3BYPA 3CC2S 4E0DA 2XWYA 3WX8A 1BGXT 2FJBB 5HLFA 3N0AA 1RBOB 3CJ0A 1YJUA 3FZBA 4YN3B 2CJZA 2NTAA 2AHOB 4A8QA 1NPKA 2XMJA 1SKSA 4K4ZA 4USUA 4P2XA 4Q5VA 1HI1A 4LREA 3V0IA 1Q79A 3ILLA 2KL8A 3CJQA 3HVWA 2JX2A 4DX8H 4U6PA 1KAVA 1PA1A 3RRKA 3H4BA 4C8LA 2FVPA 2I2YA 2J0QD 2P4DA 3JSBA 2CNNB 4V19X 1TFYA 4KR0B 4DG1B 3OV7A 5IM0B 5ETVA 1Q6TA 4C7QA 2CM2A 2B3TB 3I56S 6FD1A 3KMQA 2HRYA 2VUGA 1HWLA 1GTEA 2QYGA 3HSGA 4MKVA 1M5SA 2V2ZA 3F81A 4NRUA 3HHDA 2YVSA 4PYDA 3RW6A 1C83A 1EKSA 4RWWA 4WXOA 2UUPA 3U7JA 4HRFA 3EAXA 5IZHA 3G71S 2LFVA 1KTQA 1JJ4A 1HMVA 3QCBA 3DMJA 1VYAA 1WI8A 3M2VA 4I56A 2H4YB 2PD1A 1H73A 3DXSX 4P6QA 2DO4A 4J9MA 4OHDA 1JLCB 4R25A 1MMDA 5GAGU 1XMOF 3GJQB 3QWUA 5LT5A 1PJ7A 2IDLA 2C2NA 4QZVB 5GAEU 1UVMA 1P3DA 4RI4A 2JJDA 3RZ2A 2J6TA 3WZ0A 2HGMA 1VCTA 4DQSA 2QCTA 3PHEA 5HJYA 4LT6A 4WU3A 1YQHA 1VQOS 2RHSB 4CI0B 4Q43A 5D4LA 1KLMA 1D1UA 5IWAF 1E6VB 2NQPA 3K57A 3O5XA 2OHDA 3LAKA 2JRSA 1PIEA 1T9VA 1WOOA 1WAXA 2J9DA 2FPHX 4ES3A 2LLZA 1H3DA 2QE5A 3ITHB 3BF4A 7FDRA 1XMOJ 4M5GA 3T9NA 2X1FA 2XGPA 1FDNA 4OHXA 4JI2J 4NWBA 3I96A 2B43A 3M4XA 4C11B 3EPGA 1VQ9S 4C2MA 3GCXP 2LDIA 3JAMU 2UV8G 3Q0AA 4CIOA 2RU9A 3PKMA 4DSLA 1ZA2B 1YLXA 1XMBA 5DS7A 4ZLJA 3NNAA 1RJJA 2DBBA 3ZM1A 1MU2A 4HKQA 2QJ3A 3V81A 4B9TA 3V4IA 1R8AA 4DJBA 2YQ0A 3L3CA 2COLA 1VQSA 2OEKA 3M7VA 3RJMB 1EB0A 3I31A 1RTIA 4JI0F 2MQNA 4X4QA 2PI5A 1OMSA 4C97A 2F7VA 2AJQA 1OEMX 3MM5B 2KFYA 2ZH9A 4DR3F 1EARA 2DHHA 2HURA 4HT7A 4MTPA 5D4PA 4KV8B 3R9LA 4UQGA 1NMEB 2BJ3A 1U09A 3F44A 1QSLA 2EPIA 3TO8A 1F5BA 4KB7A 2DD8S 4NLYA 3UVJB 4NXNF 3ET6B 2ESBA 2E5JA 3AQPA 2N4CA 3UR0A 3RYLA 2ZHAA 2F9DA 4ED8A 2YNGA 5FJ4A 3QJLA 1DLOA 1RCOB 3I55S 2PC6A 1AT1B 3VQSA 3HVRA 4EYIB 4RUCA 4B17A 4JI6J 3E01B 2M52A 3MCMA 1VBZA 4O3RA 3JQMA 2E9RX 1GK8A 2DH9A 2DIUA 2Y0BB 4ZPTR 1X5SA 1XN9A 2M0GB 3BN4A 4ZVHA 5SUHA 4EWTA 3TAPA 4WZMA 4KJIA 4GE6A 3GU0A 4C6AA 1F5AA 2ZITA 2FQQB 3M9NB 2XHCA 3BM7A 4KI9A 4FF2A 2MY8A 3ZTRA 1RWPB 1WD6A 2J7UA 3MMAB 1FRXA 5DZ7A 1K1QA 2W2NP 1GFYA 5KA9A 1UA0A 3D6FB 3M30B 3QMQA 3TI0A 5T7LB 1S77D 4NMLA 3P6YC 1Y9OA 1G2EA 2YNFA 2W7OA 1R0CB 4K50A 3CC7S 4X62J 5F0WA 1FE4A 3DLKB 1FA0A 3KG4A 3AH6A 3LTOA 5F0UA 4DPUA 4ZJQA 5KFBA 3KMSA 2OJ3A 2O3DA 4QPXA 4F3MA 4FF3A 2VEYA 3DM2A 1FESA 5ETQA 4IYQA 2XLJA 1LKZA 2PMWA 4OYAA 4K4VA 5D0EA 4RW4A 1B0PA 1TKXB 2W4PA 3SMZA 1SQFA 5IQ6A 4HTIA 4JB8B 5CHCB 1UTAA 5DDQC 4ZPDA 3O5TB 3R5JB 1X60A 1YG0A 2GQCA 2AM2A 4ZVSB 4NXMJ 4H54A 2PSZA 3ISZA 2M5YA 3TUJC 3VTIA 5ETLA 3QCMA 5D0RA 4YS2A 2UUAJ 1TL7B 2HKEA 4WK1A 2RUGA 3OUYA 3U27A 4XPCA 2CVEA 2ZZNA 2G0JA 3AQOA 2ZNYA 1DQ8A 2GFFA 2O01C 4TVVA 1U4BA 4CVLA 2ZDOA 2HQCA 3GJSB 2DHAA 3IBFB 2AD9A 3G6XA 3G9CA 2VA2A 3NXZA 1WHXA 2M3VA 2CJAA 2CVIA 1BXNA 2GJFA 1UMJA 2HHPA 3H7HB 4I7FB 3D6MB 5CYQA 1BWEA 2OEJA 3DDIA 3KK1A 1KRPA 5J8RA 2FJVA 4PG5A 4FS1A 4RZRA 4LJMA 3RB3A 2E9TA 4TQRA 3HHLD 3X1LB 2KRRA 4FVMA 4KGVB 1ITPA 1UJ4A 2A6MA 5I4MA 5JVGQ 3MMCB 1U6BA 4F50A 2AT1B 2ZEJA 5F8IA 5KT7A 5BR8F 4J9KA 1L5UA 1WG1A 1NHUA 3C6TA 1Q6MA 1GXUA 3JSMB 2CQIA 1FWLA 2M8DB 4I64A 4GC6A 3CD0A 1MN7A 1FFSB 2VG7B 3BZQA 2AV5A 2LA4A 4DDFA 3TA0A 3BSNA 1VISA 3EGWB 4X2BA 3HKWA 3X3UA 1C0TB 4ES1A 1YN9A 5DM7Q 1HBMA 2HFUA 4I6YA 1UEKA 3H2LA 4LBHA 5I3UB 4A8KA 5ETMA 4CCHA 3M6WA 3MWBA 2QLXA 2GNKA 4O3OA 3S7RA 3G6VA 2PEHA 2YKNB 1RLDA 2VQFF 2D3O1 2ZC3A 3RGQA 3CE8A 5K14B 3EXYA 1IVZA 1VDHA 5KFDA 5D15A 5C42A 1AAXA 2J16B 1URNA 1IBMJ 2ZOGA 1XEZA 2OPRB 3HHLA 2MQQA 4KO0A 1J2VA 1RWKB 2PO4A 2UXCF 5HP1A 1CJKB 2W8KA 1JLEA 2AJ2A 2V9KA 2WW4A 4L75A 4B3RF 2RILA 4BUCA 2CQ3A 4CVMA 2AX1A 2J0XA 2IFXA 1NJXA 1RYSA 1WCHA 1XM2A 2ZC4A 1DBDA 1SC1B 2OKQA 2EKYA 3QGPA 1DFDA 4WFZA 1FJ7A 1Y5NB 4DCJB 2J9DE 1QM9A 4Q2LA 5A2QY 3GPAA 5LMUF 4ECTA 4KTQA 2I6OA 5AE1A 2PGCA 4ALZA 3GIJA 3KJFB 4DUZF 1ECVA 3NS5A 4XK8C 3KLEB 5J2QA 3PRBA 1BZJA 1YJ7A 2J7WA 1RLCL 4N8OA 2H54B 5A6WA 2I6MA 1EETB 2BOPA 2XZWA 4U96A 2CPHA 2XBPA 2Z8QA 2HB1A 1NO8A 3HZGA 1P9QC 3UD4P 5DG9A 2YNFB 1I9TA 3C14B 3ZZUA 2GAGC 3HDSA 4DZ6A 7AT1B 2NLKA 4CVKA 5HQLA 2BJEA 2HZAA 3I0RA 3I4PA 4X4TA 1Y5LB 3T5LA 4HTJA 3PVXA 4DSIA 4QJVA 1JLQA 3A3PB 4WFNQ 1AZSB 4B9VA 2G6ZA 1IWAA 1S59A 2J6UA 1OSCA 3LW5C 2B6AA 4EUVA 5CQGA 3MOWA 1X8DA 3KLGB 3IXQA 2KB2A 3V6JA 1F1BB 5KT4A 2DTJA 2Q6CA 4ILRA 3G8TA 4KYRA 2M7SA 3KLHA 2NCKL 3CWEA 1YRXA 2DCLA 2IM2A 2RH3A 2WSFC 4MK7A 1IR0A 1RT1A 3C16B 4FNIA 2NYIA 4FPRA 4AUKA 2Q6BA 2QA2A 5IV4A 2ADBA 2HQ3A 2FDNA 4EGLA 2F4FA 2LVWA 3TAMA 3IN5A 2VICA 1N4LA 5KABA 4NX9A 4PKDB 4DR1J 1Q86T 5KFHA 2EKNA 1G4WR 1GQQA 1XMQJ 4FYDA 4IQXA 4AE5A 1T3OA 3HVTA 3ULHA 1TVRA 2VODA 3BRHA 3FQLA 5GMKa 2W9AA 3J80U 4E98A 2QIFA 4PAAA 3V81B 2W24A 3ZMPA 5LXQB 1SC4B 3BM8A 3SFUA 2WONB 1S1VB 1U24A 1YBAA 4BS2A 2QMWA 2W7PA 3VAGA 4AL5A 4YOEA 3LALA 3KHHA 1NK5A 3D9BA 4ED3A 5K8NA 1VQ7S 5AJ3F 1XWLA 4ITSA 1F9FA 1HW9A 4QR1A 1WKJA 4DV0F 4P72A 4DV7F 5HBMA 3T3FA 1O0PA 5DGAA 1ZCLA 2GVZA 3AOCA 4OHLA 4ZCMA 2JFDA 1G7CB 1BWVA 4C0HA 5CD4A 2KXNB 4KKOB 3GWCA 1QXKA 1UCNA 5J2PA 5MMZB 4ED2A 2MSSA 3D54A 4DX6A 3NNCA 4H4KA 3JSMA 3WC0A 2JFFA 2WOMA 2NUUG 4C48A 2VEVA 3F73A 3IMQJ 3TX8A 1FKOB 1LWXA 1S49A 5IC6B 1SKWA 4GFVA 4WK3A 3OR2B 2E5LF 1F3VA 1T9YA 3A3NB 1VQ4S 4L76A 2UV8A 4MFBA 4P74A 1C0TA 5LSRA 4DR5J 2GV1A 3CT9A 3OXLA 1HBMB 2YWGA 2B8QA 3JS9A 4KV8A 1HNWF 3C6UA 1EP4B 3CJ4A 1WJ9A 3IGNA 4B3MJ 5KFTA 1IKVB 3NMEA 1K0VA 2ZH4A 2V8PA 2CFVA 4CO2A 2XYHB 3T1AA 4ELUA 2EEYA 1NU4A 4DFKA 2GIQA 2HRTA 4USKA 1EEHA 2DRAA 3G82A 1VR6A 1RAHB 3Q8YA 5J1NA 4A48A 2M3DA 2AEFA 2XI2A 4WKYA 2IYIA 1XBWA 4AFFA 4PR6A 2AYMA 2IIHA 3M8ZA 4K4TA 4DF4A 1N5YB 3QCEA 1FF2A 2PFDA 5KA0A 1FDAA 1CSJA 2ZD1B 1WWHA 4Y65A 2KDOA 2H3EB 3T6BA 4DL5A 1C87A 3QLHB 4WBFA 2CMCA 3SBMA 4F8RA 3S4EA 1Q82T 4NWGA 1TV6B 4JI8J 1RAOA 2ALZA 4RW9B 1U2FA 3I4HX 3N01A 2HVDA 2ILZA 3BQ2A 2QFJA 5L1LA 1DJ0A 4NLDA 4DS4A 3L95X 3PX0A 2VEWA 1NBEB 3BYRA 1DTQB 2CADA 3TWZA 2OSRA 3FEXB 3FJ2A 3IG1A 2C2ZB 4O3NA 3KK3A 4ERDA 4ED5A 2ZUGA 5KFKA 1QVGR 1EETA 2FHMA 1UJ6A 4ED4A 1I94J 4OHEA 2HVHA 4QR2A 4ZN1A 1CS4A 2KXFA 1RT3B 3LPYA 4HACB 2IHR1 4OYOA 3ENAA 4ZHRA 1IBCB 2ZOMA 2BR0A 4IKCA 4I67A 4WOHA 5CYMA 5JXSA 2UXBJ 3VQTA 3QT6A 3QYYA 1RT5A 3HI9A 4RL1A 1RHUB 1S4FA 3GONA 3ZC4A 4C12A 4KGZB 2HS0A 5FLXU 1YJ9S 1P6TA 2BJ1A 1E6YA 4M63A 2HNDB 3DRRB 3OTCA 2JVOA 1SH2A 2HWIA 4K8RA 3AWGA 1IWGA 2A2CA 4WPAA 1N52B 3W66A 5KFXA 1D3WA 1CJVB 2Z56B 4IUFA 3PYFA 1S48A 3E8OA 2CNIA 1S7IA 2F8MA 1SJRA 2BX6A 3VAJA 1VK3A 4LFAF 4DR6J 1CQMA 5KG3A 3BKTA 5LM7E 3EU0A 1WF0A 3JYTA 2G0CA 4X65F 1SL1A 3EDQB 3PACA 4O44A 1D5RA 3J81Y 4OHIA 4MT1A 2UUBF 4ZP8A 3MEEB 3BDPA 2GC8A 3MM9B 1TK5A 1RDRA 3IR6B 4OFZA 3IAM9 4HI1A 1ZM9A 2FC8A 1FCAA 2Z2ZA 4DR2F 5F8MA 1A7GE 2B7BB 2HQGA 1NJZA 2KO1A 1VGYA 1JJCB 4J9UE 3ENQA 3QGGA 3ILOA 4I8NA 2I5JB 1U1MA 1UWAA 4OZ0A 1JX4A 4RW8A 2CM7A 1S6QA 3M2RA 1I3OB 1RWNB 2LCWA 4PXBA 5B7WA 2L08A 4PABA 3MPDA 1HQUA 5GAHU 1L3KA 2V94A 1M0SA 5HANA 1RTJB 3CJTA 1UA1A 4P9SA 2XCAA 3M1VB 2BW2A 2EFQA 4UUWA 3I5CA 3OFFA 1R31A 1LWFB 4DUYJ 1J5EJ 2XTJP 3MI7X 4IH7A 1SV5A 1SJ1A 3H5YA 2WOMB 1UZHA 2OPSB 5C2CA 3QCDA 3T1HJ 5J2PB 1H38A 4DV1J 4CP5A 5J2NB 2BANA 2CJ9A 4YR3A 1M5VC 4JNBA 4ZOSA 2NXNA 4NLVA 2RQMA 1VQ8S 4RU9A 1SCJB 1R8HA 3R5DA 1UPPA 2CJKA 4HDGA 5KAKA 1X9MA 2JEIA 4YR8B 2DR9A 3H40A 1S7HA 3UI3A 2NUHA 3B4DA 4OZ3A 5LJ5Y 2HXPA 2ZBRA 3MEGA 4UOFA 4DV5J 1EZZB 2ZJQQ 1R8CA 2W2PP 2C1EB 2BM0A 2F65A 3UDEA 4XPEA 2C3OA 2BJDA 2VF3A 2IM0A 5E3CA 4CQ1A 2QL5B 4M5KA 4RWXA 1YGUA 3GTYX 4OHYA 4RNOA 3UDCA 3W8PA 1PYTA 2JWNA 2MKJA 3TW0A 3V0GA 5D0GA 2FHOB 2ZHOA 5KG1A 3TJ8A 2R7QA 4KFBB 1FRJA 2F1FA 3EE3A 2RRAA 5KT3A 4IOCQ 2B4VA 2DNYA 1DZ5A 1D9DA 1TV6A 3BPDA 3I9V9 1YI2S 4JI3J 2YNIB 1FDBA 2O67A 1RK8A 4PG8A 3LOUA 5GMEA 3FGVA 1N0UA 1N33F 1OHDA 2PQ5A 1WHYA 4M5DB 2V69A 1X0PA 3S01A 3W1YC 1M1HA 4Z6BA 3TEGA 4ZLLA 4WP3A 4YDDB 1RA7A 1FNMA 2NLWA 2OFHX 4R0TA 3AJDA 5HROB 5EHPA 4DWIA 1WRMA 3H42A 2OUDA 3DHWC 2RMLA 5B0DA 1U1QA 1HYSB 4ID5B 2QCJA 3KLGA 3TUPA 3Q2TC 3CDEA 2DNPA 1RT3A 5G4DA 2ZWPA 1NNDA 4ZHRB 3MUMP 3MCSA 1V3SA 1Q6SA 3BGFA 2Q47A 3B82A 3WDOA 2IA0A 2WVBA 2B4UA 3CDUA 3NMAA 4IOAQ 2WK4A 5LXRA 2GZOA 1OHEA 1W78A 2EC2A 2MBCA 2VTDA 2RKIA 1B0TA 1UJ5A 2KI2A 2M2BA 3A1YG 3MAAA 2QV6A 2XLKA 2IRUA 4NXNJ 1JXLA 4FYVB 2AEJA 4MK8A 5F8GA 2EWHA 1YJWS 2QEXS 4TY9A 2JDJA 3A4TA 4CO4A 3AD9C 2AEMA 5BJRA 2VPWB 3OVAA 5GTJA 2J8AA 4DX5A 4QW9A 1NHKL 1OYDA 2MJUA 2HWHA 5K8PA 4IO9Q 4FYYB 1LWCB 4LF9J 1LYVA 4DGPA 1HQEB 1LWEA 3P45B 4CT9A 4ECZA 3QWPA 2ASLA 4Q0BA 1X24A 2VOSA 3MPYA 2B9XA 4J9LA 3SQOP 4OI1A 1RTIB 1UEVA 4JI7F 2HY3A 5E3PA 2LYVA 2XYGB 1T95A 4RH5A 1OPZA 2DGVA 2WVEA 4Q45A 1T0TV 3R7SB 5KA3A 5C2GA 1FD8A 5E7OB 2LQJA 5GMDA 4GVLA 2NPFA 2PA5A 4Q8EA 1D09B 3D66A 1Q6JA 2PA3A 4JMKA 3PYGA 2LXIA 4DR2J 1HNIB 3GJRB 4NLUA 4K2JA 1KDNA 1XK8A 2YNGB 1DTTA 2MKHA 3R1LA 3IBCB 1TFWA 1O5JA 2DEJA 1CLFA 3OR2A 5MAOA 4PYHA 4QCLA 4X84A 1VQYA 2J76E 3PIPQ 4MKBA 4W4MA 4DFJA 5HAOA 4I69A 3TJ9A 3POTA 5J2QB 5GADI 2WAQD 1NKBA 5H9FK 1YJRA 4RH9A 3VF0B 4GO5X 2KFNA 1B99A 1M1GA 1F9EB 1JLEB 1Z2ZA 2OPSA 3O2IA 3PFEA 4U95A 2PE8A 4NYZA 1IKXB 1VRQC 3QSYB 1NJYA 4PWDA 1Q8IA 2D69A 3HN7A 1WHWA 4ZI4A 4HR2A 4DLEA 3MCOA 5CAAA 3UCZP 3M8QB 3ZV2A 3OR1B 2ZE2A 3ENWA 1N5YA 4CLKA 3ISND 4KIAA 4GMKA 3R8YA 4A47A 5HMXA 2CKWA 4B08A 2VH7A 3MOZA 4KBIA 5LSLA 1N56A 1NK0A 3SMEA 1XERA 3PJWA 3MEGB 1NUEA 1RUSA 2I9SA 1W2IA 3GFHA 4MAKA 2W9BA 5FIIA 4ZPAA 1TAUA 1V6HA 5I42B 4IDKA 2DJWA 3IGVA 4DV5F 3OW2R 4ICLB 4YB6A 2R7WA 5F8HA 2HNYB 3HVAA 3T19A 3L7PA 4F7VA 2XC9A 1D9FA 4FXDA 1G1GA 1FKPA 3LANA 1JLBB 1TL7A 1UEUA 5H9EJ 3FRYA 1KONA 4HJPA 4LIRA 4OYWA 4ZVEA 3U1MA 4NI2B 2VEXA 3ZZPA 2MKIA 3PEJA 1RBAA 1YBUA 4CWBA 3K5LA 2NSCA 3CCES 1R89A 2FLPA 1S4EA 2AX0A 1MMNA 1NDCA 1VRUB 2KXHA 3N0VA 3ZZRA 3PIOQ 3H4DA 4K4SA 4LQ3A 2RIJA 3UCUP 2H5EA 3U96A 3U02A 1N54B 2GJIA 5CYMB 4M5HA 4C0BA 3KLFA 1Z1ZA 2LQ9A 2OTJS 1LARA 1ZM4A 1C1BA 1UKUA 1HNXF 1AA1B 2I75A 3KLIB 1RP5A 3TVYA 4G1IA 2F5GA 4NX8A 2P9EA 3UDLA 2PFFB 1O6XA 2DNOA 3H2UB 2HNDA 2H51B 3CCZA 3DRRA 3DI6B 2ZWOA 3H5SA 2K7JA 3I5BA 4ID5A 2RJZA 2IM1A 4NZ7A 4A8XA 3CCUS 4AQYJ 1I1GA 1PXHA 3KK2B 3W2WB 4V19J 2SHPA 3QCNA 5A5FA 1RACB 3NMRA 4CH1A 4USTA 2WONA 4CTAB 3H5UA 1WOSA 1HNWJ 1M1KT 4NYOA 1CULB 2QG9B 3PRVA 2KH9A 3RB4A 4DSKA 4JI1F 5D3GB 3MAAB 4WP9A 1JLGB 5CXTA 1YIJS 1C1CB 1RWMB 3BGOP 3BBCA 3H2VE 4UW2A 4ECRA 3R2CJ 3S3EA 1LXJA 2GVZB 2G2YA 4OLOA 4J37A 5F8LA 2G59A 2L3MA 1Y3JA 5GVQA 1SQGA 1JK9B 2RVJA 2IAJA 3DRSB 4X64J 1OY9A 3PDNA 4CLTA 3QZ8A 5E3RA 3RR8A 3LUYA 3CDBA 3RB0A 4H1OA 2R8GA 4OJGA 2GVDB 3D2WA 8AT1B 4R5PB 3MM6B 5KFFA 4DUZJ 3THVA 1X5PA 1EAYC 1Z2LA 3GIRA 1B0VA 4MIWA 1D8YA 4LF9F 4FKYA 3DOMA 2HC1A 4LF5J 2Z30B 4RLEA 1RA6A 4DL7A 5HATA 2A18A 3MR6A 4C3LA 5BZXA 4CLYA 4LF4F 3RBZA 4MKAA 5ETTA 1WF1A 1RGVA 4QIWD 2F40A 1KHVA 2HHSA 1KAKA 3VALA 2RF2A 1R8PA 5K5MA 2F63A 5KFYA 3CCSS 3ILJA 4AXIA 2HHUA 4UAGA 3KDOA 1N32J 2F71A 1T03A 1W26A 4JI4F 3AJ2A 2H4VA 4ZP7A 3KDNA 1KVJA 1BUXA 3D6HB 2VB6A 3PHTA 1YPTA 4M1KA 2I4HA 4R0EA 4QU6A 2GJTA 4PUOB 3CSKA 1P9YA 2ZD1A 3M2UB 4NOHA 3VR1A 1WDTA 1H2TZ 2YKPA 2ZNZA 5HVFA 2I3RA 1JNZB 5IT9Y 4Y14A 3W65A 1S10A 2J0WA 3HHEA 4PQAA 1U48A 3CULA 4F4KA 1AW0A 2W4DA 2V50A 4C8MA 1TKZB 2IY5B 4DUYF 2DH8A 3PX4A 4Z7YA 4ETXA 3ZM6A 2CMBA 3S3FA 2E7VA 4USIA 4LRDA 1KSPA 2FH7A 2MLZA 3Q8RB 2LXUA 3PNIA 1K8AT 4NA1A 4YUDA 1RAGB 2W8LA 1Q4RA 2P6TA 3KG0A 4IH5A 1WORA 4G65A 4ZVQB 4QUNA 4DG1A 1ACMB 4I2PA 1FPZA 2SXLA 2CZVC 2R8HA 3GFYA 4QF5A 4A4JA 3ZZ0A 3OFHA 5I42A 3NRSA 2YNIA 4LBIA 5L38A 4DS5A 5F41A 4DHVA 4FN5A 1WKKA 4YFUA 3QZ7A 1R3NA 2VORA 4XAKA 1HMVB 2B0GA 1N5TA 7FD1A 5HROA 2XB2D 2VPZB 3D5MA 1RT2A 4HI2A 2I6WA 3SYZA 1K9MT 2HK2A 4DV3F 2LECA 3B54A 2HG4A 2C3UA 1FRIA 1S1UA 3HVTB 2IJRA 2ROEA 3HD1A 2XO6A 1U47A 1JJHA 4M5MA 4P10A 5F9LA 1PAEX 3P49B 2QLBB 3HSZA 5I3QA 1N5SA 1U8SA 4BPCA 1FKAF 4RW6B 1R0BG 4LSLA 3QKPA 1JMTA 2LU1A 4GRYA 3VAKA 2FJWA 2R2RA 3GCWP 4XDDA 4F3OA 3PS5A 2CNLB 4PXDA 2CM8A 3LO3A 3T1HF 1JWWA 2FZGB 4I0WA 4PQUA 3S1TA 3P3DA 4DEZA 3EZUA 3OSPA 1GFWB 2JLEA 2AMCB 1TL1A 2V34A 1FXRA 2IRXA 2VFTA 3OXFA 2A3JA 3VVTA 2C2EA 1R0AA 3FQKA 2FJEB 3D3CJ 3BLUA 4HV4A 2QMXA 3R2DJ 2HWTA 1XR5A 2IYGA 3CGIA 1AUDA 3ZNJ1 2VG5A 1YFOA 3VGVA 3DU6A 3D68A 3NCRA 4USJC 1NH8A 1HBNA 2KTQA 1AXQA 1WOPA 1W25A 1MU2B 2ZBPA 1F6TA 1RAIB 5THWA 2A6OA 2QA4G 3DRSA 2DITA 3L4BC 4KRWA 1EQMA 1JLFA 5LJ3Y 4P73A 2BV5A 2QDMA 3QT5A 3DGVA 3PR4A 1QE1A 5F3TA 1J5OA 1ZS6A 2W1BA 3TZZA 3K2YA 3CW2C 3NOGA 2V8HA 1C88A 5B0CA 4WIQA 3DOMB 4HHHA 5F3ZA 1NB2A 2HFOA 3BV8A 3MM5A 3GG1A 1T11A 2RNEA 2M8HA 4FP9A 2OI2A 3NS7B 3QFHA 2XZDB 4NL5A 3V5RA 3S6EA 1PGZA 4PXCA 3ZO7A 4B3OB 1BE4A 1GG4A 4FDFA 3RTVA 2G2OA 2HVZA 1WDDA 2JH3A 2FVCA 4DU7A 1L3VA 1UVIA 2DGQA 4FXWA 4WKRA 3QATA 4JV5F 4NE9C 1HL6A 2CPDA 4JOUA 2DO0A 4PXEA 2EFPA 2MZQA 4LF6J 1RZMA 5IBSA 2BMBA 4OHZA 1DARA 1YHQS 5ETKA 4P75A 4LFCJ 3O3LA 3MVNA 1RHKB 3M32B 5LOQA 5T14A 2HFVA 1ZZFA 2YPYA 4ELVA 1S76D 3F0NA 2XLIA 3MXHP 4E2FB 1N32F 1X5TA 1MLAA 2JJ4D 2KVIA 1WC4A 2DR5A 1V5VA 2O1PA 4IFYA 3MR3A 1QAIA 3QGHA 3O4UA 3FFIB 3G6YA 1VHRA 3KXDA 3G87A 3IWNC 2FZCB 1C4CA 5KFCA 1N5QA 1NSKL 2K3IA 3RRGA 1T48A 3SSQA 4JYAF 3M9OB 3SR9A 3GV8B 2RUSA 2MY7A 4KE5A 4DR1F 4LFCF 2IPOB 1S79A 5JJBA 2FTRA 4DCPB 1BHNA 4IH6A 4Y2EA 2HMIB 2RS2A 3Q23A 5B0EA 1LK7A 2FVSA 3QBCA 1SJFA 4EZ9A 1HYSA 2F6FA 1VQLS 3LQVA 4NNDA 1HARA 2MKYA 4ES2A 4O4GA 5K9VA 3QGIA 3EJMA 4MBBA 2I3UA 2YWWA 1REVB 2OAUA 1N8RT 3DRYA 1NSPA 5K9FA 2LEAA 3KLIA 5IV3A 3OUYB 1TUVA 4QBEA 4Q8FA 3KJVB 1LOUA 2HBZB 2K1RB 4OYIA 2H04A 3HCXA 4FNHA 5KG7A 2WW8A 1Q7YT 5KA8A 2MEWA 4XO0A 3MM8A 2DPJA 4IRCA 2XULA 3IP0A 1RWWB 1TTHB 3HHLC 3MM9A 3BO2A 4CLPA 1T8EA 2JOQA 1UVKA 3KK2A 1AB8A 4I7FA 5A8RB 3SQGA 4UOCA 1TP7A 3UPFA 1UL3A 2HK3A 2GHWA 1TMJA 1WUUA 2IBKA 1P27B 2ZMMA 4RW6A 1E0DA 5BZZA 2AU0A 1TL5A 1ZPVA 2YKMB 5D3GA 3EVWA 4C0OC 4X4NA 5J1EA 5EWGA 1S6QB 1UAWA 3M2RB 4H4MA 1XRIA 3GSDA 4B9NA 2DHGA 4GKKJ 4DQQA 2ZBIA 1RTHB 2NXJA 4J51A 2GS8A 2D9OA 4DR7F 1X4EA 3B7OA 2MZJA 2R2UA 3LWMA 2D3ZA 4YY3F 2XS7A 4U67Q 1C2PA 2R42A 3ZM5A 1TKDA 3QCZA 3OVSA 3OVBA 2E5IA 1G4US
chains in the Genus database with same CATH topology
5C25B 4R5PA 2R7SA 2CPYA 1Z4UA 1SJQA 2POKA 3JSYA 3MEDB 1ZZNA 1JKHA 5EX0A 4R8UA 2HVIA 1LQ9A 2KZZA 1KHWA 3BO4A 1O51A 1AW0A 2HVLA 1K1SA 1NK7A 4KC5A 2ASYA 2VL1A 2QLWA 3DOLB 2H9ZA 3MECA 5I3PA 4HT5A 5BZXA 2YWHA 5K22A 5A8WB 1MW7A 4RUHA 4GE5A 2ZH3A 1VC0A 1RXDA 3ICLA 2BQUA 2GMLA 3IAS9 4YMEA 2UUWA 4DL6A 2FY1A 2C3MA 2MQLA 1GNKA 1P8GA 4ZVFA 5BYRA 1U1OA 5KFVA 3KWMA 4JMJA 2MYFA 5KFAA 1TKDA 4WFYA 4IOBA 5E3AA 3BQ1A 3DDKA 3ZMQA 4OZNA 1IKYB 2E7WA 4WE1B 1ONZA 3D0IE 1FJGF 5KT6A 4NLQA 2B49A 5DDRC 2OTLS 4ZK7M 3MTJA 3AB2B 2HS4A 4NYPA 1S9GB 5E2QA 3H2XA 4LQ9A 4OI2A 4X4UA 2BZ2A 2HNYA 3V0FA 3LP0B 3RRHA 3I0SB 2CPFA 3DU5A 4UY85 2CQBA 3R27A 4Y2CA 2BM1A 4IFYB 3M2VB 4JI6F 2XMTA 4R0JA 2L41A 2HYIB 1XNQF 3FFIA 5KFIA 4AL7A 2A1BA 3Q8QB 2H03A 2XG8A 1SJ3P 4UY8T 1ZC0A 2IMGA 3OHBA 4WTYA 2R9LA 3H5XA 4EU0A 1QVFR 4G1QB 2DNQA 3I87A 3HHKA 3JTPA 2LMIA 2U2FA 3I7ZA 2RKIB 3TYTA 2PIIA 2H4KA 3BB5A 4OJ3A 4MYUA 2AGQA 2CM3A 2VKZG 1FXLA 4RBTA 2U1AA 1REVA 3ISNC 4DQIA 4OHVA 2DXPA 1RQ0A 2EBEA 5KFZA 1LWEB 3CC4S 1RTDA 2VKRA 3TAMB 5FLXY 1FDDA 3D1OA 5M2RA 1RT4B 2HNPA 2NV5A 3MM8B 2IMWP 1N6QB 4JUZA 3FRZA 4TY8B 4Y2AA 3N6NA 1U1LA 4URSA 2HAIA 4ZA1A 1R0AB 2VG7A 3BREA 1DTTB 1VBXA 2YTCA 1S0NA 2APOA 1OEVA 4P7TA 3LH2S 2NS1B 3FEYB 1H7WA 5KADA 1FJCA 5J2MA 1IN0A 4ZKAA 3I80A 3EZZA 5EGYA 3T5JA 2E66A 3MF5A 3OTEA 1IKXA 3UW1A 2UXDF 1VK8A 4PWDB 4W90B 3F9BA 2VBYA 3QO9B 5KFEA 2D9PA 1PC4A 4C98A 1APSA 1IBLF 1FRMA 2FJAB 2GIRA 2E0TA 2MZSA 1KS2A 3LF0A 4CO0A 2WCXA 2KM8C 1F60B 2X1AA 3DOLA 1VOMA 3IC1A 1EP4A 2E1MC 3MECB 1KD1T 3G8QA 4DMZA 3MMJA 4HHJA 5A8WA 3SZ2A 5K23A 3NKYA 1RISA 3ZM0A 2DIVA 3HFKA 3O44A 2ZH5A 3D28A 4OX7A 4GRZA 4B3MF 3R5AA 4IG3A 2HHVA 1HBUB 5E41A 4P7VA 4EEYA 2Y2FA 4X4RA 2JEGA 2BACA 1T05A 4F26A 1ZZWA 3M32A 3TA2A 2BQRA 3EZ5A 2AW0A 2N82B 3AB4B 2NREA 4FF1A 2DK2A 4GO7X 5B0FA 5LSOA 4IRDA 1J4XA 1IKYA 1HHSA 3LGMA 3CJ2A 1KOHA 3FEZA 1QUPA 4I2PB 4RNMA 1NH7A 2ZJPQ 3CB4A 5KFNA 1S9EA 4LSNB 2XO7A 4AL6A 2GO8A 3EUNA 2LQ5A 2MSTA 1AFJA 2DCUB 3GFZA 1TK8A 2ZH6A 5K24A 5KFGA 2OPQA 3QCHA 5E5NA 2KKHA 2VPXB 3IBWA 2DH7A 1R27B 2YNHB 1PC5A 4B9MA 1R7IA 4QWBA 1CG2A 1FERA 2WSCC 3D42A 3CCVS 3W2WA 4NRTA 1QAJA 4NCBA 1WG4A 1CEZA 5CYQB 4WZQA 2MDAA 1FHTA 3FSXA 2DVIA 1UFWA 1KFDA 1RT5B 2HPUA 3WX4A 1PTYA 4IKAA 1P15A 5A8KA 3G96A 2DISA 3K5MA 3PO5A 4RW7B 4PG6A 4USHA 3KJVA 2CQ0A 2CPJA 2K3KA 1N48A 2YX4A 4ELTA 5AWXA 4ZCLA 3V0DA 4IRKA 2LA6A 1TVRB 2I1RA 3AA8A 3V0HA 5CCMA 4O4RA 1M5KC 1G7FA 3SQGB 2KRBA 3CMAS 1UFLA 3BEGB 3HXMA 1FK9A 2XMVA 4PCQA 2ATLA 2F4VF 1VIOA 1S1XB 4Y6IA 1YGYA 4MYTA 1SIZA 4C8OA 3K0JA 4XIUA 1Q6PA 2OMOA 1FTCA 4DFMA 1HBNB 4A8FA 5GAGI 3THPA 3D0GE 4ZCKA 2F8HA 4ZCIA 2GQ2A 2D1CA 3FNNA 3KKFA 3N28A 2I8EA 3O1LA 4O0IA 4QU7A 2W7AA 4TNOA 2J6SA 4K0KF 2F6WA 3MEDA 2F70A 2RU3A 1U1RA