4WU3A

Structure of the ptp-like myo-inositol phosphatase from mitsuokella multacida in complex with myo-inositol-(1,3,4,5)-tetrakisphosphate
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
590
structure length
590
Chain Sequence
PAVVKNPPKLALKIDRADVNQLPRNFRMGSDKYVGVTKTGIMPTRKGMDTMNVSASSCFSEKELEAILKKVPVKPSQFYDVDLRGESHGYLNGTAVSWFANHDWGNDGRTEDIIIPLEKEQLASLKGSTVKSIYRFDDKKNVILSPVYVNYNKVRTEEEMVKQHGANYFRLTLQDHFRPDDPDVDKFLEFYKSLPKDAWLHYHSYAGMGRTTIFMVMHDILKNAKDVSFDDIIQRQKLIGIVDLSEIPDKKKNYGRKAYIERYQFVQHFYDYVKENPDLKTPYSVWAKKNKVNSWEPDYNGYIWRLDTKDRNQLPRNFRTMNSAFRTDVNVKKTGKGFTPTPTRKGLDTLYMSGSAEFSNGELQAMLPVLKQQAKGPIYIMDLRQETHGVFNGNAVSWYGLRDWGNLGKNKAEVLKDENSRLNAARGKSLIVAELDKDKMPIDPKPVKIESVMTEQQLVEKNGLHYYRIAATDHIWPSAANIDEFINFTRTMPANAWLHFHSQAGAGRTTAYMAMYDMMKNPDVSLGDILSRQYLLGGNYVAYEIAKPKPDQWKADYYHQKAHMIEKFYQYVQENHADGFKTSWSQWLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MYO-INOSITOL PHOSPHOHYDROLASE
publication title Structure of the PTP-like phytase from Selenomonas ruminantium in complex with myo-inositol-(1,3,4,5)-tetrakisphosphate
rcsb
source organism Mitsuokella multacida
molecule tags Hydrolase
total genus 205
structure length 590
sequence length 590
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2014-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wu3A02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4wu3A03
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4wu3A01
2NTAA 4OHDA 2PT0A 1OESA 2I5XA 3QCMA 4RH9A 1C88A 1OETA 1OHEA 2E0TA 3LJ8A 4HJQA 1LARA 3ZM3A 1G7GA 4OHLA 4QBEA 4NNDA 3BRHA 4OHEA 3EMUA 1J4XA 1GFYA 1RXDA 3B7OA 3SMEA 3RZ2A 1Q6MA 3ZM0A 4AZ1A 2B4UA 2M3VA 2I6JA 4S0GA 5LXQB 1YWFA 3QCGA 4YR8B 3S3EA 3QCJA 1V3AA 3QKQA 1PA9A 1QZ0A 2YDUA 1T48A 4RKKA 3EZZA 2QDCA 3QCEA 2CMAA 5K9VA 2H4KA 3F9BA 1OEVA 4QBWA 1ZCKA 2F46A 2QDMA 3V0HA 2IMGA 4JNBA 3M4UA 5BX1A 2OOQA 4ZI4A 1PTVA 2I6OA 1KAVA 2PBNA 2QBRA 4RH5A 4ZRTA 1BZJA 1U25A 2CFVA 1XXVA 1L8GA 3QCCA 1C83A 4IKCA 3MOZA 5GTJA 2OUDA 2I6MA 3QCDA 2F6VA 1KAKA 2FH7A 3S4EA 1YTNA 2B4OA 3EB1A 2HC2A 2I3RA 2H03A 1PTYA 2CM3A 2SHPA 5K9WA 1Q6NA 1OHDA 1ECVA 5AWXA 3O3LA 2OZ5A 1I9SA 4GFUA 3BLUA 1YZ4A 2CMBA 4R0TA 2H04A 3S4OA 2MBCA 1ZC0A 1WRMA 2ESBA 2I42A 4QAHA 5KAAA 2AZRA 5KA4A 4H34A 2VEXA 2I6PA 2CNEA 3D42A 1NL9A 2HXPA 5EHPA 2HNPA 3AWFA 1OEOX 2PSZA 1T49A 2CM8A 1G1GA 1T4JA 3RGOA 1JF7A 4B04A 4HJPA 2CNFA 2WGPA 4NYHA 2B4SA 2CJZA 5K23A 4RHGA 2CNHA 4I8NA 2PA5A 4KYQA 1A5YA 1C86A 3CWEA 4GWFA 4OHHA 2B4PA 1ONZA 2G59A 2I4HA 2Y96A 4WU2A 1PXHA 1YPTA 1D5RA 4GE6A 1C87A 3RO1A 3I36A 1QXKA 2BZLA 1OHCA 3EU0A 2H4GA 4GS0A 2I1YA 3EAXA 5BUGA 3OLRA 2GWOA 4WOHA 4WU3A 3QCKA 3NMEA 2B3OA 3S3FA 3S3HA 1ONYA 2HVLA 2QBPA 5KADA 2FJMA 3O4TA 3D44A 1Q1MA 3O4SA 3RGQA 3F81A 5IBSA 1YTSA 2NT7A 2P6XA 4NX8A 1C85A 4MBBA 3V0IA 2PQ5A 3A5KA 2J17A 3O5XA 3QCHA 3GXGA 4KYRA 4GE5A 1PH0A 1WAXA 1YN9A 2CNGA 4R30A 4Z6BA 2RF6A 1FQ1A 4D3RA 4J51A 1G7FA 1PTUA 4NWFA 1PTTA 5M43A 3GXHA 3PS5A 4KI9A 2F6ZA 1YGRA 4QUNA 1I9TA 2BGDA 5BZZA 2HCMA 1EENA 4GFVA 1Q6JA 3V0GA 1Q6PA 4HRFA 3BLTA 3D9CA 3S3KA 3ZMQA 4ICZA 4PVGA 2HNQA 2VEVA 4RDDA 5KA8A 5KA2A 5KA0A 1NZ7A 2J16A 4R0SA 1JLNA 4YAAA 2NLKA 3ZMPA 4GRYA 5BZXA 2AHSA 4RI5A 2B49A 1BZHA 2P4DA 1LQFA 2I6IA 2I75A 1LYVA 1FPRA 2PI7A 3D1QA 1XXPA 1AAXA 2BGEA 4NWGA 2NV5A 3QCLA 4D3QA 1G4US 1U24A 1BZCA 3O4UA 1R6HA 2F71A 1RPMA 3I7ZA 2J16B 2FJNA 4ZN5A 5K22A 4TVVA 1XBOA 4ERCA 2OC3A 2CM7A 4QAPA 3N0AA 2HY3A 5K24A 2Q05A 1G4WR 2HC1A 2Q47A 3MMJA 4DGXA 4QUMA 1YTWA 3ZM1A 3ZV2A 3V0DA 2B07A 2JJDA 5I6VA 2CM2A 2NZ6A 1I57A 2C46A 1NO6A 3A5JA 2GJTA 2DXPA 5KA7A 2F6YA 3V0EA 3BM8A 2F70A 4Y2EA 1PA1A 1Q6SA 2BIJA 3OMHA 1NNYA 5HDEA 5KABA 1YGUA 4GRZA 2ZN7A 4OHIA 3F99A 1WCHA 2G6ZA 1VHRA 3QCFA 2QEPA 4D3PA 1G1HA 2F6TA 1L8KA 4PYHA 5EHRA 4JBCA 2CMCA 1OEUA 1M3GA 2A8BA 3QKPA 2F6WA 3QCNA 1PYNA 2BV5A 2QBQA 3D1HA 2A3KA 1X24A 2QCJA 2QBSA 3V0FA 1EEOA 3V0JA 2NT2A 2VEUA 1P15A 5IBMA 4BJOA 4WTYA 5K25A 5KA9A 1XM2A 1GWZA 3SR9A 4BPCA 2H02A 2HB1A 1U26A 2VEWA 2H4VA 5KA1A 5KA3A 1OEMX 3F9AA 3I80A 4Y14A 2I4GA 4JMKA 3QCBA 5MMZB 3MOWA 1ZZWA 2C7SA 1Q6TA 1YFOA 2VEYA 4GE2A 3ZM2A 3H2XA 2GP0A 2I3UA 2ZMMA 3F41A 1NWLA 3AWGA 3QCIA 1ZCLA 5KACA 1XRIA 2CNIA 2QCTA 1G1FA 1FPZA 3CM3A 4JMJA 1MKPA 4RI4A 2F6FA 1SUGA 3U96A 1C84A 4DGPA 2Y2FA 1NWEA 4H1OA 3D1OA 2I4EA 3AWEA 2R0BA 5J8RA 2QDPA
chains in the Genus database with same CATH superfamily
2P6TA 2YKAA 2MQPA 3I0RB 3M30B 5G0RA 2FPHX 4I4BA 2VODA 1HWKA 1NDLA 3ZM3A 3MCSA 4QBEA 2VC1A 1WG4A 4CM2A 1CC8A 2JLEA 1GTHA 3QT8A 4A48A 1VI7A 3ULHA 2CAJA 2ZC3A 2EC2A 2YPYA 3S3EA 3BKFA 4OZNA 4JI3F 4PAAA 3D66A 3GIKA 2HS3A 2CQ4A 2RT3A 3POTB 1O5ZA 4YB5A 4F50A 5KFKA 1U8SA 4ECRA 1KAVA 2QSWA 2R42A 1BZJA 1T9UA 3HF5A 4NI2A 2CFVA 3IMQJ 2EW9A 3HZEA 4J9PA 2DBBA 5B0BA 2NZCA 2HK3A 3NGUA 3B8HA 2DEIA 4C7QA 3Q2TC 2EG1A 2MGZA 1E6VA 1KOOA 5B0AA 1H38A 1IBCB 2B4OA 4U96A 3MR5A 1BC6A 3V6KA 4ECZA 1EZZB 1F5CA 1VHIA 1I9SA 3H5YA 2NYIA 3QIPB 4OI2A 1CSJA 4OZ5A 4I6YA 3FBEA 4DX6A 1DQAA 4LVOP 3VVTA 3OR2A 2MXYA 4NYPA 2QC3A 4OX7A 2V68A 1FE4A 4H54A 2HNPA 4OYXA 3R2CJ 2AP6A 5EDWA 3K8VA 4B04A 4CVLA 5ETQA 4Y3CA 2D3OR 4PWDA 4P6QA 4YP3A 4WIQA 4ELTA 4B3MJ 4JI2F 3PFOA 4C3MA 4G1PA 4A8MP 4KE5A 1L3UA 2X3GA 2A3JA 2LXIA 2B7BB 5BUGA 3G9CA 1BE4A 4LRFA 5M2UA 5EUHA 2DR5A 1QSSA 1R8PA 3EGZA 1WC3A 2GO8A 4F4YA 5J2PA 1NB7A 5EX0A 2KYXA 3MECB 4NOHA 4Q43A 4UT4A 2C2EA 1HNVB 5KFHA 4ED6A 2UXCJ 1JQGA 5HQMA 2BMBA 2CUYA 2BVZA 3KJQB 2V8HA 4HHUA 1C0TA 4QU6A 2AM1A 2QRRA 2V6AA 2E5GA 5B08A 2P9CA 2FVRA 4WFAQ 3OFFA 4YB7A 1RT1A 1XN9A 4OV1A 4I2PA 1N32F 1Z1ZA 1FI4A 3MPUB 1TK5A 3M1VB 1Q6PA 2LDYA 1QAYA 4Y2KA 2OAUA 4BUBA 1JLQA 5L9NA 4CM0A 4K4SA 1GX5A 5BZXA 1VC5A 1UMJA 4AE5A 3V6DA 4Q2LA 1RWXB 4RW6B 1PGZA 1R0BG 3HSDA 2J76E 2NREA 3Q8PB 3LP2A 3UN2A 2FJWA 1QAIA 4D3QA 1F60B 1N4LA 2HGNA 4WKYA 4MIWA 4ZN5A 2ROEA 1VFJA 4P2FA 2B9XA 4ERCA 2OC3A 3T5KA 3A8KA 4MYTA 4DV0F 3DI6B 2XS5A 1FRXA 4USVA 3G96A 1JJ2R 1XNRJ 4CLKA 1QY7A 4M5HA 4CYUB 3NRBA 2HWHA 4WPAA 2AIRB 5LSRA 2V5HG 1VS3A 2M5YA 3BBCA 4LF9F 2QL7B 1H3DA 1RWWB 2H48B 2K1RA 4AUKA 5FLXY 2DXPA 5CYQA 4HLBA 3DYAA 4LUBA 1JIHA 4CO0A 1H7WA 3HFKA 4GRZA 1REGX 3TEHB 5GADU 4OV6A 2BOPA 3WIVA 4IYQA 1S9GB 4PYHA 2KO1A 2ZBIA 2B7CB 3OLBA 4BC9A 2GVZA 2QCJA 2BUNA 3MD1A 5IXUA 2VB6A 1CJVA 3NWGA 1YJ9S 1Y0HA 5CH7B 2NPFA 3BGLA 2GJFA 1GNKA 2H3EB 1U26A 1CJUB 1APSA 5EGYA 4DV3J 4KTQA 3QCBA 2A2DA 4ZHRA 1RAJA 1LWCB 3AJ2A 3W64A 4F2SA 1SUQB 4LR7A 4UZCA 2G0CA 4ELUA 1NKBA 3W5XA 3AJ1A 4K2XA 4NXNF 2F00A 1TMMA 1RBOB 1RHKB 3IBCB 2CPJA 5K20B 4QYZJ 4C8YA 2BEFA 5HLFB 4CH0S 3PHEA 1OHEA 1EEHA 3J7Z5 3CIMA 4OHLA 1GMWA 1O5JA 2B5JB 1TL1A 5D0RA 4ZLJA 4NPOA 1R89A 4AZ1A 2YY3A 4S0GA 3JAMU 1YWFA 3CXCR 4YR8B 4V1Ak 4H4MA 2DO4A 4DPOA 5E3RA 1CVJA 1PA9A 5IV3A 4DPYA 3MR2A 1T48A 3QSYB 5FIIA 3C6TB 5MLCV 2CMAA 2CPEA 2QEXS 4JOUA 2W25A 1KC8T 3DDKA 4WXOA 3NLCA 3PR5B 3NS5A 2MQOA 3Q8UA 5LMUJ 1KD1T 3SXLA 1NMEB 2DNZA 1TUVA 1WNEA 3N6NA 4B08A 1X0FA 1D1UA 2BANB 2FH7A 2J9EA 2LA6A 2QA1A 4B9MA 1A7GE 4ES1A 2AHOB 5D15A 1EX8A 2JEFA 4EZ6A 5C25A 2CMBA 4ZDNA 4AQYJ 5DRKA 3C6UA 3ETOA 3AA9A 4C8NA 1VHFA 1R3NA 5HROA 4B9UA 2LMIA 3UDLA 4ZVPB 2OPRA 3NGRA 3J7AN 4LJMA 5L1JA 4BS2A 1Q8IA 3RGOA 1S79A 1C1CA 3K5OA 3ELHA 2AJ1A 1TKXA 3HK2A 4LF4J 4DSLA 2BZ2A 3M9OB 4V19J 1PJ7A 1N52B 3J7YI 5CABA 1G3OA 4C8KA 2QLFB 4RL1A 2N4DA 4GRSA 5A2QU 1NJYA 1WELA 5HVFA 2QGFB 2OEJA 1RTZA 1TU0B 2M7SA 2OUGA 4F25A 4QW8A 3D44A 2FJVA 4LF6F 2Y68A 2OPSB 2M52A 4NXNJ 2CYYA 4FF2A 2MKYA 2CG4A 3QCHA 1TELA 4HYKA 2YH1A 4XIUA 2XGQA 4E98A 2JDJA 2J6TA 3HHEA 2K2PA 2NXUA 3MF5A 4F4WA 2H4YB 3BGOP 4I56A 5CYMB 1LWFB 1E6YB 3DM2B 4OZJA 1ZBTA 1X5TA 5C24B 1TTHB 3BYRA 3X3UA 5E3PA 1O6XA 3CD0A 3S3KA 3CMAS 2VF3A 1RKIA 4JI1F 4RDDA 5KA8A 5F8MA 1U6ZA 2DK2A 2EFVA 4MTPA 1NK5A 4PKDB 2RHSB 3CTRA 3PYFA 3KLHB 3G8QA 2ATCB 2E7WA 3OV7A 3C15A 2N7YA 2P4DA 2V2QA 2BKNA 4NMLA 2I6IA 4JI5F 3CJ2A 4YDDB 1V3SA 1GMWD 1H74A 2MQLA 3M8QB 3VZIA 2QYGA 1VCTA 2CQHA 1R6HA 2C2DA 2IA6A 2WOMB 3VAGA 1JLFA 3M2UA 3IWXA 2ZITA 3HVTA 4TLRA 3M32A 1PO6A 2QL9B 1U1MA 3MXHP 2Q05A 5KOWA 4F4ZA 2MZQA 2C42A 4ER8A 2XI2A 1X4DA 1VQKS 3CCVS 2W8KA 2PEHA 1R0AA 3GSIA 3GJRB 5F8NA 1T05B 5HP1A 4NCBA 1WOSA 1W25A 2LEPA 2LFVA 1B0VA 1N5YA 3J81j 2IYIA 3TR5A 3VGUA 4U7UD 1SC4B 2XQCA 2BIJA 2GV1A 2R2UA 1B7YB 3THVA 2JRSA 4JI4F 1VBXA 1YGUA 3DRSB 4KR0B 3LALA 3FMBA 2XNRA 1LK7A 1ZETA 3SIPB 4X62F 1ICEB 1YBTA 4ZA1A 2BA9A 3OW2R 3DLGB 2W7PA 3PW0A 2EWHA 2XHCA 2FUG9 4I6AA 3QKPA 2JJ4D 3D0GE 1CS4A 2NLWA 2D41A 2XSFA 5J2MA 1IWAA 1X8DA 1UEVA 5K8MA 1QVGR 5IBMA 4TY8A 1R43A 5F8JA 2YBVA 4DV2F 4DR2F 1FWLA 4F67A 3AD9C 3F9AA 1Z2LA 4LF6J 3QLHA 2GO9A 5DG9A 1JNRB 1SJRA 3UO0A 1NSKL 1KQGB 1C1BA 2NUUG 1QAJA 2HHHF 3CUNA 4DUZF 2U2FA 1TAUA 2E1PA 2JFFA 1JWWA 1LW2A 1YIJS 3T19A 3CJ3A 2LKZA 4GVBB 2DISA 2V2KA 1NWEA 1VGYA 3O8WA 3D1OA 1I3OB 1Q53A 4DPTA 3WX4A 4OYMA 3FUYA 1OESA 3QCMA 2WAQD 2DXEA 1OETA 1XQIA 2E5JA 4PQUA 1K0TA 7FD1A 5IOLA 3DKDA 1FWKA 1RCXB 3OFGA 3AY0A 4ZVHA 3K0JA 4B9LA 2IRYA 2ATLA 3QRRA 4OHWA 3AT1B 5T7LA 4A8YA 4RR5A 1H73A 3GG1A 4RX6A 2XJAA 1S10A 3EVMA 2YDUA 2VG6A 3N2AA 4JP8A 4PYAA 2GGPB 1K1QA 1P6TA 2HSEB 3VV2B 4QCLA 4FZVA 3HSZA 1OSCA 4P73A 2NR0A 2ZUAA 4L74A 1BGXT 1FDDA 3NBPA 3FZ2A 3PFEA 2I6OA 3DLEA 5CZVA 5DM7Q 3OFHA 1HBNB 4IH6A 2CPHA 4ZVEA 1C83A 4OIXA 4DV4J 4AT1B 3DDIA 4PEOA 1WORA 3UDCA 2DXFA 5GAHU 3CVKA 3KK2B 2M88A 5CD4H 2I38A 2CZ9A 1TKDA 2FGOA 4OL8A 3TUJC 3NS6A 2JFGA 1TKZB 2ZOGA 5L38A 3V81A 3MGJA 1JXLA 3DGPA 4KY3A 3J7ZT 4FS1A 3THPA 2FJEB 4ALZA 2G2YA 1Q7LB 1XERA 1UPMB 3BQ1A 3D4JA 4IG0B 4LREA 1ZPVA 2K3IA 2D74B 2CJBA 3LP0B 3ZO7A 1OEOX 1BD6A 4RHGA 5KFPA 3FJ2A 1FNXH 3LO3A 1QUVA 3TUPA 3BSOA 3BZQA 2QMXA 3DLKA 2BXJA 1TUWA 3ZTRA 3I36A 1N34J 3IRXB 1F1BB 3R3TA 2ASJA 2AYEA 2MJUA 4ZJOA 1UP1A 2Z0GA 3DOLB 2UVUA 4C13A 3CWJA 2ZZTA 3CDWA 2YNIA 3O4SA 4FXWA 3VTIA 3C3LA 1QTNB 2FJDB 3OL6A 1CEZA 4DS4A 3HSJA 4KYRA 2CQ1A 1RT2A 3N9UC 2RS8A 3ITHB 4RUBA 4R30A 5DZ6A 1FQ1A 4B9VA 1DTQA 2ACYA 4OHVA 3E2EA 1L3SA 1S77D 4W98A 3VGTA 1HWUA 4LFBJ 2RKIA 1RU2A 3AOAA 1O51A 2XZTB 4OX6A 1SCJB 2MMYA 3BQ0A 3HKWA 4RW7B 4N41A 5F3ZA 1XC9A 4PVGA 2ZNYA 4ZCIA 3MDFA 4F4AA 3AQPA 2ZVSA 3DXSX 3CDAA 2BABA 5E0OA 1Q0NA 2QG9B 2WBRA 2C2OB 4ICLA 1S0NA 5AE3A 5HO4A 1JJCB 2F4FA 3FSYA 1QAXA 4J7CA 4WE1B 2B6AA 2WONB 2XMJA 1SQFA 1S0VA 3VVUA 3TUZC 2IAJB 1FKPB 2CRLA 5LXRA 2XWYA 1S1WA 1UEKA 2ZHBA 4H4KC 1P1LA 2LA4A 1T94A 2X1FA 2CADA 3KLEB 2YX7A 1N48A 4QUMA 3RGIA 1IR0A 4PUOB 3DRXA 3TVYA 3Q2SC 4J5OA 2DR6A 2QX0A 4IOCQ 2CM2A 4J9NA 2I5JB 4F26A 3CCJS 4Y00A 1N0UA 1JX4A 1MMNA 2BYCA 4DR6F 1RAGB 3JSYA 5GMDA 5HDEA 1T95A 5L39A 4OYIA 4OHIA 1DAXA 1TL5A 3H40A 1KHWA 1HQUB 1G1HA 3RZAA 2XSJA 5KFJA 2CQGA 3UAGA 4KIAA 2FDNA 2KM8B 1P15A 3BSNA 5L1IA 3DC2A 2DPIA 4C4WA 5HSPA 2C1EB 1EKRA 5C2CA 2W2MP 5IT9U 3P45B 2CA9A 4EFAC 4P2MA 1A9NB 1UZHA 2VQEF 2I4GA 3D6TB 2VIHA 2V2VA 3PXGa 3JSMA 2C7SA 1YQHA 3NEKA 2ZHOA 5CA5A 2ZMMA 2B0GA 2B56A 4OI6A 1ZAWA 3T1YF 3ZTPA 2IYGA 2MGZB 5G4DA 3CM3A 4U67Q 4ID8A 1C84A 2DB1A 2YX1A 1Y00A 3NMAA 3D2WA 2MKHA 2XS2A 3L09A 2YNHA 1AROP 4XTTA 3WIUA 4DUYF 2V50A 1IKWB 4I0WA 1G7GA 2MLZA 3GYXB 3KYLA 3R7BB 4H4KA 1GFYA 3IR5B 4ECTA 5HJXA 2I6JA 2FHOB 3QCZA 3G87A 1T3NA 4ZVSB 1HWLA 3NWRA 7AT1B 4DR4J 5HBMB 2E5LF 1NM2A 2E1AA 2PN6A 1VRTB 5KG7A 3DRRB 2ZM6F 5BX1A 1NPKA 4QQBA 2F40A 1HBUB 3LQVA 1GQQA 2VOPA 2BE2A 2HFUA 2HFVA 2B51A 3ENQA 2H5EA 3UD3P 3JQJA 3QCDA 1X4BA 3QJPA 1IM4A 1VK3A 4DL6A 1JLCA 3RRGA 3LAMA 2QMUB 5KG1A 4ZPBA 4AXIA 4ZP9A 3SSQA 5A8WA 2NQPA 1JLEA 1I6JA 4DR6J 2I42A 3DDNA 5ETRA 4H34A 1HBOA 2IBKA 4LT6A 2VH7A 1NL9A 2FLPA 2HXPA 1RA7A 1HHSA 5KFTA 1Y7PA 3GFXA 3MURP 3ZNUA 4DF8A 2NCKL 1M1HA 1VC6A 1HNXJ 1RTHA 4F3QA 4GWFA 5HQLA 2ASYA 2DKOB 2RU9A 1P1TA 1NK4A 2ZVIA 1DLOB 2KZMA 2GIQA 4RBTA 2H4GA 1FKOA 3P8BB 1YRXA 2VQEJ 3IR7B 2YNFA 3RW7A 2HVLA 4ERDA 1X31C 1FA0A 2UV8G 3B4DA 3HJVA 2OTLS 3KLIB 3NNCA 3G6VA 4J9RA 1VQ5S 4M5JA 1WF2A 3MAAB 3HT3A 3KDOA 4DLGA 2VPXB 4DX5A 5DQHA 1M5SA 3TOQA 3DRPA 4GVLA 1MMDA 3BPSP 1T7PA 3KKFA 2QIFA 5A8RB 2ALZA 2GQ2A 2VL1A 2JFHA 2LEAA 1ZYQA 2PDAA 3K57A 1UPPA 1Y5NB 5GMKa 4WTOB 2UVWA 5DG8A 2HZAA 3QSIA 4LMZA 4RUAA 2XWXA 3M9MB 5EWGA 1QSLA 2RJZA 4ICZA 4LF8F 2CNNB 2OO4A 2CFXA 4ZVTB 3WDOA 3JAMY 4TN2A 2E5LJ 1XWLA 2F9DA 4RI5A 5J2QA 4DSJA 1VQSA 1BMQB 3JYTA 2AV5A 3PRVA 2XS7A 2XCAA 1SV5B 2OSRA 2HQGA 2ASLA 3R5BA 3OTOJ 4ECYA 1IKVA 1RPMA 2J16B 4DV6F 4DV1J 2ZE2B 3G8SA 3KMSA 1WD6A 4U8YA 2XHWA 2MB0B 3ENVA 4URQU 3CCZA 3GYGA 1SB6A 3IWNC 5FJ4A 3KHRA 4ZJQA 4CT9A 5AJ3J 2DIVA 3IG1B 3HKZD 8RUCA 4DV7F 3C2PA 2MKJA 3G2XA 3A5JA 1JK9B 1YRUA 5D0EA 1I94J 2UXDF 4HL9A 1SJFA 2DNGA 1LKZA 3M2RB 3PYDA 1Y9OA 4RKUC 1S97A 2G2ZA 3OSNA 2DH8A 1ELOA 2E7XA 2I9SA 4OLPA 4EGLA 2Q3PA 2M2BA 2MQQA 3M8RA 2ILZA 5I3UB 1W7KA 1S5ZA 1GK8A 4Q7AA 2ZH9A 8ATCB 3DLBA 3KJVA 3KJNB 3SR9A 2H02A 1RAEB 3PO4A 5A2QY 2FD2A 3GIRA 1XEZA 3ZZUA 2DCUB 3G71S 5D0HA 3IAM9 2WHOA 4PWUA 1FHTA 3OT9A 3I80A 6FDRA 1HD1A 5KFWA 4A8WA 4BBYA 4B02A 4PXBA 1ZZWA 1G7CB 4UTGA 1Q6TA 1Y5LB 4RWWA 1OY8A 3I0RA 2CG8A 1PAEX 1SQGA 3U7JA 3ZM2A 3PACA 2DNKA 1CQMA 4X2BA 2GMHA 4USUA 3TAQA 4RI4A 3GG0A 2F6FA 3QZ7A 1KQSR 3EX7B 1K8AT 4B3OB 4MKAA 5DLFA 3I96A 1C88A 2MQNA 3GTYX 5CD4A 3HCXA 1KLNA 2PEBA 4ED2A 3OLAA 1J4XA 3HHLA 4UQGA 4ZVUB 3B7OA 1M5HA 1P9YA 1U0HB 1NXIA 1S6UA 4O0NA 3OXFA 2O3DA 2J0SD 5J1NA 5GAHI 1NLKL 4F4XA 2EFQA 2J9CA 1M1GA 1S1VB 3QCEA 1HR0F 5AXNA 3F9BA 3SCIE 2VDHA 5A8KA 3R97A 1ZCKA 2UUBJ 4ECSA 4GKJJ 1FD8A 1GXTA 2CNOB 5CZXA 1UVMA 2RB7A 3QIPA 2G1HA 4NYOA 2A18A 4HTIA 2AJ2A 3EB1A 3GZ7A 4DR5J 4USMA 1OHDA 2FZGB 1S6QB 4X84A 3L7PA 2BW7A 1YHQS 3GIMA 3I9V9 2IVYA 4OX9J 2HBQB 1ZC0A 5LXYA 3BO3A 1ZZNA 5JVGQ 2HIYA 5KG0A 2VDIA 2OJ3A 3D0IE 3M05A 4NLQA 2E9RX 4X4PA 3VALA 2PSZA 1T49A 4IRCA 2MYFA 3D7SB 2J5AA 3TX0A 4M5MA 4KYQA 1CJTB 6AT1B 1YVFA 4Y2MA 4F0KA 3PRDA 3B6BA 3SCJE 3OL8A 4KKOB 2UXBJ 3MECA 1RT4B 2IBOA 3S01A 2EK6A 3K17A 1HNVA 4CCHA 4IUFA 1UVIA 2FTRA 5B0CA 4ETZA 2N7CA 2FJMA 3FC9A 3DLJA 4LBIA 5IZHA 1FD2A 2F65A 3EUNA 2PQ5A 3OVAA 1N54B 5K9FA 4PR6A 3M8ZA 4OHXA 4LIWA 3HZGA 3HFZB 3M1VA 4A8XA 3EMTA 4M8LA 3FVYA 4J51A 3BGRA 3K5MA 5E41A 3MR3A 4DL4A 3US5A 3EVWA 1MROB 1IKYB 4KQZA 2J7KA 3SBMA 4YEAA 2C3OA 3T5LA 4RW6A 1UW9A 5B0GA 4O3SA 1XMOF 1UWBA 1D9DA 2C2KB 5D4PA 2ROPA 4M63A 2DH9A 3ZMPA 1HR0J 4OJGA 5HANA 1N5TA 1WWHA 2F7VA 2FZKB 1TR0A 1LYVA 2Y1OA 1M5OC 1AAXA 4CYUA 1FKAF 5E3AA 2E1MC 3M2VA 4Y34A 1ZM4A 1NSPA 1AT1B 3PYZA 1KBRA 2AZ3A 3HHLD 1HLWA 2VFVA 2QYCA 1MWZA 3EZUA 3HXMA 5K22A 5FD1A 1XBOA 2B8QA 2HK2A 4PYDA 3W65A 4OYWA 3HVWA 3W8GA 4DGXA 1YTWA 4O44B 4KPYA 3SYZA 4IQMA 2YKPA 4P9SA 1RT5B 1F9HA 3L7UA 2GAHC 2GCAA 1U1RA 3PJ9A 4OZ0A 3V5RA 3MMBB 2BJ3A 3PEJA 1IR2A 2V0NA 4ES3A 2KFNA 1YZ6A 2LEBA 3MD3A 5EHRA 5KFVA 1M3GA 4KFBB 1FFGB 1HL6A 1LWCA 3V0FA 2R8IA 1SUQA 4ZJLA 2ZH1A 2BM1A 3LOUA 4FXDA 4NLOA 4ZOSA 3BV8A 2RUSA 4OI0A 2DPJA 1F6TA 1NEEA 2Z2LA 2ZJPQ 2VQFF 4KGKA 3F56A 3E01B 4ZPVR 2OI2A 5MAOA 2DR8A 1RLCL 2ABYA 2YX4A 3MEEB 4NLVA 4QIVA 5KFQA 5HLFA 2P6SA 1N56A 4LFAF 1R8BA 2DITA 2JL9A 4TY9A 5IFMA 3UPFA 2KL8A 2IMOA 2B5JA 2VV5A 3TO8A 1EETB 1TFWA 2EFPA 3DMJA 3MEDB 1HIYA 4JMJA 2V9WA 4OHZA 3L95X 3DN9A 1ZH5A 3CD5A 2B8PA 2FVCA 4H1OA 3MVNA 3M8SA 4ECVA 3UNYA 2NTAA 3KUHA 1P31A 2UUOA 4OX8A 1RHQB 1R8CA 2P5VA 2RMLA 2DR9A 3C6TA 2CNLB 4DQSA 1B0PA 2DRBA 2FLLA 4P72A 2YTCA 3PIPQ 4RZRA 4WYLA 1Q5YA 3LP1B 2K7JA 1KQKA 1NDCA 4NA3A 2L9DA 4NLWA 4ZVRB 4RU9A 1MSWD 1IQTA 1NZAA 3MMCB 1RUSA 2L9WA 2H51B 2R8KA 1S72S 1IUJA 5KT7A 2HQIA 1R8AA 2RD5C 2F63A 4C3LA 1S1XA 2WVBA 2BW2A 1GTEA 3TP2A 1QJHA 2I6MA 3N79A 3A13A 2DIUA 8AT1B 1RP5A 3SZ2A 4ED1A 4X4OA 2GS8A 2UUAF 2SHPA 3MUVP 2VJVA 4UAGA 3CDBA 1AUDA 2E29A 2WZ1A 3VZHA 5DG7A 1DTQB 1WDDA 4B3RF 4R0TA 2MBCA 2IPOB 3CCTA 1QE1B 4UOFA 4QBUA 2RKIB 3LPYA 3D42A 2LECA 4IO1A 1X5OA 4NASA 5D0GA 1YX2A 5EHPA 5D4LA 4TVAB 1R6YA 3GU0A 4ZP8A 3DLLQ 5ETSA 2HMIB 4HTJA 2ZH3A 2WGPA 4NYHA 1PAUB 2CNHA 1HPZB 2R7WA 2OPSA 3H42A 1DFDA 3UCUP 1PXHA 2R7SA 1T02A 3EAXA 3MOJB 3N6MA 4USIA 1UL3A 1TV6B 4JYAJ 3ZM5A 1XBWA 2CWXA 3CJSA 5IT9Y 3ZTSA 1F9EB 4ED7A 2QBPA 4EWTA 3M6VA 2I0XA 5CYMA 3M4XA 1LWFA 1TFYA 5DZ7A 3F81A 1E6YA 3DM2A 4MBBA 3ZL8A 2LU2A 1S1WB 2ZD1B 5C24A 2D7SA 3K5PA 4MIAA 3V6HA 1EAYC 2A0FB 1WHYA 4WFZA 1X4FA 5B7WA 2K3KA 4A8SA 1LW0B 3QGPA 1EP4B 1YGRA 2W9BB 4HDHA 3KLHA 4M5KA 4PXEA 3Q23A 4FBUA 2OSQA 4Q45A 3MR7A 1VQ8S 3EM1A 5BR8J 2DNHA 1WC4A 3TQ1A 3KG0A 1EB0A 4MK8A 3UE2A 3D9CA 3GJQB 3M8QA 5LSOA 1O8BA 3DLHA 2W2PP 2Z57B 5F9NA 3L7OA 5JUMA 4B3SJ 4GRYA 1NHVA 2WOMA 1DY3A 3VAFA 3TI0A 2RF2B 1FPRA 3CJTA 1B3TA 2IMWP 1PYTA 1XR6A 1U49A 2GMJA 5B09A 3PTWA 3BYPA 3R5JB 5LL6d 5LT5A 3BEGB 3QT6A 1BQMB 2IHR1 5ETKA 2BM0A 2FJNA 4KHPJ 1T05A 1Z4UA 4C8LA 4ZCKA 3TAPA 4QR0A 3N0AA 1A6LA 2KB2A 3SCLE 2ZC4A 4ILRA 3CJQA 1AYEA 4N77A 3DRSA 3BO4A 3BN4A 1FJGF 3W61A 2BRLA 4OYZA 2FY8A 4CIOA 3DLGA 1Q78A 1N8RT 3T6BA 1HI0P 1KP6A 4LF2A 2P2CB 2HNYB 1Q6SA 1KVKA 2YNHB 4KV8A 1NNYA 5KABA 4QWDA 2DY9A 1Q82T 4IOBA 4ZCMA 1WCHA 2G6ZA 3H2VE 2QEPA 2F6TA 1L8KA 2GVDB 1GQEA 1U1LA 2CDQA 3NOCA 1RU1A 1FT8A 5K8OA 1RCOB 1RJJA 4OQJA 3SSSA 5IS2A 4DX7A 2F5GA 4R0EA 3FCVA 1WEZA 1TK8A 2HFZA 3CB4A 4WTYA 3T5JA 1GWZA 2K8GA 1GEHA 4FXVA 2Y1RI 4CLPA 2MKIA 4Y65A 2HHTA 2V63A 2ILYA 2FLOA 4JMKA 2LXUA 3QBCA 4J9KA 2XYPB 2D3UA 1WTBA 4USHA 3GV7B 4KGZB 2D9PA 3TX8A 1N6QA 2QCTA 5B0FA 3P3DA 1VJQA 4RU2A 2W7OA 4WK1A 4RH9A 1PJ5A 4EBEA 1EARA 1GMUA 4YR0A 2GGPA 4DMZA 4JI6J 1NKEA 2PA8D 4Y2CA 3NAHA 1IKXB 3BRHA 4DI6A 1UA0A 1AUSL 1RXDA 2A10A 2B4UA 4A46A 1YWXA 4FVMA 1HBNA 4Y2AA 3M9NB 3QKQA 3K58A 3NL0A 2XO6A 2AX0A 2CKWA 2BDPA 2FJBB 2QDCA 3DFEA 4HT5A 3K5NA 3H90A 2F46A 2YWGA 2KVIA 4OZ2A 3KK2A 3C46A 4J37A 3T41A 3HI9A 3J7YU 4I7FB 1T03B 3QWUA 2QBRA 2AU0A 4ZN3A 1TKZA 1NK6A 4C8ZA 5DETA 3AXKA 4O4GB 5F8LA 1HHQA 1LEOA 2VFUA 3M6UA 2DTJA 5ETLA 5JXSA 4NXMJ 3K5LA 2CJQA 2E5HA 2HHQA 4ES2A 4IG0A 5KT2A 3LP0A 2CM3A 2BX6A 4CNYA 1VR6A 3KOAA 3PDNA 2OFGX 2VG5B 2Y8WA 1MG7A 4IR1A 2FHKA 2PGCA 2D69A 2H04A 3S4OA 1R27B 3BGFA 2HAFA 2Y0SD 3ZZZA 2E7VA 1I5OB 5KFMA 3AQOA 4LQ9A 4URGA 3IRXA 4KYZA 4LSNB 3IM9A 4C48A 1AB8A 2HLTA 4HJPA 1FRIA 1KNZA 3MUMP 2PA5A 9RUBA 3DOLA 3HM9A 4X65J 1HNWJ 1NU4A 4OHHA 4WCEQ 2I4HA 1YJUA 2COLA 1NHUA 4Q5VA 1OQ6A 4ZIVA 3QCKA 1NJWA 4GKKJ 2CPFA 3ITHA 4MKVA 4PXCA 4BCAA 3NMEA 4FS2A 2KJVA 2KFYA 3VR1A 2VOOA 2KM8C 1VDHA 2GJIA 5KADA 1TK0A 3TANA 2IVFB 2MKKA 2YPZA 2KJWA 1UVNA 3A8EA 2ZDOA 2DHHA 1IN0A 3FCWA 4QIFA 3CT9A 3CJ8A 1W26A 3GE9A 4RW7A 3CO9A 5J1EB 1YKWA 1T3OA 3PCOB 2V8DA 4QDIA 3WHIA 1KSPA 2RF6A 4NA2A 4CRJA 1HI8A 2MSSA 1HQEB 4M5LA 4DZ6A 3TW0A 5HAOA 4ILLA 1GG4A 5DGAA 4QW9A 2HCMA 4KH0B 3EPGA 2DO0A 3BBFA 5F8IA 3WC0A 2X1GA 1LWEB 4G65A 2CQ3A 2ZJQQ 2PMHA 4WE1A 4WP9A 4B3MF 2C3MA 2H54B 2H9ZA 1ZA1B 2LVWA 3W2WB 3LANA 4KHRA 4DV5J 1JLNA 1H98A 2OD6A 5KFNA 1KKHA 2IAJA 1FKPA 1U7LA 3TZYA 3R2DJ 2WVDA 3QAUA 3BM7A 5M2PA 1FCAA 2PI7A 5DQGA 1PYSB 3NRSA 3KLEA 5KG3A 4Z2XA 3S7RA 2VKRA 4CLZA 4NLXA 4PUOA 1URRA 2B3TB 4HVZA 2XB2D 1KTQA 2UXCF 1NAQA 2I5JA 3QFHA 3T1AA 1QTMA 3D3CJ 3H2UB 3OJSA 3QQCD 1G4WR 3E51A 3MMJA 2O01C 2PFDA 3CD7A 4RW9B 1HQUA 4EYHB 3GFHA 1W7WA 1FDAA 2HYIB 2KH9A 4D3GA 3CJRA 1K73T 1HFEL 3N01A 2J0QD 5I6VA 4L73A 2ZZNA 1YBUA 2GJTA 4N8OA 5I42B 3V0EA 3D54A 5KFFA 4OLOA 1IBMJ 1SIWB 2J9DA 4HR2A 2VPWB 2VKZG 3FMWA 2C22A 4ELVA 3OL7A 3CCQS 2C2MB 2ZOMA 3HHLB 5H9EK 3L9ZA 4HI2A 4R0JA 4JBCA 1VBYA 3QGHA 1L3KA 1NZ8A 1SKSA 1PYNA 2QBQA 3D1HA 2A3KA 1FRMA 3BS9A 3MM8B 3RAQA 1Q8BA 3GPAA 4UUWA 5A8KB 2HB1A 1TVRB 1OQ3A 2Y1LB 4KGXB 2R2SA 3I5AA 2HVHA 2DNRA 5HI7A 4ZLLA 1XNRF 1BQNB 4HDGA 3CJ4A 4TLQA 4EZ9A 1XR5A 2VEYA 3C19A 3F41A 1G6BA 3I56S 1IKWA 4TU9A 5CXTA 1FPZA 3M8PB 3I0SB 1H0HB 5EWFA 1Q7YT 2OMLA 4G6VB 4I67A 2AMCB 2VPYB 1RTIB 3UWTA 1VQOS 4QR2A 3LWLA 1NH8A 4OZLA 4IRKA 3MM5B 1WKJA 5I3QA 5HBMA 4X4TA 3RJMB 1SI9A 1UWAA 1WOPA 1VRTA 1U02A 2YWEA 4DCJB 3DRRA 2LQJA 1DHMA 1HBUA 3NGKA 1UJ6A 2JVOA 1YK9A 1V3AA 2R9LA 1RWNB 3ZC4A 4PG4A 4ANDA 2D3O1 4DV3F 2WJPA 2R8GA 3HULA 4I1TA 2CQCA 1W2IA 1OEVA 2W1BA 4KPCA 3EJMA 2CQBA 3FFIB 2OOQA 4N47A 4FPRA 2L9NA 2RUGA 4CLWA 2M3DA 2RILA 2IVMA 3L3CA 4DN9A 4ED4A 4KHMA 2QA4S 5DJBA 5AE2A 1X5SA 1FVQA 3QFWA 4LR8A 1AFJA 2HC2A 1PTYA 5HATA 3OR1A 1J5OB 3O3LA 2WCXA 2OZ5A 3O2IA 3MTJA 4O3OA 2QV6A 3BGRB 3KMQA 5HMWA 4X4VA 2QA4G 3OSPA 3OJUA 1WF0A 1VQ9S 1DLOA 2AZRA 3FSXA 3UFCX 2MQMA 3Q0AA 2Y66A 3FQKA 1T4JA 1JF7A 4ZVGA 1UWBB 2CNFA 1FO1A 4U95A 1YLXA 1IBLJ 5KFZA 1RKJA 3IP0A 3KLIA 4USJC 2B4PA 4C97A 3UD4P 5LMUF 4WU2A 2MSTA 1RK8A 3MAAA 2WVCA 1PILA 2ZNZA 1AA1B 1HWIA 3VHQA 5E3CA 4WU3A 1UZDA 2WTZA 2MKCA 3S3FA 2YVSA 1FK9B 4F36A 1EKSA 3M2VB 5M2RA 3HHDA 4OI3A 2R3VA 5A8RA 2FVPA 3CJKB 5BXIA 3QT7A 1H2UX 3GWCA 1HBMA 1C85A 3W9IA 3SDEB 2J17A 4DWIA 1WDTA 3O5XA 1LFWA 4DU7A 4MT1A 2YKNB 4L72B 4K0KJ 4GE5A 4AQYF 1YN9A 4Z6BA 5LMNJ 4D3RA 1S76D 1JLBB 5T41A 2GC6A 4WFBQ 2OFHX 3GCXP 3MFHA 2F8EX 4CVMA 1VQ6S 2A2CA 2W4DA 3MPYA 3NGTA 1DTTB 3JS9A 1B99A 1UFWA 4YOEA 1SV5A 3PZPA 4LF4F 1XMBA 1U1NA 5F0WA 3GB0A 3FNNA 3UNGC 1L5UA 1GXLA 2ADBA 2J16A 4E8UA 4OZ3A 2ZE2A 4J9MA 1SKRA 2V4QA 1GQYA 2MY7A 3R5CA 2JC1A 3LK7A 3O44A 3C8YA 4N56A 2W4PA 3CCLS 1VRUB 2AEJA 2NUHA 1U24A 1VIOA 4LSLB 3IG1A 4A8FA 2MZ1A 1ACMB 2Y1JA 4GC7A 1X9MA 4TVVA 5B0DA 2WK4A 4IG3A 2BBEA 4NRTA 3I31A 2IRUA 3ISND 3EGWB 3D6HB 1RADB 4C11B 3OD2A 2QFIA 5K24A 4BHQA 3M2RA 4N8NA 5KG6A 2VTDA 3RR8A 1J5EJ 4GO7X 3QZ8A 3DMJB 1UAWA 5J2NB 2AD9A 2C46A 3TZWA 4USKA 4CT8A 1Q81T 3NAIA 2C3YA 1SH0A 2XYGB 3ILJA 5I3UA 4P7VA 2PE8A 1KLMB 1HMVB 4P10A 5D3GA 2VA2A 2EKNA 4RPFA 1Q8KA 3MHYA 2XC9A 3Q24A 3PW7A 2EK1A 4DDFA 4F0HA 3A3OB 4Q0BB 1N5VA 2F9JA 2A8BA 2QJ3A 3D68A 4EMDA 3EGNA 4DSKA 1JNZB 2LLZA 4EBCA 2QT7A 4OJHA 3VQTA 5K25A 2QN6B 1HNIB 1EQ0A 2APOA 2HS4A 2IM0A 3D6MB 3MM6B 4N5SA 4K4XA 2R8JA 3EE3A 2HZCA 1X9WA 2C3PA 4XK8C 1CJKB 4JI0F 2R4FA 5KG5A 4B3OA 3CC2S 1S1XB 3GFZA 5KFGA 4NLYA 3W1YC 2O1PA 1RTDA 3AWGA 2NXJA 1NNDA 3JTPA 3H4BA 1JJ4A 3BR8A 1G1FA 4RJVA 2RIJA 3MM9B 2BJ9A 2C2RA 2GCBA 3ZTQA 1DZ5A 1U0HA 2HHSA 3QT5A 3SI8A 2LQBA 2DHXA 5CHCB 4ZMMA 2HQDA 2UUTA 1S1VA 3QIDA 5KT6A 4LBHA 4OHYA 1H7XA 3B4MA 2Z2MA 4DR3J 3LF0A 3RZ2A 1SKWA 1Q6MA 3ZM0A 3W8PA 4K50A 3GQCA 4HHJA 2YWFA 1S9EB 4ZPAA 5I4MA 2ZWOA 1RBLA 3KXDA 4ED0A 1VLYA 2CPXA 2CJXB 1PJ6A 3C16B 2VFTA 1K9MT 2XZWA 4Q8FA 2D3ZA 1PCAA 3H7HB 2PBNA 2WSEC 4FF3A 3UVJB 2Z30B 2YXLA 2MZJA 1S6QA 1X4GA 3ADAC 3TJAA 4IKCA 3FZBA 2GHVC 1Q8LA 2HBZB 1U1OA 2IA0A 2YWKA 5HMYA 1M0SA 4C12A 2DGTA 5KFRA 3WZ0A 4IH5A 5E7OB 3UR3C 1WEYA 2H03A 2XTJP 4A8KA 1FEHA 3M7VA 1S1UB 4QR1A 3F73A 2XCPA 1CJTA 1RTJB 2JEGA 3CCES 1VIXA 4M95A 4KO0A 2HFOA 3SFUA 2ESBA 4QF5A 5KAAA 2KFZA 4KKOA 2KZZA 1IJFB 2I6PA 1RT4A 1D9FA 2Z8QA 4WYWA 3PW4A 4KAIA 5HL7Q 2BOAA 1FTCA 5KFLA 5LOQA 1RAAB 1XMQJ 4TQSA 5D78A 1EIYB 1SH3A 1FNMA 1JLAA 2E9ZA 4CO2A 4DV4F 3S3HA 2VG7B 1ONYA 4JI0J 2ZBCA 1OSDA 2RVJA 2XLKA 4P2SA 1Q1MA 4WFXA 3RGQA 1MROA 3TA2A 1IKYA 4YN3B 1F9FA 4YQWA 3A5KA 1JXVA 1WEXA 2DXDA 3Q8QB 3R8YA 1P27B 5LJ5Y 1ROFA 1CC7A 1PH0A 2CNGA 2ZH7A 4WJBA 3CJ0A 1P3DA 3DHXA 5IWAJ 4NZ0A 2DNYA 4DR1J 3PS5A 4HHHA 3M8WA 1D0EA 1WUUA 1NJXA 4RBUA 3GCWP 3RBXA 5HQ8A 3VAJA 3AOBA 2ZBPA 1UFLA 5KT4A 2GAGC 1V6HA 3OHBA 4KV8B 2DGUA 2Q6CA 4J9VA 3ICLA 1YITS 3EVOA 3PYGA 4LFCJ 3TAMB 1FJEB 2PA3A 4HI1A 1NZ7A 2OHDA 4R0SA 1N34F 4YAAA 4CO3A 2NLKA 3H59A 1NO8A 3UDEA 2BJ1A 1F5BA 1BZHA 2XZDB 4PG6A 1SC6A 1RT7B 2AGOA 1Q16B 2PMWA 3D1QA 2PFFB 2B9YA 3DHWC 4ZVQB 2XGPA 4V19X 2QA2A 3D67A 1PG5B 3KLFB 4O44A 4KC5A 3E3XA 1UVJA 2BJ8A 3E8OA 2YKQA 4Y2IA 3NGDA 5L1KA 3RB0A 5HVHA 1RT5A 1RT6B 4NMXA 1YJ7A 4NLUA 3TYTA 4ZN1A 3UN3A 3RU0A 3AAWB 1M5KC 4U7UK 2HC1A 1NBEB 4LFBF 1N6QB 4HACB 3NNHA 4HV4A 3MMBA 3GR0A 2MZTA 2NYHA 2DH7A 1IBKJ 4B9TA 2O5DA 1VMBA 1Y3KA 2WRMA 1AFIA 4KFBA 3AB4B 5KA7A 1HNZJ 3MMAB 2C2ZB 2EI5A 3R1LA 3LAKA 3J81U 1FRKA 5IV4A 4U6PA 1VHRA 2OEMA 1F0XA 5F0UA 3JQKA 4JV1A 1G1XA 3E01A 1RB0A 4KJIA 1TL4A 3MEEA 3W3SA 3R7NB 4DCPB 2BV5A 3EWGA 7FDRA 1EEOA 1JLGB 4MIBA 2HHVA 3SQOP 4WP3A 4D3HA 3CE8A 1KS2A 4L75A 1YJWS 2AM2A 1I51B 1U1KA 1EETA 1XJWB 1GAOA 4KT0C 4J9QA 2VEWA 4WF9Q 4PG8A 3MEDA 4FYDA 4P7TA 4Y14A 1VLOA 5MMZB 4CLSA 4W4MA 5AXLA 2P9EA 5GAGU 3I6PA 2HW3A 2GJ2A 5ITHA 2JLGA 4DPWA 3PJXA 3MPWA 2I3UA 1MN9A 3I5BA 5KACA 4ZLPA 5CAAA 4WZMA 2CNIA 5H9FK 1VQPS 3EICA 3KG4A 2H5IB 5A76A 3MWBA 2D1CA 3LP1A 1SJ4P 4KSEB 2JVRA 3PVXA 3FEYB 4USTA 1SJ1A 2HNDB 3KG1A 4C8OA 4DHVA 3LJ8A 4HJQA 3MMCA 3IN5A 4FVCA 4JI7J 1RGVA 3GIIA 4R8UA 2X5OA 5DS7A 3IWLA 5K14A 4ID5B 1TL3B 5EWEA 3F0NA 2A1BA 4DL2A 1L3TA 3HN7A 1M5VC 1S57A 2LYVA 2BRKA 3IR6B 1C0UA 3HPOA 1PYOB 1ZM2A 1C4AA 2H4KA 1SVDA 4UZBA 3NG8A 1AZSB 2C2NA 1RQ0A 3FEZA 4JNBA 4I2QB 1V5IB 4EO6A 1FXLA 3AB2B 5KFDA 2BJDA 1XXVA 4UW2A 2X7IA 1ZPWX 4CO4A 2ZOFA 3RAMA 4FN5A 4RW8B 1KOHA 1QE1A 1T9WA 4ZPCA 2Q1LA 4DR7J 4ECUA 5K9WA 3RRKA 2HMIA 1UJ4A 4NE9C 3H5XA 2XM3A 1HPZA 2QMWA 5IQ6A 4M5DB 3JSBA 2LQ8A 3IXQA 3Q83A 1WRMA 2UUCJ 2DNQA 4MJKA 1H2TZ 3PEHA 2ZJRQ 3PIOQ 4DR4F 1TV6A 5K5MA 4QU7A 1G1GA 1HWJA 4C3KA 2BE9B 2XMTA 4I8NA 2O66A 3RYLA 4DQQA 1WC0A 3HT0A 2OP5A 5KFIA 2ZD1A 6FD1A 3D3BJ 2ZWPA 5BJRA 2DGSA 5D4NA 3JTOA 2ZKUA 2XMKA 1LW0A 2J7UA 3BSAA 1VQYA 2OKQA 1EP4A 2FVQA 1U2FA 2W9BA 3MEGB 1LK5A 1X0PA 2KXHA 4NX8A 2KG0A 5BYSA 1BWVA 1T9TA 4J90A 2EBGA 2VBYA 2N82B 3GXGA 1F5AA 3LPEA 3J7A1 4DUTA 2CVEA 2RNEA 5A5EA 3CPWR 4PWWA 2HHWA 2R8HA 1TUGB 1S12A 2P8IA 2Z58B 4DQPA 5BZZA 4TKTA 2EEYA 2HHPA 4H4OB 4R5PB 2RF2A 4X66J 1J6UA 3MCOA 3UI3A 1HNXF 2DRAA 4ED3A 1OY9A 1RAOA 3PW5A 2CPDA 4FPIA 4IQXA 4OJ1A 1D3WA 1FGSA 3P5BP 3WBZA 1BQMA 5KA2A 3U1NA 2MY8A 2GW8A 4J9OA 2XULA 1MMLA 4NCAA 1RWMB 1WJ9A 3BREA 1UTAA 3RW6A 1GXUA 3SMZA 2D9OA 3PJWA 2DGVA 4YHHJ 2SXLA 3NCRA 1G4US 2KRRA 3I7ZA 1S49A 4WP8A 3QJLA 3I9ZA 1KWMA 2G0IA 2HNYA 2V4JA 2VHGA 2I6WA 3W5ZA 1Z2ZA 1JJHA 4NZ7A 2WTFA 2M4MA 3DXBA 2HZVA 2GX8A 2DNLA 3MAHA 2GMLA 5C42B 2GVDA 2JOQA 3ZV2A 2R2RA 1D8ZA 2ZH2A 4CH7A 4X64F 2JJDA 4B9NA 2DGXA 1EHWA 3U1MA 1WHWA 1GT8A 3UD5A 2F6YA 3R5AA 2NPIA 5L9XA 4Y28C 2UUWA 4LF5F 3HMJG 5DGBA 1REVB 2AYBA 3K89A 2FY1A 3H0PA 3OPKA 4KBIA 2EPIA 1BWEA 3QCFA 2BKOA 1VC0A 3QGGA 4X4QA 2CMCA 1AXQA 2GQCA 5IC6B 4B17A 2NS1B 1KHVA 1YI2S 3OTOF 4ZPDA 3KUGA 2NT2A 1RHRB 1MWYA 4DV1F 4N76A 4FKXA 3ZFVA 4O4RA 2WVEA 2GA7A 4RO0A 3HP6A 2J6SA 3G82B 3AODA 1N5SA 2AJQA 4JI3J 5KA1A 1YSJA 5L46A 1FX4A 2FGCA 3B78A 2DVIA 1CULB 1L3VA 1TKTB 3RTVA 5AJ3F 3NY0A 2IDLA 1S48A 2YNGB 1XK8A 1ZCLA 1WKKA 3CCWA 3BBBA 1IKXA 1I94F 4XAKA 3W62A 4F3OA 4LRDA 1S0MA 1TAQA 2HVZA 2Y2FA 2PMZD 5ETTA 3OR1B 3LUYA 3RRHA 2ASDA 2GQQA 2BJEA 5LM7E 3BF4A 1F3VA 4DL0C 4QPXA 4CI0B 4KB7A 2K7KA 4PZVA 4I7FA 5A6WA 1T03A 2E44A 4Q44A 3QO9A 3QCGA 4RWXA 3DOMB 2J0WA 4PRFA 2MZSA 2CXEA 2HGMA 2G1DA 3K7RA 1QZ0A 1YJRA 4O4GA 1KFDA 3EZZA 1SC3B 4LRCA 1TQLA 2R7OA 1XNQF 3WC2A 3PNIA 2DR7A 2W9AA 1JMTA 4O3RA 4JI2J 3O5TB 2E1CA 4WIIA 2VG5A 2UU9F 3FCHA 1R7IA 5SUHA 3FSIA 5J1PA 4HEA9 4P2XA 2Y1IA 2JFKA 3IM8A 3S4EA 1HBMB 4ANEA 2YWHA 1T11A 1YTNA 1RWUA 1SL0A 4X64J 1HI1A 2VBXA 2I3RA 2HQ3A 4LSNA 5LSLA 4L3NA 1Q6NA 5D4OA 1G4CA 1DURA 1NUEA 3OBIA 2OIHA 4LF5J 3TVKA 3ZZRA 2PIIA 2QZ8A 1VISA 2E1RA 3GLJA 2VC0A 5KA4A 3MTKA 5GAEI 3LA0A 3G8TA 2EFOA 4XDDA 2XLIA 3IS9A 2KKHA 5DDPC 1QDUB 2CJAA 2CJZA 2UUBF 2ZBRA 2DYAA 1VYAA 4GKJF 1N32J 3TRGA 3Q89A 2DHAA 4NCGA 4XO0A 2HIQA 2IIHA 1UA1A 1NRKA 1ONZA 4NA1A 4I6WA 3FBBA 9ATCB 3OXLA 3S1TA 2GC8A 3GJSB 1X4HA 2AEFA 2UAGA 3D0HE 4DQIA 1OHCA 2UV8A 3HHLC 2BE7D 5J1EA 4A8QA 1M1KT 2MQ8A 2F4VF 1DQ9A 2B3OA 1U48A 1KQFB 3ZZOA 3AA8A 4AYBD 1HQEA 4FNHA 3DGVA 1WC1A 4DPXA 1VQ7S 4TNOA 4NRUA 4OI4A 4IG3B 5IBSA 1CLFA 4DR5F 1OIAA 2XLJA 3V0IA 1LWEA 2HAIA 1CG2A 2XBPA 3OQ2A 4OX9F 4DV0J 3MFIA 2QO3A 4LQ3A 3W2WA 1PTUA 4MAKA 4KI9A 1MN7A 2F6ZA 4NWBA 4DFMA 3D28A 5DDOC 4EU0A 2XPCA 4HH1A 4LR9A 4LF9J 1HARA 3Q8SB 4DZDA 3S6EA 5D3GB 1BY9A 2B9EA 3CW2C 2UXBF 1H72C 1SPBP 5B0EA 2RRBA 5GVQA 3BGUA 2LQ5A 3H25A 3AH6A 2FB0A 2AHSA 1NH7A 3I4HX 3EZOA 3QAEA 1XNQJ 3GIJA 3LGNA 2VU5A 1QD1A 1XXPA 5DO2A 4CP5A 4ECWA 3UN5A 4RW9A 2UU9J 4NWGA 3QCLA 1BZCA 1V3RA 5IM0B 3FBCA 3TA1A 3NXZA 5I42A 4IO9Q 3CIZA 1NK0A 1JKHB 3DOKB 3FGVA 1RTDB 2RRNA 4LIRA 4AD6A 3M8YA 2DGWA 3UCZP 5A0YB 3IAS9 3ZM1A 1P9QC 2XO7A 3V0DA 4RNNA 2X1BA 4RW4B 3MAQA 3QJJA 3VAIA 2BQUA 1OYDA 5D8HB 4ZKAA 3WQPA 3MM8A 4FP9A 3SFGA 4LVNP 4K4WA 3OMHA 4KRWA 2WW8A 2ZN7A 3KK1B 2XY5A 2WSFC 1TVRA 4CTAB 3OTBA 5HJYA 4QYZK 5GAGI 1BQNA 3GONA 4OJ3A 2F6WA 4IDKB 2JEIA 3V0JA 4BJOA 3Q8RB 2F4VJ 2H5JB 2J0XA 2GZOA 4WFNQ 3V4IB 2V8GA 5KA3A 3M8PA 3I0SA 2FLNA 1HYSA 3RBDA 4CO1A 1Q86T 2OMOA 2R7RA 4Z7CA 1RTIA 2ZH5A 3SQGB 1NKCA 4JI8F 1N33F 4P71A 3MM5A 4IKAA 2G13A 4MFBB 3PX0A 1WC5A 3W2VB 3T9ZA 1S6PB 3GILA 4CLFA 4DU8A 2RE1A 3R1HA 2B43A 2VUGA 1Y10A 1S1TB 2Q79A 3U96A 2YQ0A 3W7BA 2I4EA 1FRHA 3QMQA 3W63A 2OPPA 4LF1A 2LP4A 4HT7A 1N5QA 3R27A 2DGQA 3OUYB 4KO0B 4NNDA 1DBDA 1UEUA 2AF6A 2H1YA 2PC6A 4DSEA 3MPVA 3FFIA 5KFSA 4YMEA 4KGVB 3FBFA 1YRTA 5LXQB 3V6JA 2AZ1A 1PSDA 2XMAA 3NKYA 1RDRA 5JMNA 2JH3A 2X1AA 2IM2A 3KK3B 2MJNA 4RNOA 1WG1A 4GMKA 4FYWB 3V0HA 2X3DA 1RI7A 3WX8A 3N0VA 1PC4A 4EEYA 1JLAB 1WC6A 3M4UA 4BLGA 1Y11A 1RZMA 3AD8C 1PTVA 4ECQA 1VK8A 4IR9A 2DEJA 1V5VA 4ZRTA 2XMMA 4IFVB 1J5OA 4QPTA 4ZIWA 4I68A 1MNEA 3RUBL 4PG7A 2VASA 4PQAA 2W9CB 2XYHB 3G86A 4O3QA 2VA3A 1YGYA 2BQ3A 2V69A 2F6VA 3EXCX 3W5YA 3EDRB 3PX4A 2IDEA 4MK7A 3QRQA 1EQMA 3VF0B 3TVZA 1UFKA 4GFUA 3IRWP 1SXLA 2GIRA 2YKMB 1U6BA 4DSIA 2PO4A 3MZIA 4Z37A 1PBUA 4UY85 4F8RA 1KFSA 2E9TA 4ZVFA 3J81Y 3FRZA 3IBFB 2ZUGA 1FK9A 3RB4A 5C7PA 1RLDA 1SL1A 3L4BC 2CZVC 3A4TA 3CJKA 2IC3B 2WB4A 1LQ9A 5KFXA 2G59A 1GMVA 1U2CA 1WF1A 4FBTA 4JI1J 3RO1A 2IY5B 3SDEA 3EU0A 2CQPA 3K2YA 5F9LA 3OLRA 2FYXA 2YKNA 2GWOA 2KTQA 1RT3A 2MTLA 1FDBA 2Y3YA 3HFVA 1TP7A 2VD3A 4JI5J 1JLBA 4QWAA 5KT5A 5IT0A 4LSZB 1N33J 4JI8J 5AXMA 3G4SS 2QE5A 2LXFA 1DARA 3R7SB 2AJFE 5ETPA 4OYBA 1WI6A 1DTTA 1VQ4S 2XY6A 4FYYB 1LOUA 4G1QB 3CEDA 1K0VA 1WAXA 3QWPA 1ULRA 1NK7A 1PTTA 3GXHA 3IGVA 3OTDA 1YJVA 1IR1A 4IFYB 1EENA 5AT1B 4C9DA 1KN6A 2RH3A 1JXEA 1DRZA 3QRPA 5F8GA 3N5FA 2HNZB 2PI5A 3MEKA 1IQZA 3H2LA 2OPQB 1VRUA 1S99A 5D6GA 2ZKTA 3NCPA 1YDLA 4UF4A 4LSLA 2Q66A 4IOAQ 4G3IA 3I55S 4JI4J 4F4KA 4JYAF 4C11A 2I8EA 4X62J 1WOOA 3U27A 4KGMA 4NEZA 4NL5A 2AGQA 2F71A 1VOMA 5J2NA 2E66A 5E3QA 3D5MA 3EXYA 4DV2J 3DCAA 4DR2J 2VTEA 1QVFR 1WG5A 1U4BA 2CZ4A 1KLMA 4ANCA 5KT3A 1HMVA 3HVAA 4UQTA 2IJNA 3CJ5A 2BQRA 4PPZA 5DDRC 5BR8F 5ETNA 1DQ8A 3JTNA 1HKAA 2HHHJ 4DBQA 4Q0BA 4EI2A 2W4CA 1TL7A 4DUZJ 4M5NA 1OPIA 2ALYB 2KRBA 4QYRA 3BM8A 2F70A 1PA1A 3KUEA 1UCNA 2FJXA 1QM9A 2Q6BA 3B82A 4B3SF 1U1QA 2LU1A 4ZITA 5KG4A 3KLVA 2KT5A 1HNIA 2Y0BB 4R8UB 5T14A 5K14B 1KRPA 3ET6B 4TU7A 4X4UA 3MM6A 2YQ3A 2HG4A 4O23A 1OEUA 1CJKA 1SH2A 3W9JA 1MLAA 1VBKA 3P4UB 1HW9A 3DRYA 3H98A 2KHCA 1C2PA 3PO5A 2VEUA 3OTCA 3ISZA 5KOXA 3ZZTA 1C0UB 4KHPF 3ILOA 3PV8A 1MWQA 3VWSA 4BPCA 3QGIA 3NCQA 1RAFB 2V8VA 3MM9A 2FIUA 1MU2B 2VFSA 4OZ1A 3V2UC 4J9SA 4ZS6A 4JV0A 3X1LB 2FZCB 4YR3A 5RUBA 4GO5X 1YFOA 4K4YA 4GE2A 4DG1B 3OL9A 4M5IA 2VORA 4X4NA 1FFWB 1V3ZA 5DDQC 1U45A 4Y6IA 1VBZA 3AWEA 2R0BA 2IM3A 3HX9A 2PT0A 2I5XA 4K7QA 5GADI 1S9EA 5L1LA 3DNCA 2E0TA 2AT1B 4JV5F 3BPDA 3KFWX 4B9SA 4OYPA 4C0BA 4MK9A 2V8PA 3GJTB 3C16A 3NS7B 3KHGA 2M3VA 2IJRA 4A8OA 1NPPA 3CDEA 3UVJA 3AJDA 1RSCA 4S0MA 3GV5B 2MLYA 1J2VA 4YDXA 4QWBA 1FX2A 2J9DE 2PI4A 5G0RB 1UJ5A 4DSFA 3KJFB 2OD4A 1CPZA 4BUCA 2QDMA 3R6GB 2IMGA 3PG9A 3RB6A 4OYAA 3ZTOA 1WTFA 1YZ7A 2ZH6A 1VJWA 2JNJA 4CH1A 2GIFA 2AYGA 2KXFA 4P75A 4DQRA 1S1UA 3A8IA 1H6KX 2RS2A 3QCCA 5GTJA 2BV3A 1RTJA 4OYOA 4M5GA 2J8SA 3JQMA 3CCUS 4C6AA 4K4ZA 1UAGA 3W60A 4BC7A 5IQQA 2F8HA 1WACA 1CBKA 3A12A 4JI6F 2AJ4A 4NI2B 3B54A 3HO1A 1FVSA 2KG1A 1YZ4A 2DHSA 1M5PC 1E8CA 2BR0A 4JB8B 1YG0A 4QAHA 3PKYA 1E6VB 1J27A 1Y4ZB 3KHHA 2EVZA 3BDPA 3BKTA 2HKEA 3GP9A 3UCGA 5IC4B 3M6XA 2J8AA 2VG7A 4RNFA 1JB0C 1U47A 5DQIA 3HHKA 3P96A 3C14A 4IRDA 1NDPA 1A5YA 4Z7YA 4AFFA 5THWA 3CO0P 3ILIA 2RDJA 3KTQA 2Z2ZA 3OR2B 1C87A 3VAKA 3KWMA 1QXKA 4YB6A 3LH2S 2KDOA 4WOHA 4RUHA 2CPZA 1LWXA 5EN1A 3I87A 4UOHA 4NXMF 3IBWA 2OLWA 4PWDB 4QZVB 4ZLNA 3MM7A 4CLUA 4WZQA 2G4BA 3TJ9A 1YTSA 2NT7A 3ILLA 2V4JB 1N0VC 4I69A 3UDVA 5F3TA 5FDLA 3PYEA 4K5RA 3TAMA 2AW0A 3TWZA 4W90B 4NWFA 1RXOB 2J7WA 4LRBA 2K06A 1FERA 4QUNA 1I9TA 2MDAA 4JV5J 3RAXA 1VQNS 4UY8T 4RUCA 2ACMA 3LGMA 5J2PB 1LNQA 3J80U 1RT7A 1OS5A 1Y5IB 1Q6JA 1K1SA 1WSRA 5ETMA 4C8MA 2W7AA 2HRUA 3V0GA 1SKUB 3RBEA 4X65F 1HNWF 1NCLA 5KFCA 3KLFA 1C0TB 1RAIB 2AX1A 4BWJA 3G6ES 4DL3A 1OY6A 4GKKF 1RT6A 1RT1B 2I75A 4DPUA 4K8RA 3R5DA 2FHMA 4I2PB 3HSGA 1ZS6A 3C66A 4WXWA 4HACA 3CMES 1D8YA 2NV5A 4FYXB 1JLQB 2R7UA 2CQDA 2MPUA 2M8HA 1R6VA 3MR6A 2VZ9A 4BDPA 2DNPA 3MMAA 2GHWA 4UOGA 3V6DB 4TYBA 4MKBA 4EUVA 3VQSA 3T9NA 4MYUA 4NYZA 3LP2B 1QSYA 4K4VA 3MCNA 3H8YA 2NXCA 2BKPA 3GSDA 2YKOA 3VGSA 3OXGA 3EYZA 4O3PA 2CVIA 3H5UA 1O0PA 2JLFA 3T1YJ 2FHJA 5LJ3Y 3R6LB 1JLGA 1UKUA 4ATNA 4DV5F 1PBAA 3EZ5A 1S6OA 2W2OP 4K59A 3F44A 1N88A 4DUYJ 1U09A 2K1RB 1CQNA 3QO9B 5E5NA 5KFUA 1G2EA 5CYQB 3DYAB 4KH1B 3H20A 1RWVB 3S8SA 2HPUA 5KA9A 2UUPA 1XM2A 2DHGA 3PM9A 4QJVA 5GMEA 5C5JA 5BYQA 3P5TL 2JFDA 2U1AA 4Q8EA 1BXNA 4YB1P 4F0MA 1NSQA 3AXMA 2GVZB 2ZM6J 4CLYA 2HNDA 2VBZA 1CJVB 3KNAA 3H2XA 2W8LA 3HVRA 4C0OC 1T8EA 4ID5A 1S0OA 1TL3A 3D9BA 2AEMA 1PIEA 2CQIA 5H9EJ 1FRLA 3MCMA 1RACB 3K8WA 1IBMF 4ZHRB 4OHDA 4ECXA 1XIQA 3HJFA 2G0JA 4PCQA 2WSCC 3GFYA 3NP5A 4AL6A 1WSVA 4CWBA 3PKMA 4NLRA 4DFPA 1AZSA 1LV5A 2L48A 1P8GA 5HVGA 3EMUA 4I2QA 1FTRA 3SMEA 1Q1KA 4RBVA 3IS9B 2O67A 2JSXA 2KYZA 3KLGA 4O3NA 3VGVA 4C98A 2HS0A 3ENWA 1SJ3P 1YTYA 2XMVA 1NK8A 4NCGB 4G1IA 4RKKA 4RW8A 1ZAVA 2JEJA 4NZ6A 1WI8A 1TL1B 4BWMA 1S7HA 2KN4A 4FKYA 4DF4A 1ZM3A 1GFWB 4DFJA 2W01A 4JV2A 4H4MB 2HVDA 4M5DA 1OWXA 1IXKA 2QLBB 2NZ4A 4DX8H 1KVJA 1KAKA 4JUZA 1JBVA 2JC0A 1S4EA 3PR4A 1E0DA 5AE1A 4ILMA 1RHUB 2UP1A 1ECVA 4Q2MA 5ETOA 5AWXA 1FDNA 2VICA 2HHUA 5K8NA 1ZZFA 3M30A 5D77A 1KDNA 3Q8VA 2NSBA 5HK4A 5CYJA 2VEXA 3T6JA 1NPRA 2QTWA 2FJAB 4XPEA 2QLWA 2VONA 1B0TA 3NOGA 5E2QA 4K2JA 3DU5A 5C25B 2CWKA 3MEGA 4YUDA 2FHJD 3C6UB 3CCSS 2Y96A 4LF8J 2FC9A 1TZ0A 1D5RA 4N7TA 3A1YG 5DLGA 3POTA 5HROB 3G6YA 2V2ZA 2OPRB 2QLJB 1C1CB 1T9VA 3ISNC 1TKXB 2VOSA 2J6UA 2G9OA 3BSCA 4PXDA 4H4OA 4R5PA 1HHTP 1RISA 3OFEA 4DV6J 5F41A 1F2HA 4OFZA 4XPCA 2HQFA 1S7IA 4ED8A 2CPIA 4F3MA 3I4PA 2VPZB 2MEWA 1KONA 4DJBA 1F3FA 2RAQA 1KVIA 1IBLF 2M8DB 2N3OA 4DV7J 1WHVA 4ZP7A 3BLTA 2UXDJ 3SV4A 2CJKA 2HNQA 1IM6A 3QYYA 5KA0A 5KFAA 3AOCA 3T5HA 3MUTP 4A4JA 2CJ9A 1LXNA 2ZEJA 4LF7F 3BN7A 1B70B 3Q8YA 5ADZA 2ZZMA 4X4RA 2DJWA 1KR4A 1HQ2A 1M90T 1B7FA 2BGEA 2KI2A 3O4UA 2G2OA 5C42A 1HYSB 4IH7A 4K0KF 3C15B 5LMNF 1REVA 4MKYA 2DRDA 3IO1A 1V9OA 3TEGA 3OVSA 1W2BR 1NJIT 1S59A 2ZFHA 4ITSA 1FXDA 1NJZA 1FFSB 2F3JA 1GH8A 3BH6B 2NZ6A 1JLFB 3M2UB 4HH0A 1K47A 2JX2A 3HVTB 3M32B 1UVKA 2OPPB 2FC8A 4Y2EA 2Z56B 2Q43A 1X5PA 3AD7C 4FF1A 4OI1A 3F99A 1ZAXA 3G82A 4DXLA 1R0AB 3BKUA 5KFEA 4YFUA 2IM1A 2HHXA 5HP1B 4ZPTR 1CULA 3TUIC 3QCNA 2ZH8A 1TKTA 2DNNA 1N5YB 4CQ1A 2ERRA 3W9HA 2EFNA 4K4UA 2YNGA 1IJEB 3ZZPA 2M0GB 2H4VA 3FQLA 1U8WA 3QATA 2CDRB 2EC0A 3AFGA 4NLTA 2CIMA 1RWPB 3CC7S 1CS4B 4XDCA 3DI6A 2UVVA 1SBRA 1J5EF 5J2MB 4TY8B 2RQKA 2GP0A 4F02A 1NWLA 2KT3A 4DFKA 3N5BA 4QWCA 2EKYA 2WBMA 2LQ9A 1KEKA 2KHDA 2CJYB 4L3KA 1VQLS 4CZCA 1SUGA 4CLLA 3CDUA 3QLHB 4DGPA 3H5SA 3NMRA 3DOMA 3CD6S 1C1BB 4DS5A 2ZBQA 4L76A 4P74A 2R7VA 1LFPA 2ADCA 4RNHA 1H2VZ 4B3TF 3A3PB 3NNAA 4F2RA 2QL5B 3TNVA 4OHEA 3MPDA 2DD8S 1S9GA 1LW2B 4ED5A 3BJYA 5JJBA 4PABA 5K8PA 4LF7J 4TXSA 3N4WA 1N36F 5HMXA 3FEXB 3QNWB 2ZHAA 4PQUB 2R2TA 3EDQB 1X7VA 1X4AA 4LRAA 2Y9HA 4QBWA 1DJ0A 3ZZYA 1Q79A 4CLTA 1CJUA 3HD2A 2A6MA 2E5IA 2VBWA 5T7LB 3H4DA 1RT3B 4RH5A 2N4CA 2GCFA 4FDFA 4ZIYA 3N28A 1U6FA 3KNGA 3BO2A 4GC6A 1L8GA 2IRXA 2VFRA 3MOZA 3Q22A 2VG6B 4NEYA 2PD1A 4FF4A 1BQXA 4ZP6A 3KHLA 2OUDA 1FE0A 1XTZA 2HBRB 3IFEA 2V67A 1IVZA 3JXOA 2XNQA 2V34A 4FYVB 3NBPB 2HRYA 1KTVA 3DLEB 3HLUA 2R7TA 2EFGA 4QIEA 3BDEA 3KDNA 5FLXU 1RE1B 4DR3F 1URNA 3JB9k 2Z2YB 3JSRA 3TZZA 2R7XA 1OPZA 3PHTA 1FESA 2V94A 2HWTA 1RABB 4NX9A 2CM8A 2RDDA 2HGLA 2NSCA 3V81B 2B4SA 5K23A 1VRQC 1C86A 3DGPB 3P49B 2XMWA 3ENAA 1XMOJ 1RBAA 1ZA2B 4DCOB 1VQMS 1YBAA 4NLSA 2UZAA 2BZLA 4GS0A 4ETXA 2GNKA 3V4MA 2MHNA 4MMOA 1K44A 2JHEA 2MZRA 3NGSA 4C2MA 2RSQA 2L41A 1YJTA 2AYMA 1AW0A 4TU8A 3T1HF 2XI3A 2EG2A 3DLKB 2BANA 5CQGA 2P6XA 1RA6A 2DY1A 2RHQB 1PKUA 3O1LA 1F2GA 4UUXA 3PW2A 1W78A 1G7FA 1B64A 5KAKA 2XY7A 4Y0FA 3FK4A 2BGDA 3MI7X 4YR2A 2YNIB 4B3TJ 3A8JA 4GFVA 1TL7B 3GV8B 4LBPA 5H1SV 1XR7A 5KTQA 4P52A 3G6XA 2P9GA 1RT2B 1XMQF 4HRFA 3ZNJ1 1FRJA 1N36J 4QIWD 2GC5A 5E33A 3THTA 1ZM9A 1NDKA 5IM0A 3VAMA 1HD0A 1FJ7A 5JVHQ 4J91A 2B49A 1LXJA 1LQFA 2CNKB 4PG5A 4X4SA 2RQCA 3N6LA 1TMJA 4J9UE 1JKHA 3DOKA 3DU6A 2OEKA 5A0YA 2KU7A 3SCKE 3CF5Q 3D6FB 4RW4A 3U02A 1SL2A 2OELA 1RHMB 4ICLB 2VQFJ 2CM7A 1X4CA 3LW5C 5IWAF 2WB1D 3TARA 2HY3A 4ZCLA 3U1LA 2RQMA 4DR1F 2B6AB 3SSRA 2Y67A 2IFXA 3KK1A 4LFAJ 2H4WB 3T3FA 4CTAA 2B07A 5L8RC 4RLEA 4CVKA 1I57A 1RAHB 5SZTA 4IDKA 4LFCF 2V9KA 2VJUA 1SQEA 2FQQB 5A6PA 4D3PA 3W66A 3V4IA 4QIGA 1UVLA 4EYIB 2DNOA 1EJ7L 3Q86A 5CCMA 1UETA 1Q5VA 3AHPA 1NSAA 2NXEA 4F04B 3TQEA 4W92B 4AXJA 4I64A 1X24A 3SQGA 3HDSA 1ITPA 4CO5A 3UR0A 4MFBA 3W2VA 2BJ7A 1S6PA 4QOTA 2XSJB 2OH2A 1S1TA 3EGVA 1T0TV 3T1HJ 3CULA 3CGIA 3FKBA 4WFYA 1RHJB 3UW1A 1UW4A 1PC5A 4USWA 5U47A 1FNOA 5EHHA 1IBKF 4NLDA 3SEOA 3SV3A 3PX6A 2M70A 3OUYA 3QCIA 1X9SA 4ENOA 2DGOA 2GFFA 1HNZF 4DOZA 1MKPA 2LCWA 2M9KA 4OMFG 5J8RA 2HFSA 3FRYA 3JSMB 2OTJS 1I1GA 5EX3A 5CCLA 2F1FA 3KK3A 2UUAJ 2XEXA 1B4SA 3J80Y 1LARA 3CSKA 3EPIA 1RWOB 4YS2A 3ETMA 2AKWB 1SJQA 2C3UA 4DN0A 3IA0A 4B3RJ 1BHNA 5GAEU 4IFVA 4C0HA 2AWZA 3QCJA 3C14B 2W2NP 2HVIA 2W9CA 2KXNB 5K9VA 4EK2A 5H9FJ 3CC4S 4EO8A 5A5FA 4ZI4A 5IT4A 4EBDA 2Z4PA 1U25A 1SIZA 3R5GA 3R9LA 3CCMS 3OHAA 2KT2A 2YKMA 3BH7B 2NXNA 3MM7B 2R7QA 4U8VA 3LGHA 1Y3JA 2RDIA 3RG6A 4HKQA 2FVSA 4GVBA 3CCRS 2H65B 2HQCA 2CPYA 1RWKB 5FDLB 3QPIA 4JI7F 1GX6A 2BE2B 3BLUA 1RYSA 2IC3A 2YH0A 1WHXA 2CQ0A 4J9LA 1NB2A 2I1RA 2UVRA 2CNEA 1JLCB 1HA1A 1RYRA 1SC1B 4K4TA 2POKA 3AWFA 1R0CB 3ZZ0A 4DEZA 3GMGA 1ZTTA 3TZXA 2YQ1A 2OGUA 1X4EA 1X60A 3LTOA 3CWEA 2W2QP 5A8WB 4QWEA 4TQRA 1JLEB 3GYNA 1JBWA 2AGPA 4TYAA 3P6YC 1FXRA 2GHPA 1YPTA 1HBOB 4GE6A 2DCLA 2EXUA 4AL5A 2I1YA 5F8HA 4O0IA 4G1QA 2RU3A 4MH8A 1OMSA 4K5SA 1FF2A 4WBFA 3ZXWA 5HMZA 1RTHB 2QLXA 2QFJA 2RQ4A 4DR7F 3O4TA 3A3NB 2V4RA 1D9AA 4IFYA 4YY3F 3OVBA 2HWIA 3RB3A 4WK3A 1U2RA 4U9RA 1BLUA 5KFOA 2HNZA 1FKOB 4UOCA 3ZM6A 2A6OA 3K59A 2OPQA 2YNFB 3VCDA 2AJ0A 4ZPWR 4PPDA 5KFYA 1QUPA 1MW7A 3TJ8A 2UUCF 2C28A 5M43A 2DNMA 5KFBA 2HRTA 5DM6Q 2X51A 2RRAA 1FJGJ 4CDIA 1QLNA 2F8MA 1R8HA 3IGNA 2XMUA 4CNZA 2KVQE 2HEKA 4L6V3 4NLPA 1OJ4A 1WKLA 4E2FB 3RBZA 3CNQP 3ZMQA 3M6WA 1D09B 1A0OB 3DRPB 4R25A 2ZDPA 2VEVA 2HFNA 3BB5A 1NK9A 2WW4A 2MKSA 2ROGA 3TA0A 4RNMA 3BR9A 3I82A 1T9YA 1FEEA 2N3LA 2MLXA 1U0SA 3I32A 1Q95G 2AQ4A 1S4FA 3O6QA 2HVEA 4DL5A 2YWWA 2XG8A 1OYEA 2MHEA 1FJCA 5J2QB 3JYTB 3ONQA 4QAPA 4WWSA 5BYRA 2Q47A 3BQ2A 2CQ2A 2JZ5A 1IKVB 1Q4RA 1U1PA 4X66F 3ET6A 3I5CA 4M94A 2L3MA 3UQSA 2BACA 4A47A 1NO6A 2WVFA 2HBYB 2Y8YA 2I2YA 1R31A 5KG2A 3PY8A 3VAHA 4NLGA 2JWNA 5AXKA 1S9FA 2DT9A 4WKRA 1MU2A 4ZVOB 3KLGB 1FWPA 4E0DA 4DLEA 4YHHF 2B4VA 2QBSA 3GR1A 5I3PA 1C4CA 4AL7A 4DG1A 2L08A 3FDSA 3PRBA 2B9WA 1HW8A 2WONA 2IJFA 2ZH4A 1ZOTA 3HHNB 3IC1A 4ZK7M 3RR7A 1ZTWA 1OEMX 5ETVA 1NHKL 5HN0A 4YY3J 1BUXA 2HLUA 3MOWA 3OTEA 1T9XA 2EBEA 2HURA 1OO0B 1IWGA 5C2GA 4M1KA 3LWMA 3KJVB 2W24A 4FNIA 3HD1A 1XRIA 4URSA 4DL7A 2LDIA 4F7VA 2QSFA 4U7CA 3CMQA 1YJNS 2QDPA
chains in the Genus database with same CATH topology
2DHXA 2PT0A 2P6TA 5CHCB 1K8AT 4MKAA 5GADI 1S9EA 5DLFA 4B3OB 4ZMMA 2YKAA 3I96A 2MQPA 1C88A 5L1LA 2UUTA 3I0RB 3M30B 3DNCA 2MQNA 5G0RA 1S1VA 2FPHX 2E0TA 4I4BA 3QIDA 2VODA 1HWKA 5KT6A 4JV5F 3ZM3A 3KFWX 4B9SA 3MCSA 4C0BA 4QBEA 2VC1A 1KLNA 4OHYA 4MK9A 4ED2A 1WG4A 1CC8A 3OLAA 1J4XA 1H7XA 2JLEA 1GTHA 3HHLA 4UQGA 3B4MA 2Z2MA 3B7OA 1M5HA 4A48A 1VI7A 3LF0A 3KHGA 3RZ2A 3ULHA 1SKWA 1Q6MA 3ZM0A 2M3VA 4A8OA 3CDEA 1S6UA 2ZC3A 4K50A 3OXFA 3GQCA 4HHJA 2O3DA 2YWFA 3S3EA 2J0SD 3GV5B 1S9EB 4ZPAA 5J1NA 5GAHI 1J2VA 4YDXA 5I4MA 4OZNA 4QWBA 4JI3F 4F4XA 2EFQA 2J9DE 2J9CA 2PI4A 5G0RB 1S1VB 3QCEA 1HR0F 1UJ5A 5AXNA 3GIKA 4DSFA 3F9BA 3SCIE 5A8KA 4ED0A 2HS3A 2OD4A 1CPZA 1ZCKA 2QDMA 1VLYA 2CPXA 4ECSA 2IMGA 3EX7B 2CQ4A 3RB6A 1FD8A 1WTFA 2VFTA 2RT3A 3POTB 1K9MT 4YB5A 2XZWA 4F50A 1GXTA 2D3ZA 4Q8FA 5KFKA 2ZH6A 1U8SA 1VJWA 4ECRA 1KAVA 4CH1A 2WSEC 2PBNA 2QSWA 4FF3A 2AYGA 1BZJA 2KXFA 5CZXA 3HF5A 2CFVA 4DQRA 1UVMA 1S1UA 2MZJA 1S6QA 2EW9A 1H6KX 2RB7A 3HZEA 1X4GA 2RS2A 4J9PA 3QCCA 4IKCA 2DBBA 5B0BA 3FZBA 2BV3A 3QIPA 5GTJA 1RTJA 2GHVC 1Q8LA 3B8HA 1U1OA 4C7QA 3Q2TC 2IA0A 2YWKA 5HMYA 2EG1A 4NYOA 2A18A 2MGZA 1M0SA 3CCUS 1E6VA 1KOOA 5B0AA 1H38A 2B4OA 2DGTA 4DLEA 4K4ZA 4HTIA 4BC7A 3MR5A 5IQQA 3EB1A 5KFRA 3WZ0A 2F8HA 4IH5A 1WACA 5E7OB 1WEYA 3UR3C 3GZ7A 1BC6A 2H03A 3V6KA 4A8KA 4ECZA 1OHDA 4JI6F 2AJ4A 1FEHA 1F5CA 1S1UB 1S6QB 3HO1A 1FVSA 4QR1A 3F73A 1I9SA 3H5YA 4X84A 2XCPA 2KG1A 1YZ4A 3L7PA 2NYIA 3QIPB 4OI2A 1RTJB 1CSJA 4OZ5A 2DHSA 1YHQS 1M5PC 3GIMA 2JEGA 4I6YA 3I9V9 2IVYA 3CCES 1VIXA 2BR0A 4M95A 1DQAA 1YG0A 2HFOA 4KO0A 3SFUA 5LXYA 3BO3A 2KFZA 4KKOA 4LVOP 1ZZNA 2ESBA 5KAAA 2KZZA 1IJFB 2I6PA 1RT4A 3OR2A 3PKYA 1E6VB 5JVGQ 1D9FA 1Y4ZB 2MXYA 5KG0A 3KHHA 4NYPA 2EVZA 4OX7A 3BDPA 2OJ3A 1FE4A 2Z8QA 3D0IE 3M05A 4NLQA 4H54A 2HNPA 2E9RX 4WYWA 4X4PA 3VALA 2AP6A 3PW4A 2PSZA 4KAIA 1T49A 3UCGA 5EDWA 3M6XA 2J8AA 2VG7A 4IRCA 3K8VA 4B04A 4RNFA 1JB0C 5HL7Q 1U47A 4Y3CA 5DQIA 2MYFA 3HHKA 2J5AA 3P96A 2D3OR 4PWDA 1FTCA 4IRDA 4KYQA 4P6QA 5KFLA 1A5YA 1YVFA 4YP3A 4Y2MA 4AFFA 5THWA 4ELTA 3PRDA 4JI2F 3SCJE 3PFOA 4C3MA 4TQSA 5D78A 4G1PA 4KKOB 3OL8A 2RDJA 3KTQA 4A8MP 1SH3A 3MECA 4KE5A 1RT4B 2IBOA 3OR2B 3S01A 1FNMA 1L3UA 1C87A 1JLAA 3VAKA 2E9ZA 2EK6A 3KWMA 2X3GA 1QXKA 2A3JA 2LXIA 4YB6A 1HNVA 2B7BB 5BUGA 3LH2S 2KDOA 4CO2A 4CCHA 4IUFA 4RUHA 1UVIA 3G9CA 4WOHA 2CPZA 5EN1A 4DV4F 2FTRA 3S3HA 2VG7B 1ONYA 5M2UA 2ZBCA 3I87A 5EUHA 2DR5A 4NXMF 5B0CA 3IBWA 2OLWA 1OSDA 2RVJA 4PWDB 4ETZA 1QSSA 2N7CA 4QZVB 1R8PA 3MM7A 2XLKA 3EGZA 2FJMA 3DLJA 4WZQA 2GO8A 4P2SA 1Q1MA 4WFXA 5IZHA 2G4BA 3RGQA 4F4YA 1FD2A 5J2PA 1YTSA 1NB7A 2NT7A 1MROA 3TA2A 1IKYA 5EX0A 1F9FA 3EUNA 2KYXA 3MECB 4NOHA 4YQWA 3OVAA 2PQ5A 3A5KA 4Q43A 1N54B 1WEXA 5K9FA 4PR6A 2V4JB 1N0VC 2C2EA 4I69A