4WU3A

Structure of the ptp-like myo-inositol phosphatase from mitsuokella multacida in complex with myo-inositol-(1,3,4,5)-tetrakisphosphate
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
590
structure length
590
Chain Sequence
b'PAVVKNPPKLALKIDRADVNQLPRNFRMGSDKYVGVTKTGIMPTRKGMDTMNVSASSCFSEKELEAILKKVPVKPSQFYDVDLRGESHGYLNGTAVSWFANHDWGNDGRTEDIIIPLEKEQLASLKGSTVKSIYRFDDKKNVILSPVYVNYNKVRTEEEMVKQHGANYFRLTLQDHFRPDDPDVDKFLEFYKSLPKDAWLHYHSYAGMGRTTIFMVMHDILKNAKDVSFDDIIQRQKLIGIVDLSEIPDKKKNYGRKAYIERYQFVQHFYDYVKENPDLKTPYSVWAKKNKVNSWEPDYNGYIWRLDTKDRNQLPRNFRTMNSAFRTDVNVKKTGKGFTPTPTRKGLDTLYMSGSAEFSNGELQAMLPVLKQQAKGPIYIMDLRQETHGVFNGNAVSWYGLRDWGNLGKNKAEVLKDENSRLNAARGKSLIVAELDKDKMPIDPKPVKIESVMTEQQLVEKNGLHYYRIAATDHIWPSAANIDEFINFTRTMPANAWLHFHSQAGAGRTTAYMAMYDMMKNPDVSLGDILSRQYLLGGNYVAYEIAKPKPDQWKADYYHQKAHMIEKFYQYVQENHADGFKTSWSQWLAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MYO-INOSITOL PHOSPHOHYDROLASE
publication title Structure of the PTP-like phytase from Selenomonas ruminantium in complex with myo-inositol-(1,3,4,5)-tetrakisphosphate
rcsb
source organism Mitsuokella multacida
molecule tags Hydrolase
total genus 205
structure length 590
sequence length 590
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2014-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wu3A02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4wu3A03
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4wu3A01
2PSZA 2F70A 2JJDA 3QCHA 4RI4A 3ZMPA 2CNHA 1RXDA 4D3QA 5KADA 2B07A 4JMJA 3ZM2A 2QBSA 5K9WA 4PYHA 3BLUA 2CMAA 2H4GA 4Z6BA 1NZ7A 1KAVA 3ZM0A 1I9SA 2HC2A 4ZI4A 1P15A 1LYVA 2ZMMA 2PBNA 4GRZA 5KACA 1OHEA 3F9BA 3V0JA 2P4DA 1OEUA 1YPTA 4OHDA 2VEXA 1PTVA 2QDCA 2B49A 4DGXA 1V3AA 2M3VA 2A3KA 1T49A 3EMUA 2J16B 3D1QA 4DGPA 1OEOX 2C46A 1G7FA 3QCDA 1Q1MA 1T48A 3MMJA 2I6PA 1PH0A 2P6XA 3F9AA 3BRHA 5KA9A 4HRFA 1BZJA 4PVGA 1RPMA 1FQ1A 2J17A 1WAXA 1YGRA 2G59A 2FH7A 4NNDA 1NL9A 1OEMX 5HDEA 1Q6SA 4R30A 4QBWA 4R0SA 2QDPA 1LQFA 2F6YA 2NTAA 1PTUA 3O3LA 2FJMA 4IKCA 2HNQA 4HJPA 2H4VA 1ZCLA 2HXPA 4QAHA 3OLRA 4GS0A 4H34A 4GFUA 1SUGA 1YFOA 2CM8A 2NLKA 1R6HA 2HY3A 4WOHA 5IBMA 2CMCA 2DXPA 2FJNA 4GE2A 4ICZA 4WU2A 5M43A 3RZ2A 5BUGA 4WTYA 2B4SA 2VEYA 5K22A 2I75A 4R0TA 1L8KA 1J4XA 3D1HA 2PI7A 3QCEA 2QBPA 3EZZA 3MOZA 3V0DA 2CJZA 4GRYA 4JNBA 5LXQB 2MBCA 2CNIA 2I1YA 5BX1A 4ZRTA 2B4UA 3V0HA 1ONYA 3QCGA 5KA8A 3S4EA 3O4SA 3QKQA 1G1FA 3ZM1A 1OESA 2F6FA 1XXVA 4HJQA 1KAKA 3D44A 1XXPA 2OUDA 3D1OA 1PXHA 4RHGA 2Y96A 1G7GA 3QCNA 2I6OA 2B4OA 3H2XA 5MMZB 5BZXA 3QCMA 2CM2A 4GE5A 4BPCA 3CM3A 2PA5A 4JBCA 1M3GA 1BZCA 2HC1A 3QCKA 2ESBA 3F81A 2J16A 2AZRA 4H1OA 1QZ0A 3F41A 1BZHA 1I57A 2I6JA 4D3PA 2H02A 3B7OA 1L8GA 1A5YA 4QUNA 1U26A 3A5JA 3EU0A 1Q6MA 4KI9A 1OHDA 2CNFA 4JMKA 4OHEA 2CM7A 4D3RA 3BLTA 2CMBA 2VEUA 3O4UA 1T4JA 3S3KA 2I6IA 3V0IA 2IMGA 2F6TA 4QAPA 1C85A 2BV5A 3QKPA 3V0GA 1FPZA 3QCBA 2I4HA 3F99A 4GE6A 4B04A 2CM3A 4NWGA 1X24A 2H04A 1YTSA 1MKPA 3EB1A 1Q6TA 1VHRA 1OEVA 4YAAA 3EAXA 2HNPA 2H03A 5K9VA 1I9TA 3N0AA 2QBRA 1WRMA 1C84A 2BGEA 4S0GA 2I3UA 3S3EA 4MBBA 2I5XA 5K23A 3SR9A 4OHIA 2NT2A 1YGUA 3QCIA 2QDMA 1Q6PA 2B4PA 2PT0A 1LARA 2CNEA 3O4TA 4ZN5A 2WGPA 5KA7A 5KA0A 3ZMQA 1OETA 2CNGA 2R0BA 2F6WA 2VEVA 4TVVA 2OOQA 1XBOA 1ZCKA 2I6MA 3AWGA 4NYHA 5J8RA 3AWFA 4AZ1A 5K24A 1XM2A 2HVLA 4KYRA 4OHLA 4KYQA 5KAAA 2QEPA 2HCMA 4I8NA 1G4WR 3QCJA 1YTWA 2PQ5A 1NWEA 3MOWA 2I4EA 4RH5A 4RDDA 1AAXA 2BIJA 3CWEA 5IBSA 5KA1A 2VEWA 3D9CA 2C7SA 2NT7A 1NO6A 3ZM3A 1ONZA 3A5KA 4ERCA 2Q05A 1PTTA 3I36A 3V0FA 3S3FA 2BZLA 3I7ZA 2F6ZA 1GWZA 3RGOA 4WU3A 1NNYA 5KA3A 2I3RA 2AHSA 4NWFA 2GJTA 4J51A 2F46A 1EENA 5KABA 1ZC0A 1Q6NA 3OMHA 5EHPA 2GWOA 4NX8A 4Y14A 2OZ5A 3QCFA 3M4UA 1D5RA 5K25A 2RF6A 4GWFA 3NMEA 1PTYA 3PS5A 3LJ8A 5EHRA 2QCTA 1EEOA 4QBEA 1JF7A 3V0EA 5I6VA 4RH9A 1NWLA 1YWFA 2A8BA 1YN9A 3ZV2A 4Y2EA 4BJOA 2QBQA 5GTJA 2Q47A 3AWEA 1ECVA 5AWXA 1WCHA 2OC3A 3QCLA 3GXHA 3RO1A 1G1HA 3O5XA 1C86A 2SHPA 3U96A 3SMEA 1G4US 3RGQA 2Y2FA 1JLNA 2G6ZA 2F71A 2NV5A 4GFVA 1PA1A 1YTNA 2I4GA 1C87A 1PYNA 1QXKA 5KA4A 2B3OA 1C83A 1Q6JA 3I80A 2I42A 2E0TA 1PA9A 2H4KA 2QCJA 5KA2A 4YR8B 1YZ4A 4QUMA 4RKKA 2F6VA 1G1GA 1FPRA 4RI5A 3S4OA 2HB1A 2ZN7A 1U24A 3QCCA 2YDUA 3D42A 1XRIA 1ZZWA 2GP0A 1GFYA 5BZZA 3BM8A 2CFVA 3GXGA 1C88A 1OHCA 1U25A 2BGDA 4OHHA 3S3HA 2NZ6A
chains in the Genus database with same CATH superfamily
3MM9A 3S8SA 3AXKA 3AD9C 4DSJA 5LL6d 2W4DA 4ED7A 3W5ZA 4ZJLA 3MFIA 2DNGA 3GTYX 3J81U 3CD5A 2BX6A 2AYMA 4LQ9A 5AE1A 2WVFA 2AEMA 2ZJRQ 1WD6A 1B7FA 4FYWB 4QDIA 1FX2A 4HLBA 2GCBA 1M5VC 4G3IA 1FVQA 4NA3A 2XMTA 3RRKA 2KXFA 5KG3A 2QLFB 2I38A 4EI2A 1R6VA 2DIUA 2RAQA 3SQOP 2BW2A 2P6XA 3TP2A 3HVRA 4DL7A 1BZJA 1WOOA 5DETA 4O3NA 3GILA 1WAXA 2N4DA 3BH7B 4A4JA 1Q7YT 2O1PA 2QL5B 3IXQA 2IRYA 3Q86A 3MAHA 4JI8J 3GCXP 2FJMA 4NI2A 2CWKA 2FHJD 2R3VA 3BGRA 2RDIA 5B09A 2FGCA 2CPZA 2DGOA 1S1VA 2ZHOA 3EE3A 3OLRA 2XC9A 5KFSA 4NA1A 1T94A 2CM8A 4FS2A 1UETA 1RU1A 4R25A 2ZH2A 1XMOJ 4LBIA 4AL5A 2OPPA 1GT8A 1SUQA 5K8OA 4U95A 5L1LA 4ICZA 3DRYA 2GAHC 4N8NA 4QW8A 4CH0S 4BS2A 2YNHA 3GSDA 2CQ3A 2VJUA 5IV3A 4C97A 3MD3A 1LK7A 2DHAA 4FVMA 4I2PA 1BY9A 4LSZB 2CWXA 4DWIA 2ZBIA 2R7XA 4ZCIA 3QZ8A 2IYGA 3FBFA 1F5AA 2BANA 4DSIA 4GKKF 2MKYA 1B0TA 2OPQA 3NWGA 3V81B 2HFNA 2LEPA 2OELA 2XY7A 2GO8A 3D44A 1BC6A 2Z8QA 1NB2A 2CQ2A 2J0WA 2V68A 1S9FA 5GAEI 5MMZB 2YNGB 2JRSA 5G4DA 1BZCA 4ED0A 4DR6J 1IVZA 3MXHP 1GXTA 4FXWA 1HNIA 2Q6BA 1VBKA 1P3DA 1OY8A 4LR7A 1QAJA 2FJBB 4IQMA 2H4WB 1H73A 2FIUA 1D0EA 4PG7A 1S1WB 2HW3A 3ZZRA 1TL3B 1KLMA 1FRIA 3HD2A 2HNYB 4DQPA 4AYBD 1TK0A 2WTFA 2RILA 3HFZB 1XMQF 1X24A 4GRSA 1RTJA 2K8GA 3ZC4A 3MGJA 2NSBA 4PABA 2R2UA 3M2UA 3N0AA 1C1BA 4ZHRA 2LU1A 4DPUA 4ZA1A 2R9LA 2QBRA 2VL1A 3U27A 5I42B 1SCJB 2I5JB 4CLWA 1S99A 4M8LA 4RW8A 2NPFA 2VA3A 2LP4A 5U47A 2BE2B 5E5NA 2R0BA 2VEVA 2IMWP 2UUCJ 1ZCKA 4PYDA 3AHPA 5KT3A 3N6MA 2D3OR 2IHR1 2W9AA 4KYZA 2R2TA 1XK8A 4I56A 4RWXA 3QMQA 1R8HA 2ZEJA 2ZBRA 2GIFA 4DCOB 2F8HA 1T9WA 3D9CA 2NT7A 2M4MA 3M32A 2XEXA 3ZZ0A 2DR8A 3HMJG 2FJAB 2XULA 4DX7A 3OR2B 1CPZA 5B08A 4NLVA 1NNYA 3RGOA 2XWYA 1WC6A 1HQ2A 3VQSA 3DLEB 2GWOA 3WX8A 2F8EX 3QCFA 1EJ7L 2HK3A 4J7CA 3MPVA 2XYHB 2BZ2A 3BPDA 2QJ3A 5KFQA 3ZV2A 3BKUA 2QBQA 2VOPA 2B3TB 3KLIB 3AWEA 1RHMB 2DH8A 2A6OA 1P9QC 3N9UC 5F41A 4X4SA 3SMEA 4QPTA 2PO4A 4DX5A 2NV5A 2HZVA 3IS9B 2FHOB 3W65A 1NHKL 4DU7A 1NSQA 3M9MB 1JB0C 5A2QU 3CULA 1YZ4A 2ROGA 2VB6A 2H5JB 1GK8A 1LKZA 5M2PA 4CNZA 3H59A 1CJVA 2L9WA 2XNRA 1CC8A 3ULHA 4DS4A 4PG6A 4NLQA 1W78A 3FJ2A 2ZH8A 1JBWA 1YVFA 4HHHA 1SI9A 1VC0A 1NJIT 2X1FA 3H5YA 4LMZA 3CVKA 1YG0A 3OL8A 3H7HB 3CCJS 3VAFA 1C0UA 5DS7A 3R7BB 4P7VA 4JI3F 5D0RA 2HGMA 1F3VA 3OQ2A 1FJCA 4USMA 2PBNA 3T5LA 1NM2A 2H5EA 2YWKA 3B6BA 3QAUA 2J16B 4X4UA 3DLGA 4ZS6A 2AKWB 4N41A 2ZWPA 2HQFA 2E5HA 1KD1T 4OJHA 2OI2A 4LF2A 1PIEA 4AQYF 1X9WA 2NYIA 3D7SB 2UV8A 3RRHA 5KFRA 1RT7B 2MMYA 2GC5A 1E8CA 1CG2A 1FKPB 5HDEA 1Q6SA 2VOOA 1O51A 2ZKUA 1WELA 4P2XA 2P6SA 1ZCLA 3LWMA 1VRTB 3MR6A 4P2MA 2RF2B 1Q16B 1U6ZA 2UP1A 3DKDA 2YNIB 4WOHA 2DXPA 4C8OA 1O5ZA 4E8UA 3CC4S 1H2VZ 4RO0A 4WU2A 4H4MA 2L48A 1X4DA 1BQMA 2PMWA 2IRXA 3KLHB 3K57A 3A3NB 3NAIA 1VI7A 3TJAA 3TANA 1F2HA 5KG7A 4IKAA 3KG0A 3MM7A 5E3QA 1FFWB 1FESA 4FVCA 4RLEA 1E6YA 4LUBA 3GR0A 2YWEA 2ZD1B 1TR0A 3HPOA 1H3DA 4F2RA 3SQGA 5A8WB 4NYPA 4A8KA 1VRUA 3QAEA 4OZ3A 3DFEA 4ZPVR 3OW2R 4EUVA 5CZXA 1VOMA 3SBMA 4CNYA 2HVEA 1TKZA 3IRWP 2IFXA 3MAAA 1F5BA 4CYUA 1TMMA 3VV2B 2DISA 3TQ1A 3W2WB 4PG4A 1FVSA 2FYXA 1DTTA 3KK3B 3NOGA 2YX4A 2V9KA 4LF7F 1SC1B 3DCAA 2VFVA 4QR2A 2CM7A 4D3RA 4KHPJ 4ZVPB 1TL1B 4ZCKA 3GG0A 3DOLB 4HDHA 3FC9A 3OL7A 4B04A 5LMNJ 2GQCA 3VVTA 2LYVA 1NSPA 2HFOA 3EAXA 4OI0A 2VBYA 2H03A 1QUVA 4W4MA 1CBKA 2DNZA 2XCAA 3IM9A 4F0MA 3ZM5A 1WEYA 1YJNS 3AY0A 2UUAF 1X9SA 1Q6PA 4KAIA 4USUA 1O8BA 2JEIA 1LNQA 5ETPA 5A5FA 1NKBA 1HNXF 4K4ZA 2HFSA 4ETXA 1KHWA 3FK4A 3KHLA 1B99A 5J2MB 4MYTA 3M9NB 4I2QA 1FJGJ 4OZNA 1APSA 3R5GA 4NCGB 1HHTP 3DDKA 2KT3A 1P31A 1LW0B 3JYTA 5KA1A 1VFJA 4GMKA 1Y11A 4ZP6A 4OJ1A 5AT1B 3UQSA 2JFDA 3PYZA 3PX0A 2Q05A 1X0FA 4ANEA 2BZLA 3IWNC 1LWEA 2RDDA 4BCAA 3VQTA 3MD1A 3KLFB 1PO6A 5KA3A 4RW9A 3FVYA 4F3QA 1J5EJ 2FVSA 4FPIA 5DLGA 4NYOA 4M5IA 2XS7A 2UUBF 1NPRA 3Q2TC 4HT7A 4LBPA 1KKHA 2GCAA 4MAKA 3GMGA 2JLGA 3EGNA 4XAKA 1FX4A 4C0BA 1G1HA 1C86A 3GG1A 5HMWA 2Y2FA 1N0VC 3OHAA 4RR5A 1PA1A 2IC3B 3DNCA 4U6PA 2J7KA 5KA4A 4JV5J 1C83A 3GQCA 1WSVA 3LPYA 1KHVA 3BZQA 4GC6A 2CNLB 4KV8B 5D8HB 2G0IA 1Y00A 3DRPB 8RUCA 1GFYA 2OSRA 3BM8A 4ATNA 3GXGA 1RYSA 1QTMA 5HSPA 3ETOA 2GS8A 2OUGA 1K9MT 4F0KA 3G6ES 5F9NA 2WJPA 1YZ6A 3OFFA 5KFEA 3QLHA 4JI5J 4JI7F 3RBXA 3M30B 4JI1J 4Q2LA 3P3DA 2YPZA 2VORA 1DZ5A 1VHIA 1RAOA 4XK8C 1PGZA 3PY8A 1HW9A 2RQ4A 4IG0A 1R8BA 1PILA 4IRKA 3UNYA 4IFVB 2KB2A 2WCXA 3KFWX 3OR1A 4OYBA 4J9NA 4AE5A 2QLXA 3MPYA 1RT3A 1NK9A 2M8HA 2H3EB 5H9FK 1FDBA 1N5VA 2ZBCA 4NEYA 3MUMP 2W2PP 2HQCA 2L41A 1G1XA 1TL3A 4DQSA 1XMOF 3MHYA 4OHZA 4CO5A 2AJ1A 2ALYB 2B9YA 3R8YA 5K14B 1FQ1A 2HEKA 5K20B 2AZ3A 3TUPA 1OEMX 3ZNJ1 1EHWA 4WP8A 4K2XA 3V4IA 3IM8A 2NPIA 1LQFA 1KVIA 4DR7F 4ITSA 3M8SA 1SKUB 3DOMB 1TUGB 1YZ7A 2ZHBA 5ETRA 2H4VA 4ZITA 1N32J 2UUWA 4RWWA 1RT4B 4QPXA 1YFOA 3TVKA 3DM2B 2I5JA 2A2CA 1RTZA 1HNZJ 3R3TA 1Q79A 2W01A 4CT9A 2XLKA 2JFGA 5BUGA 1XIQA 4I68A 2HQDA 3UDLA 1FTCA 2IBOA 2XO6A 4N8OA 3D1HA 1VQ7S 2B51A 3V6KA 3LWLA 4ZLPA 4NL5A 2AWZA 2M70A 4USIA 2VQFJ 4QCLA 1YGYA 1SPBP 4PYAA 4M5JA 5LSOA 1UWBA 3CEDA 4ZPBA 2QEXS 1XXVA 2B7CB 3MMAB 5B0BA 2Y96A 4OQJA 1H38A 3OFHA 1HR0F 3UI3A 2R7TA 5BZXA 2VPWB 1GEHA 3TO8A 2XS5A 2V8GA 1J27A 3VALA 3RBDA 2UZAA 1RACB 1IBKJ 1EKRA 3DLEA 3US5A 3MUVP 2ADCA 4WBFA 1RWUA 3VF0B 3GB0A 2V0NA 5J2NA 4NASA 2Q1LA 4A8FA 1JNZB 4WE1A 2EWHA 4ECTA 3PW0A 3E01B 4U8VA 5EHHA 1QVGR 4JMKA 2WONA 1S9EA 4B3MJ 3GZ7A 1T4JA 3BV8A 3T3FA 2V4QA 2EFPA 1L3TA 2H4YB 1ZAWA 2EVZA 1V9OA 1B3TA 4X4QA 2BV5A 3QKPA 2OH2A 4DFPA 4HH1A 4JYAJ 2XBPA 1Y10A 3R1LA 1MKPA 2UUCF 4R5PB 5CYJA 4YAAA 1V5VA 3CCLS 5B0EA 1ZTWA 2AJQA 1I9TA 3LP1B 2YX7A 3WC0A 2JH3A 3B78A 3FMWA 2BE9B 3I0SB 4NWBA 1HBMB 1ZA2B 4LT6A 2CJBA 4GC7A 3CCZA 4ANCA 1SJ4P 2NT2A 1K47A 4DF8A 2MSSA 1KRPA 3LO3A 2UUOA 3HF5A 5KA7A 3UD5A 2HK2A 2Q6CA 4DX8H 3QT7A 2B5JB 2DGUA 1N6QA 3PX4A 3TA1A 3AWGA 4R0JA 3L7UA 5DLFA 1YQHA 2FD2A 3IP0A 2DHSA 3ETMA 5K24A 1YBUA 3P6YC 2ZNYA 4O23A 1WHYA 1WF0A 4HI2A 1PBAA 3EZOA 2BOAA 1N5SA 3AB4B 4K4WA 3PZPA 1PJ6A 2P2CB 2J7WA 4L75A 3CMAS 1Q5YA 2YKOA 1RSCA 3CF5Q 3OBIA 2XS2A 2WTZA 1AUDA 2X1AA 2AEFA 2HKEA 2NLWA 1GWZA 1I51B 4J51A 1X4BA 3TX0A 1ZC0A 3ILIA 3R5CA 2CDRB 1RT7A 2KU7A 2EFNA 2RD5C 5EHRA 2HZCA 4KPYA 5I6VA 3PX6A 3UCZP 3EUNA 3TWZA 3ZM6A 5GTJA 2OFGX 1I6JA 1F6TA 1QAYA 4DR1J 4DL5A 1G4US 1NJYA 1NH7A 1HA1A 3HSDA 3M6VA 1WC1A 2H1YA 2AX1A 2OEKA 2G2OA 4WFBQ 3JTOA 2H4KA 4J37A 2WVDA 4AUKA 2WAQD 3S4OA 2KFYA 2JHEA 3D42A 1UFKA 3LK7A 2J5AA 4JUZA 1OHCA 1FRLA 1NU4A 2BOPA 2JJDA 3QCHA 4DUTA 4RI4A 3DN9A 4H4KA 3KK1B 1EAYC 1NH8A 3EDQB 1YBTA 2B07A 3R5DA 2CNOB 4EEYA 4J9PA 1JLAB 5A8WA 4NPOA 1S59A 2H4GA 3OL9A 1YI2S 4FBUA 1DTQA 2RUSA 2IIHA 1A6LA 5RUBA 3DHWC 1IWAA 3BSOA 1XBWA 1SC3B 2F4VJ 4Y3CA 3D0HE 5L39A 3RR7A 1XC9A 1UAWA 3W2WA 2F65A 4FS1A 2VFSA 2GW8A 4DGPA 2WZ1A 2U1AA 1SIZA 1TL1A 1RWMB 1QD1A 3CDUA 1RU2A 4OZ0A 4F0HA 3QRQA 1HBNB 1MU2B 1RHJB 3R2CJ 4DSEA 2HS4A 4HACA 1MROB 2K1RA 4H54A 2D74B 1KTVA 1RA6A 3L7PA 4F04B 4R0SA 3AD8C 3KJNB 2HQ3A 3QO9B 1YHQS 5FDLB 3I87A 2VFRA 2HWHA 4OJGA 1RE1B 4YUDA 5C25B 1RAHB 3KJVB 1N36F 2DNQA 3A13A 4OJ3A 2ZH5A 2MHNA 4NZ0A 3VAGA 1ZPVA 4GE2A 4C12A 4I69A 4J9UE 1WC3A 1FEEA 5AE2A 1FHTA 3CB4A 1L8KA 2M52A 4WF9Q 3RR8A 2OMOA 5KFHA 2HGLA 5E33A 4R8UB 5IWAJ 4JNBA 3ZTOA 2VC0A 1S12A 2CNIA 1WDDA 3M6WA 3VR1A 3MCOA 4LSLA 4UTGA 3N4WA 3LAKA 4ZRTA 4KC5A 3V0HA 1LW0A 1UA0A 1S1XA 3B54A 3S4EA 4X62J 3QKQA 2F4FA 1PSDA 3BQ2A 4FXDA 1ZH5A 4HJQA 1F9EB 2ILZA 4KHPF 3QCNA 1GMVA 4RW7A 3KLEA 4DR2J 4X4PA 2QA1A 3KLFA 4BPCA 3SSSA 5D0EA 4J9QA 2EKNA 4JBCA 3HZEA 3HSZA 4KHMA 5LMNF 3CMES 1S5ZA 5HI7A 1QZ0A 1Y5NB 3V6DB 4Y2MA 4OX6A 1ACMB 3PYFA 4KI9A 2NUHA 2VONA 4XTTA 2ATCB 1HLWA 2A0FB 4NEZA 5K9FA 2MGZA 5F8JA 2HRUA 1NNDA 2GVZB 1YJUA 3QCBA 2VFTA 1IBMJ 1GAOA 1FK9A 3FFIB 4ZPTR 4MMOA 5LJ5Y 1NBEB 2H04A 1VR6A 1M5SA 2K3IA 4OYOA 2QYCA 4H4OB 3OUYB 1IM4A 1FDDA 1FJGF 1AA1B 2RKIA 5F3ZA 1L3UA 5IT9U 4S0GA 5GMEA 1JIHA 3S3EA 3E2EA 3K59A 3PW2A 3BBFA 4K4SA 4DS5A 2ADBA 1UPPA 2VZ9A 1RA7A 2QDMA 3TW0A 5T41A 2XMMA 2R8IA 2F6WA 4CQ1A 1ZAVA 3RUBL 2QGFB 4A8OA 5IFMA 4AZ1A 1FE0A 5KAAA 1QJHA 4OLPA 1FE4A 4C8ZA 4JI6J 1M90T 2FHKA 1VK8A 4CWBA 3HZGA 5E3CA 1W25A 1J5EF 1JKHB 3MOWA 1U2CA 3PR4A 1P9YA 1SJRA 2RQKA 3SCJE 4EGLA 1HWIA 1ONZA 1MN9A 1UA1A 3DRRB 1LWFA 1MMDA 3G2XA 5HROA 5EDWA 1VC5A 4Q0BB 3IRXB 3BSAA 2HFVA 4DQIA 3OMHA 1Q6NA 4WKRA 2MZ1A 3AT1B 2WRMA 2ACYA 2Y1JA 2DVIA 3B82A 3HN7A 1LWXA 3TUJC 1S0NA 3MM6B 3BBCA 1JF7A 2QMWA 1RI7A 2GV1A 1XNQJ 3OSPA 3CW2C 3SSRA 3TARA 1OQ6A 3T19A 1MN7A 1FXRA 1RTIA 2QT7A 4UOHA 2VG7B 2VA2A 1CJKA 2M5YA 2C3MA 1NDCA 1PA9A 4N77A 3GP9A 4RBTA 2XYGB 1TKDA 1UEKA 3I31A 5EX0A 4WXOA 1QUPA 5B0GA 2JFHA 1RB0A 3D66A 3QCCA 4HT5A 2JC1A 3PYGA 4ZVHA 1XR6A 4N47A 3UN3A 2NXCA 2PSZA 3JB9k 1LK5A 3PJXA 1V6HA 4W98A 2MJUA 5KADA 4PWWA 2WSFC 3I4PA 4Q45A 3BLUA 4ED8A 3M8YA 8AT1B 1KAVA 3VVUA 2YTCA 1ZA1B 2B7BB 4C4WA 4B9MA 1GH8A 2G2ZA 1Y9OA 1JLGA 4Q43A 3M7VA 3QJPA 4LFBJ 3EMUA 1OEOX 3O8WA 4TU7A 1N32F 4WJBA 1Q1MA 4O44B 2I6PA 2CXEA 5D78A 1PH0A 3FEZA 3BRHA 3LGHA 4ZPCA 4CO1A 3MEGB 4LF9F 2QN6B 5F8NA 5IS2A 2BA9A 1SQEA 1M5PC 1IKVA 4OYMA 4R5PA 4ZJOA 1KQSR 4M5NA 3AJ2A 3BF4A 2FZKB 2AGQA 2HVIA 1GXLA 5ETVA 1HPZA 2KT5A 2HHHJ 2CPDA 2UXBJ 1SV5A 1J5OB 4M5MA 1YJ9S 2Z4PA 1UW9A 3I82A 4QF5A 1Q78A 2ZH1A 3R5AA 2B5JA 1S48A 1UW4A 2XSFA 2HS0A 4L3KA 1OO0B 2Z2MA 1U1PA 1YRUA 2QBPA 1U7LA 2KM8B 2OEMA 2CJZA 1IBKF 1BQXA 1TL4A 4RUBA 3W1YC 1WWHA 2GAGC 4W92B 3IO1A 4NX9A 3K5PA 2BQ3A 1CQMA 4HYKA 3NKYA 7AT1B 4R0EA 1TUVA 4B3MF 1G7GA 2XZDB 3PACA 1F9HA 1S6PB 1IR0A 3D3BJ 3P45B 4BUCA 2W4PA 2CVIA 4DJBA 3QCKA 1WTFA 4HI1A 2FPHX 1LOUA 2H02A 2XMWA 2JEJA 1JK9B 2JC0A 4B3OA 1BLUA 1PYSB 4LF5J 3A5JA 2EW9A 2HHQA 4DPXA 4C3KA 1LW2A 2CJXB 4E2FB 1UVIA 3M2RB 3K5MA 4FF1A 4YY3J 3BYPA 3GLJA 3G6XA 1RAGB 4GE6A 2RS8A 1OIAA 4FNHA 2BJ9A 3W5XA 1RT5A 3CJQA 2PN6A 3PIOQ 2UU9J 5I3QA 2U2FA 4MKAA 2MKJA 2YWWA 4ZP8A 5FLXY 1QSYA 1U0HB 3UO0A 1RAFB 1WSRA 4A8QA 4QIVA 3QRRA 1KLNA 1CC7A 2G0JA 3SR9A 1AW0A 3PIPQ 3LUYA 2FC9A 1CJTB 2N4CA 5D6GA 2YKQA 1UTAA 2ZM6F 2CNGA 4TVVA 4ZCMA 2OOQA 2F00A 5KFIA 1X7VA 3KDOA 1NO8A 2CG8A 2IM2A 4WWSA 1W26A 2JX2A 4IDKB 3ZXWA 4ID5A 2Q66A 3CXCR 2ZHAA 1GTEA 2I9SA 4KYQA 5KOWA 3R7NB 2VBWA 3K89A 1MMNA 3DYAA 5F8GA 3NNHA 1YTWA 2PQ5A 2W24A 1YIJS 4G1QA 1S9GB 3MZIA 2RS2A 3C14A 2W7OA 2DNRA 1PAEX 3TRGA 4CO4A 1JNRB 2XY5A 4PPZA 4KKOB 2MZRA 2MHEA 4I6AA 4BC7A 2YWFA 3VZHA 1DLOA 4NZ6A 4DR1F 5AJ3F 5MLCV 2H5IB 4ANDA 2KI2A 1EENA 3G4SS 2P5VA 4NX8A 2KJVA 3IBWA 3KMQA 2Z0GA 2CKWA 3KKFA 1VLYA 3VAJA 1RDRA 2CQCA 2PMHA 3GJSB 1FJEB 1YJVA 1C0TA 4OZ5A 2Q47A 4OV1A 2JOQA 3Q8QB 5AWXA 2YXLA 2VQEF 3CO0P 2OHDA 4NMXA 3KJVA 1RT1B 3DXBA 1FF2A 3W5YA 1C87A 2ROPA 1WJ9A 3FSIA 4TLRA 5HVHA 5KT2A 3I80A 3UD3P 3T5HA 5IC4B 4YR8B 2BEFA 3QIPA 4EZ6A 2F6VA 4Y0FA 3R5BA 2KG1A 1LWCA 3R27A 4PUOB 1X5TA 5G0RB 3D6TB 2E29A 5L46A 3B8HA 2MXYA 2DR9A 2V50A 2QFJA 3PHEA 3TZYA 4I1TA 5HQMA 4ER8A 1VBYA 4DFMA 4P71A 3BM7A 1JJHA 4PXDA 2HWTA 4QWDA 1VGYA 1PG5B 1RQ0A 3ZM0A 3TVZA 2HC2A 1WC5A 3NCQA 2VICA 1MSWD 1LYVA 1YITS 3RRGA 3GV8B 1G6BA 3V6DA 2R7UA 1UEVA 4MYUA 4OHYA 5A0YB 2HQIA 1H7WA 3U1NA 1NK8A 1N33F 2F40A 4WZQA 2R7SA 1VQYA 2ZUGA 4RZRA 1HWJA 1V5IB 4EMDA 1BQNA 3CSKA 1ZOTA 5KFCA 3O6QA 4ERDA 3TJ9A 2UVUA 3A8EA 4TXSA 1U48A 3O44A 2FB0A 2R42A 4DV2F 1IJEB 3AA8A 5KT5A 3TAMB 4B17A 2NTAA 5LMUJ 2UXDF 5LSRA 2DCUB 2XM3A 1N8RT 4B08A 4DQQA 5IWAF 3Q8RB 2LA4A 2HHPA 2NLKA 1YRXA 3IBCB 2Y1OA 4ZPDA 2W25A 3TYTA 3RZ2A 1N88A 2B4SA 5K22A 5BJRA 4OZLA 3I0RA 4M95A 2FQQB 1U8SA 4GRYA 4Q8FA 1FTRA 1T05A 4OYPA 3K2YA 4EBEA 1K1SA 2ACMA 2XLJA 4K4UA 1RT6A 1EETB 2QLBB 4YR2A 3ZM1A 4KIAA 3DRRA 5L1KA 2HZAA 2XGPA 1REGX 4ECRA 3DDNA 3CCWA 4CVLA 3Q22A 3KJQB 1TTHB 3SDEB 1OS5A 3FSXA 2HC1A 3K17A 1VQMS 3M8WA 1VLOA 5C2GA 1OY6A 4ZN1A 1BZHA 1I57A 4UZCA 5L1JA 3HO1A 5CA5A 3VAHA 1IN0A 1FD8A 3CJRA 1SB6A 3O2IA 1U26A 3ITHB 3U1LA 5I3UB 4DV6J 5DG8A 5D3GA 2HMIA 4QW9A 2XSJB 3M1VA 3KLGB 1X60A 4K5RA 1TFYA 1NK7A 4JI0F 3POTB 2E5GA 4UQGA 4B3SJ 3C66A 3NEKA 1Q6TA 3DLBA 1B70B 1CJUA 3EM1A 4LF4J 4TU8A 4IUFA 4ZVUB 3LH2S 1JLCA 1OY9A 5D0HA 2VU5A 3OVBA 5E3AA 2V6AA 3T1HJ 2BW7A 4IO9Q 3U02A 2MYFA 3TZZA 2FC8A 4OI1A 2PFDA 3JSMA 4KE5A 4ED2A 4FDFA 5DQHA 3BO4A 3FZ2A 5DRKA 5HP1B 4QWBA 3MM5B 5ETMA 2QEPA 1KNZA 2YNFA 2IDEA 3CO9A 4B9UA 3FBCA 4F4ZA 5KT6A 1IKWB 8ATCB 3DGPA 4UOFA 1LEOA 2FLPA 1HD0A 5GAGI 1PKUA 3FMBA 4KRWA 4F26A 1H2TZ 1FRHA 2HAFA 1G7CB 2XB2D 1GNKA 2AP6A 2EFVA 2OZ5A 3GIMA 1MWZA 2B6AB 1UVNA 3MECB 1WG4A 3CJ2A 3RBEA 3DRSB 2P9EA 1S77D 3KK2A 1T3OA 2ILYA 4Y2EA 2R8HA 5HL7Q 2XMVA 2DR6A 3LP2A 4X66F 5KFPA 4GKJJ 1S57A 4J90A 2HNZA 1FNOA 5C24B 3UVJB 1H98A 2CDQA 3UCGA 4GFVA 1TAQA 3FNNA 3MMCA 3WIUA 3MAQA 4DFKA 2AGPA 2DNPA 4WFNQ 2JNJA 4NXNJ 5HBMA 2QCJA 3CJ4A 2RRAA 3OHBA 4P10A 4CVKA 3D6MB 1DAXA 4WP3A 3Q8UA 1G1GA 3JQJA 3ZFVA 3FEYB 3IR7B 1FD2A 3QBCA 2D3UA 3KYLA 2X1BA 3TJ8A 2Y8WA 3IGNA 1CULA 1WC0A 1JLEA 4PG8A 3JTNA 3J7A1 4Z2XA 3IA0A 3RBZA 4IOAQ 3Q8SB 3PO4A 3LW5C 1W2IA 2PEBA 1SH0A 3HI9A 4KFBB 4URGA 4QOTA 4RBVA 2B8QA 1GTHA 3ICLA 1HBOA 4DGXA 2M3VA 2CADA 2HHHF 3HHLC 1JJ2R 4KH0B 1E6VA 3CWJA 1CS4A 3D0IE 3U1MA 4PVGA 3OVSA 3HLUA 4NLXA 1ZPWX 1BGXT 3KTQA 4TU9A 1KEKA 3CCQS 1Z4UA 4V19X 4OZ1A 2N82B 5J1PA 1CSJA 4LF6J 1U0HA 2J9DE 1HYSB 3NGUA 5ETSA 3C2PA 1RADB 1U8WA 4GS0A 2NXJA 2MLYA 3E3XA 4DSKA 4LRDA 2VPYB 2FVRA 2PC6A 4X84A 3ISZA 1S49A 2QO3A 3NGRA 4ZVRB 1Q53A 2YQ1A 2RHSB 4FKYA 2E9TA 5JVGQ 1U4BA 4IDKA 1AFIA 3W66A 3MM8A 2CQ0A 5KT4A 5HQ8A 6FDRA 2XQCA 2OPRA 3CMQA 3K5NA 1NZAA 2RB7A 3R6LB 1QE1B 5GADU 5JUMA 1T0TV 4USWA 2L3MA 2J9EA 1N5YA 4LF5F 3I5BA 3A1YG 2HURA 3CDAA 3HHLB 1IBLF 3H2XA 3QCMA 4YY3F 1PC5A 2HBRB 4EO6A 1S1TA 2JWNA 3SEOA 4RW4B 2QA4S 3AOCA 1HNWJ 3HFKA 4ELTA 5GAHU 4DBQA 3MOJB 3SCLE 4ZVGA 4WYWA 3DDIA 3GV5B 1AB8A 1ITPA 2ZOMA 1SVDA 1Z2LA 1Z2ZA 3RG6A 2R8GA 3OTDA 2OSQA 4N76A 2G4BA 1U02A 1C4CA 1G4CA 3DLKB 2WHOA 4OYWA 2NREA 2CM3A 2MJNA 2EK1A 1N48A 5K8PA 1T03B 3JAMU 5K9VA 5T14A 1WF1A 3HFVA 4OYIA 1REVB 4B02A 4LF8J 1VIXA 3BJYA 4OZJA 1I94J 1T02A 1XTZA 4ZP9A 4LREA 1F1BB 4DV0F 1YGUA 2XCPA 2HBYB 2ZH3A 2B4PA 1AZSB 2WGPA 2BXJA 1OETA 5J2QB 2ZDOA 3VAKA 2IRUA 2AZ1A 4ZVOB 2W7AA 2BACA 1I1GA 1HQEA 4ZVEA 3GFYA 1PYOB 5CCLA 1TKTA 3UDVA 3IC1A 5CYMA 5T7LA 1FI4A 1GFWB 3FCHA 1WNEA 4AL6A 2HLUA 1Z1ZA 3ET6A 4NE9C 2GMJA 3UDEA 3WX4A 1AAXA 3CJKA 2COLA 4JI2J 2Y8YA 4CLFA 3ZZUA 3MVNA 4RX6A 4X4VA 5A8KA 5A0YA 1ZM9A 2MQ8A 2V8DA 2GVDB 4PKDB 4EK2A 4BLGA 2AF6A 1DHMA 4J9RA 4C11B 4UAGA 1FCAA 2O5DA 5BYSA 4IFYB 4MIWA 4RNNA 3IN5A 3THVA 2Z2ZA 4Y14A 2MZJA 3TUIC 3M4UA 1FKAF 2FLOA 5FJ4A 3AD7C 1WKLA 3HVTB 2VG6A 4P73A 3PS5A 1N52B 4QBEA 4BC9A 2BRLA 3TEGA 4RU9A 5AXNA 4I7FB 2RRNA 3CDEA 4DI6A 2LVWA 2A1BA 2I8EA 5DDRC 3GYXB 4DR4J 3J80U 3NNAA 3LP0A 2FJDB 1RABB 3OL6A 1HWUA 4HHJA 4DXLA 2V63A 3PRVA 5ETQA 1RT2A 1FJ7A 1NZ8A 4FBTA 4CO0A 1UWAA 2JEFA 4DUZF 2ZC4A 4F3OA 2R8KA 3MEEA 4F7VA 1JXVA 9ATCB 4DG1B 2R7RA 2CFVA 3NGKA 4FN5A 1LV5A 4UT4A 1EETA 3VTIA 3ZMPA 3DU6A 2IMOA 4C98A 3HT0A 2WVEA 4IOCQ 1EEHA 2FHJA 1PJ5A 1NK0A 1VQOS 3CCUS 1L3VA 3S01A 5CH7B 5F8LA 2MB0B 1MMLA 1L5UA 4ED3A 4OYXA 2AHOB 3RAXA 1WI6A 1P15A 3QQCD 1P1LA 1NDLA 4DMZA 2FY1A 4LBHA 5LMUF 3ITHA 3EGVA 4NOHA 2A3KA 4IOBA 5C42B 5ETNA 3GIKA 5I3UA 4QBUA 5GAEU 1Y3KA 4YS2A 4KGVB 2DYAA 2XSJA 2R7VA 3T1YF 1WORA 1B7YB 3MPDA 3TUZC 4G6VB 3I5CA 2H51B 3ZZPA 1HI0P 3HJFA 1X31C 3N0VA 3DOKB 2G59A 4P7TA 1RHQB 3HKWA 1WG1A 4C13A 4MT1A 1RZMA 3CCES 4P6QA 3LA0A 2F6YA 3B4DA 1GQEA 5CYQB 3O3LA 1FFSB 2HNDA 2GC8A 1Q86T 5C5JA 4HJPA 3JSYA 1M1KT 4DDFA 2DIVA 4ZIYA 2Z56B 2RQMA 4UY8T 1RAEB 2HS3A 2VKRA 1JXEA 2GMHA 3B4MA 3AQPA 2CQPA 3V2UC 3KG1A 2MQPA 4WTYA 5F8HA 2CPJA 1J4XA 5HVGA 2X3DA 2GQQA 1FGSA 3EZZA 2QIFA 2O3DA 1VDHA 2OJ3A 2V8VA 2BKPA 2BJ7A 2VTEA 2IAJB 3G8TA 3QJJA 4TQRA 3GFZA 5SUHA 4RNOA 1BD6A 1TVRB 4YMEA 2G13A 2F6FA 2KT2A 4WK3A 2BV3A 1JWWA 2DRBA 4DV6F 5F8MA 2Y1IA 2B4OA 4Y65A 2CA9A 4B3TF 3ZZOA 4WKYA 2CQGA 4GE5A 3M8QA 4NLWA 4KGXB 2ESBA 3Q23A 3ELHA 5IZHA 3BBBA 2CQHA 1C4AA 4EU0A 2I6JA 2V8PA 4M5DA 3DRSA 4QUNA 2VPZB 3WQPA 2IJRA 2ZKTA 1XEZA 5A8RB 4ED1A 4MIAA 2LFVA 3BLTA 3PJ9A 1S79A 2NCKL 4YHHF 1TK5A 4Y2KA 2F6TA 1ICEB 1WTBA 5EUHA 1SL2A 3G82A 2AX0A 1HMVA 2DR7A 4USHA 3F99A 3T1HF 2JLEA 5EGYA 3D4JA 3TI0A 2NZCA 1R8AA 2JLFA 4K2JA 5K5MA 4UQTA 4AFFA 3DLLQ 4RW6B 1LFWA 5B0AA 1XWLA 1SQGA 5IM0A 1TL5A 3P5TL 1VJWA 3NOCA 4PXCA 2OD6A 4MBBA 3WBZA 3VCDA 3OTOJ 4U96A 3FQLA 1X4HA 3UDCA 5KG4A 2CNEA 1NB7A 5KA0A 4DLGA 4XPEA 4OI2A 3G8SA 3RU0A 2Z2YB 1RTDB 5H1SV 3T6JA 2LCWA 2MKSA 5J8RA 1HBUB 4ICLA 4Q5VA 2DEJA 1NDPA 3J7YI 1YDLA 4OHLA 3MM9B 5CD4A 2RVJA 4YDDB 4RUHA 3L3CA 3C6UA 4B9NA 4Q44A 3OTCA 5CXTA 2DGTA 4KHRA 4TY8A 4RDDA 3G6YA 2AM2A 2CAJA 4X64J 2MZQA 3U7JA 3SFUA 1NRKA 1MWQA 3R7SB 1S7IA 3GIIA 3I36A 3V0FA 4XPCA 3FKBA 3C3LA 4GKKJ 1VS3A 4M5KA 3HJVA 2PEHA 2DNYA 3W2VA 4DV1J 5KABA 2ALZA 4Y2AA 3BN4A 4QIFA 4LRCA 2W9CA 4FF2A 2O66A 1KQKA 3W9JA 3CIZA 2B4VA 2KRRA 1FT8A 3FZBA 2AQ4A 4NXNF 2QCTA 4PQUA 1YJTA 1NWLA 2CRLA 3BGOP 2QFIA 3PYEA 2IDLA 5D4LA 1HYSA 2OC3A 3KHGA 4KTQA 4PQAA 1R43A 4NCBA 3RGQA 1OQ3A 4USTA 1H0HB 4Y6IA 1FRJA 4NI2B 1UVKA 4X65F 3PYDA 3BGRB 1XMBA 1DQ9A 5LSLA 4B9TA 3HSGA 2MKKA 2B3OA 1S1VB 5KFGA 2RU3A 2QSFA 3Q83A 1DJ0A 4ILRA 1SKWA 4HTJA 2MKIA 1R0AB 1VIOA 3DLJA 5HMXA 2OPPB 3ENQA 1SUQB 4USVA 3KNAA 5BR8J 3LPEA 2HHSA 4ZIVA 2GIQA 2YNHB 1XRIA 2CG4A 5E3RA 1T11A 3ZTSA 2DO0A 5KG2A 5BZZA 2PIIA 3OFGA 4B3RF 2YX1A 3BB5A 1ZZNA 2XMJA 2C3YA 1L3KA 2MKHA 2NZ6A 1SH3A 1RK8A 3I5AA 1UJ5A 3Q8VA 2C2DA 3T9NA 3R6GB 1KSPA 1JLFA 2BANB 5KFDA 2OPQB 1N34J 4Z6BA 5DO2A 3AH6A 4NXMF 1GQYA 3Q24A 3ADAC 4RKUC 4DV5J 4F4YA 2AJFE 3IR5B 2IY5B 4LRBA 1C2PA 5KFFA 2EFGA 3CD7A 4NZ7A 1ZETA 2Y0BB 1VBXA 2C2MB 1TL7A 5FIIA 5KG5A 1R7IA 3EVOA 3WZ0A 3M8RA 4XIUA 1T49A 4TKTA 2DNOA 1HNIB 4OX8A 2V69A 5KFTA 1RWKB 9RUBA 4ECUA 4LSNA 3BGUA 4NLSA 2EC0A 1S72S 1R31A 2DNNA 4MFBA 4WFXA 2UXCJ 1KLMB 4NNDA 1NHUA 1HHSA 3OJSA 1KONA 1BE4A 3NBPA 5CHCB 2CJ9A 1B64A 3GJRB 4DZ6A 1Q8KA 1RTJB 3AXMA 2JEGA 4EYHB 1HNVA 1DBDA 2JVOA 4TNOA 3Q8PB 4NLGA 1C1BB 2MSTA 4ZHRB 4C0HA 3TVYA 2E7WA 2D3ZA 4FYVB 2DPIA 5J2QA 2AYGA 1KN6A 2PI4A 2Z58B 3AOBA 3K5OA 3N5FA 4RW8B 4ZPWR 4YB7A 3RYLA 1QM9A 2CPYA 3OSNA 3N5BA 3A3OB 1FXLA 2Z2LA 2IM3A 1N5TA 1RWNB 1OPIA 2F5GA 2B4UA 4CH7A 1TV6B 1HNWF 3HM9A 3QCGA 4IRDA 1G1FA 4RL1A 2HRTA 3K58A 2WK4A 3ISND 2E5LJ 2OUDA 1W7WA 4LIWA 2Y1LB 1KR4A 2BJ3A 3TAPA 1K8AT 1KDNA 3M32B 4BDPA 2PA5A 2FLLA 1VQNS 2PI5A 1GX5A 4IRCA 4FPRA 4RU2A 3GU0A 1T9TA 2HBZB 4PRFA 4PWDB 2DO4A 1S4EA 1L8GA 1A5YA 3D54A 2CPEA 3HT3A 2WSCC 1Y5LB 4LF8F 4XO0A 1I94F 3DI6B 4EWTA 4ED5A 2L9NA 2CMBA 2R8JA 3CJSA 1PCAA 3QYYA 2I6IA 4J91A 3AAWB 1S10A 1C85A 1VISA 4RNMA 1YSJA 3LANA 2OIHA 2BKNA 1RXOB 4CLZA 2H54B 3NP5A 3GR1A 2ROEA 4AQYJ 1VMBA 1NK4A 1JXLA 2WSEC 2XJAA 4NLDA 2BYCA 1K0TA 3UR0A 1Y5IB 2M88A 1JLBB 1DQ8A 4OI3A 1K1QA 4DG1A 2W8KA 3AA9A 3BREA 4NLTA 1F3FA 2PT0A 2DGQA 5B0FA 3H2VE 1CJVB 2V9WA 5D4OA 2HBQB 2C3UA 2N3LA 4HDGA 4ID8A 2BR0A 4URSA 2MY7A 2XLIA 3QJLA 5EWFA 1VQ4S 3V81A 3JS9A 2J0SD 1NWEA 1VQLS 3OJUA 1P8GA 1Q95G 6AT1B 2PD1A 1C0UB 2GJ2A 4HTIA 2XHWA 1ROFA 3M6XA 4IH5A 2YNGA 3HXMA 3H5SA 2IM0A 1B0PA 3G96A 1WKJA 2ASLA 1HFEL 3DHXA 2V4RA 1E0DA 4WK1A 1WEXA 3LQVA 4JI8F 3V6HA 3HDSA 4LFCJ 3DLGB 3ZTPA 5KFUA 3EPGA 1S1WA 4IH7A 2D9OA 2FY8A 3GE9A 4ENOA 2A8BA 2HNYA 1NDKA 4BJOA 4AD6A 2HHWA 4WFAQ 7FDRA 3MR3A 7FD1A 4ECSA 3GYGA 4U7UD 3R9LA 2C28A 4PXBA 2DK2A 1IKYB 4LF7J 1KWMA 2DHGA 1ZAXA 2GHWA 1RLCL 1UZDA 4FF3A 4F4XA 5I42A 4L74A 1H7XA 2C42A 2J6SA 5GADI 1FPRA 2ZN7A 3PJWA 1X8DA 4JI4J 3M8PB 4H4MB 1N56A 4C0OC 2BE2A 5J2PB 1UVMA 2YDUA 3DGVA 2VIHA 1BQMB 2IAJA 3BR9A 2J6UA 3M9OB 3S3HA 2DH9A 5CABA 3C6TB 3ENVA 3BSNA 4DR6F 4PWUA 5ETOA 2QBSA 2BE7D 3LGNA 5KFMA 5GAHI 1E6YB 1OWXA 1W7KA 1HNXJ 4EBCA 3EVMA 4YR3A 1I9SA 2KYXA 3SQGB 3M05A 1EX8A 3NL0A 2KHDA 3OR2A 4GVLA 4CIOA 2DY1A 2EFQA 1TKZB 1X4FA 1K73T 3PFEA 5KFZA 1NAQA 4CYUB 1RHKB 1AXQA 3TA2A 1RBAA 5IQQA 1N0UA 1RAJA 2DPJA 4PAAA 4F3MA 1HHQA 4YEAA 3W8PA 5GVQA 3KLIA 2FH7A 1GXUA 4QBWA 1HARA 2GGPB 3L09A 3RZAA 1KBRA 3FBEA 4RW6A 1RTHB 1HD1A 4BWMA 2KL8A 2MZSA 3IS9A 5M2UA 3AQOA 2DRDA 5BXIA 3GJTB 3NXZA 1QAXA 2UUBJ 5KFVA 4H34A 4DPTA 3AB2B 3QT8A 2ZBQA 1KP6A 5HATA 2CPFA 1OPZA 4TYBA 4JV2A 2CMCA 2FJNA 4QU6A 1WC4A 2F3JA 3W64A 2LA6A 3PR5B 2C22A 3EPIA 5B0CA 2Z57B 3HHEA 2LMIA 2J8AA 2PI7A 3QCEA 4TQSA 4J9VA 5KG6A 2QYGA 3OFEA 5BX1A 3GIRA 2QRRA 1MG7A 2J8SA 2E9ZA 3I9ZA 4I2QB 3RB4A 1R8CA 3I4HX 1XN9A 3KXDA 4C3LA 2R7QA 3O4SA 3HHKA 3N28A 1PC4A 4F67A 1ULRA 4FYDA 4HEA9 4L3NA 1KVJA 3RW6A 1PXHA 1FDNA 2FDNA 3V6JA 3JYTB 4CO3A 3DRXA 4J9KA 2ZBPA 3VGUA 2J0QD 4JV1A 2FHMA 3PO5A 1GMUA 3QIDA 5HLFB 2XZTB 2CIMA 2J16A 1LWEB 2VUGA 4JI7J 2E1RA 1BWEA 3KHRA 4USKA 1NSKL 4Z7YA 4KT0C 3SSQA 1J6UA 4RW9B 3W62A 3LALA 1Q6MA 2DJWA 4YN3B 3QWUA 2KFNA 3QGPA 3HK2A 5ETKA 1FRKA 1FKOB 4Q7AA 3BR8A 1FKPA 1X5PA 3OTOF 1AUSL 1HKAA 5L8RC 2VDHA 1MW7A 3PEJA 1T9YA 1RHRB 2FGOA 1YTSA 3EB1A 5E3PA 1VRTA 1R0AA 2DXEA 2RF2A 2FVPA 2CZ9A 4Y2CA 2YNIA 3J7ZT 1NPKA 1X4AA 1UPMB 4Y00A 3QCIA 4D3HA 3DU5A 3TOQA 2C2KB 4DR7J 2D9PA 5ETTA 3THPA 4O3OA 1S6UA 1A0OB 1Y0HA 4X64F 3KLHA 1KOHA 1TELA 3ZMQA 4K50A 5DZ6A 1DFDA 3EDRB 3BO3A 2ABYA 2HVLA 3LAMA 3PV8A 2C3PA 1VQKS 4DV1F 1SJFA 2RDJA 2VG5B 2ZD1A 1BMQB 3QLHB 4F2SA 2KFZA 1HI8A 3N01A 4JOUA 4I4BA 2BIJA 1X9MA 2VEWA 2XWXA 2YKNB 3DXSX 4K4TA 2MKCA 4CH1A 5AXMA 4IG0B 3P96A 3ENAA 5KFNA 3OR1B 2EEYA 4CRJA 1I3OB 3N2AA 3KK3A 2GJTA 1RT3B 5DJBA 5CZVA 4C9DA 3D5MA 2W1BA 2V34A 2RF6A 1HR0J 2EXUA 2D41A 2K2PA 1EEOA 1URRA 1RGVA 4QZVB 3DOLA 3HKZD 3MDFA 5BR8F 2QA2A 5I4MA 1WCHA 2RRBA 3O5XA 2IA0A 2LXFA 3V4IB 3MF5A 2MPUA 4YB6A 2ZH4A 2G6ZA 1T9UA 1TMJA 2RU9A 5IT0A 4OX7A 2E0TA 3HVAA 2VF3A 2V67A 4C8YA 4K0KJ 1H72C 5HK4A 2E9RX 3F56A 1TKXB 4RI5A 1K0VA 1N34F 2XTJP 4WTOB 2NYHA 1ZZWA 3NS7B 1DRZA 2LEBA 4DV5F 5J2MA 2BGDA 1TV6A 3RGIA 4NCGA 4Y2IA 3IMQJ 1FWKA 1RXDA 5IXUA 3W60A 1O5JA 1NUEA 5B0DA 2FJVA 4RNHA 1M1HA 2FTRA 2MY8A 1UWBB 4ELUA 4J9MA 1YBAA 3MPUB 2WW8A 1HW8A 2ATLA 2ZMMA 4LVOP 3KOAA 3V5RA 2UXCF 1EB0A 2P4DA 4PWDA 4OHDA 3KMSA 2QDCA 3D1QA 2QTWA 3MR7A 4AXIA 1EQ0A 2HVDA 3DI6A 5J2NB 3W3SA 4WE1B 4DX6A 2GIRA 1IKXB 2OAUA 2WONB 3QPIA 1S9EB 4KGKA 2GHPA 2J7UA 3QWPA 4ZVSB 5D0GA 1NMEB 4CLSA 2IJNA 3NGTA 2IC3A 2UVRA 1U6FA 1FNMA 3TQEA 4QAHA 4C8LA 1JLBA 2ZFHA 4QQBA 3T1AA 2FJXA 4KB7A 3TNVA 1ZTTA 1YJWS 5LXRA 4KV8A 3PRDA 2CVEA 3CTRA 4WZMA 2AIRB 2ZZTA 3DRPA 2XYPB 2HG4A 2K7JA 3GYNA 2E5LF 3O5TB 1NKCA 2JL9A 1IQZA 2DNMA 2IA6A 1Q4RA 2CNNB 2MBCA 2I1YA 1N6QB 4GVBB 1EQMA 1LXNA 1NEEA 4QYRA 1QSSA 3M30A 4MKVA 5D4NA 1R89A 1A9NB 1NCLA 4ES1A 2QMXA 4RHGA 4ZPAA 4TVAB 2Y1RI 3UWTA 4IFVA 3NG8A 1HWLA 3ENWA 1F60B 2KN4A 4K7QA 4LFAJ 2AJ4A 5DM7Q 4H4KC 3I32A 4QR1A 3D2WA 2CZ4A 2VDIA 2F7VA 2AZRA 2R2SA 4QWAA 3Q0AA 2CZVC 1B4SA 5L1IA 3T6BA 3PEHA 2MZTA 3JQMA 3ILOA 4OHEA 3CJ8A 5K14A 2PA3A 4P72A 5DM6Q 4JV5F 3H5XA 2LQBA 2UVWA 3S3KA 1XR7A 4ZK7M 1UVLA 2YPYA 3TZWA 2V2VA 1R0BG 4YP3A 1FPZA 2AMCB 1IKYA 4NLOA 5AXLA 3DOMA 2KHCA 2BM0A 2GHVC 1RCOB 2UV8G 4NWGA 3MR2A 1RT4A 1OEVA 3D3CJ 3DM2A 3NAHA 3M8PA 1VYAA 2I3UA 5J2PA 4ZVTB 2ZUAA 4F36A 1VQPS 4C48A 2UAGA 4I67A 2RSQA 3O1LA 4JI5F 3E8OA 1IBCB 2BMBA 3VGTA 4JI1F 3A12A 4ZN5A 1M5OC 3OT9A 3C6TA 1UFWA 5ETLA 3HCXA 1D8YA 5DQGA 1N36J 5LT5A 3EJMA 2BRKA 4KYRA 3NCPA 2JFFA 3MEDB 5D15A 1SBRA 5A5EA 3HX9A 1RISA 3QCJA 1S0MA 5KG1A 5H9EJ 1RWXB 4LFCF 2I4EA 1ZBTA 2VJVA 1A7GE 3MMAA 2EKYA 2E7XA 1JX4A 2C7SA 2DD8S 1DTQB 3I55S 2Y68A 4ERCA 1R0CB 4LRAA 2UUTA 3MUTP 3CDBA 1CQNA 2HPUA 1XERA 3CNQP 4BUBA 3I7ZA 1SQFA 4F4KA 4I6YA 2PFFB 1FO1A 1TQLA 2A6MA 1FERA 2MQLA 3EZUA 3EWGA 5EHPA 3E01A 1WHXA 1VK3A 4G1PA 1EKSA 3NGSA 3F73A 3CE8A 4RH9A 3PRBA 1YWFA 5H9EK 2GGPA 2CNKB 4L72B 1HNZF 1RTHA 4ED6A 4B9VA 1VJQA 3CCTA 4JI4F 4HACB 3LF0A 2K1RB 2LLZA 1QLNA 1TP7A 4DSFA 3RTVA 2SHPA 4LR8A 3HHDA 2V5HG 4QU7A 4DN0A 1JLNA 3AFGA 4IR9A 5EX3A 3SV4A 2DGVA 3LP1A 2DR5A 1PYNA 2PDAA 2AD9A 4OYAA 4DV4J 3I0SA 4KPCA 1HBMA 3CCSS 5KA2A 1VQ6S 2YWHA 2DBBA 2VQFF 2CPIA 4CLUA 3L7OA 1TAUA 3DLHA 4TYAA 2DB1A 1S97A 2QG9B 4ZVQB 3S7RA 1C88A 1X4GA 3C8YA 1Q7LB 3A8JA 2OD4A 1UEUA 3N79A 2VC1A 2OTLS 5LXYA 4FF4A 3KHHA 4LSLB 4X4NA 4CDIA 1SJ1A 5K9WA 5IQ6A 3NMRA 2CQDA 1S1XB 3RAQA 2HSEB 3MURP 3I96A 4ILMA 4X4OA 2WBRA 3SYZA 1EARA 2BQUA 4ZI4A 3MCNA 2OP5A 5HLFA 4Z37A 4RW7B 1OHEA 3DC2A 5EWGA 3KLEB 2QA4G 1S7HA 4DR3J 1Q5VA 4M5LA 5L9XA 4JYAF 2B49A 2EC2A 1N4LA 3H2LA 3HULA 2MQQA 3ZTQA 2O67A 3VGVA 1KVKA 3UCUP 1FKOA 5KFKA 1RWPB 4G1IA 5LJ3Y 3MTKA 1RWWB 4ECZA 5EWEA 2MGZB 2V8HA 4ZIWA 1GQQA 1FK9B 2DT9A 5HO4A 3WIVA 4IKCA 2ZWOA 4WFYA 5HQLA 1S4FA 4JV0A 2ZH6A 3QT5A 3HD1A 1X5SA 4GO5X 2HXPA 2XHCA 2L08A 4ETZA 2YKMB 2FUG9 4CLTA 4HH0A 3QGIA 2RKIB 5C2CA 2YQ3A 1AROP 2DHHA 5M43A 1OYDA 4BWJA 4DEZA 2NXEA 1UFLA 4LVNP 2OFHX 5H9FJ 1S0OA 4HKQA 1SIWB 5HANA 3MOZA 4QIEA 3BEGB 4HHUA 3KK1A 4F02A 4PPDA 2H9ZA 2G1HA 3GCWP 1Y7PA 2VG5A 4J9LA 1U09A 3H0PA 4XDDA 1JLAA 3K8VA 2UUPA 1U2RA 2YKNA 4NA2A 4ZLJA 1R3NA 2LKZA 1M5HA 2AYEA 3W9IA 2VD3A 2XI3A 3IAS9 2F8MA 3H4DA 3MWBA 2D1CA 3C19A 1LWFB 1AFJA 1B0VA 1RAAB 5E7OB 1UAGA 2E1MC 5E0OA 5HROB 2ZVIA 3IAM9 3E51A 4KH1B 4KBIA 1WI8A 2E66A 3PKMA 1HBNA 3OXGA 1MU2A 2CNFA 4DLEA 3NNCA 1O0PA 1FNXH 4CO2A 4YR0A 1T95A 5F0UA 3O4UA 1MROA 5KFXA 2J9DA 3G71S 3GFHA 2OGUA 1OSDA 5EN1A 3QCZA 4UOGA 3QO9A 2VHGA 2VOSA 5FDLA 3GV7B 3QATA 5IT9Y 2DRAA 5DZ7A 5BYQA 4PCQA 1SKSA 2LU2A 1RTIB 2HNPA 5C25A 2RHQB 4DR5J 4LF9J 3UFCX 1CJKB 1SC4B 1TKXA 2FVCA 1YK9A 2FJWA 3QRPA 2MDAA 3CJ5A 5IOLA 2VODA 4UOCA 5K23A 5CAAA 1FEHA 1BXNA 3ZZZA 4O3SA 1LARA 1SC6A 1OYEA 4R8UA 2G1DA 1XBOA 3NWRA 1KQFB 2HHVA 2F4VF 3NLCA 2E44A 1UMJA 1VBZA 4I8NA 1NK5A 3PW5A 1X5OA 2V2ZA 1KQGB 3UE2A 2GJFA 1DURA 1YWXA 2VBZA 4NLRA 5A6PA 4DSLA 5KOXA 4OIXA 2GFFA 1HQUB 1Q1KA 4Y28C 1WHVA 5DDOC 2VBXA 4P9SA 2YVSA 1JLGB 3G87A 2F6ZA 3RJMB 2CYYA 3OLBA 2EK6A 2AHSA 2DGXA 3N6NA 2JJ4D 1IKXA 4LF1A 1SXLA 1T3NA 4CTAB 4M63A 2D3O1 2ZOGA 1ZS6A 2D7SA 4HL9A 4QJVA 3LJ8A 2OTJS 1G2EA 4UUWA 2W2NP 4K0KF 2GVZA 4QR0A 4IH6A 2QC3A 2W2MP 4ECWA 3FFIA 1ECVA 3EVWA 2GX8A 4U67Q 1IKVB 4F50A 3M2VB 5JMNA 2W9BB 1NLKL 1MLAA 2HAIA 4M5GA 1FA0A 5LOQA 1U6BA 4H4OA 3OUYA 1HPZB 3KUGA 1QXKA 4K4VA 1SV5B 2HVHA 4QUMA 4DHVA 2LDIA 1D3WA 1D9DA 3VAIA 1XJWB 3NS5A 4X62F 3MCSA 3EZ5A 1V3ZA 3J81j 2GP0A 3PCOB 4GVBA 3QSIA 2E1PA 4MJKA 2ZE2B 4A46A 5J1EB 1P27B 2GC6A 3TR5A 4DR2F 2F70A 3T41A 2CNHA 4M5HA 1T7PA 3Q89A 1JKHA 2VKZG 3ZM2A 1PYTA 2NSCA 2N7YA 2ZM6J 4KJIA 5KFLA 2NS1B 1NZ7A 3PXGa 3BH6B 2XNQA 2XI2A 3FCWA 1UVJA 4GRZA 3V0JA 1U45A 4AXJA 3GFXA 3HSJA 3QT6A 4Q0BA 3IRXA 5I3PA 1YPTA 4QIGA 1IBMF 1G3OA 3EGZA 1V3AA 2DNHA 4DPYA 4KQZA 1G7FA 2R7OA 3EXCX 4I6WA 4OMFG 4QWCA 4B3OB 3IR6B 3MM6A 2NUUG 4JB8B 4RUCA 1LW2B 2H65B 5FD1A 4YQWA 3OD2A 5AJ3J 3JXOA 5K8NA 2QDPA 2C3OA 4OL8A 4ES2A 1PBUA 1Q0NA 1CEZA 2VG7A 4HR2A 4DFJA 3OVAA 2YBVA 1RT5B 2FLNA 3VWSA 2MQMA 1D09B 1OSCA 1RAIB 4X2BA 2HY3A 1RHUB 1TU0B 4CT8A 5F0WA 5AE3A 4ZN3A 2KKHA 3V4MA 4OHWA 4JI6F 2VQEJ 4BHQA 4DL6A 1HWKA 4YOEA 1NJZA 4Q2MA 5HN0A 3GSIA 2P9CA 3MEDA 3V0DA 3CJ3A 4LFAF 3K8WA 4ID5B 5CQGA 3SCKE 1RJJA 4B9SA 2PGCA 1YTYA 4ELVA 1ONYA 3DYAB 2MQNA 4WFZA 4G1QB 3C14B 3FGVA 3R5JB 1QDUB 1QY7A 4J5OA 2OEJA 2EG2A 2CQ4A 3EGWB 1IXKA 2QL9B 2NXNA 1XNQF 5K8MA 3BGFA 4U7UK 3BPSP 3PNIA 3IG1B 1DLOB 4WXWA 4Y34A 4O44A 5GAGU 1VQ9S 3B7OA 1UKUA 1FWLA 2IJFA 3MEGA 2KG0A 4WYLA 4P2FA 4OX9J 3GPAA 2V2QA 2CJYB 3QNWB 4V19J 4U8YA 2IMGA 5D77A 4QAPA 2RUGA 2LXIA 1C0TB 2FVQA 2LQ8A 2XMKA 2Q43A 1YJ7A 4Q8EA 1N33J 1VHRA 2BVZA 1J5OA 3PW4A 4QIWD 3SI8A 4ZP7A 3G86A 3HP6A 4ZJQA 1VRQC 4EZ9A 1H2UX 4WPAA 2A2DA 4DL4A 2ZJQQ 4DV2J 1WF2A 4OHXA 4FNIA 2M2BA 3PDNA 3QIPB 3BKFA 2I0XA 5FLXU 2UXDJ 4N7TA 3O4TA 1LWCB 1NPPA 3M4XA 5ADZA 3OLAA 2RQCA 3OXLA 2AU0A 4J9SA 4MKBA 4NYHA 1BWVA 1NHVA 2MTLA 3A3PB 1XM2A 2Q79A 1RUSA 4LFBF 3QFHA 2B9EA 2NQPA 3H25A 2Y0SD 4NLYA 2WB1D 3ZTRA 1S6PA 2RE1A 2X3GA 4F25A 3KUEA 2V94A 3Q8YA 1NJXA 4S0MA 2KXNB 3ZZTA 2E7VA 2F46A 2KXHA 3H40A 1FDAA 2QLJB 3SFGA 2RMLA 3W9HA 2EFOA 4KO0B 2UXBF 1GX6A 4DV4F 3RB0A 4A8MP 3D0GE 1UJ6A 4ECVA 3M2RA 3CC2S 5J1NA 1BQNB 2HWIA 1YN9A 2VV5A 1ZZFA 1W2BR 1S1UB 2YKMA 4X4RA 2DY9A 5KT7A 3GONA 2HFUA 4L73A 4U7CA 3SCIE 2NXUA 1U2FA 1SH2A 2KVIA 2XY6A 1PJ7A 2G0CA 3TAQA 5DGAA 2EPIA 1K44A 2BJ8A 1DARA 1NXIA 4ALZA 1CJTA 4JI0J 1U47A 3SV3A 3MR5A 4AT1B 1J2VA 2ZZMA 2DH7A 3I0RB 4OI4A 3NRSA 2F9DA 3H20A 4A8XA 3EXYA 4DR3F 2J0XA 4KGMA 2GO9A 4ZLLA 1T05B 2DXDA 1CLFA 5L9NA 1S9GA 3F0NA 1SKRA 4JMJA 4CI0B 4PYHA 1R6YA 2CMAA 1RT6B 4NLUA 5BYRA 3RAMA 3PVXA 4KKOA 2IYIA 4ZKAA 3PFOA 2A18A 2W2QP 3EYZA 5DG9A 4X4TA 5KACA 1T9XA 2BJEA 3FSYA 1Q8BA 2ZITA 1KC8T 4A8YA 2BJDA 1OEUA 1WDTA 4DF4A 3X3UA 3VAMA 1RKIA 2DITA 2QSWA 1EP4B 2C46A 5GMDA 1QTNB 1HI1A 1Q8LA 4YFUA 1T48A 4NYZA 3BYRA 3MMJA 3PW7A 3F9AA 2UU9F 4HRFA 1H6KX 1S0VA 2ASDA 4OV6A 2ZNZA 1RPMA 1NK6A 4EYIB 2J17A 2PE8A 2M3DA 3F44A 4DPOA 3IGVA 4ZCLA 4DV7J 5D3GB 2HMIB 1LFPA 3BKTA 5ITHA 2SXLA 3UN5A 2L9DA 3M1VB 3CUNA 1SJ3P 1RT1A 3W8GA 1URNA 5E41A 3CJTA 5DDQC 3ZZYA 1C1CB 4NRUA 4TY9A 1V3RA 4DQRA 2N3OA 2GMLA 4DV3J 3KJFB 3H4BA 4A48A 2ZJPQ 5CD4H 1CJUB 1HIYA 4M94A 5A76A 4MK7A 4K8RA 1JLCB 1Q82T 4X66J 4PUOA 5G0RA 2YKAA 4K4YA 3GWCA 2BJ1A 1O6XA 3BGLA 4UY85 1IUJA 2XMUA 3M6UA 1UP1A 1WACA 2QV6A 4CM0A 3JSMB 1ELOA 2X7IA 3FUYA 4XDCA 5KAKA 2HHTA 4FZVA 3DMJB 2BQRA 3PHTA 2YNFB 3T9ZA 2OKQA 4LIRA 1IM6A 2KM8C 1OESA 2GA7A 4KGZB 4DUYJ 3DGPB 1HQUA 3D1OA 3BDEA 5JVHQ 2LQ9A 4E98A 2Q3PA 2I6OA 2I2YA 1KFSA 5KFWA 3MI7X 3SZ2A 2QMUB 4L76A 2J6TA 4CTAA 4H1OA 3G6VA 2W8LA 1XR5A 4D3PA 2GNKA 2DEIA 4DN9A 2V4JB 4CCHA 4DR5F 3EU0A 3C16B 3TZXA 2VEUA 4M1KA 4D3GA 3BO2A 2VH7A 3M2VA 2W9BA 2CFXA 3KK2B 3TAMA 2LQJA 2Y66A 5DGBA 3LP2B 4KSEB 2YWGA 4C3MA 1IQTA 3ZNUA 2HNZB 1IR2A 3UD4P 2KVQE 3MMCB 2UVVA 2LEAA 1JLQB 1WRMA 4N5SA 5IV4A 4K5SA 2G2YA 5HBMB 4P2SA 2ZE2A 2K3KA 2P8IA 5J1EA 4FYXB 3TA0A 2MLXA 2B8PA 4CZCA 2LXUA 3KNGA 1CULB 4ECYA 2I1RA 1TK8A 3QFWA 2JVRA 1G4WR 1JLEB 2E1CA 4LRFA 4ZMMA 1D8ZA 3ILLA 4F4AA 5IBSA 2M8DB 2OO4A 4MK9A 3SMZA 3SDEA 2AGOA 1SL1A 3S3FA 2DKOB 3R1HA 1EZZB 1XNRJ 4CLYA 3X1LB 3J7AN 5THWA 1HBOB 4NWFA 3BN7A 4KY3A 4O4GB 1S6QB 2B0GA 3VHQA 1D5RA 5K25A 1CVJA 4IO1A 5GMKa 1IBLJ 4CLLA 2OPSB 2B9XA 1E6VB 2HHXA 1CS4B 2C2RA 3KLGA 2HHUA 2WOMB 1EIYB 3KUHA 3POTA 1L3SA 4OZ2A 4DL3A 3GXHA 2Z30B 4IG3B 1WHWA 3H90A 4DOZA 5E2QA 4O4RA 2CJAA 2F71A 3NCRA 4YDXA 1YTNA 1U49A 2I4GA 2OMLA 2KJWA 4EO8A 1U1NA 4A47A 4CLPA 4YB1P 4CVMA 1Q6JA 2KRBA 3MMBB 4TN2A 2R7WA 4UZBA 3D6FB 4N56A 2XO7A 1QSLA 3RB3A 5DQIA 1HL6A 5A6WA 2QLWA 2W7PA 2WBMA 5C7PA 3IFEA 2CUYA 5HP1A 2NR0A 3MM8B 4HVZA 4ZOSA 3MM5A 2DXFA 3CDWA 1JJCB 1SJQA 4WIQA 3CD6S 2OPRB 2Y67A 3BQ1A 4I64A 4DV0J 1IKWA 2BABA 5JXSA 4ECQA 1WOSA 3UW1A 4IR1A 3HHNB 1N5YB 3OTBA 3PTWA 1D1UA 5HMYA 4FXVA 1RWOB 2DNLA 2F1FA 1UZHA 5CCMA 4OLOA 3IG1A 1U1KA 2CQBA 3D28A 1S1TB 1UCNA 4DU8A 5KFOA 3G9CA 2ZVSA 1NSAA 4B3SF 3SXLA 1JJ4A 2B6AA 1RYRA 3QCDA 3MECA 4A8WA 1VQ8S 3UR3C 2RT3A 2WVBA 3H5UA 3FDSA 2HRYA 5KA9A 1WEZA 3FRZA 1H74A 2XPCA 1FRXA 4HV4A 4LF4F 3I6PA 2R4FA 1RLDA 3LGMA 1PTUA 5C24A 3UVJA 2MEWA 1YKWA 2IBKA 3A8KA 3Q2SC 2D69A 1SUGA 5MAOA 1F9FA 1R6HA 2APOA 3CCVS 5IBMA 3W61A 4P52A 1SL0A 5LM7E 3NS6A 2VEYA 2YH1A 4PEOA 4MIBA 2EI5A 3C15B 4UF4A 4O3RA 1LXJA 4L6V3 5LXQB 1P1TA 3S1TA 1HQEB 3OV7A 2J76E 2IVMA 4PXEA 2F9JA 1TKTB 2EG1A 3R2DJ 5CYMB 5T7LB 3JTPA 4DUZJ 1AYEA 5KA8A 4DL0C 1PAUB 3ET6B 1KAKA 4OX9F 1XXPA 4KFBA 3D9BA 1JMTA 3CJKB 4QYZJ 3J7YU 2DCLA 2EBEA 3D6HB 2JZ5A 3CM3A 1TZ0A 4RNFA 2YY3A 5A8KB 2GCFA 3P5BP 3UNGC 1FFGB 2GQ2A 3JQKA 3WDOA 2DGSA 4KO0A 2P9GA 4GKJF 4F8RA 2ZDPA 2W4CA 3JSBA 2VG6B 1Q8IA 5L38A 1S1UA 3UAGA 5KTQA 2HQGA 3V0GA 2DHXA 3JAMY 2I4HA 4FYYB 3CJ0A 3R97A 2AJ2A 2YQ0A 4QYZK 2G9OA 3CCRS 1D9AA 2K06A 2HGNA 2E5IA 2IVYA 2IM1A 3TEHB 3LP0B 3T1YJ 1VHFA 3BSCA 3CD0A 3HHLD 4ILLA 2HIYA 1N54B 2YKPA 1RT2B 3CGIA 4OHIA 2X5OA 2GJIA 3KG4A 1U1RA 3FBBA 2YH0A 3MEEB 1XMQJ 3NRBA 2E1AA 2I6MA 3S6EA 2M7SA 3AWFA 1R8PA 1QVFR 4NCAA 1QE1A 1FRMA 4DCPB 2HCMA 3J81Y 1IJFB 4I0WA 4I2PB 5HMZA 1P6TA 2QL7B 1M5KC 2CQIA 2WW4A 3THTA 2AV5A 3QZ7A 3HHLA 2HFZA 4C6AA 2FZCB 2QX0A 3ZM3A 5HJXA 1WUUA 1U1OA 2HIQA 2XZWA 2XG8A 1EP4A 2DGWA 4RW4A 4FP9A 2P6TA 1N5QA 2KZZA 4WU3A 2I6WA 1V3SA 2NZ4A 4LF6F 2HLTA 2KDOA 3QGHA 3T5JA 2ASYA 2GZOA 5DDPC 3A8IA 3NMEA 4DZDA 4B3TJ 3ILJA 3J80Y 2MLZA 4IQXA 3MPWA 3MEKA 2HVZA 4DCJB 3I9V9 5F9LA 3DLKA 2CJQA 1VC6A 2B43A 4FKXA 3P4UB 4PZVA 3QCLA 3RO1A 5KFBA 1C1CA 4U9RA 2FZGB 2C2ZB 3U96A 1T03A 1DQAA 1Y3JA 3MCMA 2HNDB 2PA8D 1X4EA 1REVA 1YLXA 3NY0A 4B9LA 5DG7A 1RKJA 3CPWR 2XGQA 4YHHJ 2I42A 2W2OP 2B9WA 2LDYA 3C46A 1Y4ZB 4F4WA 3M2UB 2C2NA 3WC2A 2Y9HA 4MKYA 4ECXA 5KFJA 2J9CA 1U24A 1AZSA 3FCVA 2MQOA 1JBVA 1R27B 3A4TA 2KTQA 1QAIA 4DL2A 2M0GB 3CC7S 4RUAA 2AW0A 4IYQA 1S6OA 3DMJA 4ZLNA 1U25A 1BUXA 2VPXB 3AJDA 4D3QA 3EX7B 3ONQA 2ZC3A 3KLVA 2AM1A 4EBDA 4AL7A 3H8YA 5M2RA 4USJC 5IT4A 4P75A 4OI6A 3VZIA 4C7QA 2JDJA 3IWLA 1MWYA 1JQGA 2BDPA 1TUWA 2GVDA 4NLPA 3AODA 3F9BA 4DV7F 2DNKA 3M8QB 4C11A 2JSXA 2VEXA 4OYZA 1PTVA 2V4JA 4IFYA 4URQU 4CLKA 3C16A 4Z7CA 2EBGA 5KFAA 4TLQA 3D67A 4M5DB 2IPOB 3HVTA 1FXDA 1U1MA 2AT1B 4JI3J 2ERRA 3G8QA 4DV3F 4QWEA 1KS2A 2CPHA 5F8IA 5B7WA 1YGRA 4I7FA 1Q81T 2AYBA 2DTJA 1NL9A 2F63A 3OXFA 2LECA 1WKKA 2JFKA 4R30A 3G82B 1HMVB 2KZMA 2HNQA 2H48B 4UUXA 1JLQA 2X51A 2R2RA 4OHVA 2C1EB 4GFUA 4E0DA 1WOPA 3MTJA 4YB5A 2N7CA 2A3JA 5IM0B 2FJEB 1U0SA 2PMZD 2AJ0A 2KYZA 4PG5A 2OLWA 4ES3A 3IWXA 5KFYA 1TFWA 4DUYF 2I75A 5D4PA 4R0TA 4LR9A 4X65J 2C2OB 5SZTA 3UN2A 3QSYB 4JI2F 2X1GA 4O3QA 2BKOA 4ICLB 2BBEA 5JJBA 4WCEQ 1RWVB 1VQSA 3C6UB 3CIMA 2QE5A 1YX2A 4TY8B 1F5CA 4B3RJ 1NKEA 4NRTA 3P8BB 3ZL8A 3PG9A 3UPFA 3BDPA 2RJZA 2VASA 3WHIA 2CM2A 3IBFB 3NGDA 1RBLA 4RPFA 1M3GA 1X0PA 4O4GA 4PR6A 1S6QA 3F81A 1RP5A 5C42A 1F0XA 2KO1A 2CQ1A 2KH9A 5HVFA 1XQIA 3F41A 4MTPA 4DR4F 2OPSA 3ZO7A 3RW7A 4O0IA 3M8ZA 4O0NA 3W2VB 3W7BA 4NMLA 3L95X 4NXMJ 2WOMA 3W63A 1KTQA 3PM9A 2ZH9A 4MK8A 1OHDA 2W9CB 3I56S 3DOKA 3K5LA 1OJ4A 4KR0B 3V0IA 4A8SA 4IG3A 5F3TA 4PQUB 2RH3A 5HJYA 4RJVA 2IVFB 1ZYQA 1DY3A 5CYQA 5AXKA 4CP5A 1OMSA 2A10A 1FWPA 2RIJA 4ZDNA 2O01C 2XMAA 6FD1A 1VQ5S 1ZM4A 1VCTA 4O3PA 3MMBA 3OTEA 3K7RA 1U1QA 3BS9A 3FQKA 5A2QY 3GIJA 3KDNA 2LQ5A 3KWMA 1C84A 2BGEA 4MH8A 2I5XA 3H98A 1I5OB 4K4XA 4OFZA 3AJ1A 2HYIB 3PKYA 3J7Z5 2CJKA 3SIPB 1MNEA 3AOAA 4RBUA 3N6LA 1XNRF 2BM1A 4ZVFA 1GMWD 1TVRA 1F2GA 4BBYA 4WIIA 3JSRA 1UL3A 3MM7B 4RH5A 1KFDA 1S76D 3H2UB 1BHNA 2UUAJ 1JLFB 1RCXB 3K0JA 3CCMS 2BUNA 3CWEA 1U1LA 1UJ4A 1ZM3A 3GJQB 3CT9A 4P74A 1NO6A 2ZZNA 3FRYA 4JP8A 5IC6B 4C8NA 4C8KA 3A5KA 2QZ8A 1GG4A 1PTTA 3LOUA 2C2EA 2WVCA 1VRUB 1TL7B 3RB6A 2I3RA 2RNEA 1M1GA 3FEXB 4K59A 3MAAB 2V2KA 5A8RA 2M9KA 3OPKA 4CM2A 4GWFA 3L9ZA 2VFUA 1PTYA 3P49B 1YRTA 4LJMA 1X4CA 1DTTB 4LSNB 1GMWA 3V0EA 2ZH7A 4G65A 1IWGA 5KG0A 3QGGA 4MFBB 3TX8A 2POKA 4UW2A 1WG5A 3L4BC 3BQ0A 4V1Ak 1LQ9A 3D68A 4DPWA 1T8EA 3HVWA 3NBPB 4GO7X 1D9FA 3EICA 2VTDA 5HAOA 2CPXA 4LQ3A 3T5KA 3H42A 1HNVB 4ED4A 3MFHA 2ZOFA 3EMTA 4EFAC 4W90B 1NJWA 1YJRA 1AT1B 2Y3YA 3ISNC 4RKKA 1KOOA 3VGSA 4C2MA 2HB1A 2AEJA 2E5JA 1RBOB 2K7KA 1T9VA 3C15A 1ZM2A 1IR1A 2B56A 3LTOA 4C8MA 1M0SA 1RTDA 4WP9A 3NMAA 2WB4A 4J9OA 2ASJA 1HBUA 4OHHA
chains in the Genus database with same CATH topology
1SH3A 3TR5A 3MM9A 3S8SA 4DR2F 2PSZA 3JB9k 2F70A 1LK5A 1RK8A 3I5AA 3PJXA 1V6HA 4DSJA 5LL6d 1UJ5A 2W4DA 2CNHA 2MJUA 5KADA 4ED7A 1T7PA 3MFIA 2C2DA 2WSFC 1JKHA 3T9NA 2DNGA 2VKZG 1KSPA 3I4PA 3ZM2A 2NSCA 4Q45A 2N7YA 1JLFA 2BANB 3CD5A 4KJIA 3BLUA 5KFLA 5KFDA 4ED8A 2AYMA 2OPQB 4LQ9A 5AE1A 2NS1B 4Z6BA 1NZ7A 1KAVA 3PXGa 5DO2A 3AH6A 4NXMF 2YTCA 2B7BB 4C4WA 3Q24A 2ZJRQ 4B9MA 1GH8A 2XNQA 1WD6A 1B7FA 2XI2A 1UVJA 4GRZA 4HLBA 4RKUC 4F4YA 1Y9OA 2AJFE 3V0JA 3IR5B 1U45A 4AXJA 3GFXA 1C2PA 1JLGA 5KFFA 2EFGA 3CD7A 4NZ7A 1ZETA 1VBXA 4Q43A 4Q0BA 3IRXA 5I3PA 1M5VC 5FIIA 4G3IA 1YPTA 5KG5A 1PTYA 1FVQA 3QJPA 4NA3A 1R7IA 2XMTA 3WZ0A 3RRKA 2KXFA 4QIGA 1IBMF 1G3OA 3M8RA 3EGZA 1V3AA 2DNHA 5KG3A 4XIUA 2I38A 1T49A 3EMUA 4KQZA 1OEOX 2DIUA 4TKTA 3O8WA 2DNOA 1HNIB 4TU7A 1G7FA 1N32F 4OX8A 4WJBA 2R7OA 2BW2A 3EXCX 1Q1MA 4I6WA 4O44B 5KFTA 4OMFG 2I6PA 1PH0A 5D78A 2P6XA 3FEZA 4ECUA 4QWCA 4B3OB 3BRHA 4LSNA 3TP2A 3IR6B 4ZPCA 3MM6A 3BGUA 2NUUG 4NLSA 3HVRA 4DL7A 4CO1A 1BZJA 3MEGB 4LF9F 5DETA 1S72S 2EC0A 4O3NA 1R31A 4RUCA 5F8NA 3GILA 2DNNA 4MFBA 5IS2A 1LW2B 2BA9A 1WAXA 1SQEA 2N4DA 4WFXA 1M5PC 1KLMB 1IKVA 4A4JA 4NNDA 4R5PA 5FD1A 1Q7YT 4YQWA 1NHUA 1KQSR 2O1PA 1HHSA 3AJ2A 3OJSA 3IXQA 5K8NA 2IRYA 3BF4A 2AGQA 2QDPA 1KONA 2C3OA 4OL8A 2HVIA 3NBPA 4ES2A 3MAHA 5CHCB 2CJ9A 1B64A 2FJMA 1CEZA 2VG7A 2FHJD 1GXLA 1HPZA 4DFJA 2KT5A 3BGRA 3OVAA 2RDIA 2CPDA 2FGCA 1RTJB 5B09A 1RT5B 2CPZA 2DGOA 1S1VA 2FLNA 1SV5A 2ZHOA 3VWSA 1J5OB 2JEGA 4EYHB 1HNVA 2XC9A 5KFSA 2MQMA 4NA1A 1YJ9S 3OLRA 1OSCA 1DBDA 1T94A 2JVOA 4TNOA 2CM8A 2Z4PA 3Q8PB 4FS2A 1UETA 4R25A 2ZH2A 4X2BA 4NLGA 1C1BB 2MSTA 3I82A 4ZHRB 4AL5A 2OPPA 2HY3A 4C0HA 1GT8A 1SUQA 5K8OA 4CT8A 1Q78A 5F0WA 3TVYA 5AE3A 2ZH1A 2E7WA 2D3ZA 2KKHA 5L1LA 4ICZA 3DRYA 3R5AA 3V4MA 2DPIA 4OHWA 5J2QA 4N8NA 4QW8A 4JI6F 4CH0S 2AYGA 2B5JA 4BS2A 1KN6A 2YNHA 2PI4A 1S48A 3K5OA 4BHQA 3GSDA 1UW4A 2XSFA 4DL6A 3N5FA 1HWKA 2CQ3A 4RW8B 4ZPWR 2HS0A 4YOEA 4YB7A 1OO0B 3RYLA 1QM9A 2Z2MA 1NJZA 4Q2MA 5HN0A 1YRUA 4C97A 2CPYA 1U1PA 1U7LA 2QBPA 3OSNA 2KM8B 2P9CA 3MEDA 3V0DA 3CJ3A 3N5BA 4LFAF 2CJZA 1IBKF 3MD3A 1BQXA 1LK7A 2DHAA 4FVMA 4I2PA 1TL4A 1FXLA 3K8WA 1BY9A 2Z2LA 1WWHA 2IM3A 1N5TA 4DWIA 2ZBIA 2R7XA 4ZCIA 3QZ8A 4ID5B 2IYGA 5CQGA 3SCKE 1OPIA 1RJJA 2B4UA 4CH7A 1TV6B 4B9SA 1HNWF 2PGCA 1YTYA 1F5AA 4ELVA 3HM9A 1ONYA 3QCGA 2BANA 3DYAB 4DSIA 4GKKF 4IRDA 2OPQA 1B0TA 3NWGA 3V81B 2H4GA 2HFNA 3IO1A 4W92B 1G1FA 2MQNA 3K5PA 4NX9A 2LEPA 4WFZA 2BQ3A 1CQMA 4HYKA 4G1QB 2WK4A 3ISND 3NKYA 3K58A 2XY7A 4R0EA 2GO8A 2OUDA 3D44A 1BC6A 2Z8QA 1TUVA 3FGVA 4B3MF 1G7GA 1QY7A 2CQ2A 4J5OA 2J0WA 4LIWA 1S9FA 5MMZB 1KR4A 5GAEI 3TAPA 3PACA 1S6PB 1K8AT 2YNGB 2EG2A 1IR0A 2CQ4A 3EGWB 1IXKA 3M32B 4BDPA 2PA5A 2W4PA 2FLLA 2CVIA 1XNQF 5K8MA 2JRSA 5G4DA