4WU3A

Structure of the ptp-like myo-inositol phosphatase from mitsuokella multacida in complex with myo-inositol-(1,3,4,5)-tetrakisphosphate
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
590
structure length
590
Chain Sequence
PAVVKNPPKLALKIDRADVNQLPRNFRMGSDKYVGVTKTGIMPTRKGMDTMNVSASSCFSEKELEAILKKVPVKPSQFYDVDLRGESHGYLNGTAVSWFANHDWGNDGRTEDIIIPLEKEQLASLKGSTVKSIYRFDDKKNVILSPVYVNYNKVRTEEEMVKQHGANYFRLTLQDHFRPDDPDVDKFLEFYKSLPKDAWLHYHSYAGMGRTTIFMVMHDILKNAKDVSFDDIIQRQKLIGIVDLSEIPDKKKNYGRKAYIERYQFVQHFYDYVKENPDLKTPYSVWAKKNKVNSWEPDYNGYIWRLDTKDRNQLPRNFRTMNSAFRTDVNVKKTGKGFTPTPTRKGLDTLYMSGSAEFSNGELQAMLPVLKQQAKGPIYIMDLRQETHGVFNGNAVSWYGLRDWGNLGKNKAEVLKDENSRLNAARGKSLIVAELDKDKMPIDPKPVKIESVMTEQQLVEKNGLHYYRIAATDHIWPSAANIDEFINFTRTMPANAWLHFHSQAGAGRTTAYMAMYDMMKNPDVSLGDILSRQYLLGGNYVAYEIAKPKPDQWKADYYHQKAHMIEKFYQYVQENHADGFKTSWSQWLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the PTP-like phytase from Selenomonas ruminantium in complex with myo-inositol-(1,3,4,5)-tetrakisphosphate
rcsb
source organism Mitsuokella multacida
molecule tags Hydrolase
molecule keywords MYO-INOSITOL PHOSPHOHYDROLASE
total genus 205
structure length 590
sequence length 590
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2014-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wu3A02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4wu3A03
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4wu3A01
1YFOA 4Y2EA 2B4UA 2HVLA 4KYRA 1I9TA 2HY3A 2HC2A 4GE2A 2J16A 1JLNA 2I6IA 3CWEA 4R0SA 1OEMX 2H4KA 2CMCA 1QXKA 1G1HA 4RDDA 5KA7A 3I80A 2HB1A 2VEWA 4ZN5A 4H34A 4BPCA 1C86A 3BLUA 1ZCKA 1Q6SA 2FJNA 3I7ZA 3A5JA 3RGOA 1OEUA 2A3KA 4WU2A 4JBCA 3QCDA 3QCBA 4J51A 4RH5A 2G59A 1LYVA 2B49A 5BUGA 3OLRA 1T48A 2OUDA 3F81A 5K9WA 1Q6NA 2CNGA 3S3KA 4QBEA 5KABA 2FJMA 1YPTA 4QAPA 3F41A 1ZZWA 3QCIA 2F6TA 1XBOA 4GFVA 3V0FA 1YWFA 2AZRA 1OEOX 2YDUA 2CJZA 3QCMA 1G1FA 1P15A 1FPRA 5M43A 1NO6A 3ZV2A 4QBWA 2QCTA 4Z6BA 3GXGA 2DXPA 2ZMMA 1GFYA 2PSZA 3ZM0A 5KADA 2OC3A 1WRMA 1LQFA 2BGEA 2BZLA 2CNFA 3S4EA 5KA9A 2HNPA 2B4SA 1OESA 3F99A 3NMEA 1ECVA 4KYQA 1EEOA 5J8RA 5HDEA 5BX1A 5I6VA 1I57A 3CM3A 2CMBA 3V0GA 5MMZB 4GS0A 4GRZA 1ZC0A 4WU3A 2CM7A 3BLTA 1U26A 3AWFA 1BZHA 3QCFA 3D9CA 2F6ZA 2I5XA 2M3VA 2P4DA 3V0HA 1ONYA 4NX8A 3SMEA 3ZM3A 2FH7A 4QUMA 3BRHA 4ERCA 5EHPA 3O4SA 3S3EA 3QCLA 4GRYA 4OHHA 2GP0A 1RPMA 1V3AA 1G7GA 3RZ2A 4RI4A 3B7OA 3ZMQA 2I1YA 2NV5A 5EHRA 2VEXA 5K24A 2CNEA 2VEVA 2QDCA 2CM2A 4YR8B 3QCHA 4RHGA 1U25A 1PTVA 1R6HA 1OETA 5K22A 1PA9A 5KA2A 1PA1A 1VHRA 1NZ7A 4KI9A 3S4OA 3EZZA 3O4UA 2CM3A 2PBNA 1A5YA 4GE6A 4JNBA 4PYHA 5KA1A 2QDMA 3GXHA 1G4WR 1ZCLA 2BIJA 3EU0A 2WGPA 2I6OA 4HJPA 3V0IA 4NWGA 2C7SA 3ZM1A 1C84A 2CM8A 2QBQA 4ZRTA 2R0BA 2F46A 1Q6JA 2J16B 5IBMA 2QDPA 1MKPA 2H02A 2I6JA 3F9BA 4HRFA 1YTWA 1LARA 2ESBA 1YTNA 3AWGA 2I4HA 2AHSA 3QCGA 2NTAA 2H4GA 1U24A 2CNIA 2GJTA 4MBBA 1BZCA 1XXVA 3D1QA 1PTYA 1KAVA 1FPZA 1NWLA 3I36A 3PS5A 1KAKA 5IBSA 1YGUA 2ZN7A 1WCHA 3F9AA 1C88A 1EENA 4HJQA 2J17A 2BGDA 5LXQB 3V0EA 2VEUA 3M4UA 2HXPA 4R0TA 5KA8A 4DGPA 1PTTA 1YZ4A 2I3UA 4TVVA 2PQ5A 1OEVA 3ZM2A 2B3OA 2F6YA 2CFVA 3QCEA 2VEYA 4NYHA 4I8NA 3D42A 2C46A 4RH9A 1YGRA 2BV5A 4D3PA 2F70A 1C85A 4R30A 2H03A 2F6VA 1BZJA 1L8GA 1OHCA 3U96A 1NWEA 5K23A 4GWFA 3QCKA 1PXHA 2B07A 2PI7A 1ONZA 2HCMA 4ICZA 3MOWA 5K25A 3RO1A 1RXDA 4OHDA 3D1OA 4QUNA 4B04A 3D44A 1G7FA 2I6MA 2PA5A 1PTUA 3ZMPA 4DGXA 2NT7A 2QEPA 2B4OA 4IKCA 1NL9A 1T4JA 5AWXA 3QKQA 2SHPA 2CMAA 2I6PA 4QAHA 4AZ1A 1J4XA 4WOHA 4JMKA 1Q6MA 2H04A 4GE5A 1D5RA 3H2XA 1QZ0A 2Y96A 3OMHA 1GWZA 4D3QA 2I42A 2QBSA 4WTYA 1XM2A 2MBCA 4BJOA 5KA0A 2PT0A 2H4VA 2GWOA 1OHEA 2JJDA 2RF6A 2F71A 1SUGA 1YN9A 2I75A 4OHIA 5KA3A 5KACA 4Y14A 2I4GA 5GTJA 3O4TA 1FQ1A 2CNHA 2OOQA 1Q1MA 3D1HA 3LJ8A 1Q6TA 3QCJA 4S0GA 4NWFA 3EMUA 2Q47A 2HNQA 5KA4A 3QCNA 4YAAA 3V0DA 1JF7A 1PYNA 2Q05A 5KAAA 1G1GA 4RKKA 3RGQA 2F6FA 2E0TA 1T49A 2QBRA 2QBPA 3O5XA 1L8KA 4NNDA 2I4EA 4ZI4A 2F6WA 3BM8A 3EB1A 4OHLA 3A5KA 2IMGA 3AWEA 3S3FA 1C87A 2A8BA 4H1OA 1XXPA 2NLKA 4GFUA 1WAXA 4RI5A 4D3RA 2QCJA 2I3RA 3EAXA 3MOZA 2B4PA 5K9VA 1Q6PA 2NZ6A 3MMJA 3V0JA 1YTSA 2HC1A 1C83A 1I9SA 3O3LA 2G6ZA 1OHDA 3SR9A 2P6XA 1M3GA 1AAXA 1PH0A 4OHEA 5BZZA 5BZXA 2NT2A 2OZ5A 3QKPA 4PVGA 1G4US 1XRIA 3N0AA 1X24A 2Y2FA 4JMJA 3QCCA 3S3HA 1NNYA
chains in the Genus database with same CATH superfamily
2CQ1A 3SQGA 4Z7YA 2FVCA 1IBLF 1FWKA 4DR1J 1YFOA 1L3UA 4KHPF 1UTAA 2B4UA 1S6UA 1DTTB 3FEXB 2FQQB 3MMBB 1RA7A 5EX3A 1P8GA 2L9NA 2BJ8A 2Z2YB 3QT6A 1UVLA 3CULA 1XR6A 2YKOA 1ZM9A 3T1HF 2JFGA 2HHPA 4LF2A 1IBKJ 1FF2A 3PJWA 2PMZD 3U02A 2UUCJ 3QRRA 5DQGA 4R0SA 3W65A 2CJBA 1OEMX 2DHGA 3I0RB 3R7SB 3GYXB 4ECUA 2H4KA 3E01B 2QZ8A 2ASJA 3J81U 1OJ4A 2E9RX 5DRKA 4RNNA 2Q6BA 3MM6B 2RQCA 3FMWA 5E3AA 4YR0A 1TUVA 5HK4A 1ZPVA 3W9JA 3GJQB 1NH8A 2A2CA 3PW0A 2F8MA 1T95A 1V5VA 2Q1LA 5HATA 2NQPA 2CJXB 2JOQA 1MLAA 2M8HA 2BE9B 3DDNA 4U9RA 5AE3A 1QVFR 4ZN5A 4EGLA 3OVSA 2ZH9A 3ENWA 1C86A 3BLUA 2VG7B 3A8IA 4L72B 3L7OA 4N7TA 1WOOA 2DYAA 4G1QB 3Q89A 4L75A 2BA9A 1RISA 1WDTA 4NZ0A 2FJNA 2YNHA 3LH2S 5M2RA 4PEOA 3GE9A 5AJ3F 3A5JA 5DS7A 5GADI 4KPYA 1UFWA 3D3BJ 3RGOA 1I51B 4FYYB 3W2VB 4CM0A 3MCMA 3PJXA 5M2UA 2XHWA 3H2LA 4UW2A 1CULA 3BGUA 1NKCA 2E1RA 2D74B 2J0XA 3C14B 1QAYA 2W2MP 5D0RA 3JAMY 3GCXP 4MAKA 4C3LA 1LWFB 4J9NA 3I4HX 3OLAA 4QZVB 2AX0A 2MQPA 3OL6A 4ZN3A 3MAQA 4LF7J 3EXYA 3DGPA 4F4WA 1NNDA 2B8PA 2XMTA 2CA9A 2NZCA 5IS2A 3T1AA 2XQCA 2J0WA 3HSGA 2VQFJ 4ECQA 1HI0P 2HZAA 3K8WA 3OLRA 3EJMA 4NXNF 4JI2J 3FK4A 4QWBA 1HWIA 3HHLA 2OKQA 2ZC3A 2QO3A 3BKFA 1C0TB 1U0HA 3VAJA 3TVKA 1VQLS 1URNA 3HCXA 3NG8A 2W9AA 5B0DA 1S9EB 3PR5B 2CFXA 1C4CA 2ZUAA 1YJWS 5KABA 4I7FA 4Q8FA 1YPTA 4EBCA 3SDEB 3G6XA 4DQSA 3QCIA 3FCHA 2OGUA 2F6TA 1FHTA 4KSEB 1YRUA 1XBOA 1TL1B 5ETKA 2HRUA 3KK3B 1H2TZ 2F4FA 4N77A 1ZM4A 1TK8A 4ELVA 1YWFA 2VONA 4DFMA 2YVSA 2ZFHA 2AZRA 5GAEU 1X5SA 3OTEA 1JMTA 3FCWA 3NXZA 1KVIA 5KFFA 1U2CA 4C7QA 1UZDA 3DN9A 4ZS6A 4CIOA 5C5JA 4DQIA 4JI8J 3H20A 4IO1A 1FPRA 1YJVA 2RQMA 1RABB 3NY0A 4ZHRB 4AQYJ 2EXUA 3F56A 4WKRA 2ZUGA 1NU4A 1X8DA 1OSDA 3ZV2A 3KOAA 2H1YA 3MR6A 3CDBA 2FLLA 2AZ1A 3TZXA 2V8GA 1SCJB 3HO1A 1HBOB 1W25A 2RKIB 3ZM0A 1K1SA 2DH8A 3KLFA 1S0MA 2QLXA 2P6SA 4KHRA 2DNOA 4H4KA 5C2CA 4CM2A 1GMWA 4JI3J 3PV8A 2VODA 1HMVA 3AOBA 5C42B 2HVDA 4M94A 4M5HA 3SV4A 2HNPA 1FRHA 1RT1A 3ZTSA 1CVJA 3CCLS 2Q3PA 2AYEA 3ITHB 4N5SA 2BYCA 2N4DA 1JLFB 1OS5A 3BR8A 2DO0A 2W4CA 1WHXA 4GVLA 4UOHA 1JJ2R 1K0TA 3F99A 3NMEA 4KYQA 1QDUB 2CZ4A 2R8IA 4I69A 2DNGA 1LWEB 4USJC 4ES1A 5LOQA 5BX1A 2YWGA 1HQEB 3V6HA 4ZPVR 4V19X 5E3CA 2VG7A 4TYBA 5BYQA 4RZRA 4U96A 4C8YA 3EWGA 3WIUA 1I57A 5L38A 1KRPA 4G1PA 2XMKA 3UDCA 4WE1B 1UVNA 3NMRA 4GS0A 4HTJA 5EX0A 1H98A 3RTVA 2CQ3A 5B0AA 2FJEB 2WBMA 2KT2A 1SC6A 1FXDA 2RE1A 3KHHA 2C3PA 1NHKL 3J7YU 5CYQA 4EEYA 5HP1A 2W9CB 2YWFA 3PX0A 5KFIA 2HWTA 3QCFA 2UV8G 3I0RA 4TU7A 4Q2LA 4A8WA 5KOXA 5KT7A 4DWIA 2DNQA 2I5XA 2UUOA 4NA2A 2FDNA 4KKOA 3J7Z5 3TQ1A 3V81A 3V0HA 5AXLA 1ONYA 1MMDA 1TKZB 2XJAA 3GPAA 4PXDA 1PBUA 4C3MA 4BDPA 2R4FA 3K2YA 2G2YA 2NV5A 2W8KA 3QJJA 2ASDA 2HHVA 2KHCA 1NSPA 2MHEA 3FQKA 3IS9A 2VQEF 4J9OA 3PACA 4ELUA 2V8PA 1NSAA 3UNGC 1NB2A 3GLJA 5KT3A 1VBXA 1JK9B 4CQ1A 4A8MP 1V3ZA 3UVJB 3KK2A 1R0AA 2QLWA 4OHHA 1RT3A 1B0TA 3M32B 3NGRA 3HLUA 4LBPA 4CNYA 4DV6J 4N76A 2VFSA 1XWLA 1G7GA 4K0KF 3GFHA 2EFPA 2LA4A 3CEDA 3ENAA 3TYTA 2DR8A 1KNZA 1RLCL 2D1CA 1IWAA 1WG1A 1RTIA 1WSRA 2H5EA 2HVZA 2LDYA 3CDWA 5LSRA 3ZMQA 4IFYA 4C97A 3DRYA 5BJRA 2OMLA 4U7CA 2CNEA 3J7YI 2CM2A 1S9FA 3ZZZA 2KM8C 3MUVP 1WKJA 3AOCA 2AEJA 4PG8A 1IBKF 2BDPA 2VG6B 5H9EK 2JFHA 2PE8A 3W5YA 1HWJA 2UXCF 2QT7A 1U25A 3PO5A 2XHCA 2MGZA 3RAMA 5B09A 1CSJA 2RRNA 3HD1A 4UOCA 2N82B 2J5AA 3QSYB 2BQRA 4FYDA 1KBRA 1M5HA 4USTA 1RQ0A 1RT4B 2EFQA 3MAAB 3PEJA 1R0CB 1EHWA 2DXFA 4GO7X 4XDDA 1PA9A 1PA1A 3KHLA 2IBKA 2DR5A 3MMBA 4Y6IA 3KG4A 4CH1A 2QA4S 4BBYA 2W7OA 1LXNA 4ZCIA 3R1LA 4KH0B 4KI9A 1ZA1B 1OQ3A 4DR6J 2GVDA 2Z0GA 1FESA 1RT5B 4ZP7A 5DZ7A 2VU5A 2DGQA 3SBMA 2CPJA 3HSZA 4PZVA 2XY6A 2LQ9A 5CYMA 4I2QA 2DY1A 4J5OA 1RHRB 2WONB 7AT1B 2J0SD 1N33F 4KFBA 4ED1A 2X3DA 4GC6A 1C1BA 2Q6CA 1NJZA 4A47A 3MVNA 1NMEB 5ETLA 3A3OB 1C4AA 2NR0A 2QDMA 5KA1A 4WP8A 5D0GA 2IA6A 1G4WR 1VQYA 2GMLA 3OXFA 5HQMA 1ZCLA 3V6KA 1MROA 5A8RA 5A8RB 2CQGA 2I6OA 5KFNA 4CLWA 3GQCA 2FIUA 3Q8YA 3R2DJ 1AROP 1FX2A 3TJ9A 1N34F 4QCLA 2VOSA 5D0EA 4NWGA 5B08A 1U2RA 4QU7A 4ZLPA 3KJVA 3IRWP 1XMOF 3P8BB 4ED5A 1TUWA 2BUNA 1WI8A 3N01A 2EKYA 1S7HA 1VR6A 2V68A 3W2VA 4OI0A 3FFIA 1G2EA 5HSPA 1TVRB 1FRIA 2DH7A 2GNKA 4YHHJ 2JEIA 2HVHA 5HVGA 2CNNB 3OVBA 2H02A 2Z58B 1RA6A 1WG5A 2RF2B 2VL1A 3F9BA 2IMOA 4UZBA 2MPUA 3MD3A 2AGPA 1MMNA 1U6FA 4K8RA 1CJTB 3C6TB 5KFGA 3CF5Q 3ISZA 1X4HA 3KUHA 2VF3A 5HANA 2I4HA 3CD6S 2PEBA 2V50A 2BABA 5IXUA 3G6VA 1HQUA 2O66A 3M6VA 3T3FA 3QCGA 3E01A 4Q0BA 3NWGA 4NOHA 3US5A 1IKVA 4DV1F 1CPZA 2OD4A 1KLMB 3K89A 4QR1A 5FIIA 1VIXA 1FCAA 1SH2A 3BYPA 5HJXA 1EIYB 4C8OA 2G4BA 3JSYA 1JLQA 2MZRA 2FTRA 2DBBA 4KGVB 4ZVOB 3QAEA 3QGPA 1S79A 1Y5IB 2GX8A 3SEOA 1N5YB 1TKXB 4OHYA 1BY9A 4CTAB 1D3WA 3BS9A 3HFZB 3PG9A 1R6VA 1UEUA 4H4OA 3L9ZA 4ZP8A 3JTOA 4U8VA 3UO0A 3BQ1A 1FPZA 2R7QA 3EPGA 1F5CA 2J7WA 2Y1JA 3I36A 2XC9A 5D8HB 2B9WA 5D4LA 1WHWA 2M0GB 3S8SA 5E3QA 1JLFA 1GMVA 1T03A 2R8KA 1KAKA 2RHSB 1OYDA 1TQLA 1C88A 1Z2LA 2YWKA 4F50A 4X64F 4HJQA 5KFJA 3MTJA 2YKPA 2JEGA 2UXDF 3DCAA 4X84A 2BGDA 3V4IB 1JNRB 1P27B 1JLAA 3IO1A 1AXQA 4ZLNA 4DL7A 2JVRA 3H4DA 2OH2A 4F25A 1YZ4A 2I3UA 4TVVA 2R7VA 3N79A 2VFRA 3UCGA 1GMWD 2ZH1A 1FD2A 3OT9A 1RGVA 2XEXA 3N6LA 1QAIA 1BQMB 2XMVA 1AZSA 2WW4A 4RBVA 2JLFA 3L09A 3VGVA 4NLYA 2F6YA 4FN5A 4QW9A 1P31A 2VEYA 1X0PA 1RWWB 3T6BA 4LF9J 4O4GA 1KSPA 3D42A 4A8XA 2Z56B 4R5PB 1NK9A 5F8NA 2UUBJ 2GVDB 5IQ6A 2OTLS 4OYBA 4Y2KA 4ECTA 2C3UA 2HGNA 2OSQA 3NGUA 1LWEA 3FGVA 2ZD1A 4P52A 1L3KA 3H5XA 5EN1A 1OYEA 1YHQS 2XSJA 1BZJA 4O0NA 1G7CB 2M52A 2QDPA 1AB8A 2GJFA 3CWJA 4B02A 2MQNA 3QMQA 1ITPA 2UVVA 1X4CA 3OUYB 2CQCA 4CYUA 2CPHA 2V6AA 3MPUB 4JV1A 5E33A 4P6QA 3QCKA 1VGYA 1K47A 1FD8A 1PXHA 3CMAS 4XO0A 1ZH5A 4L3KA 2W9CA 3M6WA 3KLHB 1TL4A 3I96A 1ONZA 4DLGA 3CD7A 4IRKA 4OX9F 2GQCA 2AYGA 2GC6A 2D69A 1W26A 3W9HA 1NLKL 4P2FA 3VVUA 4J37A 4PUOB 2VHGA 2EEYA 3RO1A 1PYOB 3C6UB 2ZNZA 1H7XA 1RXDA 4K50A 2CKWA 3D67A 4UY85 1D8ZA 2VC0A 3QNWB 5M2PA 1K0VA 2BW7A 4D3RA 2F8EX 3HHKA 1RHKB 2Q66A 1UW4A 2ILYA 5HROB 2LU2A 2OPSB 2QMWA 2VZ9A 2HQFA 4K2JA 1HARA 3ITHA 2BJEA 4WKYA 4WTOB 2N7CA 1T4JA 3W9IA 4LF6F 1CLFA 1RWXB 4ZVGA 1XIQA 2SHPA 1NSKL 2I6PA 2HLUA 4JOUA 4F0KA 4KBIA 2ZDOA 1T9XA 2GC5A 1SJ1A 1QE1B 2HIYA 1S12A 2ZHOA 3GYGA 3T9NA 4ED4A 1REVB 1RTHB 2AJ2A 2QMUB 5C7PA 2H04A 4JMKA 2VUGA 3ETMA 4L6V3 4P71A 3LP0B 2Y96A 2CQHA 4TY8A 4DDFA 4KRWA 1PJ5A 4PQAA 3RRHA 4JI3F 4OV6A 1HNZJ 2EK6A 3H5SA 2NREA 4CVKA 2NLWA 5K8NA 2GGPB 5THWA 4BLGA 4B3SF 1R7IA 2RNEA 5K14B 1HFEL 2IC3A 3KNAA 1RYRA 2NXUA 3MAHA 2BZ2A 4Y2CA 4ECZA 3NNCA 1UVKA 2RRBA 4KIAA 4DX5A 3CCJS 2UUBF 1VRTA 3THTA 4K4VA 3G6ES 4OI3A 2CYYA 3PRBA 2K1RB 1YN9A 2I75A 4OHIA 2CJQA 5KA3A 4FS1A 5DGAA 4Y14A 4ICLB 1TAUA 1KHVA 2ZD1B 3LO3A 2ZITA 1P1LA 2E5JA 2UUAF 4ZVSB 4Q2MA 4DN9A 4DFKA 1VQPS 1NK4A 2ZOMA 3HFKA 4HH1A 2HKEA 3OV7A 1ZZNA 2UVWA 5ETPA 4UAGA 5KT2A 4HVZA 2XGPA 3CM3A 1N88A 2DGSA 2A1BA 5IC4B 5CCMA 4EU0A 3MUMP 2VIHA 3QRPA 1JLEA 2IVMA 2Z57B 2MZQA 2VDIA 4YB5A 3TI0A 3PYZA 3NP5A 3MI7X 1FWLA 5E7OB 1VYAA 2J7UA 4NLGA 2WTFA 3WX4A 4CT8A 4BWMA 4X64J 3CTRA 2XZWA 3EYZA 2IMWP 4DQRA 3PKMA 1S7IA 5HBMB 4MKYA 6AT1B 3D0HE 4L73A 2Q47A 2HNQA 4MTPA 3PYFA 4W92B 3D54A 1S1VB 3DU6A 3P4UB 3JTNA 1MN9A 5BR8J 5DM6Q 2YQ0A 4NXNJ 4NMLA 1P6TA 3Q86A 3R6GB 4TY9A 3QAUA 5A8WA 5C25A 2HHQA 3V0DA 4CLKA 2I1RA 2XTJP 2VJUA 3IS9B 5KFRA 3K58A 4IRCA 2MZJA 2DEJA 2Y1OA 2DNNA 3IRXA 3UDEA 2Y0SD 3BZQA 4DX6A 3LGHA 3JYTB 1J5EJ 2VC1A 2XWYA 3C46A 3QCDA 3N5FA 5I3QA 5LXYA 1WF1A 1J2VA 2QSWA 2ASLA 2NUUG 5L9XA 4DCJB 3SDEA 1TV6A 2VV5A 5DETA 1QUPA 2QBPA 3O5XA 1FK9A 3TX0A 4CT9A 4I56A 2FHJD 3AJDA 4ZI4A 1T9TA 1UWAA 4ILLA 5HQLA 4C8ZA 1E6YA 2MKCA 4LFBF 3EB1A 1KLMA 2WB1D 2ZWPA 2PC6A 4OHLA 1SB6A 4YFUA 3ZXWA 1UPMB 3SCJE 3AWEA 3S3FA 3AJ1A 4URQU 5DDPC 5C2GA 1UWBA 4OZ3A 3W66A 1RTZA 3W5XA 1RUSA 2V9KA 2CWKA 2HFZA 4DHVA 3H5YA 1H6KX 1TL3A 1YX2A 1R8PA 3NLCA 2HHHJ 2GAGC 2I0XA 1RP5A 3PFEA 4DUZF 4JI4J 4GFUA 4ID8A 1JJHA 2DNLA 2B5JB 2PA8D 4O23A 2OPQB 3D2WA 1R8AA 1A9NB 2CNIA 3DLLQ 3HULA 3VAHA 2X1AA 3DLJA 3EAXA 3K0JA 1HPZA 1TFYA 4PWDA 2FHMA 1WACA 3CJSA 4GRSA 1UEKA 1Q79A 4DN0A 1W7WA 3CD5A 2IM3A 2B8QA 4GE5A 3FRYA 1YQHA 3CCZA 1KOOA 2V2VA 4RBTA 2HQIA 1IKWB 2AT1B 3MEDA 4B9LA 2HC1A 2Y68A 3ILOA 4UOFA 2CPFA 4NCBA 2L41A 5D3GA 3D0IE 3MECA 1IBLJ 1FKOB 4DR5J 1K1QA 3C3LA 3SR9A 1HBOA 2RKIA 5J2MA 1M3GA 2M3DA 3RB0A 3N9UC 2PEHA 2XB2D 3QCNA 2HK3A 4LSZB 2GFFA 2JLGA 1D9FA 5BZXA 2GHWA 4ED8A 3L95X 4ES3A 4FDFA 2FVQA 2EG1A 1VQ9S 1LFPA 3FZBA 1Y10A 2Q43A 2WK4A 2XLKA 3V4IA 3N0AA 1X24A 1S49A 2DRDA 3I0SA 2X5OA 3TEHB 1RAGB 4FXWA 5FD1A 3PNIA 4AFFA 4B17A 4CLZA 5AXNA 3BN4A 1LEOA 4ZOSA 2J9DE 2PFFB 3IFEA 5DDQC 4DSIA 1YKWA 4LT6A 2BJ1A 2A10A 5IT9U 3VTIA 3VZHA 3KK3A 3KHRA 2AEMA 1CQMA 3CGIA 4DV6F 4A8QA 4ED3A 2DRBA 2OEKA 2AJ1A 3B54A 4OQJA 5F9LA 1I9TA 2HVLA 4NLQA 3RR8A 4R5PA 3MMAA 2KFYA 2HC2A 1RBLA 3S01A 3D6MB 3BKUA 4MYUA 2JDJA 3K7RA 4ITSA 5GAGU 3PX6A 2DXDA 1M5KC 3CWEA 2W4PA 1BQMA 2V4JB 3NOCA 5CYMB 1NZAA 2HFVA 2G2ZA 1D09B 3I32A 3IG1A 2QEXS 2VOOA 4YDXA 3OQ2A 1G1HA 2AM1A 2H4WB 1M5OC 1HYSA 2WTZA 4HYKA 3DI6A 3U1MA 1FO1A 4MKBA 4O4RA 4O3OA 3IC1A 4DPYA 1X5TA 3UPFA 5B0CA 2Y8YA 1HD1A 4ZVQB 3Q24A 2KL8A 1I5OB 1MWYA 1FDAA 1RCXB 1WOPA 2FZCB 3BGLA 3CDEA 4H34A 2K06A 2V4JA 5EHHA 3JXOA 3D28A 4CDIA 4OJ1A 3JQKA 4RW9A 4EWTA 4K4TA 1JB0C 2WONA 1V3SA 2MKSA 4OHWA 3NGSA 5ETMA 5K8OA 5E41A 1RT3B 4LF5J 4ECYA 3MMAB 2BXJA 1TL7A 3GFXA 1UVMA 1TL7B 2HVIA 4F2RA 4XIUA 1HPZB 1SV5A 5I3PA 4PWUA 3SXLA 3ZZYA 4HACB 1T7PA 2UAGA 3H40A 1X4DA 2A3KA 3DLGA 3V6DA 3D0GE 4JBCA 3M9OB 4B3OB 2YPYA 2YXLA 5LXRA 1JX4A 3QGGA 1NAQA 3O44A 3PX4A 3QCBA 3NWRA 1HIYA 4J51A 5A0YA 2XY7A 4RH5A 4DR7F 1TMMA 1B0PA 2C2NA 4AUKA 4CLSA 5SZTA 3SCIE 4M5JA 1UWBB 3H90A 2KZMA 3FCVA 1TUGB 3DRPB 4J9LA 4LFAF 3DRPA 2B49A 3OD2A 4Y00A 5HP1B 3UN2A 2F40A 3CJ8A 1YJUA 1S5ZA 3M7VA 1M1GA 4FNIA 4AL6A 3RB4A 4DSKA 1MWZA 2DJWA 1MMLA 3MM5A 3HDSA 4B3SJ 3AXMA 4KFBB 2BM0A 4NCGB 5DJBA 4Q43A 1U1KA 1NO8A 4F8RA 2YQ1A 5D78A 2VORA 3R6LB 4HL9A 4USIA 2IRXA 1U6ZA 4UUWA 2G0JA 2YTCA 3IMQJ 4PABA 1RT5A 2MLZA 3HVWA 3LTOA 3VCDA 1B3TA 3ONQA 3CJKA 1J6UA 4KV8B 2ZH4A 3D5MA 2C2KB 2AKWB 3LP2B 4LVOP 3WX8A 4ANCA 4F7VA 2POKA 3UFCX 3GFZA 2IJFA 4QYRA 2QGFB 1VK8A 1RAFB 5LMUF 2OPSA 2XLJA 1Y3JA 4I4BA 4QIEA 4LF6J 4DCPB 3FSIA 5J2PA 2YKMB 4YR3A 3GTYX 4R25A 3G8QA 3OHAA 5M43A 4ZP9A 3JSRA 2R7UA 3JQJA 3BM7A 1GH8A 1R27B 1NO6A 4YB1P 4NLWA 2R2UA 3M2VA 4PXCA 4QW8A 2BQUA 3MWBA 3VQSA 4NPOA 2BANB 1HD0A 4QWCA 4P9SA 3QJLA 3P3DA 2HFOA 4M5LA 2UP1A 1WHYA 3T9ZA 2Q79A 1IBMJ 2DR7A 4GKKF 2A0FB 4YAAA 1VJQA 1XBWA 2PSZA 2W25A 2ZZTA 5KADA 2YNFB 2WSCC 2MYFA 3BGRB 4Y28C 1LQFA 1WRMA 2WJPA 2BGEA 1S4EA 3PIPQ 2CPZA 1OSCA 3R97A 2VPZB 4DSEA 4F02A 1YBAA 4H54A 2CNFA 3Q8VA 3S4EA 1F2HA 2BEFA 2CAJA 3VALA 2H9ZA 1UVIA 5KA9A 1Q78A 3HHNB 4ZPAA 2H4YB 3I87A 3QFWA 4AXJA 4ZKAA 4CLTA 3BF4A 5DG8A 5GADU 4OMFG 4M5IA 3N0VA 1VBKA 4NRTA 3GIKA 2W7PA 1X9SA 4DQPA 2K1RA 1ECVA 2GVZB 4ZCKA 3V0IA 4YY3F 1TL1A 1P9YA 3OL9A 4QDIA 5CH7B 1A7GE 1EETA 4ILMA 2KO1A 1KDNA 2A6MA 4RJVA 4USHA 1IBMF 4JI2F 2IJRA 4C11B 5C42A 4OYAA 2CMBA 2QSFA 2CVIA 3Q8QB 2VDHA 1LWCA 4KGXB 1BHNA 1ZC0A 2FGOA 3G71S 4WU3A 4C8LA 2QJ3A 2VG6A 3P96A 4LIWA 2KJVA 4LSNB 4ZCMA 5IV3A 3BPSP 5K8MA 4TU8A 3KLFB 3AAWB 1RWKB 4UUXA 1X7VA 4LF9F 1PYTA 5ETRA 4Z2XA 4J90A 1S10A 3AWFA 3NOGA 2EBGA 3X3UA 1GG4A 3MEEA 2VG5B 4M5MA 4PAAA 1R31A 3D9CA 2RMLA 1QSLA 1R8BA 2JC1A 3KLIA 3SMZA 2F6ZA 2CJAA 5KFAA 3GCWP 2XMUA 2M3VA 4L76A 5IT0A 2I4GA 1EP4A 1S1WB 4ZPWR 2FHJA 1OWXA 1HI8A 2VPWB 3CJ4A 2COLA 4Z7CA 2DHAA 4WP9A 3VAIA 1V6HA 2CPXA 1H2VZ 3I4PA 1CULB 4HHHA 4PR6A 1RTDA 3BRHA 2IPOB 3DLEA 2ZH8A 3QCLA 4ID5A 2YX4A 2CPEA 2JH3A 5CCLA 4GRYA 1TU0B 2CZVC 2BVZA 2LFVA 2VB6A 1SQEA 4ZLJA 4NXMF 1RAIB 2GP0A 1PG5B 4H4MB 1J5OB 1V3AA 4QWEA 4OZLA 2HPUA 1GAOA 5IOLA 1G7FA 1CQNA 1RAOA 5EWGA 1PILA 2AYMA 3EDRB 1HHQA 2QFJA 5LMUJ 2HFUA 1WKKA 3QRQA 2J76E 3B7OA 2JJ4D 4NLOA 3MEEB 2KZZA 4DL4A 3AY0A 4ZVHA 3PW5A 2VEXA 2HMIB 4KGZB 4P2SA 2VEVA 2R7SA 3P45B 3MM6A 3R5JB 1X60A 2XULA 2ZNYA 1FKPB 3FUYA 2PA3A 4P75A 1N56A 4F3OA 4RHGA 1WTFA 3OTCA 4OI6A 1PTVA 3EDQB 2CQ0A 3B8HA 5F0UA 3L3CA 1SI9A 3AFGA 1R6HA 4Y2AA 2UZAA 5D15A 1OY9A 1ZAVA 2DCLA 4FF2A 1LWFA 3HT3A 4IDKA 3M2UA 4C6AA 4ZLLA 2HQ3A 5HLFB 3EVOA 4NLSA 4C2MA 4X4QA 2PI4A 4EBEA 1MG7A 4JV5F 2HFSA 2QLJB 3M8ZA 4MK9A 3DLHA 4DR7J 4LMZA 4TN2A 3S4OA 1FJ7A 2X3GA 3CC4S 4HT7A 4RW6B 4IRDA 3O4UA 2CM3A 1S1UA 2PBNA 4JUZA 2ZBQA 5K14A 1CEZA 3OFGA 1YZ7A 2K7KA 4U7UK 5BXIA 4NLUA 2MKIA 2X51A 4J9SA 1TKTB 3AA9A 8AT1B 5K8PA 3KJVB 4XDCA 4JNBA 2GMJA 3W8PA 2D41A 2OFHX 2CNKB 2C42A 4J9KA 4TY8B 1ZS6A 3M6UA 4FPRA 3TRGA 3MR3A 2DVIA 1Y4ZB 3EU0A 1CJKB 2I8EA 2B4VA 4MIAA 2G0CA 2HK2A 3KLHA 1EKSA 1N34J 1HHSA 5LM7E 4TLQA 3R9LA 4DUYJ 1NBEB 3UN3A 1X9WA 4DR4F 1K9MT 3MM7A 4JV5J 3JTPA 1LV5A 4TYAA 1BD6A 1FGSA 3CE8A 3ZNUA 1C84A 2DIUA 2E44A 4ZRTA 2F5GA 1K73T 2DPIA 4I6YA 1Q6JA 2HNYA 3KK1B 4DS5A 3OBIA 1QJHA 3C66A 2W9BA 4QIVA 2M7SA 3AH6A 1T02A 1PCAA 2DGXA 4I68A 4USUA 2M2BA 3R3TA 1K44A 1VMBA 4L74A 3VAKA 2AIRB 3MM9B 4IFVA 5E3PA 1KLNA 2C22A 3EXCX 1VC6A 1F9HA 2JHEA 3KFWX 3EZ5A 4RUCA 4IOCQ 1B99A 4DX7A 2XI3A 1W78A 2ZHBA 1HNWJ 1YTWA 1D8YA 1FEHA 1HWLA 2MQ8A 1LARA 1S0OA 2ESBA 3I55S 4D3HA 2ZWOA 3Q2SC 4O44B 4ECSA 1KKHA 1WSVA 1W7KA 2V2KA 2AHSA 2BW2A 1PJ6A 2ROEA 1GTEA 4DR2J 1EAYC 1UL3A 1S1XB 2KB2A 3I5BA 2HHTA 2NTAA 1FA0A 1ZYQA 3H5UA 3IM9A 1U24A 2BRLA 4OJGA 5B0GA 1T3OA 2VD3A 4RL1A 2DITA 5BYRA 2GJTA 1OY6A 4MBBA 1DTQA 2RIJA 2JZ5A 3A1YG 3POTB 2PO4A 1W2IA 2RILA 4DV3F 4DL2A 4B3OA 1WELA 2XSJB 3D1QA 4ID5B 2MZ1A 1IKWA 4PWWA 2HVEA 4KGKA 2I38A 1KAVA 2JRSA 4LUBA 1KD1T 1ZBTA 2HAIA 2RJZA 5CZVA 4D3GA 1HBUB 2MZSA 3UVJA 3T5LA 1U1NA 3O6QA 3T6JA 1SKRA 2DHXA 3MZIA 2GQQA 1TK0A 1Q81T 5JUMA 3L7PA 4ECWA 1WCHA 1NB7A 3F9AA 5IBSA 4ZJOA 3CJKB 1XTZA 1JLCB 2O3DA 4OV1A 3MMCB 1PYSB 1UKUA 3HHLD 4MK7A 3BO3A 2ZHAA 3D68A 1NCLA 5KFVA 1UJ5A 1VHIA 1O6XA 1NHVA 2YY3A 4WZMA 3GB0A 3DI6B 1S1TA 2NPIA 3CCTA 5C24A 1RT2B 1NPRA 3NAHA 2B0GA 2HYIB 1N54B 5B0FA 4H4KC 2F65A 2KVIA 3Q8UA 3DOKB 4CLFA 2C2DA 1WDDA 3BKTA 4ZPBA 4DUZJ 4DL6A 2HRYA 4WFBQ 1HL6A 2IRYA 2CPYA 4I8NA 2FHOB 3DOMA 1X4BA 2DB1A 5F41A 5L1IA 1IXKA 1NK0A 2XS5A 3O2IA 2V5HG 2U1AA 1HR0F 3C15A 4D3PA 3RJMB 2FJAB 4O3RA 5GMEA 3N4WA 1ZETA 3LF0A 3OL8A 4LFBJ 1SUQA 3HSDA 1S77D 4WFYA 1C85A 2ZKUA 2F6VA 2H03A 1FRJA 1VRUA 1DRZA 2DISA 4OZJA 4N8NA 3FRZA 1L8GA 3MAAA 1OHCA 2QX0A 1NK7A 5RUBA 3U96A 5F8GA 1NWEA 1AA1B 1HBMB 4NI2A 5K23A 1ZM3A 1AFIA 4GWFA 4IOBA 4ZPCA 2KM8B 1JBWA 1O5JA 5AE2A 2MQLA 2OEJA 2GJ2A 2HS3A 3EVWA 5ITHA 3K8VA 5KG4A 1EJ7L 3KUEA 3OXLA 3T19A 4RNOA 2VKRA 4DPWA 4ZVRB 5JVGQ 3LOUA 4B3TJ 4LQ3A 2MHNA 1S1XA 3E3XA 4PYDA 4HI2A 2XYPB 3NS6A 4DUTA 5CYJA 1ZAXA 3KG0A 3FBFA 4NYZA 5J2MB 1SQFA 1PBAA 3GSDA 1R3NA 2AGOA 1FRXA 4ZJLA 2YKMA 3AQOA 2UUAJ 4OHDA 3Q2TC 3PXGa 4V1Ak 5HMWA 1V9OA 2XMWA 4X65J 1U09A 1XEZA 3VF0B 4F04B 1R89A 4QUNA 4B04A 1XQIA 2DY9A 2HBZB 4KAIA 4LSLB 4AQYF 2X1FA 4K5SA 4RX6A 2R7XA 1FJEB 3V6JA 2B4OA 2CRLA 2NT7A 4C0HA 4FKYA 4BC7A 4EO8A 4NEYA 5KFYA 3QKQA 2AGQA 2B56A 2CMAA 3JSMA 2G2OA 3QCZA 3VGUA 3ZZOA 4CO4A 4U6PA 3TWZA 4OFZA 3W2WA 4MIBA 1TP7A 4DL0C 2ATLA 1BQNA 1RHUB 3QZ8A 3M9NB 2MMYA 3ET6B 2ADBA 1N32J 3OVAA 1J4XA 1S57A 2EK1A 2MJUA 3I0SB 4LIRA 2B7BB 3BBFA 4EYHB 4U7UD 2JFDA 1S9EA 1D5RA 3H2XA 1VC5A 3PVXA 2FY1A 4D3QA 2E7VA 4OI1A 2J0QD 2RH3A 5IM0A 1Q7YT 2VFVA 1M5SA 3OSNA 3V4MA 4G65A 1FFSB 3SSQA 1XM2A 2MBCA 3RRGA 2H4VA 1RTJA 1RTIB 2V63A 4I2QB 3Q8PB 5H9EJ 3AXKA 3GIRA 2JJDA 1REVA 1RTHA 3M4XA 3H42A 4LFAJ 3WQPA 4F26A 2MKKA 3K5MA 5AT1B 4DV7J 1J5OA 2YNGB 2R8HA 1SKWA 3FSYA 1WC0A 1Y00A 4ZPDA 3SFUA 2KYZA 4CH0S 4YMEA 4RW6A 3M8RA 5KACA 4C0OC 4KT0C 2HHSA 2KRRA 2W9BB 1F60B 1YBTA 2HZCA 1ZPWX 2KJWA 2I6WA 1E6VB 1RTDB 1IM4A 2F63A 2GA7A 1IKYA 3LAMA 1KR4A 4J91A 3WZ0A 4ALZA 2ZM6J 4B9NA 2J6TA 3ISNC 3QSIA 3OR1A 4OHVA 1VFJA 3HP6A 1Z2ZA 3FBBA 1QUVA 4M5KA 4KKOB 4OZ0A 2XY5A 1DY3A 2A2DA 2CNHA 3FBEA 2Y1LB 3MEGA 1GXLA 4N47A 4RW7B 1RWVB 3C6UA 2JEJA 5KFWA 5A5EA 1R43A 3IBWA 2C28A 4B9VA 3QCJA 1ZAWA 2CQ4A 1JKHA 3NCPA 4S0GA 3I5CA 1M1HA 4ZMMA 1NJXA 3JB9k 4EK2A 1KQFB 1KS2A 1F9FA 4OZ2A 2DD8S 2FUG9 2JWNA 4FYVB 1ULRA 5I4MA 2MQQA 4M8LA 3KLVA 2HMIA 4K4UA 2D3UA 1VISA 2RAQA 3IBCB 3IWLA 2JFKA 2RUGA 4NI2B 1UA0A 3K59A 2P6TA 1S6QA 5KA4A 4DV5F 5F8LA 2P6XA 3TVZA 4F3MA 2IAJA 2YKNA 4DMZA 1GX5A 2C3OA 3SCLE 5A6PA 1TZ0A 3DDIA 5MAOA 3PY8A 1Q7LB 5KAAA 1KQKA 4IFVB 4ZDNA 1U1RA 2RSQA 1VQ7S 3IWNC 3P49B 5LXQB 1VQNS 2HBQB 2FVRA 2M5YA 4IDKB 3DRRA 1AT1B 3DOMB 5ADZA 1NHUA 2MJNA 5HQ8A 1GFWB 4KY3A 3V81B 3S1TA 4V19J 3RYLA 1VQ4S 2F6FA 2DNYA 3PO4A 2F4VJ 2FZGB 3EM1A 2IAJB 2X1GA 2YKNB 5A8WB 2R8GA 2DT9A 4DR1F 2OTJS 4O3PA 1T94A 3MURP 2IC3B 1L8KA 3BO4A 4NNDA 1X5PA 2E7XA 1NRKA 3IP0A 2ZKTA 3T1YJ 4OYOA 2WW8A 2MY7A 3A8EA 2HWIA 3TA0A 4CO0A 3AB4B 3GV5B 5HMZA 2IYGA 2OEMA 2VTDA 1BWVA 1S59A 3A5KA 1JJ4A 2GC8A 2XGQA 2A8BA 2BE2B 2NLKA 1OY8A 2YWEA 8RUCA 1PC5A 2EKNA 2IYIA 2X7IA 1URRA 2JVOA 2OELA 3DC2A 3MD1A 4IQMA 4ZVPB 2LKZA 5HAOA 1VRQC 2EC2A 1WAXA 3QYYA 3LAKA 2BJDA 4IOAQ 4CI0B 3OR1B 4GO5X 1Y11A 1T8EA 5T41A 1XC9A 4OYIA 3LPYA 4W4MA 3OTOF 4YS2A 1U0SA 1B7YB 1X4GA 3OFEA 3W62A 4DV3J 3DLBA 4JI4F 2B4PA 2GJIA 2KG1A 1T9WA 5HVFA 5JMNA 4A48A 3AB2B 1N8RT 5IFMA 2VICA 2IIHA 3R8YA 1YTSA 3BH6B 2JEFA 4U95A 5LJ5Y 4H4OB 3E8OA 3J80Y 2OAUA 5HO4A 2AD9A 5CA5A 5BUGA 2EW9A 1U8WA 3KLIB 4KTQA 2VBZA 3O3LA 3FVYA 1WNEA 3TW0A 5F8MA 5H1SV 1UJ6A 2VFUA 2W2OP 4USWA 1XERA 2FD2A 2KT5A 1IKXB 4DV4F 1YVFA 1CC8A 2LXIA 1GTHA 2EWHA 4OX7A 5CZXA 3I31A 4ER8A 1NKEA 1RT7B 1QVGR 4DSJA 2F4VF 3P6YC 1S0NA 4CH7A 3HHLB 1FXLA 2OZ5A 2UXBF 4FS2A 5J2QB 2Y9HA 3MPDA 5FDLA 3KMQA 3QGIA 1IR2A 1FRMA 1U48A 2ERRA 2F3JA 1LWCB 2ZBCA 3H7HB 1R0BG 5E2QA 3WIVA 3LANA 3QLHB 3DGPB 3K5LA 2RU9A 3FBCA 2VH7A 2F9DA 2R7WA 1CJTA 5CD4H 2UU9J 1SJRA 3HVTA 4ZIWA 1C0UA 4HV4A 2CDQA 4X4NA 1LK7A 1DQ8A 2B51A 1NDPA 1FWPA 3CJ2A 3DLGB 1IKYB 2WAQD 2QL5B 1WTBA 4Y2EA 4DV0J 5KFHA 1IN0A 4KYRA 3UN5A 2HY3A 5F3TA 4OYXA 5D77A 5E3RA 5HJYA 2DNKA 2ZE2B 2YNHB 3AOAA 2KRBA 3N6MA 1CJUB 4P2XA 3Q23A 4GE2A 2DGWA 1S6QB 2WOMB 2AW0A 3KYLA 1YLXA 2GIQA 2WSFC 2I6IA 2P9EA 3B6BA 2EFNA 1WJ9A 3OTOJ 2DGTA 2FB0A 3OTBA 3S6EA 2JLEA 2CMCA 4FP9A 4NCGA 4TU9A 5KA7A 1RI7A 4LF1A 1S6PA 5HL7Q 3LQVA 3PW7A 2O5DA 4CZCA 1NDLA 1S4FA 3TVYA 1G1XA 3I80A 4LVNP 4LSNA 2HB1A 2HGLA 1JLEB 2FY8A 4LJMA 2WVFA 4YN3B 3PFOA 2CJ9A 3WHIA 3J7ZT 2VEWA 3NNAA 2NS1B 4BPCA 3FKBA 1M0SA 1YDLA 3HHDA 1GK8A 3CCWA 3WC2A 1HA1A 1X9MA 1SPBP 4DS4A 2L3MA 2I5JA 4AL5A 2D9PA 4B3MJ 2RU3A 3J7AN 1PIEA 1IWGA 5KFQA 1PSDA 3MF5A 3I7ZA 4QWAA 3A3PB 3QT5A 9RUBA 5DQHA 1LWXA 3M2RB 5HMYA 2JL9A 3RG6A 3K17A 4KV8A 1U02A 3F44A 1OEUA 2NCKL 1T05A 1TTHB 1RJJA 3EGWB 4WU2A 1VQ8S 4CTAA 4YB7A 1TR0A 3ENQA 1RWOB 1UW9A 4AE5A 1HNVA 1B70B 2ATCB 4A4JA 4J9MA 2G59A 2HFNA 4WYLA 4OYMA 2MDAA 4NLTA 5IM0B 3W3SA 1P9QC 3C16B 4ZVEA 5DDRC 5B7WA 1RCOB 2D3OR 1Q4RA 4KQZA 4XPEA 3EE3A 2CWXA 4W90B 1T3NA 1NNYA 4WFAQ 1FRLA 4DR3F 3M30B 4K59A 4R8UA 4OJ3A 3M2VB 3N5BA 1E8CA 2Y66A 3F81A 3QFHA 5HMXA 5K9WA 2AJQA 1Q6NA 1RBAA 4HDGA 3CXCR 2CNGA 3S3KA 1VLOA 5L1KA 1YJ9S 3LP1B 4WXWA 4DG1A 1C1CB 1DLOA 1SIZA 4DPOA 5L46A 2VQEJ 2RB7A 2CNOB 2GQ2A 1ZZWA 2FJMA 1O0PA 4QAPA 3GIJA 2FLNA 3RZAA 1WHVA 2H5IB 2OLWA 4N8OA 2ZVIA 2XO7A 5EDWA 2ZH7A 2WVEA 4HTIA 1CC7A 1VRUB 4DU7A 2G0IA 5H9FJ 1DQ9A 1RAJA 1X4EA 2CVEA 2IDLA 2MTLA 2YBVA 2ZBPA 3TX8A 3GMGA 1Q5YA 5IT4A 3SSSA 3J81j 2QYGA 3DMJA 4I1TA 3BJYA 2C2MB 4MJKA 2DHSA 1IUJA 2MSSA 3T41A 5LMNF 3MPYA 4R0EA 3EMTA 3MGJA 4M5NA 5IV4A 4WCEQ 1T11A 2HAFA 1C0UB 1P15A 1FFWB 4J9QA 1T9YA 3AD7C 3CJ0A 1YWXA 5L1JA 1NDKA 1Q8BA 4HKQA 4QBWA 3FJ2A 1NEEA 1FI4A 1YRXA 2B7CB 4PG5A 4EUVA 3ZM5A 1KOHA 2MY8A 4OI4A 2R2TA 3GXGA 1SL1A 3CJQA 4Z6BA 4RR5A 3O8WA 4F4KA 1HNIA 1JLBA 2O1PA 1GFYA 4NASA 1U4BA 5A5FA 3A12A 3OUYA 1VLYA 3ZM3A 2XSFA 1F5AA 1ZZFA 3N6NA 2XZTB 3ETOA 2ZM6F 1L3TA 2BZLA 4QF5A 4A8KA 4ZITA 4RNFA 3MMCA 3V2UC 2W7AA 4WJBA 1FFGB 2ZZMA 3UWTA 1DTTA 5KFBA 3TJ8A 2B07A 2XI2A 3FMBA 2NPFA 2LXUA 2W24A 4IG3B 3TR5A 3UQSA 3GV7B 3BSOA 4EMDA 4TKTA 2DXEA 2KFZA 3AHPA 3KDNA 1OESA 1WF0A 4K4XA 2N3LA 1RHJB 2XYHB 5J8RA 2C2OB 4C9DA 5HN0A 5AE1A 5EGYA 1GQQA 2I5JB 2CJKA 4WFNQ 2E1AA 2OPRA 2IM0A 3MR5A 5EWFA 2G1DA 2HIQA 4GRZA 3QATA 3ILIA 1HWKA 2CQBA 3FEYB 3PYDA 3F73A 2YNIA 1ACMB 4C48A 2VJVA 1VQ5S 2OO4A 2CM7A 3BLTA 3UDVA 1IJFB 1U26A 2CPIA 1CJKA 1H72C 1N5VA 4X4VA 3AA8A 4JV2A 2VOPA 4X62J 2MKYA 3LPEA 3GJRB 1XN9A 2E7WA 3HZGA 4I2PA 4PG6A 1EB0A 4RKUC 4JI6J 1RSCA 3HM9A 2YWWA 1TKTA 4M5DA 2XM3A 3G82B 1KQGB 3DMJB 3FQLA 1UA1A 3GJTB 4J9RA 3QT7A 2UUPA 4FKXA 4ECXA 2FHKA 1RKJA 4NX8A 2FH7A 3GG1A 1TV6B 4LRAA 4MK8A 4Z37A 5EUHA 2GIRA 5CAAA 3H25A 4HEA9 4ERCA 4ANEA 2C3MA 3HD2A 3QCCA 1N5TA 4DX8H 1Y0HA 2MQMA 3MM9A 2XZDB 5GAHI 2B9XA 2UVRA 2NZ4A 2YPZA 3BPDA 1GEHA 4DPTA 2GAHC 1H3DA 3M2UB 9ATCB 4KHMA 3OSPA 4JI8F 3ENVA 1UEVA 4DG1B 1RHMB 1S48A 2LEPA 1SL2A 5IC6B 4A8FA 1WORA 2ALZA 3BN7A 2NYHA 2EFGA 4URGA 2WSEC 3EZUA 1HKAA 1UETA 3QGHA 1HHTP 2F8HA 5ETSA 3W5ZA 3HI9A 2ROGA 4OJHA 4X4SA 2V94A 5DLGA 3A8JA 5J2QA 3RR7A 4FF4A 5K24A 4FXDA 1MWQA 2HBYB 2HNZB 4CVLA 2NSBA 3JS9A 4YR8B 1H7WA 3BV8A 2YX1A 3QCHA 4JI5F 1F3FA 3CCMS 2E66A 2QL7B 4RUHA 5J1EA 1DFDA 1FK9B 1JJCB 3OFFA 3BSNA 3SFGA 1PJ7A 4E98A 3K5NA 3V6DB 1N36J 1Q1KA 1QE1A 4JI1F 1OQ6A 4E2FB 1JXVA 4LRCA 2DNMA 3DRSB 5KA2A 2XWXA 2JX2A 4KPCA 3KK2B 1GQYA 2P9CA 5DQIA 4PRFA 4DZ6A 3SCKE 4BS2A 1X5OA 2J9EA 1NZ7A 1KEKA 4HI1A 1O5ZA 3KHGA 2YWHA 1SH0A 3EZZA 3DM2B 3HT0A 4JI0F 4I6WA 2HNDA 4DF8A 5C25B 4X4PA 1RADB 1SJFA 4UZCA 2FJBB 1N52B 4USKA 4NA3A 3MM7B 1KTVA 2R42A 3BEGB 5KFDA 2HWHA 4KB7A 1A5YA 4GE6A 3ZTPA 3QLHA 4IH6A 2LLZA 1B0VA 5FLXY 2E1CA 1SH3A 3C2PA 4LR7A 3I9ZA 3HKZD 2ADCA 3GXHA 1BLUA 2K2PA 3ZZUA 1UAWA 4A8OA 2XO6A 1EARA 1RBOB 3CD0A 4CRJA 4FBUA 4DR6F 4HJPA 4G1IA 4M95A 2C7SA 1G3OA 4C0BA 1SJ3P 4S0MA 4Y2MA 3OLBA 1KFSA 4OX8A 3TZYA 3QCMA 4RLEA 4AXIA 2CG4A 4QOTA 1Y5NB 5DGBA 2GO9A 3ZFVA 3UE2A 2AQ4A 2J16B 4I0WA 3JSMB 2RS8A 3KJNB 3TAPA 2NSCA 1U49A 1WC5A 5GAHU 1MKPA 2FJDB 3N2AA 1XMQJ 1JBVA 4B08A 1RAHB 2R7OA 1N48A 1MU2A 1X0FA 2I6JA 2MZTA 4LBHA 4CP5A 5ETQA 3BQ2A 2RQ4A 4HHJA 1GQEA 1NH7A 5KFKA 4K7QA 5D4OA 2LEAA 2B6AB 3TZZA 3RBDA 3C19A 1UFLA 4OX6A 3BGRA 4QPXA 2V2ZA 2BBEA 1Q82T 1YSJA 3AWGA 2M9KA 3Q8RB 3PZPA 3IWXA 3HK2A 1RU2A 2UUWA 2H3EB 3R2CJ 2VG5A 3KJQB 3DFEA 4O0IA 4IFYB 4NXMJ 4IYQA 2RRAA 3TARA 4DXLA 3GIMA 2AJFE 4DPUA 1NXIA 4ED2A 5K9FA 1KC8T 3D6FB 4OLOA 2BQ3A 1OETA 4RW7A 1XR5A 1YZ6A 1SC1B 3HVAA 3MEGB 4RO0A 5KG3A 3TZWA 1QTNB 2QA4G 1CBKA 2WOMA 3EUNA 4DV2J 2HZVA 1Q86T 4AL7A 1SC3B 3ADAC 4OYPA 4QR0A 2G9OA 1YRTA 5KG6A 4UOGA 5AWXA 1G4CA 1ROFA 2BM1A 2OPPB 1MU2B 1RT6B 1EZZB 1X4AA 2X1BA 3B78A 3IR5B 3NS5A 3JQMA 3GILA 1N4LA 3M8PB 4Y3CA 3B4DA 4DV5J 1T9UA 2WVDA 3H2VE 3NGTA 1SQGA 2BACA 1YGUA 1TKZA 4GMKA 4NA1A 1EP4B 1LNQA 1S1WA 2CQ2A 4IH7A 3NAIA 3GIIA 1EENA 4IR9A 2IBOA 2OD6A 3SIPB 3TA2A 4LF8J 1FNXH 4C98A 2J17A 3GG0A 3QPIA 3FZ2A 1SL0A 1P3DA 3HHEA 4HR2A 4J9VA 3V0EA 3FSXA 2PD1A 4J9UE 3KMSA 2HXPA 4FF3A 5IT9Y 3M4UA 4TLRA 5KA8A 1Y5LB 2FJVA 4DGPA 2YKQA 2QTWA 1PTTA 2XMAA 1LW0A 2W8LA 3AODA 3DYAB 3M6XA 4X4RA 5DLFA 1L3SA 2PQ5A 4ES2A 3LWLA 1HI1A 4MT1A 4JI5J 5FJ4A 2WVCA 2N4CA 2QRRA 5KFSA 1VDHA 4JB8B 4ZVFA 4FXVA 3ZTOA 4C11A 3CIZA 4DZDA 4DBQA 1J5EF 3QCEA 4RWWA 2K3IA 4KGMA 5GMDA 4WYWA 5F9NA 3WBZA 1U7LA 1VHFA 3CCQS 4JI0J 1N32F 1JXLA 1YBUA 4RH9A 5LL6d 2BV5A 2VBXA 4DV2F 4HACA 4RUAA 2F1FA 4N56A 5KFCA 1UVJA 2F70A 5JXSA 4K2XA 4CWBA 5L1LA 2Y67A 4JI1J 1VS3A 2CNLB 2AJ4A 2ACMA 5J1PA 2M8DB 1UJ4A 3MM8A 5L9NA 1XK8A 3KWMA 3FNNA 2J8AA 4X65F 3KNGA 3RAQA 2BE2A 2FPHX 1DTQB 1ZTWA 1EEHA 3VQTA 3LW5C 2PI7A 4OHZA 2DO4A 1D1UA 1H73A 4XPCA 3PTWA 2VPYB 1HLWA 3KLGB 4DCOB 4R8UB 3EGZA 3CJ3A 2DHHA 1LW2A 2AMCB 3OL7A 4A46A 1IR0A 3X1LB 4ICZA 5K5MA 5G0RB 4M63A 1O8BA 1LXJA 4YDDB 5KAKA 4RU9A 2DCUB 3HMJG 1BXNA 1R6YA 4JYAJ 3OPKA 3AJ2A 4CYUB 1GT8A 5K25A 1HBNB 3H98A 2WVBA 4ILRA 3C6TA 1NUEA 2V8HA 1RACB 2L48A 2XMJA 3D1OA 3PCOB 5FLXU 1E6VA 5CHCB 3PKYA 3IR7B 1XNQF 4ANDA 2RT3A 2RHQB 3QJPA 5HVHA 5KT6A 3D44A 2Y0BB 4MYTA 1AYEA 1SJ4P 2I6MA 2J8SA 3ISND 4DGXA 2YNGA 4F0HA 1ICEB 5T7LB 3I9V9 2ZH5A 2QYCA 2KKHA 5KFZA 1S9GB 1VIOA 3FFIB 4C4WA 2N7YA 4MMOA 2RS2A 1N5YA 4LF4J 1BZCA 4JI6F 2CQDA 3PYGA 4UTGA 3SZ2A 4B3TF 3GSIA 1F9EB 5T14A 3S7RA 1MSWD 4NZ7A 3QBCA 1XMBA 2D7SA 4RW9B 1VQMS 3FDSA 4Q8EA 4LR8A 1IM6A 1Q6MA 2HS0A 3O5TB 5AXKA 1WEZA 1IKVB 2W2NP 2VFTA 1HNXJ 4EFAC 1QSSA 1QZ0A 2AM2A 1RT2A 2JNJA 4DQQA 1AUSL 4QYZJ 1AW0A 3GJSB 1JLGA 5A2QY 1BGXT 3TO8A 4J9PA 1PKUA 1FT8A 1JXEA 4FBTA 2IFXA 2XLIA 3ZO7A 2DIVA 1RHQB 3H8YA 3KJFB 3PS5A 2F71A 3R1HA 2C1EB 5D3GB 2QLFB 4RW8A 3CC2S 1HBMA 1TMJA 3RAXA 2HHWA 1RU1A 4NLVA 3GFYA 2F00A 1T03B 4K0KJ 4K4SA 1S9GA 1ZM2A 3UR0A 2FLPA 1H38A 3DHWC 3BB5A 2UV8A 2EFVA 2BRKA 2QV6A 3LP2A 2BE7D 2XS2A 1IQZA 4A8SA 4DSLA 2KH9A 5K20B 4DSFA 2HGMA 4NCAA 5GTJA 4PXBA 1KTQA 3BO2A 4LF4F 2NYIA 3D7SB 4LREA 3ZTQA 1M5PC 1FQ1A 4LFCF 3MCNA 3OR2B 4YR2A 3TNVA 4GKKJ 3UW1A 4DFPA 3PM9A 1T48A 3D1HA 3MPWA 2GHPA 1HBNA 3PYEA 2LXFA 2R7TA 1QAXA 2A18A 3R5BA 4P73A 2FVPA 2FC8A 2M88A 4NWFA 2XCAA 1SVDA 2BMBA 4LF8F 1Z4UA 2ILZA 2V4QA 2MSTA 3BYRA 5IQQA 1E6YB 1S6PB 2W01A 2YKAA 3THVA 1U1QA 3EMUA 1HNVB 3H59A 2DK2A 3KLEB 1UMJA 3CO0P 2KYXA 3LUYA 2UUTA 2V69A 3CVKA 3CCSS 3HJFA 4B3RJ 4NZ6A 1AUDA 1T05B 4ZVUB 1SUQB 5LSOA 1JF7A 3M9MB 1XNRF 3TEGA 1XRIA 4G3IA 1H0HB 3DOLB 2UUCF 2IM1A 3IRXB 4ZN1A 1QM9A 3GYNA 3M8PA 1F6TA 5I42A 2QBQA 1QLNA 2KVQE 5IWAJ 3CDAA 3RGQA 2Y1RI 4F4YA 3LWMA 1VQ6S 2DRAA 2OOQA 2E0TA 3NNHA 5ETVA 2DPJA 2QBRA 5BZZA 3DHXA 4DR2F 3RUBL 2B43A 2ZVSA 4UQGA 2LYVA 3EGVA 4Y34A 1B7FA 2RUSA 2I4EA 2UVUA 1SKUB 3BDEA 3PW4A 3UAGA 2CXEA 5KFLA 1N0UA 3U27A 1KQSR 1XR7A 2MKJA 2V34A 3R5CA 2ZZNA 3C16A 1C87A 2DGVA 4O3SA 4CO1A 1K8AT 3QZ7A 1OMSA 2FJXA 5D4PA 3K57A 4BUBA 2FC9A 5KG1A 3I5AA 4NE9C 2DR9A 4WPAA 1M90T 1FJGF 1HWUA 1GMUA 2B9YA 2V8VA 3P5TL 3DNCA 1NK6A 2DGUA 2R9LA 1DAXA 2LQ8A 2I3RA 2LCWA 2QCJA 3MOZA 4IG3A 5L39A 3KKFA 1YTYA 4NYOA 4LF5F 1FE4A 2AU0A 3C15B 3M2RA 3NMAA 1Q6PA 3SYZA 2NZ6A 3MCOA 2GMHA 4KE5A 4QJVA 3Q0AA 1S97A 3LK7A 1D9AA 3SMEA 3V0JA 1PC4A 3WC0A 1MN7A 1RT4A 3RU0A 4CO5A 1RT6A 1QD1A 4WK3A 1Q5VA 4X4OA 1RT1B 5KG7A 3WDOA 4Q44A 1RK8A 1FTCA 1C83A 2ZOFA 3R5GA 1I1GA 4TXSA 1OHDA 1BWEA 2Y1IA 4ENOA 1LW0B 4R0JA 2YNFA 5KG5A 3IGVA 4LBIA 4QU6A 3EPIA 1FJGJ 2NT2A 2EG2A 4C8MA 2W4DA 4PVGA 2B4SA 1C2PA 4CLPA 2P2CB 4CCHA 1G4US 3HX9A 2B3TB 3PHEA 2BANA 4WE1A 3ILJA 5CQGA 3OJUA 1RB0A 3NRBA 1FKOA 5E5NA 1WG4A 1WD6A 3O1LA 3PHTA 4PG7A 2BV3A 3BGOP 4YHHF 3PEHA 3HF5A 3CUNA 2KXNB 2B6AA 3IXQA 3PRVA 4Q5VA 4YOEA 1ELOA 2WCXA 4U67Q 3BH7B 4PXEA 4DV4J 4LRFA 2V2QA 7FDRA 2OHDA 2VBYA 4K5RA 3T5JA 2LU1A 1N36F 2GCBA 1I3OB 3M8WA 5A2QU 2U2FA 4NX9A 4ED6A 5HROA 1H2UX 5HLFA 2M70A 2V4RA 4N41A 2AWZA 1DLOB 4WP3A 2P8IA 2J16A 1S1VA 2V9WA 2MLYA 1JLNA 2FLOA 4O3NA 2MQOA 2DH9A 1A6LA 3OJSA 2BJ9A 2Z8QA 1XMQF 3QWPA 3M30A 2Y8WA 5H9FK 4ZIVA 4NEZA 1O51A 5FDLB 3D6HB 4QIWD 4UT4A 1BC6A 1QXKA 4RDDA 4B3RF 3GV8B 1FDNA 2HNZA 4B9UA 1JWWA 2E9ZA 2HS4A 2D3O1 3NCQA 3VHQA 1V5IB 4X62F 3CJTA 4DR5F 2FJWA 3BGFA 2CQIA 2H5JB 2V0NA 5L8RC 4ZHRA 5KTQA 3EGNA 4BWJA 3CCRS 1S1UB 2QA1A 5A6WA 2HLTA 5KFTA 4F0MA 2DKOB 3ET6A 1RDRA 1L3VA 1Q6SA 1ZCKA 4EO6A 2LVWA 2OJ3A 4DU8A 4CNZA 4CLYA 3NGDA 2QIFA 3KUGA 2RVJA 5F8HA 4KO0B 4RBUA 3DLKA 4RNHA 4UY8T 3DLKB 3ZNJ1 4LFCJ 3ILLA 1I94F 3GZ7A 4O3QA 3DM2A 2O01C 1TAQA 2HNYB 2IVFB 1SV5B 2VBWA 3KK1A 1VBZA 4K4ZA 4DOZA 2LDIA 4Q45A 1HMVB 4LRBA 2VASA 4XK8C 2EFOA 1HW8A 1YK9A 2BOAA 4G1QA 4PWDB 2K8GA 4RW8B 3JAMU 4C8NA 1I6JA 3HVRA 5E0OA 3TANA 3M05A 1DZ5A 3ULHA 1LYVA 4HH0A 3W60A 2D3ZA 4GC7A 1GX6A 3OHBA 4CO3A 1NKBA 1NPKA 2AJ0A 2YQ3A 5HI7A 1PAUB 3CPWR 4FYWB 2OUDA 4IKAA 5KFMA 1QAJA 3CMQA 2AEFA 4GVBA 3K5OA 4QBEA 2AP6A 2CDRB 2QC3A 2ZH3A 4EYIB 1CJUA 4AD6A 1UZHA 2QE5A 2ZH6A 3W8GA 3F41A 5J2PB 2RDJA 3HN7A 1UAGA 3UDLA 3HXMA 3Q83A 4TNOA 3BDPA 4GFVA 3T5KA 5MLCV 3NEKA 3EZOA 3BQ0A 3V0FA 4OHXA 3IM8A 1G6BA 5KT4A 4RW4A 3J81Y 2L9DA 3BSCA 2OIHA 3DXSX 5B0BA 3P5BP 1VRTB 3GU0A 4P74A 1F0XA 2HQGA 3QT8A 1APSA 1FTRA 1OEOX 2YDUA 3BM8A 3DXBA 3HHLC 4I7FB 2CJZA 1UP1A 1WF2A 2C3YA 2IRUA 4HHUA 1G1FA 4HLBA 3HFVA 2VKZG 4ETXA 4A8YA 3MXHP 4TQSA 3NL0A 4C8KA 1SBRA 1AZSB 2P9GA 3MM5B 2MLXA 1XNQJ 4OYWA 2QCTA 3CO9A 2E1MC 4Q0BB 3H0PA 2DXPA 2XPCA 2ZMMA 2WBRA 3LP0A 1LQ9A 1DBDA 2RD5C 3VAGA 5D4NA 4UF4A 1S1TB 1RWUA 4K4WA 4WIQA 4MFBB 3VR1A 1MNEA 1RLDA 2E29A 3KDOA 5F8IA 2OC3A 1WWHA 3SSRA 3W2WB 1TKDA 1HQEA 1HNZF 2E5LF 1EQ0A 4FVCA 1CS4B 1WEXA 2RF2A 4DI6A 1U8SA 5CABA 2OP5A 4X66J 5I42B 1RYSA 1FX4A 4NYHA 4IQXA 2E5LJ 3DRXA 3E2EA 4WBFA 5DG9A 4WXOA 1Y3KA 2ZH2A 1EEOA 5HDEA 2ZOGA 5I6VA 3RB3A 1U6BA 2ZC4A 1M1KT 2GCFA 1CS4A 4FVMA 2DNPA 5GAGI 5CXTA 2V67A 2ZJQQ 1TK5A 3VGSA 5MMZB 2EI5A 1FDBA 1Q16B 2LQJA 4B3MF 4WF9Q 2HQDA 3LGNA 3KLEA 5EHPA 4LRDA 1Z1ZA 1U1OA 1TELA 3SV3A 1NDCA 4P72A 4X66F 3QIDA 3RB6A 2R2RA 3MHYA 1FNOA 1MROB 2BJ7A 3DOKA 2QFIA 1KONA 4DEZA 1BZHA 4RU2A 4URSA 2KHDA 4BC9A 1PAEX 3AT1B 1DQAA 3B82A 3CIMA 4P7TA 3NBPA 2R2SA 1L5UA 3K5PA 6FD1A 3ICLA 2KFNA 1SKSA 2MB0B 2P4DA 1JIHA 3CC7S 1KHWA 4YQWA 3ZC4A 3DKDA 5KFPA 4K4YA 2GCAA 2GVZA 4F3QA 5LT5A 3T5HA 5DM7Q 1VQOS 1HNXF 4QUMA 2LECA 2RDIA 3CB4A 1NJIT 4NLRA 3S3EA 2E9TA 1FKAF 5LSLA 2VTEA 3W64A 4RW4B 5BYSA 4LSLA 3W7BA 4DV1J 2W1BA 1Q95G 2HBRB 3IR6B 4F36A 4O4GB 2BOPA 4DL5A 3DDKA 1RPMA 3QWUA 1PO6A 1FVSA 4OYZA 2M4MA 4BHQA 1F2GA 3RZ2A 2GIFA 4DJBA 2MGZB 3EX7B 3POTA 2H54B 2I9SA 2K3KA 4Y65A 1OIAA 5KFOA 4DL3A 3MDFA 5LMNJ 2EC0A 1B64A 3DU5A 2I1YA 4ZP6A 4GVBB 2Z2ZA 3L4BC 8ATCB 5DZ6A 4USVA 4X4TA 4PYAA 3TP2A 4KH1B 4PG4A 4CLLA 3IN5A 2QDCA 4OHEA 1FVQA 1LKZA 4NLDA 1KVJA 2YNIB 1N5SA 1XJWB 3LGMA 2ZBIA 5LJ3Y 1J27A 4MKAA 3BREA 5J1NA 4DV0F 1Q0NA 2ACYA 1JLCA 4LQ9A 3C14A 2Y3YA 2WZ1A 3CNQP 3QIPB 4QWDA 2HG4A 4IUFA 2NXJA 3RGIA 4QQBA 4DR3J 1VK3A 3HJVA 3W61A 1IJEB 4TQRA 3EVMA 3R5DA 5K22A 1VHRA 2BR0A 3QO9A 4I6AA 3TAQA 3EICA 2UXDJ 2DNRA 2HSEB 4IR1A 1CJVA 1RXOB 1ZA2B 5ETNA 4PQUB 1GNKA 5F0WA 4M1KA 4F4AA 3G6YA 2QN6B 1SC4B 2E5GA 3TOQA 3J80U 3UCZP 1U1PA 2UXBJ 3I56S 1U1MA 4F4ZA 1E0DA 2SXLA 3PIOQ 3PR4A 2XMMA 1UCNA 3G8SA 1T0TV 4EZ9A 3IGNA 1R8CA 1SJQA 4PYHA 4B9MA 5KT5A 2JFFA 3M8QB 2HHHF 2XS7A 2OUGA 3TUIC 2BIJA 2J9CA 1WC3A 5CYQB 4USMA 4WIIA 4RNMA 2WGPA 2EPIA 2YH1A 2G1HA 4PCQA 1FNMA 3VV2B 4IO9Q 2KXFA 4ZPTR 3CCES 1QSYA 5SUHA 1RZMA 2IY5B 1B4SA 5B0EA 4OZ1A 4KHPJ 3ZM1A 1VOMA 2PI5A 2HEKA 1RAEB 2IA0A 1DJ0A 2CUYA 4J7CA 4WK1A 3SQOP 2CM8A 2BKNA 1CJVB 4DFJA 2F46A 2R0BA 2ZJRQ 5D6GA 4EBDA 5U47A 1WOSA 2O67A 5GVQA 2GW8A 5IBMA 1EQMA 3SQGB 1HNWF 2CZ9A 1R8HA 1UPPA 1X4FA 2PMHA 3C8YA 4IG0B 2L08A 5KG2A 3MUTP 1YITS 2WRMA 4NWBA 3M8YA 4CO2A 2D9OA 5GAEI 1VCTA 2MEWA 3D6TB 1SXLA 2QMXA 3ZZ0A 3TQEA 3H4BA 4Y2IA 1WC4A 3V5RA 4MKVA 3R7NB 3CCVS 4HRFA 2CJYB 3R27A 2GS8A 2HURA 2EBEA 1JLGB 1YJ7A 1Q8LA 1YTNA 5BR8F 3ZZTA 4B9TA 4X2BA 1NJWA 3ZM6A 2F9JA 2NUHA 4QR2A 2H65B 5D0HA 2BKPA 3KLGA 1XMOJ 3Q22A 2JC0A 3TUZC 3G96A 2H4GA 3MCSA 2UU9F 4ED7A 2IM2A 5ETOA 3U1LA 4Y0FA 1YJTA 1IKXA 2IVYA 4RPFA 1TFWA 1NZ8A 2YH0A 3NCRA 4P7VA 1KVKA 3I6PA 2VPXB 1XXVA 4YB6A 5EWEA 4XTTA 4YUDA 4ED0A 1PTYA 3E51A 1NWLA 2ZJPQ 3DRRB 3G2XA 3IAM9 2E5IA 3MR7A 3JYTA 4F4XA 2FVSA 3BBCA 1NJYA 1N33J 4KO0A 1S99A 2ZN7A 1FERA 1MW7A 1F5BA 3HVTB 3THPA 3VZIA 2OI2A 5AXMA 2IJNA 2KG0A 1IQTA 1T9VA 4LR9A 1TL3B 3G9CA 1NM2A 1S6OA 1UFKA 1F1BB 4KR0B 2LQ5A 1RWMB 1OPIA 2DEIA 1FE0A 1FDDA 2PGCA 4PPDA 3G82A 5G0RA 3VAFA 4M5DB 1NPPA 2KXHA 2XNRA 1VQSA 2VEUA 4R0TA 1RE1B 5C24B 2CADA 4KYZA 1XNRJ 4RI4A 4WFZA 1QY7A 3CJRA 3GR0A 4ECRA 2AZ3A 2W2QP 1JNZB 2WB4A 1WC1A 1BMQB 1OEVA 3ZM2A 3PRDA 2N3OA 1JKHB 2B3OA 1BQXA 1KWMA 4OI2A 1SIWB 5IWAF 4C3KA 2K7JA 3A4TA 2DGOA 3MEDB 2CFVA 3MM8B 4NLXA 4Q7AA 1WI6A 2WHOA 3M32A 4P10A 2CG8A 3RBXA 3A8KA 3M1VA 2ZE2A 3RBEA 2C46A 1YGRA 1IR1A 3NRSA 3UR3C 4FNHA 3UD4P 2I2YA 1S0VA 4KJIA 2L9WA 1LK5A 3LA0A 2R3VA 4ICLA 3TA1A 4R30A 3T1YF 2BX6A 3SI8A 3W63A 3CCUS 1V3RA 3VGTA 2Z2MA 3DOLA 4FF1A 2OPQA 3DRSA 2ABYA 2B5JA 4ZJQA 1NK5A 1DARA 2LEBA 5JJBA 4MFBA 4PKDB 1U47A 4XAKA 3CW2C 5J1EB 4AZ1A 2E1PA 3KTQA 2OMOA 1N0VC 3MOWA 2J9DA 2GGPA 3DYAA 4FZVA 3M8SA 3TAMB 4L3NA 3VWSA 4JV0A 1QTMA 2B9EA 3LALA 1C0TA 3ZTRA 5ETTA 2HCMA 2AX1A 3W1YC 4ERDA 2CPDA 4BCAA 2HRTA 4DPXA 2KU7A 4DF4A 3HKWA 4OX9J 1Q53A 1YJNS 4KC5A 4NLPA 2DR6A 2CIMA 3OTDA 2QG9B 4UQTA 1VBYA 3RRKA 2R8JA 3KG1A 3GP9A 3ELHA 2Z4PA 4OIXA 1REGX 2ALYB 2DNZA 3BBBA 4ATNA 5EHRA 4EZ6A 1Q8KA 3CJ5A 2QBSA 4IH5A 2BKOA 1Y9OA 2RQKA 1RWPB 5KFUA 3KXDA 3U7JA 5KG0A 2E5HA 4TVAB 4ECVA 2PMWA 4YEAA 2C2EA 1PTUA 2PA5A 3ZMPA 4RWXA 4JI7J 2QEPA 1NL9A 3R7BB 1TL5A 2APOA 4IKCA 3OXGA 2W2PP 2NXNA 3FEZA 5CD4A 4CLUA 3MEKA 1VC0A 1DURA 4YY3J 2R7RA 3UD3P 3J7A1 2G13A 3UI3A 4E0DA 4QAHA 4ELTA 4NL5A 4GKJF 1EKRA 3D4JA 3QIPA 3Q8SB 3D3CJ 2AV5A 4WOHA 1U0HB 3ZZRA 5HBMA 2NXEA 4E8UA 1YI2S 4C13A 1HW9A 2LP4A 1M5VC 3MR2A 2FZKB 3V0GA 2HHXA 1GWZA 3OMHA 4AYBD 3A13A 2I42A 2J6UA 1X31C 3TUJC 4WTYA 1YGYA 3JSBA 4DV7F 4GKJJ 1RAAB 2A3JA 2GHVC 1OPZA 6FDRA 4BJOA 2KDOA 4ZIYA 1I94J 2PN6A 2PT0A 2LMIA 3CT9A 4F67A 2GWOA 5KA0A 3IG1B 1PGZA 1U2FA 3HPOA 4JI7F 1OHEA 2RF6A 2OPRB 3IBFB 3BSAA 1C1BB 2CQPA 5GMKa 1SUGA 2AHOB 2ZEJA 4BUCA 3I82A 1VQKS 4I64A 3A3NB 3G86A 2GO8A 2VA2A 4P2MA 5G4DA 4JP8A 2OFGX 4EI2A 5J2NB 4PQUA 2H51B 5KFEA 1VI7A 1WUUA 3CMES 3NGKA 2AYBA 2Z2LA 3QQCD 4ZCLA 1U45A 4JYAF 3O4TA 1D0EA 4MIWA 2HHUA 4G6VB 4QBUA 2J7KA 1U1LA 4PUOA 1GXUA 4I67A 1FKPA 3G8TA 3G4SS 3U1NA 1JLQB 2GZOA 3H2UB 2ASYA 2J6SA 1RWNB 4QYZK 5F8JA 3GONA 1Q1MA 2XBPA 1Q6TA 3LJ8A 4HDHA 2XG8A 5JVHQ 4JMJA 4W98A 3ZZPA 3TAMA 4U8YA 2LQBA 4NYPA 1HQUB 4OZ5A 3RBZA 5DDOC 1LW2B 4QIGA 3VVTA 4C12A 2EVZA 3CDUA 3CSKA 5I3UA 1HYSB 1JLAB 4QIFA 3UD5A 5A0YB 4OL8A 3NS7B 3OR2A 4HT5A 4H4MA 2BJ3A 4WZQA 2RDDA 2IHR1 5IZHA 2KTQA 2ROPA 4CVMA 2MXYA 1WEYA 4WFXA 1NSQA 2HNDB 5A8KA 3HSJA 5KOWA 5F3ZA 3AD8C 2VQFF 1IVZA 3O4SA 2NXCA 2KN4A 3OFHA 1PYNA 2Q05A 3DLEB 3IAS9 1EX8A 2KI2A 4IG0A 4QPTA 7FD1A 1G1GA 2DNHA 3FC9A 1D9DA 1R0AB 4F2SA 1FEEA 4LF7F 1W2BR 1FJCA 4RKKA 3QO9B 1HBUA 3M1VB 2PIIA 1AFJA 2H48B 1H74A 3RW6A 4B9SA 2P5VA 2F7VA 1T49A 1YIJS 1RKIA 5A8KB 1FRKA 4MH8A 1KP6A 2XYGB 2DTJA 3F0NA 1RTJB 4I2PB 2FYXA 1HQ2A 2F6WA 3MFHA 5I3UB 3ZL8A 3G87A 1JQGA 1ZOTA 3GWCA 4ZVTB 1HR0J 2HQCA 1DHMA 3L7UA 2HW3A 1HNIB 1KN6A 3DGVA 4DR4J 2IMGA 2GV1A 3M8QA 1S72S 4X4UA 1Y7PA 2MKHA 4H1OA 1XXPA 5DO2A 1KFDA 1RT7A 4O44A 2XCPA 5DG7A 1BQNB 1WKLA 2ZBRA 1EETB 4NMXA 3MPVA 4RUBA 4RI5A 3VAMA 2C2RA 3HZEA 2YX7A 1GXTA 3D9BA 1BE4A 3NKYA 4FPIA 1NK8A 5AJ3J 5T7LA 3R5AA 1N6QB 1P1TA 2JSXA 1N6QA 1S76D 5K9VA 1N5QA 2KT3A 3MOJB 5J2NA 1LOUA 1TVRA 1IBCB 4ETZA 3MMJA 1TKXA 4DLEA 1VJWA 3IA0A 4ZK7M 4DUYF 1ZTTA 1A0OB 2LA6A 2OPPA 2PDAA 1I9SA 3RW7A 3NBPB 2G6ZA 1C1CA 3PJ9A 3LP1A 1YJRA 1JLBB 3OW2R 1AAXA 1PH0A 3UCUP 2IDEA 3MTKA 1F3VA 3D66A 4M5GA 4WWSA 3PDNA 3MFIA 2Z30B 2XNQA 2V8DA 1CG2A 3AD9C 3QKPA 2UXCJ 1WC6A 1LFWA 5A76A 3PW2A 2QLBB 2C2ZB 1Q8IA 3GR1A 2A6OA 2VA3A 1OO0B 3T1HJ 3MECB 3TUPA 2FGCA 2Y2FA 4FYXB 5KFXA 1BUXA 4OLPA 2PFDA 3UNYA 4YP3A 2QA2A 3N28A 1YG0A 3BR9A 2ZDPA 4NRUA 4ZA1A 3B4MA 4OZNA 4PPZA 3TJAA 4AT1B 3S3HA 2OSRA 2QL9B 3AQPA 1FXRA 2AF6A
chains in the Genus database with same CATH topology
2CQ1A 3SQGA 2FVCA 1IBLF 1YFOA 1L3UA 4KHPF 2B4UA 1S6UA 1DTTB 3FEXB 3MMBB 5EX3A 1RA7A 1UVLA 1P8GA 2L9NA 3CULA 1XR6A 2YKOA 1ZM9A 3T1HF 2HHPA 1FF2A 3PJWA 2PMZD 3U02A 5DQGA 4R0SA 2CJBA 1OEMX 2DHGA 3I0RB 3GYXB 4ECUA 2H4KA 3E01B 2QZ8A 2ASJA 2E9RX 5DRKA 4RNNA 2Q6BA 3MM6B 2RQCA 3FMWA 5E3AA 4YR0A 1TUVA 1ZPVA 1NH8A 2A2CA 3PW0A 2F8MA 1T95A 2Q1LA 2NQPA 2JOQA 4ZN5A 2M8HA 4U9RA 3DDNA 5AE3A 1QVFR 4EGLA 3OVSA 2ZH9A 3ENWA 1C86A 3BLUA 2VG7B 4L72B 3L7OA 4G1QB 2BA9A 1RISA 4NZ0A 2FJNA 2YNHA 3LH2S 5M2RA 5AJ3F 3GE9A 3A5JA 5DS7A 5GADI 4KPYA 1UFWA 3RGOA 3W2VB 3PJXA 5M2UA 1NKCA 2XHWA 3H2LA 4UW2A 3BGUA 2E1RA 2D74B 2J0XA 1QAYA 3QCDA 3JAMY 4MAKA 4C3LA 1LWFB 4J9NA 3I4HX 3OLAA 4QZVB 2AX0A 2MQPA 3OL6A 3MAQA 3EXYA 3DGPA 4F4WA 1NNDA 2XMTA 5IS2A 3T1AA 1HI0P 2J0WA 4ECQA 3K8WA 3OLRA 4NXNF 4QWBA 1HWIA 3HHLA 2OKQA 2ZC3A 2QO3A 3TAQA 1C0TB 3VAJA 3TVKA 1VQLS 1URNA 3NG8A 2W9AA 5B0DA 1S9EB 3PR5B 2CFXA 1C4CA 1YJWS 5KABA 4I7FA 4Q8FA 1YPTA 4EBCA 3SDEB 3G6XA 4DQSA 3QCIA 3FCHA 2F6TA 1FHTA 4KSEB 1YRUA 1XBOA 1TL1B 2HRUA 3KK3B 1H2TZ 4N77A 4ELVA 1ZM4A 1TK8A 1YWFA 2VONA 4DFMA 2YVSA 2ZFHA 2AZRA 5GAEU 1X5SA 3OTEA 1JMTA 1KVIA 5KFFA 4C7QA 3DN9A 4ZS6A 4CIOA 5C5JA 4DQIA 3H20A 4IO1A 1FPRA 1YJVA 2RQMA 4ZHRB 3F56A 4WKRA 2ZUGA 1NU4A 1X8DA 1OSDA 3ZV2A 3KOAA 3MR6A 3CDBA 2FLLA 2V8GA 3HO1A 2RKIB 1HBOB 1W25A 3ZM0A 1K1SA 2DH8A 3KLFA 1S0MA 2QLXA 2P6SA 4KHRA 2DNOA 4H4KA 2VODA 3PV8A 1HMVA 5C42B 4M94A 3SV4A 2HNPA 1FRHA 1RT1A 1CVJA 3CCLS 2Q3PA 2AYEA 3ITHB 4N5SA 2BYCA 2N4DA 1JLFB 1OS5A 3BR8A 2DO0A 2W4CA 1WHXA 1JJ2R 1K0TA 3F99A 3NMEA 4KYQA 2CZ4A 2R8IA 4I69A 2DNGA 1LWEB 4USJC 4ES1A 5BX1A 2YWGA 1HQEB 3V6HA 4ZPVR 4V19X 5E3CA 2VG7A 4TYBA 5BYQA 4RZRA 4C8YA 1I57A 3CM3A 3V0GA 5L38A 1KRPA 4G1PA 2XMKA 3UDCA 4WE1B 1UVNA 3NMRA 4GS0A 4HTJA 5EX0A 1H98A 3RTVA 2CQ3A 5B0AA 2FJEB 2WBMA 2KT2A 1SC6A 1FXDA 2RE1A 3KHHA 2C3PA 4EEYA 3J7YU 5CYQA 5HP1A 2W9CB 2YWFA 3PX0A 5KFIA 2HWTA 3QCFA 2UV8G 3I0RA 4TU7A 4Q2LA 4A8WA 5KOXA 5KT7A 4DWIA 2DNQA 2I5XA 4NA2A 2FDNA 4KKOA 3J7Z5 3TQ1A 3V81A 3V0HA 5AXLA 1ONYA 1MMDA 1TKZB 4PXDA 4BDPA 4C3MA 2R4FA 3K2YA 2W8KA 3QJJA 2ASDA 2HHVA 2KHCA 2MHEA 3FQKA 3IS9A 2VQEF 4ELUA 4J9OA 3PACA 3O4SA 3UNGC 5KT3A 1VBXA 1JK9B 4CQ1A 4A8MP 1V3ZA 3KK2A 1R0AA 2QLWA 4OHHA 1RT3A 1B0TA 3M32B 4CNYA 3HLUA 4N76A 2VFSA 1XWLA 1G7GA 3GFHA 2EFPA 2LA4A 3CEDA 3TYTA 4RI4A 2DR8A 2D1CA 1WG1A 5LSRA 1RTIA 3CDWA 2H5EA 2HVZA 2LDYA 3ZMQA 4IFYA 4C97A 3DRYA 5BJRA 2OMLA 4U7CA 2CNEA 3J7YI 2CM2A 1S9FA 3ZZZA 2KM8C 3MUVP 4PG8A 1IBKF 2BDPA 2VG6B 2PE8A 2UXCF 1HWJA 2QT7A 1U25A 3PO5A 2MGZA 3RAMA 5B09A 1CSJA 2RRNA 2N82B 4UOCA 2BQRA 2J5AA 4FYDA 1OETA 1M5HA 5CYMB 1RQ0A 1RT4B 2EFQA 4XDDA 3PEJA 1PA9A 4GO7X 1PA1A 3KHLA 2IBKA 3MMBA 4Y6IA 3KG4A 4CH1A 2QA4S 4BBYA 2W7OA 1LXNA 4ZCIA 3R1LA