4WU7A

Hla-a24 in complex with hiv-1 nef134-8(2f)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title Crystal structure of Nef134-8 epitope presented by HLA-A24
rcsb
total genus 70
structure length 274
sequence length 274
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wu7A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4wu7A01
3P77A 1RURL 3O3DA 1AO7E 1G9NC 5LBSL 1KNOA 4QEGA 4OBSA 5EZIL 4S1RH 3H9ZA 3QSKB 1I8KA 1FG2B 2I60H 1JHTB 2UY7A 4XCNB 1MFAH 4AEHL 3LEXA 1BZ7B 5C0IB 1KCSL 1UWEH 1SYVA 1S78C 1DANU 4M1CC 5CJXC 3IFLH 2YUXA 4PJFF 2JCCF 5GIRB 2G60L 1DQDL 3P73A 1INDH 3QNYB 1IGYA 1Q9KA 3MMEA 4L9LA 5JUEL 1TZGH 1FZKA 3U36B 4P57A 4MA1C 3HAEB 3I6LE 1FO0L 4LSSH 3VXME 1U93A 1QSEA 3BVNB 2F15A 3FZUD 1FNAA 1EVUA 2P24A 3O3DB 5GZOD 4NN5B 3BPOC 2PXYA 4YHPB 1DEDA 5D5ME 1AY1L 4ETQB 3GSVB 2XKSA 4WHCA 2Q87A 4RQQA 4CVXB 4NGHH 4NQCD 2DJ4A 1TVBB 1QLFA 3T04D 4AG4L 1G7MB 3WL9A 2VSDA 4LDOB 4XNXH 2NR6C 3S96B 5HYIA 1L6ZA 1NEUA 4AG4H 1GGTA 5KSVB 3UO1H 4PJCE 3VXPA 4G8GD 1OP5K 5D2LE 3T3ME 4FXKA 2PETA 3FOLA 5EU4B 1LNUB 3QDGB 1MCCA 4M7KL 5A2IH 4I18A 3TIEA 2F5BH 1OT2A 5IFAH 1CD1B 5LAXA 3QQ4A 1MEXH 4JB9L 1YEHL 2ZKHL 3H9YA 3MLXL 5E8DL 4PRID 3UBXG 1TVBA 5F6IB 2ZUQB 1U91A 5C09A 2MOVA 3C8DA 4HHAB 4QGYA 1CGYA 1BFTA 3F6LA 4XMPH 4U1HB 3UTZA 5T5NF 2IQ9L 2VZ3A 1LMKA 4YLQT 5D5MF 3ZYJA 1JPSL 2ADJA 3Q5OA 3U9PL 2BVOB 3W9EB 4PGBB 4HWEH 1EO8H 4P3WA 3EOTH 3I50H 1T21B 3I84A 4L29A 2GY5A 5GGQH 4DZBB 1OAXH 3UC0H 3AREC 4Z5RB 3REWA 3FOMB 5FCUH 2CXKA 2FHFA 3BJ91 5D9SA 5JA8B 1I4FA 4ELMA 3IDXL 4P23D 4UTBL 5FHBL 2WNGA 5E2VH 3NA9L 1ADQA 1T5WB 2NY3C 4NQDA 5BW7A 1DQTA 3B8YA 4FABL 5IM7A 3MODH 4N0RA 1JGUH 3JV6B 2YA1A 2HJLA 5ADOL 4FABH 4ZTPH 4S1SH 1UWXH 5J9PB 4RGNB 5CEZL 1U8JA 4OIIH 2FX8L 5IHLB 4FN0A 3WLWC 4W81A 3DRQB 1P7HL 3TT1H 2NY4B 4JG0H 2BXZA 1BBDL 4YDIL 1WFUA 4PV9A 2XXCB 4Z7VF 1D6VH 1XF4B 4U31A 4X6CA 4YHNB 2UZXB 4XVJH 4IRJA 3MZTA 2Q6WB 5BVJA 1A14L 4ZTOH 3F7VB 8FABA 5IHUH 1PQZB 4OF6A 4QRTB 1KG0B 3E6FB 3OJ2C 1UENA 2EIBA 1J18A 3O6LL 5HDLA 3L5HA 3LD8C 1QNZH 3DRTA 4Z0BL 4K07A 2WV3A 2MSPA 3PL6D 2CRZA 1L7TL 3QDMD 4JFED 2XOTA 3CDCA 4N0FB 5SWSA 3ROOB 4NO5B 3E3QA 3LKSA 5D7LA 1L7TH 2X7LA 3R1GH 4LCIH 4MAYD 1PEZA 5DRNA 4L1DA 4LCYB 5CEYA 3VI4E 1OGTA 1DBKH 4G7YH 5CGYD 1DZBA 2AEQL 3ARSA 5T1KD 1R3JB 3FT4B 1HIMH 4QHLB 4YDJA 1BZ9A 5L0QB 2VLKD 4P4KB 5IOPB 1KACB 3DO3A 4ODHL 1XCQA 5D1XB 3B9KC 2MHAB 2AXFB 1NFDA 1RU9L 5CZVL 5IBTH 3GMOA 4K7FA 4WUKH 1BLNB 3AB0B 3GSXA 7FABL 1V7ML 1I1RA 4MAUL 4OZGA 1N0XH 5J11C 5H37G 1UXWB 1XGTB 5BZWA 3BZEB 2JB6A 2K9UA 1F8TL 4JO2H 3ILPB 1QLEL 1CBVL 4GW1A 4D0BB 2CPCA 4MVBA 1QKZH 4GG6A 1YEJH 1MWAL 1S8DB 2EO9A 3WE6B 4Z7OE 3JVGC 5C0AA 4MDIB 1R3HB 4L3CA 1NFDB 4ZXBC 4TSBL 4TUJA 4U1HA 5GGSB 3G6JA 4XP9L 4C54A 5F9JB 4ODWA 4Y2DC 5JDSA 4M43L 1S9VA 5D7JD 3I9GL 3NA4A 2XQBH 5TE6H 1KCLA 1OL0A 4PJ8D 5DUML 1X44A 1GGCL 3O11B 4NFDA 1R3JA 3FT4A 3LZFH 4Z7QF 3FQTA 4LQFH 1CL7I 1DQJB 1TQBC 2H3NB 3SDAC 5H37H 3GO1H 3RGVB 2GAZB 1W0VA 3QAZB 4KJWC 5HHOB 2IGFH 1AQKH 2PYFB 2C3HA 4JZJA 3PWLA 3LN4B 2NW3B 3WKML 3IDNB 5DQDH 1K4CB 5C0EA 1IAKB 1IILE 4TUJB 2NY0D 3C08H 4RISL 3QEHA 1B6UA 5DO2C 2VQ1A 8FABB 5J9PA 5EU6A 4G8GB 5CD3B 4GMSH 4R4FL 1U3HC 2NZ9C 4P2OB 4KKLD 3DUSA 4KRLB 4K7PH 3MJ9H 4OAWA 4OCRH 2CLVA 1I85C 1OGAD 1I7RA 5E8PB 2GJ6A 2H6PA 3QPXH 2JJSC 2HMIC 3QUMH 1BD2A 3IU3B 5IEHA 4XZUA 3OKLA 5KN5B 3QPXL 5HHME 1I1FB 5ETUA 3IGAA 3NABL 4JQXC 3C9NA 1OQOA 4FZ8H 4OD2B 4OJFH 1M05B 1QEWB 1MRDH 1MELA 2C1OB 3L3IB 3O4LE 3DXAD 2VJXA 5GS0D 1JN6B 3MJ7B 3Q6FB 3ABZA 2IBZX 2L0DA 2BVEA 4E41A 1CXKA 3SGJA 4X98B 1CG9A 2W1NA 1NPUA 1O7VA 4MJ5B 3V0WL 1WIPA 1RZFL 1V05A 4PJ7A 3O45A 1UKQA 5CJ5A 2C3WA 5D7SL 2WY3A 3ZDZE 2F74A 2F5AH 1YYML 4KTEL 1ZA6B 2PR4H 3SDXF 3HCVB 1WEJH 4K55A 4BZ2L 2NY6C 3WLWD 2EYSA 4DK6A 4MZ3A 2XFXA 2MHAA 3ROLA 4AMKH 5IESL 3ARXA 4MDJA 1QBML 4NCC2 2NY6D 1LE5A 4I9WD 4G8EA 5DI8B 4HBCL 1MI5D 4LU5H 5E2VL 4BSVA 2R4RL 4YWGH 4Q9RH 2PW2A 4PGJA 1QR1B 2X70B 1E4XL 2GUOB 2DQEH 3TJEL 3WUZA 4OGAC 3P0YH 1X5FA 4AH2A 1JGDA 3U46A 1UA6H 1B6DA 2A6DB 4PTTA 1J12A 3FONB 1DN0B 1PVHA 2W0FB 1AC0A 4NKDB 3QIBD 1RMFL 3SE3A 2VNCA 4WU5A 3LV3B 2NY6B 4NN7C 4Y4HD 2R9HD 2Z31B 1K3ZA 3RZCC 1WC7A 4UAOC 5E5MA 4M48L 3HHRB 5HJ3B 3DX6A 3QUZA 3HNSH 4RQQB 4M9PA 3I75A 4AM0A 1NCBH 1URLA 3O2DA 2CXGA 5AAMA 5E6IC 1PG7L 3MROA 4N1EA 4A2LA 3RY5A 1HCVA 1RIVL 4M8QA 2FZ3A 3O6MH 5I9QC 1HEZB 4N0CC 1WISA 3PABB 3W9EA 4U1LA 3VH8A 3H9SA 2UVEA 3SCMB 1DUZB 1CICB 2J8UF 3DXAB 3TFKA 2VDOH 2OTPA 3VI3F 1FG2A 1MVUA 1S9YA 4K94L 3A6BL 3O4LA 2X4QB 2HWZL 3LQAC 2P5WB 5LGHH 5IQ7L 1X5ZA 4KDWA 3PIQB 4Y7MA 2FIKA 3GIVA 4PJEF 3WFBL 5GRVL 5C08B 3QNYA 1D5MB 5MEPB 2R1XB 1NCWH 2CLRB 3FONA 5DUPH 3K8LA 4OIAA 2QQLH 3HS0B 2D0GA 4PGDB 4M6OL 5J1SC 4P0DA 1M6OA 1FC2D 2YPLE 1AXSB 3N9GL 2NNAA 5TDOA 4TNWK 4EJ1C 1JHLH 3RTQA 5ABDE 5JHDA 2C4FT 4F7PA 1OCWL 1GVIA 4EI6A 4S1RL 4D0CB 2BP3A 2X4SA 4GRMA 5ID0B 3AS1A 1U8OA 1MFDH 5DQJB 3CPLB 1W8OA 4AEHH 2FIKB 1LE9B 1C5BL 2VLRB 2XFXB 3CFIC 4X6CE 2R29H 4LIQL 4QRPB 3MREA 4MHHI 3MLVL 1AKJB 4KY1H 3L95A 1LWRA 1CL7H 2EDHA 5C2BL 2VB5A 1BZQK 1Q0YH 1CR9L 3D25B 3L6FB 2HH0H 1J86A 2VR9A 3QJHB 3ZE1E 2C26A 2HT4C 4UV7L 4XBGA 1U8MA 4I0PA 5GGSY 4F15B 4ORZC 3VFMB 3MRRB 2YD5A 4XRCA 2ESVE 4MD0B 4YBLB 3L5XL 5FK9A 4M1CD 1I3UA 2V9QA 3GIVB 2CDEA 4GFTB 5AYUH 2JELH 4ZOBA 3MXVL 5TH2B 5E00A 5HYJD 3UTOA 1Q72L 5I74B 4JFOB 2H32B 2BY2A 3GO1L 4RAVA 1V7NH 3AMKA 2R4SH 3R06B 4GKNA 4JDTH 2DDQH 5E4EC 2V2TB 4F7EA 2GFBA 4RRPG 3OL2A 5C0AE 3ZHKA 5IJKA 4OLVL 3BP6A 3TLRA 4NNYB 1FVEA 4R0LB 1Y6KR 3IETB 4XNZB 4O4YH 4D3CH 2P8LB 2AVGA 4LNRA 4JB9H 4XCCH 3VFMA 3CJJA 5IB5A 1KTDA 3O3EB 2R0LL 2ADJB 4JZOA 3IDJA 3PL6C 4EOWL 4OZGE 2ADGB 2XPGA 1LP9B 4KKCD 4X7TB 3M45A 2H2SC 1J8HE 2VXTH 2DKUA 1T0MA 3AS2A 5D96B 1AXTH 5I1EH 4B5EA 3TO4A 1A1NB 5IK3B 3EOTL 4IMKA 4MYWB 4G42B 4BQ9A 1FG9C 1K8DB 4LDLB 5FCUL 4HWBH 4U1IA 5D2LA 1JI1A 4QYOB 3ARBB 2A9NH 4OT1H 1XF5B 1A6VH 2W0PA 3JTCA 2B4CC 3MRQB 2QR0B 1F58H 3ET9F 4PJGF 5TGBB 2WBJB 1XZ0B 4L4TD 2GT9A 3RRQA 3QFJE 1EXUB 1JGUL 3LQAH 1IEBB 2ZCLH 3NH7L 2AP2A 2VIRB 1QFPA 3D85A 3Q1SL 1OP9A 4ZS6C 1BM3H 1H15A 4KJQC 2MJWA 2HLFC 1T7ZA 3MMEB 2FSEA 1ZGLB 2JCCB 3X13A 2R0KH 4XPAH 3OR7A 4UT7L 1YMHB 4QRPE 3VRIA 4ZOCA 5IESH 2OI9A 2PYEA 3KPNB 3GSRA 5E99H 1BFVL 2ZCHH 4HWNA 4JHBA 4Z0XA 3RPIA 4LCWA 5HDBF 4GSDH 4KFZC 1KB5A 2I07A 2KH2B 4LHUG 3KJ6H 4YDLB 4EDWL 3QXAA 1FGVL 4M93C 1R0AL 4N0YH 1Y0LA 2ZOKA 4H1LA 2HVKA 2ESVB 4FQQA 2NMSA 4ZO8A 4PJEB 5CINH 3ARFA 2DJSA 4F7CB 2UY6A 3W39A 4QY8B 2PYEE 1XGQA 4Y4KA 3PL6A 2LABA 3T4YA 4DCQA 2EEBA 4PD4J 4P23C 1MIML 1X5KA 1HHGA 2QKIA 3IDMB 3F7QA 2ZWLT 3OKDB 2O61A 4ELME 3QNXB 3DUSB 3SQBA 1FJ1B 4J3WA 3K80A 1JGDB 1JGVL 2BMKB 2BNRB 1K5NB 4HXBL 4UDTB 1GAFH 1Q9OB 4KVNL 3TH2T 4N1CA 4Y5XA 3LEVL 4QOKB 2FLRT 4ZPVB 4JDZA 5HHPB 2QV2A 4FFYL 5DD6B 1GAFL 1V3KA 1CFQB 2BVOA 3IFNL 5DJ6B 3L3JA 4HK0A 4TRPH 1KT2B 1UEMA 1P5VA 4PG2C 4F2MA 3IFNH 5DEFB 2D4DA 1NL0L 1TJIL 3HR5B 2D7TL 5CKAA 5C09E 4Y4KC 4DGVH 1AGBB 4N0CD 4MCZB 4MA7L 1ZMYA 3RGVA 3S37X 3JWNC 1LDSA 2K3TA 4NO3B 5E0QA 5I1LA 1P4BH 3WNKA 3CX5J 3HE7C 1DL7L 2GSGB 2ZSVA 2BNRA 1IRAY 3CLEL 2MMXA 4MZ2A 1XF5A 1KN4H 3DMMD 3ZDXE 4N0UE 3PWPD 1P4BL 3ULVF 1FH5H 2I5YL 4Q9QH 3RWHB 3T1FA 1RZIB 2NXZD 1KT2A 5IK3A 3SDCC 4PJ7E 4KHTH 15C8H 1JZ4A 4K9EL 4YHZL 5D7JA 3CH8A 5DURD 3NIDF 2IFFH 5EOTB 4EBQH 3KNBB 1LK2B 1JTOA 1AJ7H 1OCWH 1K4DB 1K5NA 4UDTA 4CMHC 2Z4QA 2A9ML 4XPGH 4NRYA 1ZA3A 4PRPD 4G9FB 1I1AD 1ACYH 32C2A 1U58A 2A9MH 3IAPA 3MRGA 3OF6D 4TUOB 4XPGL 5EU3A 3SE3C 3U9UA 4M93B 4PJ8B 5CJ8A 3M1BA 3C08L 3ARDA 4RISH 4LHUB 2BNQE 4S1QL 4P2OA 4NWTL 3LRHA 5IVZB 3C60C 4YUEH 3O0RH 3AUVA 4OZFH 2XQYK 4HK3N 5EFIB 3HE6A 1JZ8A 1RJYA 3UYRH 1TZGL 4GO6B 4LP5A 1NAKH 3H9HA 1FO0H 5FUZH 1K3IA 4PGEB 5HY9A 5FUCC 3MXVH 1GL4B 5I8EA 1A6UH 1SYSB 5EBWA 1TJGL 5DA4A 2PYEB 5B22A 2FJGA 3QUML 3WN5C 2X4PA 4BQ8A 2BSSA 3G5ZA 5D8JL 3BPCB 1IAIM 3RVTD 3DETD 3WYRA 1U92A 2NX5A 5C7XH 4LFHG 5KSAA 1TENA 4PRPA 3LAFA 4AIXA 5GSRA 5LVEA 2ICWJ 2FR4B 4JANB 3O81A 3RP1A 1X5GA 2DRUA 3LN4A 1A6TA 4QOKE 3T09A 4Z18A 3ULVE 1GGBH 4K3EH 2OXGA 4R96A 3TP4A 4F7PB 4O9HH 4LVEA 1UXSB 4MNQD 1BEYH 1T66D 1CD1A 5LAXB 1VA9A 4QXWA 3RA7L 1HOCB 1R5IB 2X41A 1A3LH 4DKEL 5D6CA 4JJHA 1WEJL 1N7MH 1VENA 1FFNA 1LQVA 4GRLA 2FNBA 4PV9B 4WV1B 4L3EE 4MWFA 3QQ3A 3ETBF 1RULL 4Y19E 3V79C 3PHOA 5I2IB 5T3XD 5CSGA 1S7UB 1SJHB 1U2CA 5DJDA 4DAGL 4V1DA 3VGEA 3MQIA 5IMKA 3MODL 2R1WB 5GZND 3O9WB 1WWWX 3FQNA 3MXWL 4D0BA 4NO0B 5I1HL 1C8PA 4UT6H 3P0YL 3GSUB 5AUMB 3MLPA 5D9SB 3HG1A 3AM8C 1OTUC 1KGCD 3N1PC 2PN5A 3ARTA 3A67H 4GLRH 5JW3H 3TYFB 1F6FB 3EZJB 4RGNE 4BQ6A 2Y07L 1TNNA 3QCVL 1OGAE 3HPLB 3GSNA 1U8MB 1ZLWK 2FEEI 2HLAA 1BP3B 4JFDD 4AEEA 1WK0A 4XB8A 5T1DH 2BC4B 4UB0H 1NCBL 2IANB 4MJID 1UKTA 5IP4A 3W81A 1D6VL 3GMMB 1DVFD 1U8KB 1JF1A 3NZHH 3OJVC 2QQKL 4MXQA 1KTRL 4WW2A 5F7YC 5HDBE 2WAHA 2BSED 3AS0A 4RFNB 4ZPTB 4JN2A 1A3QA 4Y4HB 1RZ7H 4MSWA 2PXYB 3EFFA 3IJSB 1RHHB 3MV7D 4PJFA 2QLVB 4WUUA 3GHEL 4WI7A 4D94A 2VDPH 1SQ2N 2P8LA 4OLWH 5IIEB 1A2YA 4V1DD 5BV7C 1W72H 4Y5YC 3VWJC 4I3SH 2EDDA 3HZVB 4DZ8B 3VXRB 4QRQB 4XP4L 1BF2A 4Z9KB 4KI5F 2HKHH 5EULV 3FB8B 1N6QH 4PB9L 5E8OA 3V52L 1FPTL 4KC3B 1HZHL 4XMKL 1BQSA 4U2ZA 2DQFB 4ETYA 4XHJD 3RTQB 5JHDB 5FO8B 3V4UH 2D0HA 3VG9C 1KJMB 2EH8H 4KPHL 2W9DL 1I9IL 5SWZE 4MNQA 3U6RB 4OFDA 3CFKA 3QWRA 1N0XL 4IDLA 3NCYS 3EYSH 3VXTA 2QL1A 3KYKH 4NQDE 3UPAA 7FABH 1FNEA 4HIJA 3LS5H 3ZYOA 4Z78B 1V7MH 1BQHG 3VXRD 3KPSA 3U7YH 1A1MA 2VLJE 4Y2DA 4XVUC 5FIEA 2D3VA 3ZT5A 2GEEA 1D6EA 1Z9LA 2AK1H 2QADC 1MJUH 2GFBB 3SJVE 1DL7H 2X4NA 5DURB 5I9QB 4Z8FL 4M1DH 1ZT7B 5ECJE 3WIFB 1LEKA 4TSBH 4GBXD 1E4WL 3MRBA 4ZS7H 3C8KB 1JFQH 2F58L 3B9EA 3MRCA 2C3XA 4ODUB 4Y4FA 4ZFOL 5IVXE 5JOPE 1F6AB 2PO6A 4MA3A 5DRZB 3HE6C 3MV9A 4HG4K 3D3VB 4S2SA 3I9GH 5KVFH 5EUOE 1M1SA 3KPRE 3VRJA 4B41A 5FYLH 3RJDA 1KBGH 3CZFB 4RZCB 3TZVA 3VGAC 2VITB 1JUFA 3I75B 1XGPB 1UB6B 4AM0B 3L1OH 2P8PB 4Y8DC 4APQC 2ZUQC 5C1MB 2DAVA 3OF6A 4W6XB 4XVTL 1AQKL 1X4ZA 4QT5A 4Z7WA 2IANA 4XC1L 1BVKB 1IM9B 1T2QH 1UADC 1F90H 4X6DF 4Z77A 1G7LB 1R3IL 4OCWH 1S7SB 3D9AH 4OGXH 4NHUA 1IGCH 4G6KH 3GBNL 3QXVA 4MD4B 4ZUUA 4KMLB 4XPFH 4G9DA 4JCLA 2VXTL 2VZOA 4X6CF 2GTWA 3O11A 4N8CH 2EDKA 4WEUD 1RFDL 3QEQD 1W72A 3TO4C 4JFPB 2Y06H 4JE4B 3THML 1JPFB 1KC5L 2CLZA 1D9KB 1Q1JH 4KAQH 3BP4B 1MRCL 2YMXH 1IGTB 1KC5H 4HC1L 5FXCH 3RBSA 5CIPA 3H9HB 1FZKB 2HT2D 2PNDA 1UYWL 3IVKB 2R0WH 4PGCA 4BH7A 3UJJL 3DXAA 2ZUTA 1M7IB 2NQCA 4PRHE 5EWIL 1HH6B 5CEZD 4OFIA 5BRZD 5GGVH 5DFVC 3CSYB 4YBQC 1BZ7A 1G6RL 4L8SB 3NH7H 2YXFA 4ODSH 5SWZB 3DV6B 1PY9A 5CBAA 4JFHE 4WHYG 4I18C 1CYGA 1FORL 3KXFE 3QISA 4BUHA 1UH2A 2X4RA 1FBIH 4YBQD 4ONFH 2GTZA 1EEYA 4NRYB 3TA3D 3RWGB 1FFPA 2GJ6D 4JVPA 4NUJB 4U05A 5DT1H 2NY2B 5L2KD 4KUCD 3UAJD 5HVFB 5D1QB 2Z8RA 3GI9H 2VN7A 5TDPB 1MPAH 4RWYH 3G6AB 2FEEL 3UPRA 4JRYA 2KZ1B 3TJHC 3V5KA 4CDGC 1FGNL 3DUHA 3K2MC 1MNUL 3SJVB 3U2SA 4JM2A 3MUZ1 2Q1EA 3L9RB 4BQBA 3VFTA 4Q9RL 1EEUA 3V6FB 1ZA6A 2P7TB 3FFDB 2DS4A 2DQEL 1A22B 1BJ8A 3NFNA 3IDIA 1VSCA 3WS3B 4WDIB 2ZCKL 3UTTB 2C3VA 2EYRA 2E6PA 3IU4H 3ZKSD 2WUCL 1AGEA 3P0GB 1T83C 4L9LC 3BGMB 5E70A 5I8EB 5HGDA 3MV9E 1V5JA 3OAZH 2QSQA 3PJSB 3MX0A 4AEIL 4P5TB 3MRHB 4BSVB 1U8LB 3KPRB 3GIZL 5FYKD 3RVTC 5I8CA 4KKBC 1QSFA 2QHLA 1OD9A 2A1WL 4G43B 3S35H 3T0BA 4G7VH 3L9RA 2R1WA 4JQIL 4KUCF 3EYOB 2FR4A 2EYSB 1T5XA 1MSPA 5EC1A 4DVRL 2DM7A 5D7LD 3O9WC 3HR6A 3NZHL 2J8OA 1WWAX 4LIQE 3RWFB 3SDCD 1MCBA 1FNHA 3ILPA 4J3XA 1HHKB 4NQUA 4OF0A 5KSBB 1UJTA 3MLSL 3JV0A 3DUUB 2P45B 3D69B 4HULB 5DQ9B 1NUGA 1OM3H 1ZK9A 4OCXL 4XPHH 1A1OB 1HOCA 1R5IA 3HNVH 5FKPB 5CHNA 4R3SB 3RWJA 2EDNA 5CWSA 4NIKB 1S3KL 4K94H 5I74C 4G59A 2I9TB 4GMTL 4UUJB 2VABB 2XN9D 4D0DA 4PS4L 3QQ9C 4Q6IC 3E2HC 3PWPE 5K9OA 3UMTA 1NCDL 4RFNC 1YEEL 5EOQL 2BFVH 3BOVA 2QADD 4APQB 1ZT1B 4K3GA 4PB9H 4R90H 4U6YB 4YDJB 5GRVK 4WTWA 5DUBB 4I48A 4S0TD 4M6OH 5GRJL 5D7KE 5IW3A 3DVGA 4J8RA 1H8NA 2R23A 4M1GL 1W72B 1XF1A 5IMMA 3V6OA 4LASL 1E28B 4PLJC 3QUZC 3WJLA 4CMMB 4BKLA 4CGTA 1FCGA 1YZZA 3LKSB 4YXLL 3EJYD 2FSEB 4O51B 1I7UA 2YPLB 2EZ0D 2HYMA 5L6YH 5EN2B 2VQ1B 5IJKC 3STZA 4JR9L 1E4KA 1Y6MR 2I60L 3U7YL 4QRTA 2AEWA 3V5HA 1CGSL 1WF5A 3KPOA 1ACYL 4KY1L 2DB8A 1T7YA 2NY5H 3MV8E 4J6RH 3NIGF 2NX5B 1I9EA 1FJ1A 1JPTH 4HUKB 2N56A 1JRHL 4YHML 2AQ2A 2UVFA 5IMMB 1KUMA 4O5LL 1LEGA 1YNKL 5F7KC 2NTSP 4NKQB 1OTSD 1UM5H 4Y4FC 3ZKMC 4UDUA 3CSGA 4Q6IA 1WZ1H 3CX2A 5MENA 4I0PC 4KRNA 4WV1C 3HMXA 2VDRH 1KG0A 5EN2A 3R8QA 4NRZA 1VGEL 4HFWA 1HXYB 4GW5B 1U8PB 1A1NA 3O8XA 3QI9D 4BZ1H 3NIDE 5IB2B 3WE6A 1UC6A 1KCVL 4H8WL 2FEDC 4PJ7F 4YXHH 3LKOB 4CVWA 4FQQB 4K2UH 4HKJB 4TSCH 3RHWK 5FHAH 4FHBD 2DDQL 5IJVB 4R97C 3BZ4B 4UT9H 1IBGL 1WBZA 3F7PC 3D48R 1MEXL 4PRNB 4TSCL 4LVNB 1Q0XL 3E8UL 1UXWA 2D7OA 5KSAD 2YWZA 1T21A 1V3JA 4PJXA 5CMAA 5IUSA 2DKSA 2E27L 3HUJF 4WGVB 2BDNL 4PDCE 5D7JB 3C6LA 4JQXA 2ARJA 5C0IA 3Q5YA 1RIUL 4I2XE 5LBSH 1QO3B 4OGAD 1BVKA 1UCBL 3FQWA 1U8IA 4YNYA 3RVVD 1P9MC 2P5EA 1TITA 1YY8A 1BGXL 3VGGA 4POUB 3H8NA 5D7IA 5F1IB 1IKFL 2H2SD 4MD4A 4I18B 3SO3B 4OT1L 5L2JB 3TPUE 3HLAB 3MV8D 4JAMA 4NO2A 4LSSL 4ZOAA 3LSOA 4LSVL 4YC2C 5ICYB 2ZUUA 5GGSA 3S4SG 1F58L 2XA8L 1WAAF 1KEGH 2CK0L 2NX5D 2VLLB 4MGXA 1D9KC 4WUUB 1Q9WA 4D8PB 4L8DB 3W39B 5C0RL 1YA5A 3IKCB 1JRHI 4F33B 3VI4F 3TO4D 4OV6F 3SDAA 5CCKL 3T0XA 4F57H 2X1PA 3QCVH 4I48B 4G6FB 2DIJA 5DHYA 5K59F 3C60D 2FO4A 1EZVX 4MNGB 5DRWB 3HZMB 1YY9C 2QKIB 5HI3D 5I1GL 4KH2A 4RFOL 4XP1L 1WCBA 2J8UA 4JFXB 4P46C 2AV1A 2D7NA 1KLGB 2HFEB 3B4NA 3RY6A 3TNNB 4JG1L 4E42B 4Z7WF 4NWUH 2LVCA 3GSVA 2JCCA 3X13B 2J5LC 3BX7C 4Y5VC 3TWCL 1CE6B 1CE1H 3H9SE 3QCUH 4MXWH 2ICWA 3V5DB 1UJ3B 3QEGL 4HK3J 4UQ2B 4WHTB 4NO0A 4B53A 5HYJA 4HWEL 4LSTL 5EU7E 5HHMA 4KJQD 1YYLL 2XWJA 2RGSA 4LKXB 1T04A 4J3UA 1IVLA 4JFXA 5MENE 3VG0H 2I9LA 5EORH 1FNGB 6FABH 5HGBB 2OZ4A 1PJ9A 5DEGB 4LMQE 4XMKH 4GLRI 1UVQB 1A7OL 1B0GB 2XI9A 3VXSB 2EH8L 35C8H 4JN1L 1MAMH 4UV4L 1S9XB 1FDLH 3HMXL 5I16A 1RQ5A 2Y5TA 4GAJL 1FO0B 4FFYH 1RZKL 1X5LA 2BJML 4HH9B 1TPXB 1FDLL 3HMXH 1DEEB 1HN1A 2AKRA 4GAYA 4U6XB 1IAMA 1UB6A 4ZNEE 4AL8L 4P5TD 3U30C 1OSZB 3WIHH 2IQAA 4NNXA 4G6AD 1YEJL 4AH2B 1YEKL 4Z8FH 4JJ5A 4IJ3B 1K8IB 1DUYB 5HI4D 1HHGB 1NCCL 5DHVA 3D3VA 3ECBB 5FECA 3ARVA 3CLEH 3K0WA 3ULUL 3BQUA 5KS9B 1DANT 3O4OB 3QHZH 4RMQA 3SKOA 5JIIA 4JM2C 1XMWA 3UPRB 1GGCH 1JGLL 1HYRC 3QO1A 4Z95H 4JPIA 1CDJA 2OK0L 1MY7A 1S9WA 3HB3D 3RI5K 1QBBA 4LQFL 3M8OL 2LAGB 1OAKL 1EAJA 5L7XH 4YAQB 4P9HL 2VXVL 2FZ3B 2M2DA 1K8IA 3DTXA 5DRWA 1FHGA 5L7XL 2FBJL 1MREH 1DBKL 4J6RL 2AEQH 1FAKT 4MNGE 1NANI 4G9FE 2D2OA 5CAYB 2FBJH 5EZLB 1JPTL 3MBEC 2C5DC 5HJ3A 5D1XC 1EGJH 3QUZB 4GAYB 4U6XA 2I26N 1Y6NR 3TN0C 1CDUA 1BF8A 4P2RE 3K7UA 3VWKD 3S3JA 5FB8B 4P4KD 2ICCA 2B5IB 1ZWIB 1EBAA 1UJ3C 4U1JB 1H5BC 5CSZB 3LN9A 2DBLL 3MCKA 4MAUH 4P5KB 5FUZL 4Y2DD 3TFKC 2EYTA 5D8JH 4PJHA 1YJDL 4F7TB 3E2HB 3LS4H 5ADPH 4HV8B 4NYLB 2BY0A 4TQEL 4NDMA 4LAQL 2X1OA 5TFSL 43C9A 2VLJD 3WO4C 3BT2L 2QSVA 3MRJB 1NFIB 5GS1A 1EH9A 2PW2B 2OTWB 5IEKA 3GJFH 3QULB 3PQYD 4OZHE 2F5BL 3RWGA 5B39A 3LKQB 2OR9L 2VDKL 3FO1A 3HAEG 2F19H 4P2YA 1Q94A 43CAB 1CGTA 3C6LD 3J8F7 4F7TA 1T2XA 5I6XB 5EG6C 1X4XA 4M62H 1AD0B 2X09A 3TF7A 5KG9A 3P9LA 4G6MH 3QCTH 3OJMB 5CILL 1IT9L 3AM8A 1T0PB 5EBMB 2ZUSA 4YDLC 3JUZA 3U9PH 4XNMB 2P5WD 5FA3B 4R0LA 4X7EC 5KVMC 4DKFL 2QJDA 2J7LA 4PRDB 2Z4QB 4DKFH 5M95B 4H0HB 5E5RB 1L9NA 4IRSD 3NVQA 5TPWL 2XZCL 4FMFA 5DRXB 3EO9H 3VE0A 4OLUH 3PABA 4LVOC 3W2DH 1R24B 1BD2B 3IU3A 4U3XA 4GUPA 1A1OA 2EEDA 5JQ6H 4X5WA 3JV5A 3MRRA 4AEIH 4X4YB 1OSPH 4MJ6B 2YD8A 5A2JH 2XZQL 5E7FA 4R2GD 3QXUA 2R9HC 5A2LH 1Z3GH 4GXUN 4C56B 4F3FA 3GMQB 5C6WH 1HINL 4QRPD 3IRPX 1OWWA 3X14B 2PO6D 5E95B 1Q38A 4QHKI 3V7AG 3HNSL 5F3HA 1RUAH 4R7DA 3TNMB 1QVOB 1YMHA 5DA0B 2A6KB 5DI8A 2JJUA 1G7HB 1ACZA 2IMNA 1LO2H 1GPOH 1AGBA 1LD9A 4JG1H 3ARGC 3KPRD 1TMCA 4HS8H 1RZGB 4DUVA 4PJHF 4UBDD 1X6LA 5L9DL 3D85B 4F9LA 2V6HA 4CL7A 5E8PA 1NMAL 3V0WH 1VESA 4OCSH 4UBDC 4X4MA 3W0WD 5I19H 3FAXA 4NQEA 4P5MB 3O41A 5H8DA 5A2FA 1NMAH 5CFHA 3ZDYE 5TGBA 1UEYA 5JNYA 4JN2B 1OTTC 3QHFH 3PWNB 4KQ4H 3RNQB 2J6EH 1NLDH 4X4XA 4P9HC 1YEEH 1F02I 5T5FH 4CN6A 3VFVA 3C6LB 4JHWH 1NEZA 4G80A 4G7YL 3SY0A 1PGRB 4XTRC 2ITDA 1A7RL 4NQED 5FUCE 1DQQB 4ODVH 1AIFB 3P4NA 5KANI 2BVPB 1Y18B 1EV2E 3MYJA 3VFWA 3ESUF 1ZT4B 3DX8A 1T4KA 3G9VA 3LQZA 3QBTB 2BSRB 1G7QA 4EIGB 2J1KA 3P9WB 1RZKH 2P1YA 3O4LD 4YHKL 5ISZA 2XY2A 2YWYA 5L6YL 5I73B 1P7QD 4QRRD 1AO7B 1NJ9A 3LB6D 4F7MB 4NOFA 1FZOB 3OZ9L 4FFWD 3H3BC 2J6EA 1RZJH 3IS0X 5HSFA 5KW9L 4OM1H 4MWFB 3GSXB 5E8NB 5E08H 2Q3AA 5IM7B 3A6CL 3HZVA 2BZDA 2QHRL 4PY7B 4M1DL 4XGZB 3WN5B 3N1FC 3RIAK 1I3GH 1RJLB 3PV6A 1WSST 2ED8A 4FQHB 4FQXB 2F8VA 5FUOH 4ZXBA 3NACL 4OZIE 1WZMA 2D7PA 2VL5A 5KVFL 1HDMB 4MXVE 3VXMB 2A6DA 4M43H 3LDBB 1T3FB 4GAGH 3PDOB 1YNLL 5D70L 1IE5A 4J8RB 1CZ8L 2FX7L 2V17L 2X2YA 5CD5D 3MR9A 4L8CB 2OI9C 3FO9B 4ISVA 3S3PA 3WS3A 3OAYH 3BD5A 5E8NA 1ROWA 5C0EB 1B2WH 3WFCH 1EHLH 5K9OB 5ALCH 5F93C 3V6ZA 4HSQA 3ZDYF 3NIFE 2H26B 1G7HA 5CEZE 4O4YL 4D3CL 3HZYB 3VG9B 5DQDL 4KK6D 1IGCL 1ZV5A 1NJ9B 1HDMA 2OMBA 4FFZH 1F11B 3DVGB 2NXYD 4FNLH 2NY1C 1FIGH 3T0EB 2QQLL 4MNHA 1PD6A 4OCWL 4ZO7A 2E27H 3KXFD 4PJHE 4WU7A 1OARH 1DJSA 4ZXBD 5IVXA 1FIGL 5ACZA 5T1LB 4HJJH 3MLUH 3AU1A 3DROA 5IV2B 3QRGH 4PP8C 5B38G 3CFDB 5TF0A 4D9QE 1BFOA 5IMLB 3VD9A 2W0LA 1P6AB 3LMJH 1NBQA 1QRNE 3O3BB 1RJLA 4FQXA 2A6KA 3WN5A 2V5RA 4G8IA 4WCYL 3P11H 4XXCC 1RIHH 4LHUA 4D9RE 1B0RB 4HFWB 5TQ0H 1P4IH 3NFPB 3MLVH 1A7QL 3KPSE 2NY0B 1Q1JL 3QA3A 1S7RA 1HHIA 2OJZH 5J57B 1Q0YL 2QQNL 1ZE3C 2VDMH 1A5FH 1UYWH 4NPYB 4WU7B 5DS8A 3T0AA 1Y18A 4ZUSA 3ZE0F 1JPFA 1IGYB 5ELIA 5KANG 4OZGB 4OLEA 3IS1X 5E03A 4F33A 3WNLA 4FQ1H 2IPTH 4P46A 4NGHL 4RDQG 2BSRA 3ARGA 2ZUWA 3MGAA 3VXUE 4N5EA 3ALXA 3BZFA 1M7IA 4NQXB 5GRUH 5IB4A 5EO9B 4OD1L 1FORH 3MJ9A 5H94A 3NTCL 1R3LB 2ITDB 4U6TA 1PEWA 1A9EA 3U0TB 4MAYC 4ZD3H 3T65A 1A6ZB 3KS0H 2GCYA 2JIXB 5SWQA 2H9GA 1JYXA 2JJTC 4Z7VA 4O51A 1ED3B 2DWDA 3SGKC 1DBAH 1JUFB 1FL6B 1YEHH 4QCIB 4FXKB 4DGYH 2C4FU 5DJAA 2FHBA 5B4MD 1U6AL 5E6ZA 3S97C 3QWOA 4LU5L 4Z7VE 5JO5A 2Z92B 1T83A 1FGVH 2R4RH 3I6LD 1RZKC 3WFHB 4KRPC 3SDCB 4OQTL 1U3HD 4MCZA 3IU4L 4L4JA 3VMOA 3EYFA 5B4MC 4PRIE 2XZQH 4CU6A 4ZFGH 1OAXL 3UC0L 5IW1A 1FVCA 1ERNA 2WIIA 1C5CH 3T0ED 2DBJA 3GMLA 4IS6A 2EDBA 3VG0L 3U1SL 3CU1A 3PNWA 2AV7A 1MCNA 4RMVA 3NBNA 3CCHA 2P47B 4GXVH 2HFFB 2IF7A 2FECL 3C5JB 1E4JA 3L5IA 2X4TB 5H2BB 5HI5C 3HG1E 4DVRH 1VEPA 5L0QC 2N7AA 1NMCB 5T1KA 4MJ6A 3W0WA 4NQDD 5C3LD 3IDGA 1M71A 3EZ8A 1M7XA 4H1LB 5GGTL 4HIXL 2D7TH 4YK4B 4HD9A 4WI8A 1SEQH 4P2QE 1KIPB 3C8KA 1D3CA 1NGZB 4YHYC 4DN3L 4MA7H 4LLWB 2BNQD 3GSNL 4LF3B 5BRZB 1OY3B 3ULUD 1S3KH 3MLWL 5EOQH 2VDOL 3Q6GH 3OKMB 1KB5B 4JKLA 1B0WA 3VDCA 4PS4H 1X7QA 4WGWB 2HWZH 4HIHA 1WCBB 1WBXB 5LJYH 5C8JB 4XI5C 1A02N 1U3HA 5JORB 4WV1A 3ARBC 3OAUH 2W38A 3TZVB 4I4WB 1ADQL 1OB1B 4ODVL 1S9WB 3HE6D 4TPRL 4ESKA 4HZLB 4R26L 4NQEE 3RVXD 3WS6C 2I27N 4K9EH 3OPZL 4K23L 4QT5B 5DD3H 1AI1L 2Z91B 2QSCH 3TV3H 2IPKA 3M17B 5I6XC 4O2FB 1A6WL 3MUJA 3RTQC 1CGSH 4G8GA 5IMOB 2QSCL 4MAYA 1A6PA 5EZLA 3CXHJ 2R2HA 3B6SA 2H2PD 3CIQA 4N0UB 1GGYA 1D6EB 3F12B 3TA3C 4BFIB 2CMRH 3VXPB 1IAKA 2X70A 5JLZB 1QZ1A 1HSBA 3FB6A 5SV4A 3UEZA 4W70A 3RVVC 5I30L 1D5BA 1FYTE 4HWUA 4NQCB 5BJTB 3O0RL 5C2BH 1CR9H 4WY7H 3SN6N 4D9QD 3FB7A 3H3PL 3Q0HA 1U8OB 2FWOB 2A74A 5HVHB 1VGEH 1MCKA 4WY7L 4AIZB 1YPZA 4UAOB 2RCSH 1MHEA 3BRFA 2WBJC 2ARJB 1JN6A 5D70H 1WBYB 1TJIH 1YEGH 3ZT7A 4XNXL 1F8TH 1IJ9A 4YFEA 4S11A 5T33L 1S9VB 3MCLL 2AJSL 4NN7B 2UWEF 3QQ3B 3LEYL 2Y1VA 3BGAA 5FHAL 3VFPB 1NANH 4MX7A 1JV5A 4JO3H 1W8NA 3ARDB 5GISH 1KTLB 1ZTXH 3FOMA 3C5JA 1HEZA 1D5MA 3MTRA 1MJJA 2X6MA 3QI9C 2WINB 2VH5H 1HILB 1WAAA 5DMKA 3HG1B 3OB8A 3E8UH 1MHEB 4OFYD 3WSQH 2BVUA 5JTWA 4U1SA 3VFNB 2QADB 1MWAB 4XCEA 3EDFA 4MJ4A 3P4OA 2VZTA 2ZNWA 5E94B 4BQCA 1H8OA 2GTWB 5I1AB 1KCRH 4PJBE 5EZIH 5J12C 1N8ZB 5J4MA 3ARDD 4EUPG 1MF2H 3CDGA 5FKAA 3DURA 3NZ8B 4XBPA 5T1KB 2NY1B 3DO7B 2MFNA 3ESVF 1SBBA 4PGDA 1G9NL 5TQ0L 3TM6A 1T03L 4H25B 4Q9BA 1K85A 5E7BA 3ZSSA 1MHPL 2G75A 3BN3B 3MV8A 2XZCH 2Z8WC 3MXWH 3EIFA 4PP1D 1REIA 1H5BA 4X80H 3MRCB 4Y4FB 1MLCB 2ZOLA 2FGWL 1KPRB 5CD5C 1N6UA 4DEPB 5F9WB 5ANME 1BJ1J 5CCKH 3H42H 4H88H 1ZANH 2VLME 5A16B 2WINA 3SE8L 3K8KA 2VDQH 1SJXA 5C0RH 5KSBF 2XG4A 4OLZH 1ZANL 3TBVB 4ZUSB 2V5MA 2DM3A 3WFZA 3ZKNC 1XCTA 3C87A 4C4KT 2CO7B 4JY4A 1CLOL 3BP7A 4L9DA 2CIIB 1NBYB 5D7JC 4M03A 3CC5A 2W9LA 3JTTB 1IZJA 2J12B 4B7LA 1UWGH 4TOYL 3HUJA 3L3DB 4FQLL 3SDXB 3MLRL 2JF1A 3OKOB 2DI8A 1BFOB 5IMLA 3DWTA 4FQLH 4U1NB 5GGRA 3W11C 2HRPH 5GZOC 4NRZB 4KV5F 3H9SB 1S7XB 3DJ9A 3KPQA 1IEAA 1RK0B 3JVGA 1CCZA 4J4PD 5KOVC 1DFBH 3DIFB 3RPIB 3RGVC 3SDAB 5E2UH 3T0EA 5D71L 5FA4B 3IXTA 3FN9A 2DN7A 5GJSL 1KTKE 3BO8B 2P5WE 5E2UL 1RULH 4PG2A 4KWUA 4QRSB 4V2CB 4O2EA 3CPLA 1LE9A 4HMEA 5C08E 5GS0C 2ID5A 3KYMA 5CP3H 1J0JA 1R6VA 2LV4A 5C09D 2IAMB 3WFEL 3L7EA 2W9DH 2VAJA 3V0VB 4ZFFB 5DLMH 4QHLA 3BH8B 3ELAT 3QDJD 5CGYC 4EI5A 3OV6A 1K6QL 3TZVD 5E6YA 3QG7H 1ZHLB 2PCPB 5HVGB 2FJHA 4JHAL 2RHEA 4QF1B 3ZL4L 3FQWB 1DQJA 2OSLA 3V2AR 4FP8H 4PBXA 5HYJB 2P49B 5L2KA 2NY7L 1F13A 4P3DA 3MRPA 2WQ8A 1FNLA 5JW4Q 2FJFB 4XVJL 1S7XA 2YUVA 5FUOL 4CU8A 1GZQA 1A6AB 1JGLH 4ALAH 4Q2ZA 3OKEA 1JWMA 1PAMA 3ARPA 3O3UN 4EDXA 1R3HA 3UTPE 3O6LH 4NQDB 4U1GC 1MVFA 3RX7A 1WFOA 3JV4A 3RDTA 1JNLH 5ANMB 3S36X 5J3HC 3PHQB 3LN5B 3LKNA 1KXVC 3PWJA 4HX1B 4KK5C 3RL2B 4P2OC 1B90A 1FNSH 1QFOA 1QSEE 3GBMH 4X5XB 3BZEA 1MQKH 5B3NA 1MCFA 2HT2C 5GS3A 3AROA 4KKAC 4L4VB 2P44B 1GRWA 1N3NB 5J3HD 2E7MA 1QBAA 1T2QL 2F54B 1ZVHA 1F2XK 3B2VL 1N6QL 5C0AB 2M8XA 1HHJA 3OKEB 1OAYH 3ARFB 5ICXB 5KSAC 1SJEA 1TZHB 4YHIA 4JFPA 4YDKH 3V4UL 4XNYH 2Z8SA 1IL1B 5EUOB 3L3JB 4NO0D 4ZG1A 1TQBB 4HKXA 3BYTA 2RR3A 4DKDC 2V5SA 2QR0A 3SQOL 4UINH 4LK4A 3TPKA 4JKWA 3TIEB 3VWJA 4TQEH 4JO1L 1BOYA 1QTYT 5C07B 4NM8L 4NHUE 1NDGB 3D39D 1A6UL 4NO5A 5GS2D 4OCYH 4Q2ZB 1UFUA 5EUKB 4M6NH 1AIFA 1I8IB 4RNRB 5EO0B 2XICA 4L5FH 3PWLB 2P7TA 1ZHNA 2F53A 4LAQH 3EKCA 3DI2B 5KVGH 4HK0B 4OSUL 1YY9D 2DOCA 3L5JA 2VWEE 4CVZB 5FM8A 1CK0L 3U82B 3BUTA 3QHTC 4LLMA 4EXPX 3JUYA 2AK4E 1HE7A 3G5ZB 4IMLA 4LEOA 3DIFA 2CR6A 1SHMA 2JB5L 5FA4A 1G7IB 1NUDA 4X4YA 4LNRB 4GT7A 1U8NB 4FA8A 1RPQA 3VJ6A 5F8QC 2ATPA 3BH9A 1ZLSH 3MNVB 1T4KB 1CVRA 4J4PC 2C1PA 4ONOA 4HGKC 5F6IC 2FD6L 3D39A 1T03H 2DQHL 2YRLA 4M02A 3SBWC 5ID1B 2FJFA 4P2QA 5DFVD 1A3RH 1H8SA 3C8HA 1EHAA 5BV7H 3HKFA 2E7BA 4JRXE 5JHLH 4LVHB 4OZHF 4Z0XB 1RUML 4EZMA 5FA3A 1YPZB 5C0CA 1C12A 5BZDB 3MV11 2W07A 4FTVB 3MLZL 1ZA3B 1ZVYA 2E8YA 4HCRA 4HGMA 1KB9K 3I02B 5BS0A 5GGUB 5LWYH 1GIGH 3LKNB 3X12A 2BVYA 3V6ZB 2YD6A 4MNQE 2APTA 3PGFL 1BFSA 4LPUA 3IVKA 4LQ1A 3BN9D 4XNZC 3L3HA 3VXNA 3QUMB 3MA7B 2LU4A 2JJTA 1GPOL 3B5HA 2VIRA 4X4XB 1G7LA 2KBGA 4CADA 1DSFL 2D4FA 4HLJA 2ZOLB 1DE4A 2PYFA 3FZUC 4X9HA 1KPUA 3DVNA 5C0DB 3QG6B 5T1DL 4OBRA 3C2SA 1I3RA 3UJJH 1DSFH 1DLFL 5I71B 2X7LB 1QOKA 1WV7T 1LO2L 2ZSVB 4QOKA 3MLSH 4AIOA 5DD5L 4P23A 2Y5EA 3E1F1 1YEDA 2O5ZL 2EC9T 4OCLC 4HWBA 4U1JA 2G2RB 5JPNB 4DN3H 3PG2A 4XX1G 5I19L 1OPGH 4U1KB 1QFUH 4F58H 3EO0A 4WWKA 5KVEH 1EPFA 1XF4A 1FL3B 1IGJB 3CFJA 5DQJA 3DV4B 4YXKL 3QFDB 4PJXE 2G75B 4F7CA 4ZOEA 4FZEL 4DQOL 1ONQA 4LSRL 2XY1A 3HC4L 4E41E 2BY1A 4YWGL 3IFOB 3ULSA 2E8ZA 5FYLD 3DNKA 2L4OA 4NCC1 2GK0B 1QSED 4QHMB 4CAGA 5IVXF 3N1GC 2D7MA 1I9IH 2K7QA 3QXDA 1ES0B 4U49A 2VWEC 4U3HA 4K7FB 4U0RB 4RMSA 5HHQA 1MFDL 3HI6L 3GMRB 3P4LA 5ALBL 4N5EC 1ZSDA 4NBZB 4JFQB 2QHRH 4P3CH 3CNKA 2AK1L 2AAVA 1T2JA 3FMGH 3B43A 4L3EA 2W0FA 1J05A 3OJDA 3RPKA 1MFBL 3LV3A 2AJVH 3QFJB 1OT1A 2UWEA 3WFDH 5IF0A 2Q86A 2GKIA 4LBEB 2DIAA 4OZIB 4M3JA 3MACH 5EPMA 2RAMA 2DQJL 3AREA 5I1JH 4YX2H 1KB9J 4EN3C 5J89A 5DJYA 4WRLA 1F42A 3GJFK 4YIQA 3QULA 2AK4A 1JPGA 2IWGA 2KPNA 4ODBD 5F9DC 4YGAB 4WNQB 4HWZB 4O2FA 4H0IA 3AB0C 4FQCL 5F1SA 4HDIB 4QWWC 1G7JB 3U4AA 3DETC 1T7XA 1A64A 4OLXH 1MJ7L 4P4RA 4ZFZB 2UWEB 4NZRH 1C7SA 4I0KA 4L1HA 3CZFA 4RZCA 4Y1AD 4Y5XC 2VXQH 1J5OH 4NHCH 4GBXC 4K8RD 2R69H 4LCUB 3H7LA 4RAUB 5CZKA 3UJIL 4YHOH 3VFSA 3EOAB 2ORBL 3PE9A 1OAQL 1LILA 2ZUXA 2BRRL 2AEIT 4MA8H 3WNNA 2C1OA 3T0VA 3QRGL 2GITA 3I2CL 1DE4B 5K59E 4RGOH 1PG7W 3MC0A 3MJ7A 3KHQA 1QRNB 3LMJL 4KJYB 1CLCA 3BDBA 3CUPB 1FL3A 4M6NL 2X4NB 4RFEB 4WW1B 1IKFH 3OKLB 2VDLH 1KLGA 2FYYA 3AXLB 4Y2OA 3HZKB 4Y19B 5DK0B 4K3DH 2HH0L 3JTSA 4JREC 2J88L 3CZJA 1UM5L 2VDML 2QTEA 3MRIB 4PLNC 3WNMA 5BVPH 5GGVL 1IAOA 4AIZA 3CVHA 3SKOB 3CMOL 3L95B 5DJ8A 3MBEA 4LKCA 3Q1SH 3WIHA 2Z31A 3UO1L 1I3VA 4PB0L 1FVCB 5DT1L 3K2UL 1IC1A 3IGAB 1OOAA 5GHWH 1IGIH 3UYPA 3FO2B 2RBLA 1EFXD 3S8WA 5JOFA 3AS3A 1LDPL 3S7GA 3OG4B 1QA9A 3WJLC 4NC1C 1G7IA 4DWHA 1DBAL 1DVFC 5F72S 3QFJA 5IF0B 2GAZA 5D2NE 5IFAL 3QPQD 3WDHA 1CG9B 1U8IB 4LKCB 4YNYB 3N50A 1RZJC 4Z7VB 2HT3D 1JPSH 4EI5B 4QNPF 3BQUC 1KXTB 4YPGB 3RWCA 5FB8A 2DLEA 2AJZB 5IHZB 1XIWD 4GAFB 3KPLA 3HCVA 3T2PA 4Y4HC 3MBED 2ZUYA 4JFDE 4PP1C 5EO9A 3QUKB 5HGGS 1JNNH 5DGQA 2E9IA 2VLRD 4NJAH 3U48A 4PUBL 3NA9H 4PRNA 3OXSB 1FFRA 2V2TA 3G08B 3TVMB 1RJZA 1GGUA 5AZ2L 2VAAB 5ACMA 3LEVH 3TIDB 2ZNXA 3AY4C 3TCLA 3WFEH 1KJMA 4ELKB 1XGTA 1MIEL 3VXNB 1D5IH 3QA3B 1CE6A 5B8CC 3LQAL 3UP1A 2ZCLL 3C9NB 1SBSL 2ESVA 4FTVD 3BSZH 3CFDA 4GKSA 1GOHA 3MV9D 1Z6JT 2MCG1 4MDIA 1BBDH 2R8SL 4X6EB 3HNTH 3FQXA 4I3GA 4LCWE 2YD4A 5FYKE 3C5ZA 2AW2A 2VLKA 4U6HA 5KVEL 2R8SH 4JFDA 1H3GA 1VB9A 4LLUA 2NXZB 4RX4A 2PO6C 4IS6B 1T1ZB 2XTJD 3F62A 1YEDB 3GK8L 4YQXL 4N0FA 5SWSB 2HFFA 4PRBB 3ROOA 3GDBA 3BP5B 5I1LB 5GRYA 4LHJB 5DRNB 1YPZF 3NN8B 3BE1H 1Z0MA 1W0WB 4RWHA 2YSSA 3GBLA 3QDMA 4OZHA 1JZ6A 4U1KA 1CGWA 4ONGH 3FL7A 4QNPE 4NM4L 2H26A 2IFFL 3HE7D 1BBJB 3U7AA 1UQSB 5HXMA 4F2MB 3FHAA 5MI0C 1W72L 1AGFB 5FGCB 3MA7A 1OLZA 3MRDB 5C07A 4Z76B 4P9HH 3RVXC 3WFHA 2VYRE 4XP4H 5K9QG 4JQVC 4R4ND 4RRPA 3X3FL 4JR9H 4M5YL 1U3ZA 1YYLH 3C2AL 4AEFA 3GMQA 3BPCA 2M26A 5TQ2H 3I02A 4OM0L 3QIUD 4HLZH 3EFDL 4PBWD 4PJ9B 5D7IF 4NWTH 1R5WA 2CMRL 4GKSB 3ZKXB 4UOJA 4OM0H 4DKAA 3BWAA 3T3PE 5BS0E 3F58H 2RFXB 5IG7B 3D3VD 1T0MB 5LQBH 3I3DA 2VERN 3VFNA 3SQOH 5T33H 4U6VH 5FKPA 2DBLH 1YEIL 1W2KT 2VDRL 3S9DB 2YZ1A 4AT6A 2HVKB 2HA1A 5DS8B 1P1ZB 2OLDA 1VFOA 1KTDB 3ARFD 4BUGA 1QKZL 2ZUVA 4PP2A 1P9MA 4PJ9D 4ERSL 2OTUB 3O6FA 2B8OT 5L2KB 1U58B 3QEQA 4LLMB 5EU3B 1G7QB 1FSKC 4HUUA 1P84K 3F65A 5B3JF 5F7UA 5F21B 3VFVB 4KZEH 1HXYA 5DFTA 5D1XA 3FN0H 2Y25A 1YUHB 1QYGL 2O5YL 5F7FA 3RFZC 4LPVA 4ZSOA 2VH5L 4MD5B 2XWBB 5IB1B 1R3KB 2NCMA 2X4OB 2WK2A 5AG9A 5I76A 3KHOA 2EIZA 2EO1A 5KJRH 2XTJC 3JWDH 4EXKA 3B9KA 2DTML 3RDTB 2IFGA 5B8CA 3PUCA 3KYMB 4KRPD 3VCLB 1J1XL 1N7ML 1NMBH 3QDGA 3N1QC 5I1CH 4QHNA 5C08D 2WP3O 4WHYH 2CDGB 3WJJA 2OL3H 3W11D 5EIIA 2VC2L 1MREL 3IFLL 2AI0H 2OQJA 1HWGB 4NO3A 4JO4H 3VGFA 5CP7A 1A3RL 3INUH 3DRQA 5IFHL 3NOIA 2IH1B 1T1YA 2DQCH 1AQDA 2R2HB 4LSUH 4DTGL 1VGKB 3RIFK 2DQCL 1EJOH 3FRUB 1G0XA 4UZGA 4UT6L 4YHNA 1EO5A 1FE8H 4OFVA 4OCRL 3KPMA 2WBJA 4X8JA 1WQVT 4MQ7B 4R7DB 3TNMA 2L7UA 4HUUB 1KULA 1QFWM 4GS7C 4HAFA 3C60A 1J8HD 1JE6A 1EAPB 2XRAL 1JYWA 3DHJA 4H8WC 3UJTL 3ARDC 4XPTL 3SE4A 4M7ZB 4NCDA 5E6ID 5H35B 2XRAH 4YHIB 3CDGB 5FKAB 5TFSH 5CGMA 2FL5B 3FB5B 3FAWA 3BYYA 4OUUA 3JV4B 4X9FA 3U83A 4C58B 1T22A 2IG2H 2EKJA 5A16A 5CIPB 3MNVA 3RUGF 3PL6B 2YA2A 3MBEB 4GKZA 4D9RD 3V6OC 1NCAL 4RAVB 1U42A 3UBXA 3EOAA 1CXHA 5L9DH 2HRPL 3LVEA 1J0HA 3DUUA 2A77H 3BPOB 4FMKA 3BPLB 1HKFA 4IRZL 4C56E 5T3ZH 3RWIA 2HFGH 5F88A 5INDA 4OZFB 2VTFA 5TDNB 1DQQA 4MXQD 4ZS6D 4EN3D 5CEYB 1VFAA 3FO0H 4YH6A 1JZ3A 1QBMH 1OP5H 4PBVC 3BWAB 4R6UA 4LSPL 4WWKC 2BNRE 4S0SD 2IADB 3CVIH 3EOBB 3PWVB 4HBCH 4PUBH 4TNVK 2AV7B 4JRWA 3HR5A 3C5SA 4DQOH 1AHWA 4J1UA 2X1QA 2W9EL 2HT4D 1EZVY 4TVPL 5L8KB 3U2SB 4J3TA 4AY0A 5B39B 5KS9F 3L3KA 3B3IB 1UZ6E 2OL3B 2R23B 3VFOA 5E1HB 4LNVA 1WGOA 3O3AB 4O00A 4GRMB 2NTFA 1VFMA 4F3FB 2YD3A 4U7KA 4LCYA 5CLWA 3EYSL 4LOUC 2C3VB 2EYRB 3CVHL 3P9LB 4QYOA 3AREB 1SBSH 5D6DC 4ZTPL 4BH8B 5CEXB 5GGVY 5FGBC 5DEGA 4U1NA 3MRQA 4H1LG 5JIPA 4KGLA 2B4CL 2PYED 2Y07H 3OXRA 4EVNA 4OF5A 3STBA 2EDQA 4HJ0C 3GNML 1TMCB 2DI7A 1T1XB 2IH3B 1AR1D 4Y88A 3X3GL 1ZLVK 1CF8L 2A83B 5CJBA 2BNUB 4NT6B 4PTUA 4ZS7L 2OL3A 4Z7WB 3O6ML 2X1XR 2Q8BL 4X6DB 4L3ED 4X6FB 1AXSA 1T7VA 4FRWA 3U36A 4RAHA 5I66B 1N5YL 2PTTA 4O02H 3V8CA 4ZUVB 3D18B 3VFSB 1LP9A 4CDHA 3ZKXC 3BUYA 1ZLUK 3MACL 5FOBB 4B7IA 1KELL 1XF3A 2NZ9D 5H2BA 3P0VH 4PJEE 1RK1B 4JPKH 4K7PY 4FQJL 3SBWA 3TJHA 1OAKH 2R2BA 5E1AA 4JPWH 1GHFL 4DGIL 3VI3E 4JM4H 4XP5H 4JPIB 4JPWL 4HQQH 1NGZA 1NSNL 5DC0A 1NUNB 2F54E 5D1ZC 2SEBB 4XPBL 5D7LE 4JRYD 4OB5L 4KPHH 3DURB 3NZ8A 4JFFA 3KYNB 4HPYH 1U8HB 3DRTB 5FV2A 4U6VL 1CLZL 4RMWA 2IAMA 4AYFA 4YR6A 4X0KB 3L6FA 3MO1B 3P11L 4H5SA 1TTUA 2DLFH 3ES6A 5MHSD 4KAQL 5IW6B 3MRJA 4MS8D 1IAIH 1P4IL 3OKKB 2Z91A 3C5SB 3DSNA 4JRXD 4AQOA 4JRYB 1AHWB 4J1UB 1CK0H 2CGRH 4FFEX 1G7PB 4YZFF 3BT2H 5F96L 1IAOB 4LP4A 4NQXA 5JUEH 1NGPH 4PJHB 4UIKL 1NDGA 1GC1L 2BSTA 1HILA 5CJXA 4I4WA 1HI6A 1HKLH 4NDMB 3UTSA 1KLFA 1F3DJ 5DZLA 4UV7H 1FYTD 1UH3A 4OLYH 4PJ7B 5AYQA 4BYHA 5IBLC 1CFNA 3GSWB 2FJGB 5F71A 2NYYC 4ODUA 3VXTB 1P4LB 3IKKA 1KJ2H 4OV5A 1F3DH 4G6ML 3O9WA 3IXAB 2B1AH 2VUOA 1L6XA 5K9KA 3TCXA 1IGIL 2IH3A 4UQ2A 1FL5B 5ITFA 3NCMA 5IWLA 4ZSOB 1E6JH 4BM7A 5IVNA 3G6DH 4JFYA 1AGDB 4AENB 1TZIB 2OJEB 4L29B 3MUHL 1CICA 3DSFL 1W0YT 3O45B 4N90D 3RDTC 3PF2A 4RFEA 4WW1A 4I0PB 3S88L 1NGYB 3KGRA 1GIGL 3K46A 1YPZE 2R0LH 4GW4B 1FV1A 2P4AB 3SCMC 3CCHB 1C7TA 2A6JB 2O5XH 4Y1AB 2WLYA 2IQ9H 3UTSD 4M8QB 4YEFA 4HDIA 1S7VB 3D0VA 3T2NL 3TBWB 1FVDA 1I7TA 4IDJL 3U0WH 1XR9B 1S7SA 5LWYL 4P49A 1BAFH 2V9TA 5GS0H 2AXFA 4G8EB 3I50L 4WU5B 2VXUL 5T1LD 1AXTL 5I1EL 2COQA 4IDJH 4G7VL 1OVZA 2OP4L 2E7HA 4WI6A 4LARH 1BQLL 5IG7A 1OW0A 1Q9WB 4WI4A 4JFEA 5FF6A 2RJMA 4RBPK 1WCQA 5EU5B 1IC7L 1X4YA 2R0WL 2Z35B 1MRDL 4J4PA 1EA9C 4G8GE 1N64L 1Z2KA 3BI9X 3QWOB 5C0FA 5HD8D 1NLBL 1P2CB 4HWZA 5D2NA 4C83A 3VFGL 3FCTA 1G6RH 1RUPH 1IL1A 2DQDH 3MNZA 2LQRA 5C0BE 3PP3H 5B8CB 3HC0A 1G1CA 1NLBH 2C9AA 4MAYB 3ZT6A 3STLB 1WBXA 4S1SL 4NC1E 2CUMA 3KWWB 2APXA 2B0SL 4JZNB 4KJPD 4PJBA 4WVRA 5T3ZL 3NCJL 3MUY1 4WHDA 3KPPB 5HHNA 3VWJD 3SDDB 1MFCL 1MVUB 5I75C 5DVLA 3NFPA 1IZKA 1HSAA 4HBQA 3EO1B 3QHFL 1NAML 1T1YB 1AHWC 3EOYG 1NBZB 2X4TA 3UDWA 4YXKH 4Y5XB 2J8UB 1NCNA 4EDWH 4F80A 4JGUA 4J7RA 5IHUL 2AABH 3IDGB 4M1GH 1MFEL 5E99L 1P5UA 4XH2B 3BWUC 1XIWC 4E41B 1M7DA 2WUCH 4P2QB 4X98A 3P30H 2ADFL 4N0CA 1ZS8B 4L3AA 3QO1B 1IGML 3TV3L 3CVHH 4FFVC 2AERT 3JZ7A 3SGDI 4CNIB 1CN4A 3OX8A 3B83A 5ALBH 5DVOA 3T0WA 4IRJD 2ICWB 3V5DA 5BO1L 4UU9A 5HVHC 3B5TA 5E9DB 3GMOB 4GW5A 2Z0BA 3OGCB 1BOGB 4X7DC 3VXUD 3FB5A 3O6FB 1YN7B 3UTSE 5IT2H 4EN3B 5J13B 4IRSB 1CF8H 2CKBA 3EUUA 4XCYB 4P3DB 2LU3A 1OAZL 5GGRY 1MAML 3NCCB 1TQCC 2Q8AH 2DTSA 2ARWA 4PRIA 1BX2B 4ZUWB 3GM0A 4A6YH 3QRFM 1FN4A 3GSOA 2FB4L 4WIQA 2YN3A 3W9DB 3NACH 2X4OA 2B2XL 3DVNB 4P4KC 5CD3A 1K4DA 3FTGA 4OCXH 4GRWH 2W0KA 4OCNC 5DJZA 2IJ0C 4HIXH 1FSKB 5HGAB 4ODTH 3I6GA 1CLYH 4XGZA 1W0WA 1NC2B 3HC3L 1RUQH 1G0YR 3STZB 4Y16A 3U7WH 3L7EB 3L3HB 3PGCA 4H8WH 3PWNA 3A6BH 3T77B 2HTLD 5LGHL 1G9EA 1XH3B 3IT8D 4NKMA 1NCDH 3ULUH 1YY8B 3MRDA 4Z76A 1UT9A 4EQ3A 2YPVL 2EC9U 1A7PL 4XAKD 3MNWB 2R69L 3TBYB 2WWMD 5EIVA 3DV6A 5DK2B 1YDPA 2XQBL 3JWOH 5SX5K 2Q7YA 4EBQL 3VXUA 1FIEA 4HUWB 2VL4A 5SWSD 4HUVB 1RIUH 1P7KB 4NSKA 3KXFA 1JHLL 5BVJB 1CLZH 3AY4A 4YHZH 3KLHD 5FO9A 3F6IA 2Y7QB 4YO0B 1XGYH 5I1CL 1MJ8H 1FZOA 1T1ZA 1MF2L 2HJFB 4MCYB 2X9WA 1UWXK 3GMNB 4PJDB 5EC2B 3BP5A 1JHKL 1NUFA 2VLJB 4WCYH 5F7DA 2CLVB 3LKOA 3CC5B 2GIYA 4MNGA 3DROB 4HKZB 5IV2A 5DF0A 1WBZB 3KPMB 5ESQA 3RDTD 3RL2A 2YC1A 1AE6L 1INDL 4GG8B 3CSPA 1NGXA 2P8MB 5E9DD 1GC1H 4BH7B 1PKOA 4DZBA 1I8MA 5C71A 1P7KA 1GZQB 1BWWA 2UZIH 3KXFB 4DFHA 1P7QB 3EGSA 3VWKA 4P4KA 4FQ1L 3VU2A 1FYTA 5D1QD 3Q5TA 4PB0H 4PRPB 1XCQB 2VISB 2OTWA 5IEKB 5LXGL 3LSOB 1YEGL 3CMOH 1FZJA 2DWEB 1LEGB 2Q76A 4PJ5B 2VLRE 3OAYK 3MCLH 2AJSH 3TBSB 5IBLD 4MB4A 5C7XL 3C6SB 5HTSA 5C9JA 4M7KH 5EU7C 1HSBB 3FB6B 1NAMA 1S7QA 3BGMA 3RX8A 5D7IB 3ULVL 3UTSB 4CVZA 3QJFA 3HRZA 4X9GA 1VPOH 4OI7A 3WNOA 5HHVL 4ZFFA 2LFGA 5E94A 3RNQA 1UGNA 3HE6B 1YUHA 2APVA 3V6FA 4I2XA 5T1MB 5JW4N 4XMPL 5EOCH 4GRWF 1YMMB 2GTZB 1L7IH 4MJ2A 4J2XA 4NP4L 5F7WC 3QIUA 3ZKND 3T3MF 2XQYG 3GKWH 3G04A 4IIQC 1CT8B 2YD2A 3UDWC 1NGQH 2DMCA 1T1WB 3VXOB 4LSPH 4JFDB 3WIIL 4Y4KD 2W60A 3BD4A 2J4WL 4U0QB 5JOFB 1FCCA 1ZOXA 3QIWA 3CUPA 4O2CB 4UIMB 3WLBB 2XTJB 2CLZB 1RVFL 4ZUVA 1AFVH 5E6IA 2ITCA 4GAJH 4JFQA 1OAUH 3GUTA 1IGTA 4PRHD 1RVFH 3OR6B 3RKDD 4XWGH 1Z3GL 1OP3H 4JHAH 1IC5L 2V2XA 4KHXH 1KJ2A 2CIIA 1VDGA 3MRIA 3BSZL 3GSQA 3MRFB 1IEBA 4F57L 4QRQA 3BPNB 1EIBA 2BSTB 4OLZL 4KHXL 3GSNH 1YEKH 3KR3L 5FV1L 3TT1L 3DVIA 3Q3GA 3K1KC 3QUKA 3PQYA 4NZTL 2JTDA 5JXAH 3VFRB 3KLAA 3ZSTA 4MQSB 3ARFC 4CVUA 4PGBA 5JXAL 3E3QC 2G5RA 2PXYC 2ZCHL 1KV3A 1RZ7L 2Q7NA 4PY8J 5TE4H 2OR8A 5SWSE 1C16A 3QWQB 1K2DA 1TCRA 1A47A 5F6HI 1LGVA 3AAZB 5E5UB 1A21A 1LO5B 2CH8A 2EZ0C 3PDOA 4JDVB 3OPZH 1LO3H 5BV7B 3QEUA 4IOFD 1TTGA 3TH4T 4NC0B 3CXDH 1OF2B 4PRPE 3X3FH 2ZG3A 1LO3L 1I75A 3BKMH 3MFGB 4MJIB 5T5FL 3UTTA 1MCWM 2HKHL 1I1YA 2FO1A 4QXUL 2R2EB 3FT3B 4YFDB 1HHHA 4WFGE 3JSSA 5D7IE 3G6JE 3L3GB 4YHLH 1F6AA 1RU9H 4NNYA 1BIHA 1FVDB 2J8HA 3SDXA 4KZDH 1J0IA 1CQKA 1CDGA 1KPUB 5DMJB 1LO5A 4L8BB 1FZJB 2DWEA 4UV4H 4Y2DB 4LSQH 4U3CA 5CZVH 3F58L 3KPQB 3OB0H 3L3OB 5C6PB 1JK8B 3C09C 4P46B 2Y72A 2OCFD 3ZHLA 3NCFB 2PO6B 4MA3B 3OKMA 4JLRB 1FL5A 1I7ZB 3OHXA 4KZEL 1HXMA 2E3VA 1DBBH 1MI5A 4JY6B 5HHOD 1AGDA 4AENA 4IOSD 4XBEL 1A7PH 2W91A 3DV4A 5AAWA 3F8UB 1OF2A 2BK8A 5FO8A 1WC7B 5CIPH 3SKUD 5T3ZD 43C9B 2OR9H 4ZO6A 3X11A 5JW5B 1MRFH 2X5PA 1QFWL 2KKQA 2VDKH 3MGTB 3QUYB 3WMSA 15C8L 1P4LA 4WI3A 3IFOA 3ULSB 1JK8A 2JE8A 4YC2B 4Z95L 4YIQB 1FLTX 3GGWA 2JELL 3DI3B 5C0NC 3N1MC 4V2BA 5INCA 5C07E 2XWTB 2IGFL 4LPWA 1Q72H 4ORGA 4K71C 2ED9A 4M7JL 4NN6B 3EDEA 5FYKU 5FDWB 2HTKC 1IEHA 1U3HB 1V3LA 2EDTA 4XVTH 2OMNA 3SDDC 5C0ND 3TBYA 4L8BA 4LBEA 3MV7E 3ZDZF 3FT2B 2YUZA 4A2MA 2CKBH 3HMWH 2EE9A 3QG6A 1UH4A 3O9WD 4N68A 4QRUA 3QWRD 1VACA 3MV8B 4JPVL 2A0LC 5IROA 3MRBB 4H5SB 4OGXL 3IKCA 3V4VL 2AK4B 2NLJB 4I13B 2FDBP 4JFFD 4L4VD 4YUEL 1S7WB 4EVNB 1DQLH 2OYPA 4D9LL 3TVMD 5JW4M 2MNUA 4EOWH 1AR1C 2AJXL 5EUKA 4M61B 1W0VB 3HS0A 3BN9C 4Y0GA 3MRNB 4PJ8C 4HKZA 1OLLA 1RIHL 5GRXG 1HH6A 4PRIB 4ZUWA 2HAZA 1MRCH 1RFDH 3FQUB 1DVFB 2OP4H 4FQIL 1KCGC 3D2UD 1KPVA 4G9FA 1U36A 4MJIE 4R9HA 3NPZB 1BJ1H 3RWEA 5IFJB 4QXTB 1CDYA 2ILLA 5K9QI 4RGNC 4GQPH 1P1ZA 4LF3A 5BRZA 1MJJB 3RNKA 1GYAA 1RK1A 1L4IA 4NQSA 2V7NB 3H7BB 5IKCB 1Z5LA 2JJVA 4HIEB 3W0WB 5DD1L 2Y36L 3GZKA 3TNNA 1ES0A 4JHZA 1WTLA 2VZVA 5DD1H 2C3GA 4HEME 3FRPG 3DX7A 3MA9L 4N5ED 5A1AA 5DJAB 4MQ7A 4XBGB 5BZWB 3U46B 1EMTH 3HRZB 1MFCH 3CH1B 1L8JA 1QSZA 4IOFC 4M5ZH 2VLMD 2D0FA 4ZAKA 2DQUH 5AG8A 3LDBC 3QO0B 4UT7H 2EDYA 3L3IA 1SMAA 2AEPL 5KVDH 3BGFC 1N4XL 4ZMAT 1U6AH 2H41A 4LVHC 4OUUB 1EFXB 5C0AD 1QO3A 4KV5E 1I7UB 2AEPH 5KVDL 2VITA 1L0QA 5I8CB 2GY7B 2YK1L 1I1CA 2VZSA 2B5IC 2FH6A 1KJ3H 2HT3C 4N0YL 4YE4H 4WFEE 1FP5A 5J6GB 1N2RA 1JWSA 4Z7OF 2P48B 3FQTB 1EX0A 5GSVA 4JEGB 3GJFB 3H9SD 4U2YA 5DRZA 1YECH 5ESQB 4HH9A 1NC2A 3O2WH 3IFPA 2H8PA 5AUMA 1Q9LB 2E9BA 3O3AA 4URTB 4MDJB 3D39B 5HHXH 5JDSB 3CFEB 4OZ4B 5J1AA 3SJVA 1QRKA 4JFEB 3QEHB 2P5WA 4S10A 2Q8BH 4Y4FD 3ZKMD 5IB3A 8CGTA 1RV6X 4PRBA 1QR4A 3AC0A 1MFBH 1DLFH 5BW7C 4BKLB 4XX1E 4F9PA 5D1ZB 2IBBA 4HXAH 4MA1B 3VXUB 3DX8B 3LQZB 3QUXC 4DEPC 1YNLH 1N5YH 3LN5A 1QNZL 2PW1B 5F1NA 4HX1A 3HG1D 3MCG1 1SY6L 5AWNH 3LKPB 2CKNA 4XPHL 4XNUL 2HJFA 1FLRH 3MOAH 1FNSL 4K3HA 2DLIA 1QFUL 2FHCA 4I3SL 4F58L 2PTUA 4TSAH 5EOTA 1LK2A 2R56H 3DPBA 4ZNCD 1KN4L 3QUZD 1BREA 2GSIB 4JGJA 4EUPB 1F4XL 4F37F 2Q7YB 5IVOA 2AJUH 4POZC 2I5YH 1DP0A 3O41B 5D72H 4UDUB 5D6CB 1F4XH 4KQ3L 5DEZA 2CQVA 3OKNA 3MRGB 3SGJC 1NC2D 4LASH 3TVMA 1S7TB 4W6YB 1NCWL 1AI1H 3WUWG 4Y89A 4LSQL 1CD0A 2VZ1A 3CFBA 1RZGA 1RHHA 1AGFA 5HBBA 4G9DB 2M1KA 4MA8L 3SKMA 1H3XA 3KYKL 4BFBD 2DLFL 1QHPA 4UINL 4MB5A 4LSDA 5F7MC 4X6BA 3P9MB 4PV8B 1PDKA 4HJGA 3VXRE 2LTQB 5LGJA 5H94B 3QO0A 4NM8H 4PJAE 4NO2B 3HC0B 4H20L 4IRJB 1MWAH 2UWEE 4XI5D 5JMOC 5D1QA 4H20H 4CJ0A 1E4WH 5JHDE 2ICWI 3S34L 4XBEH 3R0MA 2J2ZA 3O8XD 1G1YA 5ACLA 3MO1A 1WTGT 4KDTA 4KI5C 5HPMB 4G6FD 1QQDB 2IPUK 4PRAB 2UZIL 2E7LE 4ZQKB 3FQRB 1NGPL 4L8SA 5I1DB 1WVZA 1HHIB 1R3KA 5CSZA 1ETZA 5IJVA 3GMPA 2EDOA 2DQJH 3PHQA 1YN7A 3BDYH 4JKPL 4YX2L 3L5WA 3RJQB 2AXHA 4GKZB 5GRWA 3MRPB 2VKXA 4JKPH 5E2JA 3JXAA 2HFEA 5J1AB 4AJ0A 3D39E 1ZLSL 4L4VA 3UCRA 3BIKA 4TVSa 1MI5E 5ITBL 3BRGC 3DSFH 1BECA 2G9HB 3FFCE 3NGBC 4G3YH 1JIBA 1T0NB 2NXZC 1NBVH 4ELKA 4PREB 1E6JL 2BXYA 3JTSB 2XN9E 3HFML 5I1DA 1BD2D 2VLJA 5DVNA 2NXYC 3FO1B 4GMSL 3QR2A 1AGEB 4GRLD 5E4EB 4Y16B 1A8JH 4P2RB 3T2QA 5EZOH 3KLDA 3MJ9L 3OAZK 4N8CL 3IDNA 1RZIA 2NW2A 5LG1A 4NBXB 1AO7D 2HVJA 5J6HB 4DN4L 4MVBC 1QSFB 5GJTH 1BQLH 4I1NB 1CFNB 3GSWA 2Y23A 4QKXB 5BMFL 5EBGA 3THMH 5AEAA 3LH2L 3FQRA 3FO9A 5GRZA 2X9XA 4RX4D 3P4MA 3WDJA 1IC7H 1S5HA 3IXAA 1KN2H 4MD0A 4UQ3B 5I17B 3LHPL 2VDLL 4PLKC 1QA9B 4OJFL 4YR6B 5EC1B 3VXRA 1NBZA 4QRSA 1KN2L 4HKXB 4H25A 3TBSA 3LHPH 4M61A 1A6VL 2Y36H 1G6VK 1LD9B 1UQSA 4JFZL 2IPTL 3V5HB 4JFFB 3V6OE 4JVWA 2XZZA 4PJFE 1RUPL 4MD5A 4XWGL 3UZQA 3P3YA 5DMIH 4G42A 5EFIA 2X4SB 4WTXA 4APQD 2G5BA 2V5TA 4CMMA 3MLWH 2MKWA 4R97B 3L3DA 1I7TB 2Y6SD 1CFQA 5DJ6A 2QSTA 4P57B 3ISWA 4H26B 4NUGL 1S7TA 5DJ2B 1ORQA 5HYJE 4TVPE 5DK0A 2IADA 1RJZB 3D69A 4JRXA 1IEAB 1RK0A 1YC8A 5FF6B 2NY5C 3BP7B 1NH6A 3BAEH 3M07A 3T0EC 4XCNA 2I24N 3GB7A 4KKNA 3IB4A 4HIHB 4YAQA 1KLUB 3S4SA 2FGZA 2A6IB 4HAGA 1JTTA 1A6WH 1DFBL 2NPLX 4Z7UE 2WP3T 2A2QT 1IGMH 3STLA 1DVFA 5J12B 2WUBL 3O2WL 3RWHA 3QEGH 3AFLA 5HDQL 4WW2C 5EB9A 4JJ5B 5GJSH 5I8OL 2OI9B 4JLRA 3TCLB 5CUSH 3MBXL 2W60B 3NFSL 2D03L 4XRCB 4HIIA 5H35A 4HKBA 4YHLL 1KTLA 5J56B 4KMTL 3CSBA 3NFSH 2ESVD 3MCKB 4EQ2A 2XN9B 3VMPA 1OAZH 3NFNB 1D9KA 5JOEA 5EU6E 4YPGA 3BKYH 5DSCB 2PTTB 3QI9B 5HYQB 4OZFG 1QACA 1MLBB 2GI7A 2OBGA 3ZE0E 4S1DD 2ATKB 2DYPB 4KKLC 4P5TA 2MCPL 2HTKD 3ECBA 3BKJH 3O2VH 3ARED 3EYFB 4RDQF 2O26U 4RMTA 1KYOK 1UG9A 4ODTL 3HE7A 3F5WB 3TN0B 2QEJA 2CO6B 3LPFA 2DQTH 4OTXH 1NCCH 5TE7L 1MAJA 3LQMA 4NKOA 2JIXD 4Q9QL 3VXSD 2X4RB 4XBPB 3QT2A 5HGBA 2F54D 1PSKH 5JLZA 5L8JB 5EU5A 4ALAL 2P5EB 3P2TA 3B2UC 3OR6A 4IOIA 5MP6L 1MJ7H 2DJUA 1QYGH 5C9KA 1MQKL 1U8JB 3LKRB 4R26H 5FOBA 1ZWIA 3TEUA 1MH5B 4KROD 2CRMA 4JGMA 1CDHA 5A40E 5HI5D 4ETQA 4JZJC 3QDHA 4K23H 4IHOB 1MJ8L 3HUJE 4WW2B 3PDGA 1I9JH 4J3VA 4AQ1B 3CLFL 4P2CG 3LIZL 3SGDH 1LVEA 3M8OH 1PBYA 3PWPB 4Q9CA 3O4OC 5ETUB 2VC2H 1FAIL 4HUNB 4WEMB 5DRXA 2AI0L 2K1MA 3TJHD 3ZE2E 3VXQB 2HTLC 4Q74A 1UCTA 1AE6H 4JPVH 1OTUD 4HUMB 3WCYA 2CRYA 4DUXA 1A2YB 5IMOA 1I8KB 1XEDA 1AY1H 4ZDHB 3D87B 2YRZA 3B9VA 3PWUA 3H3PH 1EVTC 2JKXA 1QRNA 4KJYA 5EBLB 5MEOA 5T1MA 3JWDC 3NCYP 4Y4HA 1MCRA 2AQ3A 3UYRL 2HRLA 1I1FA 1NAKL 2IAND 4YPJA 4HUWA 4Y5YB 1U2HA 2D31A 3K8MA 4M6ML 4NQCA 1RZ8A 1XGUA 4UTAH 5C0FB 4MNQB 3PWVA 4CU7A 3KYNA 5EIIB 1T1WA 1O0VA 5C92A 4ERSH 3G5YB 3B6SB 1QLFB 3E3QE 1JZ7A 3EBAA 3QFJD 3ULUF 1PW3A 1KIQB 5SWQB 4XWOC 2D9QB 3RIAF 3KYAA 5EWIH 5EBLA 1GGBL 4K3EL 4W4NA 2CDFA 1SVZA 2F19L 3MFFB 3HAEA 1J8HA 5JOPD 3ARBD 1I8MB 3T0EE 3RIFF 4YHPA 5EOCL 3GJEA 4H0GA 2HFGL 2Y9RT 5INCB 3MRKA 3SDCA 3VD3A 5CP7B 5JR1L 2F9BT 3GI9L 3I3EA 1Z0NA 2LE9A 4LRNL 3GSQB 4S2SB 4ZPTA 3VFOB 1EO8L 2L7JA 2GCYB 2JIXA 1FZMA 3SPVA 4KRPB 4UNVA 3CFBB 1MHCA 1KNOB 2NXYB 3PGDA 1VKXB 3L3OA 5SWZD 1LP9F 1ZVSB 4GG6E 3QIUB 4ZXBB 2B1HL 2UYLA 1AFVL 3GMNA 5EC2A 4G6JL 3LKRA 2R1YA 4G8IB 1U95A 2IAMC 1E4XH 3TJEH 1FQ9C 1I1AB 3DTXB 4FFVD 4G9FD 1S8DA 4KKAD 2R15A 3O6KH 1WT5C 2MKLC 4I2XB 4L4TE 2W65A 4OIIL 3WNPA 1ZEAL 2AGJL 3FB8A 3OTTA 5IROC 5I1HH 4UILL 3QG7L 1OAUL 4KK9D 3E0GA 3FHQA 4NHUB 3NAAH 3E6HA 1HINH 5FM5O 1D5ZA 3FJTA 3BIKB 5HPMA 4Z7UF 1TCMA 4QTIL 4PR5A 1XR8A 3LRSA 3LPWA 4V1DB 5J8OA 2R2CA 1CFSA 4ZTOL 3KR3H 1SY6A 1A7BA 1M05A 1QEWA 3N0PB 4RMUA 4C55A 5TE4L 4C59B 4WNQA 4ZUTB 3FRUA 3PP4H 3BEWA 3KNBA 3OWEA 2YHGA 1OW0C 1J1PH 2YD9A 3L7FA 4HGWB 3QP3A 4WUUE 3WXWH 1VFAB 3EGSB 3QJFB 5DO2D 1N6VA 1F3JA 4Q6IB 3A6OA 1ZLUH 1CE1L 4MB3A 4Q6YA 3VFRA 3HPJA 1CFVH 3QCUL 4HEPG 4MXWL 4U33A 2Q6WA 2QQQA 4QRRB 3TT3H 5HGHB 1ULVA 4XMLL 4JPKL 1MCPL 4JFHD 4PREA 3GHBL 1A9BA 2CLRA 1FLRL 2H32H 3DYMA 1J1OH 4LEXL 1B0RA 3OKNB 4QLRA 4NZJA 2QBWA 1HZHH 3CVIL 4XP6H 4LEXH 5GSRB 5KSUA 2F53B 4HXBH 3D85D 4TULH 1CDBA 2NW2B 4KMTH 4WJ5A 4I0PD 3G6JB 1AP2B 3EYVA 4ODWB 2I9LB 1BWMA 1ZS8A 4Y19D 4RCAA 3OX8B 2LVEA 1YEFL 4PJIF 5INDB 3BRDA 2IBZY 5LQBL 2B7DT 4F37K 4PP2B 2V5YA 3IDUA 1EK3A 2Y4SA 3KAAA 5DFWH 1S7RB 3LS5L 1DR9A 4U6HB 4BK5A 2DQTL 5JA9A 2EKSB 4R8WH 5TE7H 5KSUB 3DX6B 3BP6B 3W82A 3SY0B 1S7UA 1C08B 1SJHA 3IDYB 3O2DL 3SKNA 3VXSE 2XKNB 5I0ZA 1QFWH 3SGEI 4YJZL 1GCFA 1JWUA 4A6YA 5DUMH 4MQTB 4NNPH 4AK1A 1QFHA 3B9KD 3QIBC 3FN0L 4O02L 3PHSA 4FQXC 4NNPL 1QLRB 3S3SA 1CZ8H 3HRPA 5FYJE 2GSGA 2VE6A 3PGCB 5D1ZD 2DF3A 4IBLT 4W4OA 4EI5D 1V7NL 4KMQA 4GBXB 1ZHLA 2PCPA 3MRLB 1G84A 1GJIA 1KPRA 3HI5H 3MV7B 3V4VH<