4WU7A

Hla-a24 in complex with hiv-1 nef134-8(2f)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Nef134-8 epitope presented by HLA-A24
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
total genus 70
structure length 274
sequence length 274
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wu7A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4wu7A01
3BRDA 1EJ6A 4HDIB 1T21B 3BP6A 5DFTA 3C60C 1IGIL 3NIFE 3CXDL 4HK0B 3D39E 4Y5VB 4K3GA 1JNHA 5CKAA 4NRYA 5EUOA 5T33L 1BD2D 4CU6A 3NCBB 4PGCA 4XNZC 4G59A 2PN5A 5E6ID 2R0WL 2YA2A 3O0RL 2IQAB 2F58L 3MV8D 3ARXA 3VGHA 5JDSA 1DSFL 3W2DL 2ZUSA 3OWEA 1GAFL 3RVTC 4WUUD 2RFXB 4YIQB 1OB1B 4OV6F 4BZYA 3RTQB 4MSWB 5JW5A 2AJZB 5FO8A 4U1GB 4L4TA 4HUVA 1QSEA 2ADIA 3HPLB 3OB0H 1G6RA 1H3UA 1D5XA 1LK3L 4LSPH 1ZEAH 3WFDL 5JOFA 3ROLA 1JV5A 1MH5B 3ALPA 4M61B 4OZGB 3HB3D 3ZKSD 1A1NA 2EE3A 4Z7UE 5CJ5A 4I3RL 3TZVA 1U58A 1HEZB 2V2TB 3TNMB 3DPBA 5BZWB 4G8FA 1CXFA 5IVXE 3H0TA 4XWOD 4N1EA 4LPVA 2EYSA 5F1KC 3TO2A 2ARJB 5FGBA 4I2XB 3RJDA 3IRZA 4LPYA 1MWAH 3TN0D 2GJZA 3STLB 2DTSA 4I0PC 2MKLC 3UTSA 4QRPA 1ZHNA 3X12B 4DKAA 3VFNB 2BNRB 5IHLB 4JRYD 5DD0L 2ZPKH 4M1GH 1U41A 4GRLD 5C0FB 1NL0L 2PYFB 4Y5YB 1IAIL 4MQSB 3MA7A 2X6MA 5IBTH 4NM8H 4JRXA 1FNEB 1U8KB 5EC1A 2K9UA 1ZVSB 1G7MA 1WFUA 1FNHA 3HI6H 4R4ND 1MRCH 2X2YA 3L3KA 3O6MH 3VXPA 4PJEE 1S7UB 2QEJA 1CD8A 3P9LA 4PJXE 1IVLA 1KCKA 1A6AA 3LHPL 1S5IL 2Z92B 4ODUB 4OD3H 1TDQA 5LBSH 3GMQB 2JCCB 4ZFZB 1CFNA 4F7MB 3WUWB 4K23L 4R7DB 4M7JH 3MGTA 4WWKD 3ZE1E 3IGAB 5F9DC 8FABB 3KR3L 2X9WA 3TFKC 4MD5A 4GMTL 1D6EA 4OT1H 3H9HB 5DRWB 3CVHA 1EFXB 1MF2L 4FMFA 4M7LT 3LAFA 3U4EB 4PJAB 5JXEA 2P8PA 4PGDA 4PRBA 1FVEB 3JWNC 1T20B 4NO0A 3FL7A 3EGSA 2GJZB 4OLWL 3E8UL 3MRFB 5IM7A 4XCFH 1BBJA 1N5YL 1ZA6A 3BRFA 1UZ8B 4DQOL 3BIKB 4L4TE 1FNSL 3HI1B 1VEMA 3Q5YA 4LDOB 4PRHB 4OZIB 4S11A 1GHFH 5ANMB 5CGMA 3GRWA 2MWCA 2F58H 4XB7A 2BNUB 4WU5A 5F1OB 1IGTA 4N5UA 3S3SA 1II4E 1ADQL 3C9NA 5C92A 1JMXA 3WN5B 1LP9A 4BJLA 5ICZB 5CZXC 4HG4J 4P2OC 1WQVT 3UJIH 4J2XA 4XHJD 5IVXA 2HT2C 3JV4A 1ZANH 4XNQA 1DBAH 3RWCA 2IANE 2UY7A 4WW1B 1UB5B 4PS4H 5DUML 1ZT4B 4JLRA 4JB9L 5D6CB 1U36A 5JO5B 4JFEB 5HHOD 2APXA 3X11B 5L2KA 2DLIA 3V5KB 3WIHH 1NGWA 1UA6H 4PJ9D 2XY2A 1VERA 5IR1A 1RUAH 4UQ2B 5ETUB 1WCBA 2EH8H 1HCFX 4P57A 1M05B 1IM9B 3QUMH 4JM4L 2AJVL 4D0DB 1XGUA 4LF3A 2GITB 4KI5C 3QXWA 4FQXD 2EDQA 1A6ZA 1JF1A 3QIWD 4OZ4A 3MRNB 4KDVA 3SDCD 5I8OL 5K9JL 4G8GA 3B8SA 2H2PC 3I6GA 5IK3B 3CFBA 5GS0L 3LPGA 4TVPD 5DD0H 5GSVB 4M1GL 1CFTA 4KJQD 1N6VA 4PV9B 4HGWA 3EDFA 1IBGH 4HK3J 1CTOA 3SO3C 5TE7L 1MAMH 1HKLH 3S3JA 5CZXD 1HH6B 1MCPL 2CKNA 5CJXA 3WJLC 4MNQB 3HNVH 3EUUA 1GGUA 1AE6H 2DYPD 4U2YA 1OWRM 2GEEA 2WZPD 3TBWB 2PO6C 2FX7H 1DQTA 3CFJB 1ZT4A 3V5DB 3VD7A 4KFZC 3VWKC 3NCYS 1AD0B 5IV2A 2A0LD 3T4AA 1RURH 3VD5A 3AS0A 1RIVH 2DQJH 4PG9B 4NKDA 4H0IA 2AQ1A 4XVUC 3KPSD 4KKCC 3WUWG 4Z7VA 4QRQA 4X6EB 4M8QA 3ERYA 5D5ME 4ZS6C 2YEZB 1FZMA 5HYJA 2PETA 3OHXA 3VD9A 3RZCA 3B9VA 3QDGB 2PYEB 3E6HB 4Q0XL 3PL6D 2Y36H 1I7UB 4M9PA 3QCUH 2V5TA 2ERJB 4YHIB 3MRMA 4DK3A 1DQJA 3BDYL 3ES6A 4HS6B 1FL5A 2VN4A 3Q6FB 3TT3H 3WIFA 2ED7A 4OF6A 2GQHA 2I60H 1I1AA 3FRPA 4AM0A 3BJ91 2LTQC 4DGIL 5D5MA 1JF6A 1LK2B 2FD6H 1VA9A 5IGXH 4G6FB 1UH2A 4QRSA 4MNQA 3GKWH 2VDNL 1RPQA 2Q7NA 4JFOB 3ARDA 3PUCA 4YGAB 5IB1A 4RQQB 5CD5D 3VWKD 4JZOB 3QWOB 3R8QA 5I8CA 3U9PL 1N3NB 3S36L 3Q2CA 2IC2A 1KJ3H 5KW9L 5HHQA 5I76B 5KG9A 5TFSH 4HXBH 5LWYH 3SDXF 1RUAL 2Q1EA 4WO4C 2OTUB 2UV3A 4HJGB 4FQ1L 1CZ8H 3MOBL 3PP4L 3PGCA 5JUEL 5DK3A 3RZCB 5I1EL 3L3HA 3ZKXB 4OZHB 5EULV 3NFNA 2OJEB 3JZ7A 2BOBB 4QYOB 4KHTH 2VXQL 3NCCB 2A2QT 2DQHL 1IAKA 3BE1L 1VESA 4RGNB 4MXQD 1Z9MA 3DGGB 4WFFE 3P4LA 4L9DA 5D4QA 2O5ZL 5E8DH 4CNIB 3RVUD 1SQ2N 5C0IA 4F7EB 2M26A 2V2XA 3CX5K 3HR5B 1MAML 1M4KA 3T0EA 3KYMA 4OM0L 1HHGB 2WP3O 3DURB 1QKZL 2OZ4L 5KVGL 4Q9RH 5DUBB 2R4SH 2X9XA 3D6GA 2FJHA 4MCYB 5M7QA 2ICES 3NAAH 1QYGH 5CIPB 4XT1C 1Y6MR 1G1CA 1LEKB 3FN3A 3LRGA 4DUWA 5IJKC 5J89A 1C5BL 4BH8B 1BQHG 4D9QD 3TIDA 1D5MB 2V2WA 2ZOLB 4N0FB 3VFSA 2LAAA 4TSAH 1FNAA 4XC3L 2YXFA 3AU1A 4H88H 3MUGB 2O61A 5D7KD 5I1GH 1KLFA 2LAGB 5DJ2A 3QFDB 2R29H 4NZDA 1AQDA 1A9BA 4GW5B 1PEZA 1D6EB 4Y2DD 4LVNB 4P9HC 1MHEA 5IBUG 5IROA 4I2XA 1HXYB 4OLYL 5DD1H 2IH1A 3TT3L 4M6NH 1GGCH 3AUVA 4TUOB 5T3XE 2HTLC 4M6OL 4KJWC 5MEQB 2NY1C 5BZDA 1OOAA 5DD6A 3QNYB 3HRPA 4NNPL 3WKMH 1KG0A 3KYMB 4KXZH 3FO1A 3QDJA 2FSEB 1CXEA 4X6CE 2Z91B 3GHEH 4QRRA 1B0RB 3KPMB 3DVGB 3RWEA 1LEGA 2OI9A 5IQ9B 5DI8B 1VPOH 2R9HC 1DE4B 1JWUA 1RUKH 4HPYH 1PY9A 1HHHB 1HWGB 2DQTH 2HLFD 2QKIA 5HHNB 4QOKA 3SE4C 1NL0H 1XGPB 2JJTC 3WEXB 1ZGLM 3ILPA 1MRDH 5C0BB 5B8CB 2ORBL 3MV9E 4JLRB 5D6CA 1GSMA 1NAMH 5D7SH 2H26A 1ZVHA 5HVGB 2FO4B 3SJVA 3L3DA 4WFED 4PJ5E 3N0PB 4OD3L 1MQKH 4V1DE 4XP1L 3BH8B 4PB9H 5LBSL 4IS6B 2VABA 3EZ8A 4WTWA 3RAJH 4LNVA 5DZNA 3BRGC 4RGOH 3QUZA 2VMFA 1AR2A 2J8HA 5DVLA 3ARGD 2Y5EA 1WC7B 1YMMA 2XKNA 5ANMA 4KQ4L 4WHTB 2EO1A 4O58H 4NQUA 1CXHA 3FOMB 4MD4B 4KRNA 1IGYB 1N5YH 2VSDA 2GJ6D 3DYMA 3WO3B 1BM3L 1M7IA 3FTGA 3DYPA 1JYXA 5FK9B 4M1CD 1LVEA 4H0GA 1GZQA 1NAMA 3GB7B 2IMMA 4JHWL 3VRIB 3O2DA 1IGML 2QQNH 2XWTA 1CFSB 3LH2H 4GQ9H 3V4UL 2CDFB 5IVZB 5D1XA 1P6FA 4HH9B 1I7ZB 2MQ0A 4TUKH 1FO0A 4NSKB 3OKMA 2VLRD 1MCLA 1AXSA 1PLGL 1E6JL 4LHUD 3EOYG 4LLVA 1JHLH 3DUSA 4YQXL 3O9WD 1F8TH 2F54E 5GXBB 3BZDA 4Z7VB 4ZPTA 4JB9H 4Z76B 4JQVC 1S7XB 4OIBA 1ZLWK 1PX4A 4L8BA 3QUZB 5C09D 1KIPA 1ZGLA 2ZP0T 3JSSA 2C3GA 1X6LA 2A9NH 3MSPA 4H25B 5EU5B 2VDQH 3C8HA 5DMKB 2D7TH 3PV7A 1S9XA 1OARL 4WFGD 1WT5C 2P44B 4ZOAA 1BZ9A 1RZKH 12E8L 1I9RH 4JHAH 1RZJL 3R06A 4J6RL 4ACPA 5I8OH 2WMPA 3GRWH 4N5EC 1MRFL 4QHKI 1S7RB 2NY0C 2ED9A 4XAKD 4JO2H 3CNKA 4NO3A 5F7HA 2JJSA 5MEOB 4J4PC 3LMJH 2AJYH 1BREA 5D1XB 1T21A 1RJCA 4CJ1A 5HDQH 5SWZA 3T4YA 1JGUL 3MREB 3O8XC 2HAZA 1IEBA 1NBYA 5IEHA 5EUOB 3QDAA 3DRQA 5CJ8A 4PJ7A 2DTMH 4GO6B 5DUPL 4JPIB 1REIA 5EBLB 4MAUH 4FQJL 5DYOB 4EEEA 4ZTOL 1JJUA 4PUBL 2QADD 3RX7A 5CEXA 2YPKB 1BZ7A 4PV8A 1D5ZB 2R1XB 3MFFA 3ME0A 2Y07H 1C5DA 4BK5A 2ZSVA 3OXSA 1CVRA 2HFGH 3WFEL 1MVFA 3WD5L 4Y19E 2UWEA 3TBVB 4Y4KB 3N9GH 3BDYH 3E6FA 2HLAA 5BS0B 5HSFA 2OZ4A 1E4WH 3SDCA 2LVEA 3C8KB 3E2HA 2ZG3A 1ZLSL 2D4FA 4DTGH 2I60L 1XGYH 2V2TA 2DLFL 2MCPH 2LU4A 5B39A 4KMTH 4Z95L 4PGBB 5BJTA 4FFZH 4UNVA 5CKGA 1LGVA 3O8XD 3MV7D 4DFIA 4AMKH 4K7PL 4NZJA 1UEYA 4N0RA 5F9WC 4ZG1A 1OGTA 5DLMH 3EJJX 32C2A 5C08E 3BWAB 1CICA 3O3AB 5K59F 1JHTA 1UQSA 1VDGA 2JELH 4KTYA 2W91A 4WEBH 4NRZA 1UCBL 3BQUA 4NPYB 1I9IH 4KZDL 2IH3B 1CICC 4JKKA 3FQWA 1Y18B 1BLNB 4JHBA 4JN1L 1IQDB 1C5CH 5C0ND 5EO9B 2JE8A 3REVA 3P11H 1ZAGA 4QHKJ 3W9DB 5IMOA 4LDLB 1RAMA 4BELD 1RZKL 3KJ4B 3QHFL 4HS3B 4MA1C 4JHAL 4Y4KA 5DHYA 1ZTXH 3MJ7B 4DFHA 3PL6A 4GRWH 2BJMH 1MRFH 2W07A 2JJVA 2AXGA 2J2ZA 4LLWB 4G7VL 4K94L 5DS8B 1QA9B 4PJ7F 3VGEA 4F2MA 5C0DB 5A2LH 4S1DD 5E6IC 4PD4J 2MCG1 3NFSH 5EU7C 3DI3B 4WUUA 3AMKA 4UI2A 5FYJU 3GFUA 4NQCB 1E0OB 4ZS7L 1EHXA 3UTZA 3H3BC 3NN8A 3O41B 5ADPH 4YWGL 1JK8A 3U0WH 3BP5B 1IE5A 5FKAB 1ETZB 4K7FA 4PLKD 4C56B 2G9HB 1C5BH 5DHVH 4RIRA 3IAPA 4NNXA 5AG9A 5D7LB 4RAVB 2WINA 5INCB 1IILE 4GKNB 1OGAD 3P0YL 4LDEB 4PP1D 4KY1H 2A6JA 2XZCL 1UJTA 1RJZA 1HE7A 2RIKA 4K94C 1KJVB 5CSGA 3RGHA 2XRAL 4LCCB 1TZHA 3HI5L 3RHWK 2VE6A 2YPVL 2J8UE 4P5KB 4PJIF 3TWCH 1M71A 1UXWB 4MX7B 3VFMB 5I71C 5IMMA 5E2UH 3QUYC 3RX8A 2D7MA 3SE8H 1DBJH 3CLFL 1U8OA 3F6IA 4MVBD 4XWGH 4JPVL 5E8EB 4AEIH 5B4MD 4JG0H 5MHSD 1NBVH 1EO8L 3PWPB 4MJ6B 1MY5A 4DAGL 5ESAB 4ODUA 5E95B 3S88H 1G6VK 1FFOA 4Z7WE 1FE8H 4PRPE 4JFYB 4YZFF 2YUWA 4JE4B 1AGEA 4PP2B 4E41E 1KENL 3MA9L 1CL7I 1KPRA 4NKMB 3T0DA 4PJDF 15C8H 3JUZA 4K9EC 4XPTH 5T1DL 1JNLL 4JRXB 2X4TB 4LKXB 4UTBL 1MCDA 1W72L 4ENEC 2F5BL 3BP7B 5CBAB 4Z77A 4NQEB 3WIHA 5JA9A 3DETC 3UTQA 2NX5D 5EZLA 3RWHA 3RUGE 4L3AA 4U6XB 4YBHA 4FABL 2QQKH 5E00A 3IKKA 1T03H 2DQEH 1X5AA 4RAHA 4UT9H 5AWNH 1BOGA 3V52L 1YDPB 3THML 3PWNA 5L6YH 4DOHE 1INDH 2B0SH 2NXYB 1JCKA 4OFIA 4PB9L 5B21A 2P8PB 5JZ7C 3QNZA 1QOKA 3SDAD 3KJ6H 2F74B 3KPSE 1XF4B 2EIZA 2VIRA 1C08B 4LSVL 4WTZG 4O58L 4DN3H 3QXTA 2HTKC 1K8IB 4M4PA 5HPOA 1NLBH 4KK6D 3VA6A 1PKQA 3OKYA 3CFDB 5CJQH 4HIEA 3WLBA 5CJOH 5DVNA 3UTPD 4ZO8A 5LGKA 2JJTA 2W60A 2GKIA 5I9QB 2EDXA 3ARFD 4KPHL 5JXAL 3NIGF 3UTQB 3GSUA 5GISH 4GQ9L 3V4UH 4ZD3H 3D48R 4LHUA 3D87B 3K8MA 3RGVB 3RKDC 2NY4B 2YOCA 3LY6A 1YC7A 4F7CB 5H37G 1F3DH 1Y0LA 5DEFB 2N7BA 3F7VA 4LVOC 1T7XA 3BISA 5EOCJ 2YPVH 3ARDB 5IB1B 5LXGH 2P8LB 2IQ9L 4X9IA 4NT6A 5JMOC 3QJHB 1U6AH 3SDAC 5HGBB 2OR8A 4YXKH 3S6CA 4OQTA 1UH3A 3BX7C 3M1BA 3MRGB 3OGCA 5F9JA 1A1MA 4YR6A 1UGNA 4ELMA 1NKRA 3DUHA 4YDVA 4M3KB 3MRLA 4POUB 3G08B 5HHPA 5A43C 2DI7A 5GRWA 1MEXL 1HI6B 2JJWA 3FKUS 15C8L 1AXIB 4Q97A 4OV5A 1MHHB 5CIPH 3SE9L 1W0WA 3TJHD 3EDJA 3NCEB 4S0SD 3UO1L 1S7TA 5C0JB 4R9HA 1JPGB 4Y4FB 5DJ6B 4E42A 5JHDD 2DMBA 1QSFD 2PKDA 2XZAL 4QHNB 2P5WE 1NANH 1G7PB 2Z4QA 3V79C 5DJZB 4M1DH 5CEYA 3LV3A 4RNRA 3QUXD 4Z7UF 4EN3C 4AG4L 2E27L 1JWSA 3B2UD 3U9UA 4UTAL 4FABH 4JVUA 1T03L 4NO2B 1U8PA 3G6AA 2ZUQC 2YZ8A 4WWKC 1JVKA 2APBA 1FZKB 4MXQA 1PG7L 2HKFL 3SPVA 4EDXA 4U1IB 1PY4A 2OQJB 1IC4L 1DLHA 1AGFA 3DVFA 4Y1AA 4Q9BA 4WRLA 3ULVL 4JDTH 4OIIL 43C9A 1BGXL 2DL9A 2NYYC 4LSVH 4NHCH 2FB4H 4PLOB 4YXLL 1AIFB 4E5XA 4JRXD 4R0LB 4OGYL 3RY6C 5IHUH 5I1DB 5D7KE 1AD9B 1WSST 4GBXC 2DN7A 3TBYB 5ENWA 2LABA 4D9RD 4K3DH 1KCSH 3TM6A 4F57L 3ILQD 1KEGH 1J1PH 1YEDB 2NY3C 5D1QC 1P4LB 3P3YA 4HWNA 2F53B 4OF0A 4ERSL 1KN4H 1NEZA 5F7EL 4OLXH 2H41A 4V1DA 4MMZC 5JW4R 3GM0A 4OIAA 1HWHB 4TUOA 2PR4H 4IIQA 4KMTL 4RISH 4H26A 3UEZA 3HS0A 5JHLL 4HLJA 2VJXA 5I66A 3NIDF 4P3CL 2JK5B 3QUXC 1G7QA 1XGQB 5E0QA 3QWOA 1OTSD 4EN3D 5J11C 2G9HA 4ZAKB 2YPLD 3DGGA 5DC4B 4KAQH 5IW1A 5MP6H 2W9EL 3KNBA 2C4FU 4X6DA 4P3DB 4OD2A 5F6HJ 1Q1JL 3PIQA 3O4LD 1ZHLB 3VE0A 3ZSSA 1LE9B 5GSRA 4UDUB 1MHPL 3L3HB 4OZHE 1UCBH 1N5AA 2BVQB 4TVPL 5F6IB 3MRIA 4KI5D 3X3FL 2VDKH 4LPUA 5CZKA 3IKCB 3P11L 2LV4A 1TXKA 3UDWC 2XTJD 4URTB 2BVUA 4FQXA 3TIDB 5J06A 3GIZH 4LSRL 4CVUA 4QOKE 3LQAH 4L8DA 4NZUH 4XI5C 3I6LD 4Z7UA 4H8WL 4JFFA 4BKLB 3DLQR 5D1QD 3KDMB 4HAFA 2ID5A 1F2XK 2DIJA 3A6OA 1WBYA 3C5ZD 3AREB 2AK4E 3FQTB 1ZT1B 1CGSL 1KLGB 1QHPA 5DC9B 1N59B 5EOCH 3R1GH 3QXAB 4XP5L 1F4YH 2GJ6E 4TTDD 2RCSL 3N1GC 2IJ0C 3VD3A 3ULVF 3ZMRA 3P4MA 1YMME 2YMXL 1ODAA 1KG0B 2X4OB 5HYSA 2A38A 1MSPA 4PBWD 5EH1A 1JZ2A 3TVMA 1VENA 2WK2A 1LD9A 1OT2A 1GGIH 1FV1B 1I7RB 4NGHL 5A40E 1MJ7L 3GMNB 3RVXD 4Q6IC 4YXLH 1QRNB 1U93A 5DT1L 3N1MC 4KHXH 5B3JE 2XKSA 3FO2B 4FOMA 3HZMB 5TH2A 2ZCKL 3D2UD 1MWAB 3O2VL 2FJGA 1XF2B 4S1RL 3QG7L 1YY9C 2YWYA 3VRJB 1JF1B 3LEXA 5ILTL 2Z8WC 3ZTNH 2NY6C 2FECL 5HYIA 3QDHA 1FFOB 4K7PY 4IJ3C 2EEDA 3RVVC 1CF8L 1YN6A 1OTUC 4OLXL 4X6DE 1EVUA 1NBVL 5I1LB 4UT6H 1ZGLB 5CGTA 3RPKA 3WIIH 4H5SA 3RRQA 5IT2H 1G7HB 3FB5B 3EW3B 5CBAA 1UYWL 1D5BB 3HAEG 1HHHA 3S34L 3H9SE 2IGFH 3QEQE 4WHYG 1T80A 2AGJL 1JNLH 4LLDB 2X4RA 4LSSL 1HHJB 4LCUA 4UILL 5GZOC 3HE6A 4JQVA 2A83A 5IW6A 3GSVA 1RUQH 5L88L 3BH8A 2ZUTA 4BA8A 3STZA 5ACMA 1G0DA 4NJ9H 1RUMH 1LO5A 2XI9A 5TH2B 3DUUB 4ZYKB 4LLYB 3THMH 1KCRH 1QFHA 3VG0L 4YHZL 4XP6H 1WZMA 2Q8BL 1IKFL 1OSZB 4OCYH 5TGBA 2G2RB 4ZFFA 3C6LC 5CFHA 1IEAA 1JPFB 1IGYA 2NY6B 4CGTA 3EBAA 4PG2A 4WDIB 1MVUA 2R2BA 3HG1A 3ZYOA 5JTWA 1SYSA 4PJ9B 2DLGA 5F7FA 4JY6B 3UBXG 4MZ3A 5DVOA 2HP4A 4JZJB 2C5DC 4BSWB 5KSUB 2A74B 3RWGB 5I2IA 3W81A 3DWTA 4UV4L 5IFAH 4LSTL 2AV7A 3GSOA 4XBGA 1QFPA 1RZ8B 1MJUH 3MXVH 3F8UB 1X5KA 4BZ1L 3OAUL 3B2VL 3QCVL 1EK3A 3LV3B 4POZD 2CLZA 1JWSB 5JXAH 4C83A 4K9EL 1J1XH 4HCRH 1ITBB 4QRUA 1TZIA 2YUXA 1JYNA 4ZD3L 4DGYH 1IAOA 3S35H 1MJ7H 1RU9H 2BVTA 5CWSB 4JFXB 2BNRD 1NAKH 4KK6C 2RB8A 4ODWA 4RMSA 3Q48A 4M93B 3FMGL 4WUUE 1EXUB 4M02A 4QT5A 1UWGH 4U1GC 4PJ8A 1E28B 1I3GH 2BSRA 3QG7H 3T0XA 4OZFB 2BOBA 5ILTH 1Q8MA 4JFHD 1AHWA 3MRLB 4Z7OE 2A6IB 1U6AL 1I7TB 5BQ7A 1JYVA 3QNXA 4EDWH 1CF8H 4EUPH 3C08H 1NCWH 1CDHA 2FLRT 4ODXA 5I16A 5EFIA 1VGKA 4DKEH 4DVRL 1FYTD 3T3PF 4GOSA 4F7EA 1NLDH 4ZUUA 2QSQA 1P1ZA 4APQB 4M43H 2ESVA 3TH4T 4Y5XC 3D0VB 1FG2B 5I18H 3C2AL 2YHGA 1HH9B 5C09A 3E1F1 4PJHF 1JGDB 1MRCL 4S2SA 4G6AD 3IS0X 5C07B 3RDTA 2FR4B 4LSSH 3VFOA 3CPLA 5DHVB 3PWVA 3S4SB 4Z7NF 4P2QA 2QJDA 5HBBA 3U30C 3VFUA 4AIXA 5B39G 3FOLA 2ZOLA 4U4BA 3JVGC 3O6FC 4OKDA 3VXSE 4Q7DA 1DQDL 2Z31B 1AFVH 1NC2D 4BFGA 3SE4A 4PRIE 4Y5YC 4Y88A 43CAA 1L8JA 3NGBC 4Z7WA 1QR1A 3BIBX 2KH2B 4Z5RB 4ZOEA 5FYKH 4ZDHB 4OTXL 4E5XB 1WIUA 3IVKA 3LD8C 3TJHC 4XCFL 3C09C 4PD4K 5TQ2H 4Z7VF 1NGPH 3A6BL 4LOUC 5BJTB 4NWUL 3DROB 4ZO7A 5DXWA 4NO0D 3HMXL 1GHFL 2Z93B 3ULVH 5HGDB 4OIIH 1PZUB 3HA0A 3U7WH 2IADB 1S9WB 4BFIA 4GKNA 5CZVH 5BS0E 4QXWA 3MYZA 3OAYK 5BOZG 3EDEA 3SKOB 5FO8B 1I1AC 1B0WA 2X1PA 4L29B 3ZKQD 3UXFA 3P30L 4QXTB 1QTYT 4HQQL 2FIKA 3MRPB 4ZTPH 4OFKA 4HUWB 1EA9C 2MQCA 5JPNA 2DKSA 5KSBB 2AQ2A 2Z91A 5JW3H 3VFMA 3SDDC 1EVTC 4HWBH 3UC0H 2GUOB 1N64H 1KCUL 2A6KB 3SDXE 3V6FA 3QUZD 4KVNH 5MHSE 1XGTB 3FFCD 1JWUB 4K9EH 1T66D 5F1NB 2Y4SA 1BAFL 1D9KB 2BNQE 3G6JA 3WIHL 3ELAT 4HXAL 2FWOB 5GRXG 2DQDL 4KKLD 3U0TB 4D0BB 4X6BB 2DLHA 4YPJA 3W0WB 4S1SH 2GSIA 3I3DA 4I8DA 3WN5C 1C7TA 4X6FA 3DXAE 1HHIB 4G9FD 3ROOA 1KPRB 5BW7C 1FVDA 1KC5L 3QEGH 1A5FH 5ELIA 3S3PA 3KLSA 1GGYA 1BJMA 4EDWL 5F93C 4EN3B 5D96B 1XCTB 1W8OA 3MV7A 2R8SL 2ICEB 2V5RA 4MNHA 3UJTH 2EDHA 3FB8B 4KK9C 5D1QA 4KKBC 1MFEL 3VXSA 1YJDH 1EV2E 3PWNB 5EZIL 4G7YH 1S7UA 2ATPB 1DL7H 4HHAA 4H5SB 1HN1A 4LMQI 2OBGA 1U8HB 1WIOA 4U0QB 4FZ8H 2W0LA 4M62H 1TVBA 3L7EB 1G7MB 5SX4I 4Z7WF 1TVHA 5EU3B 4HKBA 2NW3A 2O5YL 4M48H 2GITA 1ZHBB 5D71H 2XQBH 1RURL 5IG7A 3QHTC 3CFKB 4F7TB 1U8LA 1KB9J 3MLZL 4C56E 2P1YA 4PY7B 4KKLC 5FHAH 1GCFA 3DVNA 2X4NB 2NY3B 1SY6H 2CLRB 4R3SA 3OXRB 3SO3B 2UUDK 4L3EB 3QQ9C 3P9MA 3D3VA 3V6OE 3G5VB 4JO4L 3C5ZC 5TQ2L 4ESKA 3EGSB 3LSOA 1FO0H 4H1LB 5DVKA 2PXYD 4I18A 1WC7A 4FQ2H 2PW2B 1A2YA 2J8UB 3GNML 5EU5A 1K5NA 4H25A 2JB6A 1KPVB 1LO2H 2QSCH 3U46A 1KIRA 2BOCA 1OGAB 3QFJD 1DP0A 1FQ9C 4U7SA 3L3GA 4KUZH 1IGTB 35C8L 5ALBH 3IJYA 4XB8A 1VFBB 3VMNA 1P7QA 4PGEA 3GI9L 4UIKL 3BPCA 5HYFA 2VB5A 3CUPB 2YD1A 4FTVE 2OSLB 4BQ9A 3RWDA 5JW3L 4PRPB 2WAHA 4LNRB 3WUZA 5L9DH 1S78C 4PP2A 2XA3A 3UC0L 1FZMB 1F90L 1RULL 3BJLA 4NO3B 1BZQK 2QLVB 4NDMB 4LRNH 3F62A 2EC9T 3TLRA 2CMRH 5EOTA 1MFNA 2PO6A 2NX5A 2VLKE 3MLSL 2LTQB 4ONHB 3FO9A 5GZND 3WLWC 4Y16A 4NCC1 3VXME 1W0VA 5KAQF 3WV0A 1KPUB 5IFHL 2MKWA 3RDTC 4O2CB 1I1CA 4QCIB 4QTHB 2F8XC 1A6PA 5MERA 4KHTL 1A64A 1KLUB 5FYLD 4FP8L 3BE1H 3OJ2C 1I8IA 2WBWB 4F15B 2G5RA 2H9GB 3CVHH 3NIFF 1I8LC 1W72A 4KTDL 4QY8A 1WBZA 2C3HA 3I6GB 4R7NB 3MRBA 5F3BB 4ZUSB 5CBEB 1I8LA 3KYNB 4FZEL 1CGWA 1CK0L 4IDJH 2Y06L 5IMLA 4OCYL 3E3QE 1S7RA 4ODSH 5IB4A 3VXOB 2HH0L 3JV6A 5ECJE 4JDZB 3C5SA 5I30L 1A4KA 4BFEA 4LPWA 5DJDA 1E4KC 3VFVA 1F6AB 4K3JH 3V0VA 5BMFH 4G8EB 2EXWC 2ADJA 3W11D 3ARFA 3CFEA 3O3BA 3UJJL 2R2CA 4R96A 1MCBA 5EO1B 5JIIA 1S7VB 4ODVL 4DGVH 5JOEA 3R8BB 4AYFA 5JQ6H 1A7PH 5FXCH 3AROA 2LQRA 4XBPA 2OJZL 3I3BA 4G6FD 1I7UA 4YHYB 4Z78A 3MRMB 2H1PH 4HBCH 1ZA3B 3MACL 5HHPB 2UZIH 3MRRB 2VZ3A 4JKMA 3OAZK 4P2OB 1G6RB 1B3JA 1XIWA 2PCPB 2FEEI 3Q0HA 1YUHA 4MA1B 2WBJB 1A9EA 1EX0A 5HDLA 3FMGH 2R0KH 1XIWC 1YMHA 3TCXA 1T1ZA 1ZHKA 3D39A 1YN7A 5DJZA 1YA5A 2X9YA 5K9QI 2DQUH 5CP7B 1FIEA 5FCSH 1D9KD 1MCWW 1H3WM 1WFOA 2ICWI 3G04B 2F8OA 4KKAC 4JKPH 4F2MB 3TBSA 4Y5VA 4X4XB 5AZ2H 1LO3L 4X0KA 1AY1H 3GK8L 4LCYB 4HV8B 2CMRL 7FABH 1QSFA 3HMXA 1JIBA 1S9YA 4QOKD 2WW8A 2HVJB 3QUXA 1L9MA 2HT4D 4PYGA 4F37F 4V2BA 3NFNB 2P5WB 3MLXL 4AT6B 3BPLC 4IRSB 2FCBA 3O9WA 3DMMD 4NKIH 5D1ZD 3PQYD 5DHXB 3OJVC 4F80A 4QRPE 2AXHA 5AG8A 1FNEA 1U8KA 3MLYH 4NCC2 3TCLB 4JZJC 2RFXA 1DQQA 3QISA 2UZXB 4P4RA 3OKEA 3WXWH 2VAAA 1QSZA 5I8KH 2R56L 2OTPA 4JAMB 5D2LF 2F53A 4PJCB 1MPAH 5IMKB 4PJHE 4KQ4H 4OUOA 4FQHA 3VWKB 1T83C 1RZJC 5GRUL 1SBSL 4MXWH 2BVPB 1V3JA 4U1KB 1JTOA 4O2FB 4I48B 3D39B 4GAJL 1PQZA 4P48A 5HGGS 1A1OB 1FLRH 2Z31D 2R0WH 3HMXH 4EUPA 2H2PD 1S5HB 4IRZL 4P23B 3TF7C 5DS8A 1DQML 3WUWA 2QQLH 4K3JL 5FA3B 3VXTB 3OX8A 5CZVL 4V1DD 3PGFL 3PIQB 4X0KB 1YJDC 4QXGL 1FZJA 1XR8A 1ACYL 3OKOB 1XGTA 2FBJH 5T5NG 1Q9KA 3V6OC 1A7PL 4OSUH 3MRFA 5IM7B 1S8DB 1L4IA 1AO7E 4NKMA 3BIKA 4XPHH 5SWSE 1N2RB 5I6XC 4OZIA 3VFRA 3MOAL 4LRIA 2DI8A 3DGCR 1CXLA 4NUJB 4W6XB 3FRPG 2OL3L 3Q6GL 5EZJA 3ECBA 5EU6B 1KULA 2FEEL 1K6QL 3VI4E 3CXDH 1NPUA 1Y6KR 4N5ED 1VADB 4Y5YA 3PDGA 3TV3L 3U4AA 2Q7YB 3TNNB 5KVEL 2KL6A 4MZ2A 4JRWA 1FFPA 1UB5A 4FFEX 3H9SD 5FK9A 5JDSB 1AH1A 5L0QC 4S1SL 2EDRA 4APQD 2R0KL 4HUUA 2J4WL 4RFNB 3QI9B 4D2NA 1BOGB 5HD8D 4C58B 4PLNC 2VE6B 4RA0C 1VEPA 3QEGL 3QUZC 1MWAL 3L6FA 4WEMB 3RNKB 1RZJH 4F37K 4U1JB 4U3HA 3HKFA 3G6DH 1H15B 2VLRE 2D31A 1IM9A 1FFRA 5IBLD 2EIZB 3L3JB 1A1NB 4XI5D 2OR7A 2BSTB 3PDDA 2Y72A 4NBXB 4RFEB 4DZ8A 2NR6D 1JGUH 4P2OD 1ZA6B 2YD3A 1UZ8A 3WDIA 1CD9B 3JTTB 1RUPH 3L3DB 3NACL 4X6CF 1TJIL 4J3TA 4NZRH 2YUVA 4G8GE 2H26B 3L1OH 5DFVD 2BX5A 1JBJA 5D71L 5GS0C 4M7JL 4PV9A 1PZ5B 1YMMB 3FT3A 2XA8L 3GBLA 1NMCC 25C8L 2X09A 3CZFB 5AD0A 4OJFH 1UWXH 4PRHD 1DCLA 1O0VA 2PTUA 3JWOH 4MD4A 5GS3A 4EVNA 3ARDC 1JPSH 3BKMH 2I9TB 3PWLA 3IAQA 1MCSA 2HFGL 1ZS8B 3NIDE 1KEMH 4L4VE 4MJIB 3DIFB 4U1MB 3JUYA 4KDTA 4N68A 4MXQC 3MBED 2XWTB 1Z5LB 1WV7T 4G6JH 4OZIE 4IJ3B 1QBMH 1T3FA 1BVZA 4OZIF 3IB4A 2BCKB 3EFFA 2H32B 3MJGX 2O93L 3WJJA 3JV6B 4WTXA 1PDKA 5J4MA 5JO5A 3HPJA 5EBLA 1XT5A 1OL0A 4LVNC 3UCRA 3RBGA 1Q94B 1EHNA 3KYOB 3OKDA 3F58H 3UJIL 4WUKL 3ZDXF 3QDME 3FB5A 4PJGB 1T4KA 4P2RA 1ZANL 1P5UA 3NMEA 4K3EH 4PRBB 2FBOJ 3MOAH 1VACB 3VXQA 3KR3H 1A4JB 2OL3H 5I73C 1QO3B 1MCIA 4M5YL 2P49B 4JM2F 1I9IL 5F88B 2J6EA 1B4JH 3PWPD 3LZFL 1MCNA 4LCUB 4WU5B 1ZA3A 3OV6A 2WNGA 1JPFA 4FQPA 4ZXBA 3BWUC 1JHKL 1QFWI 5DK0A 3VCLA 4PJFF 3QO0B 2VDPH 3RL1B 2HFFA 1RZ7H 2AABH 2XPGB 3WMSA 4YO0B 1KJMB 2AP2A 1WIPA 5D2LA 2VC2H 4XNUL 5C0RH 3VXRA 3F5WA 5KANG 1F11B 2OR9L 1X44A 2W59A 4ZFOB 3OG4B 5KVDL 1ZHKB 1UC6A 1J8HA 4P46B 4P5MA 4PRID 5GZNC 5DSCA 3TH3T 3X11A 1A4KB 3VFPA 4UDTB 1HKFA 1KNOA 1QPXA 3AVEA 5FGRA 5BCAA 3GUTB 4X4ME 3CX2A 2PYEA 3IFLH 4Y89A 3RKDD 2Z35A 2EC9U 3O4LA 3PE9A 5MENA 1EBAA 4AL8H 4YHPB 4BSWA 4B7IA 2NTFB 1RJLA 4LCYA 3K7UA 3GJEB 5IKCB 5ADOH 5C71A 2Q8AH 1NDGA 2YD6A 4NC0B 2V7NA 4JPKL 1RK0B 1U8IB 4LGRB 3ZZ1A 4P4KB 1MJJA 3H42H 3U1SH 4HFUL 2F19H 1JGVH 4LLWA 5LAXB 4ONFL 3NPSB 1A6VH 1KJ2B 1PYWB 4PV8B 5D5MB 2W0PA 1GYAA 2H1PL 5GS0H 4HBCL 4JAMA 3RQ3A 3QO1A 1KEML 1EAPA 4JRYE 4WUUB 3QCUL 1A3RH 3QSKB 4NFDA 2BNQD 3VXRB 1QD0A 5HHVH 1TNNA 4XP4L 3BP6B 4G6JL 1U3JA 4Q2ZB 5BZWA 2CDGB 3DECA 1MCPH 4JG0L 2FWOA 1BPVA 5H2BA 4FFVC 2HT2D 1B0GA 3K2MC 2BFVH 2P4AB 4PRDB 3T04D 4JY4B 4LP5A 4XXCC 1NGZB 4UINH 3F58L 4JM2A 4DCQB 4OLZH 3KPLB 4WUKH 4G5ZH 1QBAA 1MFCL 4QHMA 1SJEB 4TNWF 4YGVA 3BW9B 4Q74A 3T3ME 5BZDB 1QQDA 3EYUH 1TTUA 2WLZA 1AGCB 2N56A 4N0UA 1DUZB 2CKBB 2ZSWA 2HWZH 2ZUYA 1OB1A 3DXAA 1NC4A 3NPZB 3U9PH 3RTQA 2WP3T 2MHAB 3K3QA 1UQSB 2BSED 5K9KA 3CPLB 5DHVA 2MPAH 3LPFA 4NUJA 3L9RB 2A9MH 4DW2L 1R3IL 1NJ9A 3QIUA 4P3DA 3VDCA 1LK2A 4NKIL 4BSVB 5L6YL 2HKHH 4E0RB 4JO3H 3X14A 3RWJB 1UM4H 4L9LB 3P9LB 4WWKA 4E41D 3BGFC 5C0AB 1NUFA 2KKQA 2FL5B 5DDHA 1HEZA 1QR1B 2F53D 4GSDH 4R7DA 5GS2D 2FD6L 5I1CL 1YEGH 1RHFA 3QPXL 1IFHH 1URLA 3EYVB 3MV9A 1I8KA 4Z7QE 2A6KA 3V6FB 1T1WA 4DN3L 2XOTA 5GRUH 3G5XA 4J12A 2NX5E 3U0PA 4XCEB 3TYFA 3LN5A 3UYRL 4X5WA 3BGMA 2OZ4H 1NQBA 2B4CL 1C8PA 3SCMD 1EH9A 3S36H 2CSPA 5CJQL 3PXJA 4IRZH 5AEAA 3BD4A 3GI8L 4GMSH 3LSOB 1F02I 2CKBA 2ZSWB 4X6CA 1KELH 4JANA 1Q9WB 1A2YB 3U48A 4NHUE 4YX2H 3GBNL 1F3JB 1HYSC 3SDXB 1AC0A 4GAGH 4GUPB 3U1SL 2V6HA 4RWHA 4QRRB 3L3OB 5T1KA 4ZMAT 2CRIA 4ONFH 5FEBA 1FL3B 5EPMB 3MR9B 5EIIA 3MNWA 2WWMD 5HI5D 3CDYA 4KZEL 5E8DL 4PJGF 2EYRB 1I1FB 1HQRA 3QI9A 3D18B 5JQHC 3ZO0A 5INDB 3JTCA 4PJ5A 5IR1B 1Q38A 2VLME 3QAZC 2VLKD 3ARTA 3U82B 1HHKA 5IBUB 2V5YA 5E99L 4OM0H 5F8QC 3LS5L 1KB5L 1TVBB 4KRPB 5D7JB 2FNBA 1R3JB 4ONHA 1FAIH 4UINL 1IGJA 5I19L 1U8NA 4OLUH 5C0BA 4POYA 3NTCL 4DZ8B 4JZNA 1AQKL 4PJFB 2WLYA 1EAJA 4Z6AT 1DLFL 4R3SB 4NQXB 4HWZB 4HMDA 3OB0K 1DUYA 4LEOB 5GSVA 2YD9A 3VXMA 4WNQB 4HUNB 4L8CB 1DVFB 3DRTA 5EA0H 3VA2C 4AH2A 5EU3A 5JOPE 3VXQB 1ORSA 4PLJD 3HR6A 2E27H 5DGRA 2XN9A 4UU9B 5T1KB 3ZL4L 4MB3A 5C0BE 1TJIH 1LE5A 2CRYA 3GBMH 3U46B 4N0YL 1K3IA 1T0MB 3Q1SL 2WWMC 5HI5C 4RBPH 4YHOH 1H3PL 2VLJA 5KZCB 1EERB 3HNSL 3BI9X 2DM3A 1P6AB 3O6KL 4X7EC 4PG9A 2ADJB 3QQ9D 3ARFB 4MYWB 1FC1A 5H8DA 2Q6WB 3JWOL 4OGYH 3MLWH 4Q6IA 4O51A 5IHUL 3BDBA 1QSFE 1IRAY 2GTWA 5ITBH 3NZ8B 2GK0B 5E1HB 1MREL 1I9JH 1OQOA 2VLJE 5EOTB 4ZAKD 5J9PA 1TLKA 3EYFA 3CCHB 5GGTL 1U42A 1DBBL 1KYOK 5M94B 2OP4L 4HGWB 4P4KD 5F8RC 5GGUB 2ORBH 2PXYB 4FTVB 4HGMA 1JPST 3IDGB 5LQBH 3GBNH 4LNRA 3B5GA 2EXYC 1T6WA 5K9QG 2EYTA 1CI5A 4CN1A 4G9FB 1KTLA 3MC0A 4JFDD 5CEZH 3QIBD 4XP1H 2E3VA 1VFUA 1M7DB 3J7HA 3EO1A 2IEPA 2X4UA 3U79A 2A77L 1MJJB 2GJJA 5JR1L 1AGBA 3BP4B 2PF6A 2DWEA 3QFJA 1CDGA 5D7IF 5LGHH 3ORJA 2CKBH 2IMNA 1YQ2A 3QZWA 5C2BH 2HFFB 4WI7A 2IPTL 2A9NL 3IFPB 1GVIA 3CSYA 4YNYA 2R0ZL 1OARH 1FPTH 4P2QE 3QYCA 4TTGA 2V9RA 2AJ3B 3WO4B 1JHKH 1S7QB 4MAYC 4L3CA 2HVJA 3QUXB 3L3IA 2H3NA 4OZFA 4YLQT 3I02A 2R2HB 4QRPD 4ZDHA 5SWZE 5KSAC 32C2B 3L5JA 1AO7A 3KPRA 1B0GB 1QR4A 3EYOB 3OR7A 4D9LL 5KTEL 1ND0B 2I5YL 3LMJL 4WU7A 3VWJA 2AJYL 3T08A 2OM5A 1MLCB 4YE4L 1EMTL 1HINH 2CGRH 4AIZA 3WFDH 5C0CA 5FDWA 4UDUA 3LN9A 2LU3A 5DJDB 5DQ9A 1HH9A 5C09B 3PABA 2FIKB 3OAZH 1JGDA 4I3RH 4RWYH 3DO7A 2HLAB 5BS0A 4AIOA 3MNVB 2WBJA 2XTJE 1A9EB 3MLUH 1GC1L 3MLRH 3FRUB 4U1HB 4NO2A 2RBLA 5I76A 5FGSA 2NY6D 2UWEE 1XCQA 4G43A 4K8RD 4UUJB 3GKZA 1D9KA 1GIGH 5JLZB 4NRXA 1B2WL 1JGEA 4Z7UB 4YDKL 5C0CE 3T65B 5HHME 2AK4D 2XWJA 1EEZA 1S7QA 5DT1H 5F7LB 4CU7A 3MUZ1 4ZXBD 4BM7A 4BZ2L 3T0ED 3DYOA 2WUBL 2IPUK 1GZPA 3IFOB 4OZFH 2NZ9C 1I9JL 1ZXQA 5KSBF 4QHUB 1AD9A 3BPNB 5FM5M 1CE1H 3TBYA 3QXAA 4NRZB 3KXFA 1AHWC 1RJZB 3ECBB 2AEWA 4G6AC 4CNIA 1S9WA 5CGYC 4BFIB 4XH2A 4EUPG 4DEPC 1X7QB 4X80H 4JM2D 5E9DB 1FNGA 1FNFA 1J8HD 4PRIA 2CRMA 4W68A 4ELKB 1A22B 5E2VH 4YBLB 2B20A 3DOSA 2CXGA 1DJSA 1KN2H 3GSNL 1UT9A 3VRLE 4U0RB 4GRLC 5I66B 1YNTA 5A16A 4PUBH 5EBMA 1PJ9A 3AAZB 3FQRB 2E7BA 2XQYG 5FOBB 5GRVK 4V2CB 4G8FB 5KS9B 2E7HA 3E6FB 3CFKA 2X44D 4XMPL 3BAEL 4XAWH 3K1DA 4N1HB 2ITCA 3RNQB 2X42A 3WFEH 3L5HA 3IDYC 3UTSD 1BD2B 2X1WL 1JZ3A 1K8DA 3QQ4A 5TE6L 4G8GD 3BEVA 4PJCA 1OLZA 4DTGL 4JHZA 2CK2A 2ED8A 4PJAE 4EQ2A 3TJHA 5ID0A 5ESQB 4G7VH 2ICWA 4K94H 4NYLA 2ZUQB 2A6JB 3D9AH 2Y6SD 1EHLL 4PRHE 5DJ8A 4K7PH 3H3PH 3NPSC 2Q87A 3HC3H 3BQUB 4NPYA 4UNTA 1E6OL 1QBLH 1ZVSA 5EN2B 4P9HH 3QDJB 3ULUF 2WINB 4RFOL 3FO1B 5INCA 5KVFL 1NMAH 3BDXA 4DVBA 3I85A 4XPFH 3STBA 2KQMA 2EXWD 1VFBA 2HVKA 1I75A 1U8HA 3RVTD 2YD2A 3AM8A 5C3LD 3GI8H 3MXVL 2QADC 4C4KT 4ENED 1KELL 3P4NA 5D2LE 1C5CL 4BQCA 3AM8C 2EZ0C 1MCKA 3QUML 1I7RA 5SX5K 4PRNB 3P4MB 1J05B 5DJYB 1CWVA 4WFGE 4R97B 4OGXL 3FT4B 2AJUL 3D18A 4NO0B 2W60B 2XZCH 4JFEE 4TYUA 3U7YL 6CGTA 4U7KA 1Q94A 1R5VB 4Y16B 1D3CA 1I4FB 1PKOA 3LEXB 1W0VB 1R24B 1HHKB 4XMKL 4HC1H 5BW7A 5DTFA 1CGVA 2F5AH 2EO9A 4ZNCD 1IKNC 1T22A 5C6TH 5J7CC 5JIPA 1PEWA 4HMCA 1ZMYA 1CG9B 3PNWA 1WZLA 5D6DC 1SBBA 2VISA 4N1CA 4UNUA 5IJVB 4DAGH 3CU7A 5DA4A 1HYRC 1BQUA 4YWGH 2ZCHH 2DBLL 4PGEB 3NVQA 1VHPA 1X5LA 4IRSD 1AJ7H 1T7YA 1T5WA 4Y2DB 3FAWA 2P5EB 1KJVA 4NBYB 3TH2T 1P7HL 4P5TC 2ZJSH 3V6BR 3VWJC 4OQ1A 4JN2B 1TQBC 2F5BH 1EGJL 3IU3A 2HT4C 3GMOA 3MRGA 2HJFB 3QRGL 3E3QA 4WFHE 1T1YB 1JWMB 4NQEE 4YAQB 1NCBH 3QIWA 4F9PA 1UM6L 3K1KC 1CD1B 1FRGH 3GSNB 1I4FA 3GIVA 5DMJB 3HZVA 5D1ZA 2DJUA 1R24A 4GKOA 4N0YH 3NBNA 4FFWD 2W1NA 4HKXB 2H2SC 4OTXH 4QF1A 4GT7A 2PTTA 3OKDB 1EUTA 3MRRA 2PYEE 2BDNL 5DMKA 5IJKA 1SYSB 4L4VB 3MV8E 1J88A 3RWFA 2CLVB 1EHLH 3DSNA 4QXUL 4G6MH 3OKKB 1UH4A 3LD8B 2BRQA 4GG6A 3VXSD 3EYOA 4OCRH 3KPNA 5T1DH 1YEKL 3CXHJ 1MCHA 3LQZB 3PHOA 5GGRA 1W72H 4HJ0C 3NH7H 3O6LH 3C5JB 1F4XH 4FS0A 5FV2A 2VNCA 4O2EA 3C60A 1DBBH 5F89B 1ED3A 5I1DA 3DBXB 4LPCA 4DKFH 2HT3C 3DHMA 3QIBA 1OHQA 4MQXC 4UT9L 1J12A 5AWNL 3V52H 3LQAC 4HXAH 3V8OA 1FGNH 2DWEB 3FN9A 3WNPA 5HJ3B 5CHNB 4PJ8B 1PSKH 3K81A 4UT7L 3NA9L 1BWWA 1HILB 5B38G 1XFPA 1CR9H 4MVBC 3T1FA 2WIMA 5JR1H 4XPGH 4Z18A 5MEND 1BBDL 1E27B 1HOCB 1CFVH 5I8EA 4Z0XA 2CKBL 3SDDB 3HRZB 3ZTJG 1B4RA 2AEQL 3AY4A 4NWTH 1Y6NR 1NLBL 1BMGA 3RVXC 3VW3H 1TMCA 4RGNE 3MJ9H 5E56A 2GUOA 5DR5L 1OPGL 3KLHD 3VWKA 3TBVA 1CE6A 2EDWA 1YYLH 4PJBF 1H3XA 3D85B 2DYPB 2DJSA 1R0AL 4LSDA 5E8OB 3HZYB 4R4FL 1JNHB 2ESVB 3DETD 1J8KA 2NY3D 5H94A 4NOFA 1LDSA 4ELKA 5F3HA 3KWWA 4HDIA 1TQCC 2R1YA 3WNNA 4BSJA 2ADFH 5FGBC 3UO1H 1EGJH 4ODHH 3T77A 5J13B 2XQBL 1EMTH 3MRJA 1RZFH 4NN5B 1A3LL 2R29L 2ARJQ 4IRJC 5FHAL 3HFMH 4N8CH 3WNMA 1OGTB 1MIEL 3LN5B 2UVFA 3RY5A 4PJXA 4CDHA 4ZODA 5HYEA 1GGCL 4JFFE 1PG7H 2VQ1A 3MOQA 1EEZB 1RVFL 4U6VL 2AXJA 4YIQA 2IFFH 3N85L 4RAVA 3K2UH 3S5LG 3LQMA 1GOFA 1B2WH 1QLFA 3E0GA 1V05A 4S10A 4PREB 1LWRA 1MAKA 1U3HB 2CDEB 3D25B 3WDHA 3KNBB 4OCRL 2VR9A 3KXFD 2P8MA 1YPZE 4NFCA 4XCNA 1NFKA 2JB5H 3TYGL 1A1OA 1F4XL 3F7RA 1N4XL 3U9UB 1MI5A 3L5XL 1KCSL 5J6GB 2JK5A 3GMNA 5B8CA 1CE1L 3QH3B 1C1EH 2DICA 5A2IH 1J18A 3TNMA 5FOJA 5FA3A 3VXTA 5C0DA 1IJ9A 1MRDL 1K9TA 2XTLA 4HLZH 4BYHA 3CC5A 3RGVD 3ABZA 4HIXH 3HI1A 4OFVA 2E6JA 1CL7L 4KUCD 3WFHA 3ZHKA 1JI2A 5TPWL 1G9NL 3PP3H 1A7QL 4UT7H 4WJ5B 5BVJB 4U7MA 1SJHB 3REWA 2HFTA 3W39A 1G7HA 3T3PE 4A6YA 1T1WB 5SV3A 3MLTB 1CFVL 4OI7A 3GO1L 4JVPA 3FQXB 3KYAA 5J1SC 4FTVD 4O5LL 2DDQL 3MA7B 4NC2B 1PZ5A 3RWIA 1A6AB 4WNQA 4EOWL 4V1DB 3GHBH 4LLDA 4HCRA 4GXVH 3MJ9L 3VRIA 1WZ1L 3P73B 3P77A 3QEUB 4LSUL 5TE6H 3UTPE 4P5KA 5E94A 1INEL 5CSZA 5EOQH 3ARGC 2CPCA 2Y7QB 5D5MF 1F00I 5CCKL 3G5XB 3MBXL 3VXMD 3U0PB 4QGYA 4JDVB 5I30H 4TQEL 1TCRB 2FDBP 3BYTA 5FO7B 2ADFL 6FABL 2XN9E 3PWPA 3GMLA 1H8NA 4YK4B 4TUKL 4FFYL 5GSRB 1A21A 3VMOA 5BMFL 4IHOA 4KAQL 5FYKD 4LHUG 3SOBL 4XMLH 4ZFFB 5EOCL 3NABL 3DUUA 4ZYKA 3CDGA 5DEZA 3GJFB 4WW2F 4N8CL 1P9MA 4KMQA 1PKQB 3NZ8A 5GGRY 5T5FH 1MHPH 3TO2B 4LKXA 3SKJH 3IKCA 3B9EA 5AZEL 2VO5A 5M95B 1YY8B 5FFLA 2YMXH 5ICYB 1G7JB 2VDKL 2A74A 3RWGA 3SGEI 2QR0B 4X9GA 1TFHA 4HLZG 2Y5TB 1EGJA 2VOTA 3KDMA 4Z7VE 3RL2A 2BY3A 4GRWE 4NC1C 4JFDE 5L7XL 5HDBE 3RBSA 4G3YH 3RWCB 3RWEB 4PP8C 1BHGA 1QRNE 5ALCL 4XMKH 4HT1H 4HW6A 2CLVA 4HBQA 5DO2C 5A2FA 1DN0A 5C6TL 1XR9B 3CMGA 3QEQA 2Q20A 1IC1A 3TVMD 1UJ3C 3KGRA 2LE9A 3PXHA 4MA7H 1OTSC 3VH8B 1OSPH 1DANT 2VR5A 1QP1A 4HIXL 1YEEH 2YZ1A 2SEBB 2R0LL 3MPCA 1KCVL 5DQJB 4LQ1A 2ZCHL 1PBYA 5IK3A 5AZ2L 1AY1L 3GK8H 2DTML 3C6SA 3BN9C 4MA8H 3NA4A 4KKCD 3O4LB 5DZLA 2Z35B 2UYLB 2DD8L 2HA1A 1T1YA 1MI5D 1OAYL 3H3KA 3GSWB 3RU8H 1T20A 4XP9L 2DMCA 2YXMA 2ZSVB 3AGVA 3OXSB 4Y4KC 4Q6IB 4PGZA 2IANA 5F72S 4X6DF 4RGNC 3D2UB 4M4RA 4BUHA 2IALB 3QRGH 4KHXL 4P99A 4M6AA 3EJYC 2ZCKH 3TA3B 4QF1B 2A6DB 4HIHA 4GXVL 1X6NA 5FF6B 4UAOB 4XBEH 4ZOBA 2CR6A 1U8PB 3G6AB 3QO0A 3PGDB 2YK1L 1INEH 5EOQL 5H37H 2H6PA 3MREA 3WHXA 4YFEA 1Z9SA 3JV0A 1IEBB 5DO2D 1S9YB 4QRUB 3KG5A 1CDBA 1V3LA 1CDUA 2CDFA 1A1MB 4YR6B 3OPZH 3OGCB 3JBG7 1NMBH 5F9JB 5IB4B 3SQBA 4FFYH 4WY7L 1HHJA 5HHMD 5C9KA 2CDGA 2IGFL 3OF6D 4OQTL 1CICB 3O3AA 4G6ML 1NGWB 1A7NH 3DBXA 3C6SB 4X4MA 1UM5H 3UTTA 3T0EE 3WXVH 2B2XH 3FAXA 1GPOL 5AYUH 3QRFM 4QO1A 2GT9B 4Q9QH 2JELL 5IF0A 3ZKMD 2VDRH 1A6WL 2KDGA 4G6KH 2X7LB 1A6TA 3X3GH 4BZ1H 3B3IA 1UADC 5DJ6A 1S7TB 3EYSH 3D2UA 3ZDZF 1DUZA 3BZ4A 2VTFA 4HWEH 4XH2B 1RZKC 2OMBA 3PHQB 3DHJA 5KSBA 1XF1A 1IEAB 3PL6B 1NSNH 1U3HD 4GBXD 2NNAA 4MJID 1E27A 3ARBD 3S35L 3D0VA 5TF1H 5I8CB 1QFUL 5D72L 1DBKH 1IKFH 4ZAKA 2NY1B 2FH8A 1D7FA 3BGFB 2VXSL 3ESUF 2E7CA 2FHBA 3WFZA 1P4IH 4FMKA 4U6YB 1P1ZB 2EH7H 4APQA 3L7FB 4K2UL 2EKSB 5FA4A 5GS1C 3WE6B 1NFIB 5ACZA 3IXTA 5IHZA 1BIIB 1IC5L 2KUTA 4PYHA 4U1HA 2R0LH 3H9ZA 2RGSA 4TN9A 3LEYL 1JFQH 4MA8L 3UDWA 5IESH 1ZV5A 1P84K 5D9SA 9CGTA 3D69A 3TNNA 3CC5B 3X13B 1OAYH 3PG2A 4KI5F 5MEQA 4S0UC 5E6YA 1DEEA 2XWJB 4DGYL 4NZRL 3R0MA 5BXFB 4KY1L 3VXUE 1CTNA 3SCMA 1WBYB 4H26B 4FN0A 2HN7A 5IB3A 1MJ8L 4OCLC 1RSFA 3CDFA 3EFDH 5ERWA 3ARUA 5EORH 3HCVA 1WVZA 2UWEB 3GJFH 5D7LE 2IAMD 1D6VL 3UP1A 4Y4HA 4UZGA 1MH5A 1KJ2H 3C6LD 1JPSL 4ZUUB 5LCVH 3SE8L 4PJEF 1DFBL 5E9DA 1U8LB 5FYKL 2UVEA 4Y8DC 1FNGB 1SY6A 1NCWL 1EHAA 4FXLA 2O61B 3MRPA 4HAGA 5GIRB 1N26A 3KPTA 1FE8L 4IMKC 4PJAF 5EBWA 4IRJD 4QHUA 4WY7H 3TO4C 4Z7OF 2X4TA 4JFED 1T0NA 4PJDE 1WEJH 1JFMA 3W9EB 1BVKA 3TIEA 4NKOA 3G6JE 4XRCB 2DQFB 1IT9L 2FJGB 5E9DE 4Q9QL 3KVQA 1J0JA 3IU4L 2BC4A 4X98B 4U1SA 3MJ9A 4MCZA 4Z5RA 2VQTA 3GGWA 1P5VA 4LAQL 4JANB 5C0FA 1ZT1A 1CGYA 4NQXA 5EWIH 4JKLA 4H0HB 4L4VD 1BAFH 2Y1VA 1IGIH 1YEFH 2FGZA 2NY7L 3CUPA 5EZJB 2B0SL 1FJ1B 2GAZA 1QG3A 3BHBA 1D5BA 2BNQB 3UYOD 2AJXL 4EIGB 3V5HB 3KPMA 3T0WA 2BVYA 3G5YB 5DEGB 4MX7A 4R8WH 1ZWIB 5I0DA 3T8XA 3MV11 4NP4H 1CICD 4CMMA 1E4KA 1OTUD 2BSSB 4GLRH 1X5YA 2AABL 4K71C 3SJVE 3QDMD 3FFCA 8FABA 4DOHB 1P4BH 4FXKA 4MAYD 4JREC 2B4CC 4NQED 2Y7QA 2BSTA 4OUUB 5TQ0L 3MLVL 2PTVA 4BH8A 2R8SH 4Z76A 3TESA 1LNUB 5E24E 4HIJA 2GHWB 1TVHB 3WFBH 4TRPL 4PPTA 1F3RB 4RA3A 1U8NB 1MFEH 3GIVB 5FYJD 4X5LA 2VERN 3UBXB 3CVIL 3ARBB 3L95B 3QDJE 5DRZB 5GISL 5EU7E 3FONA 3MCKA 2PYED 4NNYA 5E03A 4C59B 2IPKB 2FYYA 3KS0H 4M7KH 1GZQB 3IETA 5IB5B 1O7VA 2BZDA 3MLZH 2XYCA 2AQ3A 5D2LB 4M00A 1G9MC 4QKXB 5LXGL 3OBAA 4JFHE 1UACH 2Q3AA 1LE5B 3O11B 1CFQB 3PHOB 3LQZA 1F42A 3PWLB 4WW1A 3RVWC 5AZEH 5D1ZC 4EBQL 3UZEA 2GSGB 1XAUA 3T4YB 2FSEA 2DF3A 4XPAH 4CW1B 3FT2B 4ZXBC 5HHVL 3ARYA 1WF5A 2DRUA 2RHEA 4XP4H 4LASL 4CVXA 2H6PB 1N6QL 5IQ7H 5DWUL 1NGXB 4G7YL 1EZVX 2VL4A 5IWLC 3HI6L 4G9DA 4XCYB 2G60H 2Q76A 1UXSB 1WICA 5JIKA 4M62L 3GI9H 4UIKH 4YHML 1X5IA 4LVHC 1NUDA 4RNRB 4L4JA 1C5DB 4Y8AA 3QXUA 4K23H 3QNXB 1H3TA 4KJYB 4RMUA 3GSUB 4LAQH 1MVUB 2R2BB 4WI6A 2PXYA 4Z0XB 5C08D 1ZLVH 3C6LB 4JJHA 4QCIA 4XVSL 3V7AG 5D8JH 2R23A 3CMOL 1YDPA 3MJ8B 1FZOA 1PX3A 4OLWH 3E2HC 4UB0L 2DD8H 1MCOH 3R4DA 4FHBD 1FNSH 4GQPH 2VLKB 3L3GB 1IQWL 4M5ZH 3N50A 2E9WA 1LO2L 2QSCL 3M1BB 2WM0A 4G43B 1ADQH 2O26U 5MEPB 3T1WA 1S7VA 4YO0A 5I1CH 1PD6A 1FBIL 1YEGL 3FZUC 3LKOA 5E6IB 4K3DL 5A3ID 4XBEL 2AK1H 5HGAB 4AEFA 4AEHH 4ELMF 4P2CG 4JFFD 3RWFB 2IWGA 2VRAA 2J7LA 1OP3K 3VFGH 2VUYA 2C3VA 3U7AA 1HIMH 1NCUA 2E9IA 3SKMB 4GMSL 2E6QA 4M6MH 5I75C 1BECA 1RK0A 5C7XH 1QSVA 1SYVA 1VGKB 4ORGA 4JGUA 4MNGA 5IKCA 4L9LA 2F53E 5GGTA 3C8KA 4OI8A 2JJUA 1Q72H 5IHBA 1T0PB 3KLAA 1LDPL 3SBWC 2EZ0D 4LOUD 1A6WH 4G6KL 2AAVA 3GSXA 2Z8VC 2R4RH 4YHYC 4BH7B 4KZEH 5K9OB 1K3ZA 1R5IB 1X4XA 4NM4H 3T3MF 1NSNL 1P4LA 4LASH 5DMIH 3O2DL 4IDJL 1FIGL 1TCMA 2Y06H 3V0AC 4KUCF 5ENWB 2N1KA 1J1OH 2AI0L 1MAJA 3SY0A 1GGBL 2BXYA 1P4IL 1FAIL 2YC1B 1NBYB 3NGBB 1AKJB 5E5MA 4OLUL 5F7DA 1DSFH 3LIZH 1GAFH 1IGFL 2JIXD 2DQUL 3MFGB 3HLAA 2BVEA 4WI3A 4NJAH 3S5LA 4L8SC 4C56D 5EO0B 2NCMA 4ODVH 5E8OA 5J1AA 4DGVL 2FATH 3MJ7A 5ID0B 2ESVE 1VGEL 1IAII 3L6FB 3WLWD 4XVJH 5LGJA 1JFQL 3QUYA 2LVCA 1NJ9B 2VLMD 3MFFB 2Z8SA 5GGSB 1A6UL 3H8NA 4W6WB 2ARJA 4MXVF 1LMKA 3IFNH 2XKUA 2BY2A 5CILL 2UZYB 1QA9A 1IM3B 1ZLUK 2XN9D 1EFXD 3KPQB 4NOBA 3VFSB 4PJEB 5D2NB 2CQVA 3L3JA 5SWSA 4U1NB 4WENB 4PJXB 3S37X 1S7SA 2ZUVA 3BXNB 3U4BL 3GMQA 1PAMA 5EORL 4PJBE 1MFBL 4HKJB 4N0CC 1MPAL 2C1PB 4ZNEA 4XC1L 5HGHB 4KJPC 2JJSC 5GS1A 3EYQC 5DA0B 1I8KB 3DMMA 1U8MA 2J6EL 3I6KA 5EC1B 1CCZA 1MREH 4X7FC 3MCLH 1YY8A 3WIIL 5ICYA 5IT2L 1QSED 4KGJA 1LO3H 2Q7YA 5E2WH 2CR3A 1DQMH 5TFSL 1JZ4A 2EDJA 2QQLL 4L4TB 5C7XL 4G80A 1QBBA 1TTGA 3QWRD 5EC2A 1MIML 3EOAB 3PP4H 5JUEH 2AGJH 4U1MA 1L7IL 5GGVL 1PFCA 4ISVB 4JFPA 5GGSA 5A1AA 3BFOA 4FQQB 3QP3A 4KRMB 3MZGB 5FYLE 3MLYL 2I24N 2EDDA 1FJ1A 1XF3B 3HZMA 2NXYD 4J7RA 3H0TB 5FHBL 4A6YL 3SKUD 1YEFL 2NY7H 2EYRA 2D31B 2EDLA 4GAJH 1R5WA 4S1DC 5KVGH 4Q9RL 1A7OL 2R4SL 3RWIB 2X4PA 3GSNA 3EO0A 1ZGLP 4P2RE 1ROWA 4M7ZC 5HDBF 1NBZA 5IFJB 3RGVA 4GRMA 3JWDH 4K55A 3WHE1 3ULSB 3DX6A 4YPGA 3JXAA 5I1HL 3C5ZB 3I2CH 4PRAB 5CUSL 3K8LA 1AC6A 4HK3N 1VGEH 2X4UB 4UV4H 4OSUL 5JHDE 2BP3A 3OKKA 5KSAB 1L7TL 4GG6B 2XN9B 2P5WD 5EU6D 3KS0J 3CZFA 5AD0B 4D0DA 4ODTL 4ZUVA 4MNQE 4WW2B 1RU9L 5HPMA 3RNKA 2J5LC 4YFLF 2ENYA 2A1WH 4KWUA 3CFEB 4LKCB 3T4AB 1D5IH 5BO1L 1CD1A 1I7TA 5BQ7B 1BBJB 2CRZA 1RZIB 1MFBH 5EU4B 4OJFL 3SBWA 4YHLH 1FFQA 1KPUA 4X9BA 3S9DB 4QTHA 4LU5L 1ZLWH 4C54A 3B9KB 3EFFB 3ULUC 2Q6WA 1P53A 1KB9K 5FO9A 5I1IH 1HH6A 3GZKA 1MFDH 1MLCA 4GKZB 1PW3A 1FH5H 4D9RE 3MCLL 4X4ZA 5E6IA 1AP2A 1UCTA 2LU7A 1FG2A 4DVRH 2P5ED 3RI5F 4PJIB 3HRZA 2V7NB 1KBGL 3V4VH 4MJIE 4MAYA 5IVNA 5I18L 3BUYA 4GAFB 1FL6B 2X4SA 5D7SL 1I85C 4M8VA 3KYNA 2QV2A 1T1XA 1NC2A 4FXGB 2FX7L 1T04B 3B5HA 4P49A 4RMRA 1B9ZA 3WNOA 1TQCB 4ORGB 3ARRA 1N6UA 3MJ8A 3KHOA 3QR2A 1NGYB 4TVSa 5HGBA 3I75B 5J13C 4KTEH 3BN9D 3B9AA 5ETUA 5HI4C 1WCBB 25C8H 3O4LE 3BPNC 4MLSA 5IHZB 1LEIB 4R96B 1OTTD 3P2TA 4XX1E 3UPAA 3CMOH 4CJ0A 1B4JL 1MELA 4MHHG 3FCTA 1QQDB 1NGZA 4LP4A 5IB2A 4WV1B 4PJ7B 4H20H 3TA3C 4V3EB 2APVA 4MGXA 1J8HE 1MCFA 4OCXH 4QTIL 3O0RH 5IEKB 1IQWH 1D9KC 5IBLC 4UAOC 5SV4A 5T3ZH 3O9WC 2GFBB 5L8LB 4HJ0D 3VXUD 4JHWH 4EI5D 1CFTB 1QBML 3U83A 1U8IA 1YUHB 2D0HA 2VC2L 1BQHA 3AS3A 3MX0A 4P4RB 5CS7A 3FQNA 4N0CA 5IGXL 2C3VB 3KPRB 3S96B 3GJEA 4OCSL 5E5MB 3H3PL 1U3HA 3HC3L 4FXGA 1L7TH 1E6JH 3PABB 4HWBL 1NMAL 5JW5B 3HR5A 1FC2D 4HUVB 1QPPA 3HAEB 3P4OB 4M5YH 4HF5H 1UB6A 2I27N 4OBSA 1F45A 3TBSB 5GIRA 4HPOL 3BKCL 1JNNL 3T77B 1IAKB 3EOBA 1IAMA 4ODWB 2EC8A 1OTTC 3BEVB 2A1WL 3DROA 3ARDD 1KTKE 2D7QA 3MRDB 4LVOB 3MYJB 3T0AA 4N9OB 4OGXH 5J0BA 2P5WA 3KAAA 4JM2B 5E9DD 1LILA 4DCQA 1YYML 3PDOB 3U7YH 4L5FL 2DQHH 4YDVB 3W82A 1KLGA 5H2BB 1P7KA 5ISZA 1B90A 4MJ5A 3H7BA 1TNMA 2RJMA 2OI9C 3W0WE 1EFQA 4IRSC 1A7RL 2BNUA 1A3RL 1IL1B 1SMAA 5E4IA 2NTFA 4Y5XA 5BVPH 4UQ3B 3L3OA 4LQFH 5F7DB 5GS2H 3HE7B 3L9RA 4P9MH 1P7QD 3VU2A 3EO9H 4O2FA 4DN4H 5IVXB 4BSVA 1J0KA 3P77B 3QEUA 4ZO6A 4ZUWB 3TVMC 1MI5B 4HC1A 2O5YH 5K9KB 4G5ZL 4PY7A 4I2XE 3QEQD 1N5AB 2WWKT 4EZMA 4X6FB 3V5KA 2J3SA 4FFWC 5INDA 3OX8B 5FKPB 2FATL 1MFAL 3H42L 3RZCC 4H8WC 1LEGB 2WIIB 3C8DA 5A16B 1SVCP 3GMMB 5FECB 5TDPA 2DKUA 4H88L 5I1KH 2EXYD 5DDHB 4NZTH 3U2SA 4HIIB 1T2JA 3PDOA 1S8DA 2VDLL 1UM6H 1XZ0B 4NHUA 5DD6B 1J0ZA 1G9ML 1CVSC 4JGJA 3VG9B 4GFTB 5CILH 4OLYH 4JO3L 4FQ2L 1T0NB 4Y7MA 3GNMH 4KMLB 1YY9D 1VFOA 4NNYB 4M6OH 2NY5H 4HWZA 1VADA 5DQDL 3DX7A 4ZSOA 1OAQL 2ICEA 1FGVH 1Z3GL 2BDNH 1BQLH 2Y5TA 3KHQA 1NBZB 3QPXH 5IFJA 3WL9A 4OCSH 4HUWA 4GG8A 4CN6A 4N9GB 5C0NC 1AI1H 1HK6A 3D5OF 3LKQA 4OGAC 4F7PA 2HG5B 4X7CC 5F21B 2DIAA 3EYUL 5DFVC 1F3DJ 2YRLA 4GW1A 1TIUA 2ITDB 4LCCC 2A0LC 2D9QB 2B4CH 4XCCH 2PO6B 2X40A 4AENB 4N0FA 1G7LB 4PJ8D 1C7SA 3ETBF 5FYLL 3BKCH 3MNWB 5ANME 2EH8L 4DKFL 3VH8A 5T3ZE 2YWZA 1XF3A 1BEYL 4OFDA 1WWAX 2AK4A 1OCWH 4F58L 1NBQA 3ARPA 3WJJC 3RA7L 1H5BA 1Q0XH 2HJKA 1IGJB 3T0BA 3KYOA 1UZ6F 3B6SB 3ZE2E 4P5TA 2YKLL 1UZ6E 2W38A 1MQKL 3KPOA 3MBEB 2NY2B 3TFKA 4TNVK 4OFYD 4PLKC 1RZIA 1FN4B 1F4AA 2VZTA 2IANB 4FNLL 4CDGC 4GBXA 3BKYH 3EO1B 3CD4A 4OLVL 4Z7NE 2D9CA 1ORSB 3H2WA 1QFWL 3UYRH 2ARWA 1INQA 3VW3L 2QHRL 4I1NB 1B0RA 5ADPL 4UBDC 2OSLA 3IJHA 1LNUA 3TT1L 4HIJB 1MLBA 2NQCA 1UENA 2JTDA 2OL3B 3D0LA 4LMQE 4TTDC 5HVHC 3VFWB 3IDMA 1EXUA 4JEGB 1T5XB 3QEHA 1Q9OB 4HG4K 1UEMA 5F44A 4FA8A 1K4CB 1OY3B 4OZ4B 2YD4A 1BFTA 1HCVA 1Q0YL 4Y16D 5MERB 3U30B 4H1LG 2EDFA 3TGXA 3CX5J 2IBBA 1ZEAL 1WWCA 2VDML 3AB0C 1HQ4A 3B6SA 5HGAA 3CFDA 5TGBB 1YEHH 3RZWA 4GAYB 2ICWJ 4PB0L 4LKCA 3FO2A 1G9MH 4JQXC 1YC8A 2HFEB 1OP3H 3CLFH 2NXZC 2DLTA 5F97E 5D7JD 4NN5C 5EG6C 1RVFH 4U6VH 3UPCA 5ID1B 5E99H 1EO8H 3O6KH 3PV6B 1F4WH 5F7YC 1D5IL 5BO1H 5DF0A 4LLUB 4W4NA 4LLMA 2GFBA 4MVBA 2YSSB 3I3EA 2D03H 3BPCB 3RGVC 5LKNA 4J6RH 3PGDA 2BMKA 5F70A 3SE3C 2EEAA 1YEIL 4JFXA 4CBPA 2NY5C 2R23B 5J12B 1FL6A 5D1XD 4EXKA 4Y4HC 4IMLA 1ED3B 1YNLL 3FQUB 4G9FA 4FQCL 1C1EL 4NQDE 3LKPA 1KBGH 4ELMB 3O3BB 3MRCA 2M1KA 1UG9A 2OP4H 4MQ7A 4ZPVA 5FYLH 5HVHB 1PG7X 4Y16C 1CZ8L 1KGCD 1BEYH 3I75A 3ULVE 1C16B 3ZDYF 1OCWL 5IW6B 3MLXH 1OAXL 5TDOB 1JL8A 1IZKA 2X70B 4PGCB 1CL7H 4HUXB 4XZUB 4NQSA 2Z0BA 3RJQB 4J1UA 3V6ZA 3RPIB 1RZGB 4JKWA 2VXQH 3AB0B 3O3EB 3M45A 3RY4A 1KIPB 1U0QA 3DXAD 4G9FE 1QNZH 3SDYH 1EZVY 3KXFE 3DSFH 1KFAL 4OLEA 4ODXB 2CXKA 5I16B 2L7JA 5BXFA 4JJ5B 3S5LB 2E9JA 2XG4A 4JFOA 5LGHL 1A02N 4O5LH 1S9VA 1P7KB 3A67L 5ISZB 2P48B 5I1AB 3NOIA 4WDIA 3PWVB 4OLVH 1JZ5A 5EB9A 3SDDA 5HY9B 3WD5H 1PYWA 5LAXA 3K0WA 1JV5B 3QIUB 4RSVA 2ICCA 4QTIH 1G0YR 1FFNB 1HSBA 1J0HA 3LKOB 3CU1A 4J8RB 1N0LA 5D1XC 3MMEB 1XGYL 4G8EA 4Y4HD 1IM3A 2VDOL 3NCYP 5SWZB 4HSQA 3O8XB 4OZHF 4CMHB 2FGWH 4TSAL 2CLZB 1YQVL 5HVFB 3VFRB 1SEBA 3BEWB 3RTQD 4JY4A 2R1YB 3MRKA 3SOBH 1MNUH 4F9LA 1DBAL 4JPWL 3MGAA 4RFNC 1YEHL 2QL1A 3GMPB 4PB0H 5E7BA 1RJYB 3MRDA 2C26A 4JGMA 3ARGB 3TPUA 4PJDA 3JV5A 1WISA 2EDKA 1JNNH 2HN7B 1WGOA 1F13A 3MRQA 2APFA 1EEYB 1MHEB 2G75B 4PTUB 3S4SG 4LEXL 4YFLI 4ZO9A 3F7YB 1CDJA 1T1ZB 1D5MA 2V2WB 1JI1A 3ZKNC 4KQ3L 4U1KA 1OAKH 2BNQA 5L7XH 3GHEL 4J4PA 4ZAKC 4ZSOB 1RI8A 3H6JA 3TN0B 5K9JH 3D3VE 1FL3A 2GIYA 5EPMA 3HE7A 1UKSA 5KTEH 2D0FA 1KUMA 1YNLH 2X4NA 4N8VA 4FQCH 4APQC 3F7PC 4UIMA 3ZE0F 3FFCB 1JRHL 3SN6N 3F7QA 1G9EA 2OK0H 1AKJA 4NNXB 4ETQB 2VLRB 4IIQC 4P9ML 1U8OB 4UTAH 4DEPB 1Q9KB 5DTFB 4NKOB 5C0BD 3OKMB 2L7UA 3EJYD 4B5EA 3O9WB 4AZ8A 4LSQL 1XF5B 4P2RD 2GY5A 2P7TB 2CJUL 4WJ5A 4J3UA 1OAUL 3MRHB 1FFPB 3S35X 1K5NB 2P47B 3RL2B 3MUJA 3ILQC 4N0UE 2DQJL 4XP9H 3FQTA 2EIDA 4X6CB 1H3GA 1MFAH 3G9AB 2NR6C 1BGXH 1NFDF 4D0CB 3QIUD 2W65B 5JPMB 3IXAA 3MBEA 4DUVA 3V0WL 5KSVB 3GMRB 1I3RB 5B22A 3TJEL 2VDLH 2D3VA 5JA8B 4Z0BL 2AW2A 5JORA 4XNQB 5IROC 2VZVA 2VLJD 1ERNA 3GEWB 4G80B 4F8TA 5I73B 4PJBB 2J88L 5E1AA 2R2EA 3LEVL 3T2OA 3V4PL 2GSGA 2QQNL 5A3IC 1OD9A 1BF8A 1FV1A 4WTZA 2PR4L 5DJYA 3QQNA 4KXZI 2GTZB 4DGIH 1Z3GH 1IC7L 4GW1B 4EI6A 3S88L 2HRLA 2IPUG 4PLJC 2Y9RT 1ORQB 4LF3B 4O51B 4QRTA 1MNUL 3UAJC 5F1IB 3JWDC 4LRIC 3BQUC 3M8OL 5EIVA 1F8TL 1CFBA 2X4QA 4UTBH 2B2XL 2QQQA 1KIRB 3CLEL 1KTRL 5EZOL 4LARL 2VH5H 2DI9A 2VXTL 4TVPH 3VGGA 1BFVH 4BQ6A 3SDAA 2I9LA 2AERT 5IMLB 3RWDB 4QWWC 2VXUH 1ZLVK 2I07A 4KV5F 3RA7H 2KPNA 1T22B 1EDQA 3C60B 1P7QB 1XEDA 1DR9A 2ZNWA 1OAKL 3QI9D 3V95A 2ZKHL 2I9TA 1QFUH 5D72H 4LAJH 2C7UB 2HJLA 3UZVB 4LIQH 2ZUUA 4XVTH 4YBQD 4ZQKA 5C0RL 1SJXA 1ZKAA 1XR9A 2V17H 4MJ6A 2F5AL 4AEEA 1BP3B 4P2RB 4LPXA 1N8ZB 5HD8C 2OK0L 1KLUA 1TETH 2OL3A 3D0LB 1CLOH 3FO9B 4K8RH 2H8PB 3T2NH 1VB9A 1DBMH 1NANI 4XCYA 1FLTX 4O2CA 3LEYH 1HILA 2CJUH 1QYGL 3CSBA 5B3JF 3DVNB 2Q8AL 2CLRA 3ZT7A 3IF1B 2JIXA 4MAUL 2NNAB 2MFNA 4FQJH 4KDWA 3WIFB 4GG6E 3GM8A 3PWUA 3NFPB 3VJ6B 5C0CD 1X5JA 4HFUH 5C8JB 2B5IC 4XC3H 3PHSA 1VKXB 2C3WA 5GJTL 1W0WB 3INUL 5EUKA 5I1GL 1TJHH 5JXEC 2AV7B 3GSOB 4HC1L 4YZFE 2BOCB 4QHLA 3IDJB 2YA1A 3IJSA 4Q2ZA 3RL1A 3KJ4C 4S1QH 4YK4C 3QFJB 3FB7A 4M6NL 3LEVH 3BP4A 3V4PH 1F6AA 3V0VB 2IAMA 3B9DA 4PIRF 3F5WB 1EBPA 2DLFH 4U33A 5A2JH 2GY7B 2VYRE 4X4YA 5IOPB 3OKLA 5JLZA 2DBLH 1EO7A 2OQJA 5HYQA 1UYWH 1UFUA 4CVZB 4OZHA 4N5EA 4MD0B 1M6OB 1XH3A 1F5WA 1FVCA 1U8QA 1ZSDB 3MV8B 1J9CT 3ZYJA 4L1DA 3QIBB 1MCEA 3SE9H 4L8SB 2X05A 5EZOH 1UWEH 4KK8D 2NY4C 4KZDH 1AO7D 4Y19B 5ABDE 1CU4L 2VR4A 5HHXH 3DMMC 5FIEA 4EI5A 3S98A 1YEDA 4I48A 4JN1H 4LCWD 5IEKA 5TJWK 5CP7A 2VXVL 2VXUL 4ALAH 4NKQB 2WUCH 3B5TA 4ZFGL 3ARGA 1D5XB 1FNLA 4QHLB 2R9HD 1A8JH 1T6VN 5F9OL 1ZTXL 3MXWL 4S2SB 2HLFC 3QUYD 4PRDA 5I71B 4PJ7E 1XCQB 4UUJA 4XPGL 1IFHL 2W92A 4X7SH 4IRSA 4OB5L 4QXUH 1JGEB 2E6PA 2EDEA 4X83A 5E2TL 4W4OA 5F89A 5H94B 4X98A 1YEKH 4MD0A 3O6LL 3LN4A 1RIHH 3HUJF 1AGEB 3W11C 4Y1AD 3H7LA 4AT6A 5IFAL 4LSTH 2OLDA 3FQNB 2APWA 3U0WL 2NXZB 4NRYB 3Q3GA 3REWB 1YYLL 2JF1A 4I4WA 2IH1B 5L2JA 3PQYB 5F1SA 1O7SA 3SHSA 4EI5B 3QQ3A 3QA3B 4M3JA 3QUKB 2FGWL 3ARWA 4R26H 4G8IB 3P0YH 2C9AA 3LS4L 2L0DA 1ZHNB 5CSZB 3X12A 4PBXA 4GKSA 3SJVD 2BVPA 3QAZB 1RZFL 1UWGL 1V3MA 1JHLL 2FIRT 2XRAH 3SPVB 4Y4HB 1Q1JH 3S8WA 4KRPC 3RWJA 1HNFA 1ZVYA 5FM5O 2G5BA 1B6UA 4F7MA 3UTZB 4U0RC 1YPZA 1TCRA 5FO7A 3HZYA 4R4BA 3TZVC 4I0PD 3WEXA 5T3ZD 5I17B 2VIRB 2IFFL 4K07A 5HHMA 1U58B 2AJSL 5IMMB 5DR5H 3M17B 1FSKB 4LCIH 3O2WL 3WFHB 5EU6A 2I25N 4LSRH 1WAAE 3CAFA 3TIEB 3IDNA 2GK2A 2FHCA 5I15H 4KJQC 5L2KE 4X4XA 2E9BA 2WBKA 2FYYB 2C4XA 1BOYA 1N4XH 1ORQA 3ARFC 1UWEL 4EN3A 4DZBA 3MZTA 5CD3A 1XCTA 4PTTB 1ULVA 1S3KH 3DX6B 4R4NC 4YPGB 5I9QC 3WYRA 5HDQL 4WI8A 3C87A 3HFML 4XVSH 4PJFE 5GS0D 2GAZB 5F7WC 2YPLB 1NGQL 4JFDA 3VD4A 4XVUD 4LSQH 1KV3A 1G7IA 1V3KA 3PWPE 2ZOKA 2F9BT 4YHKH 4YHOL 5DJAA 3TFKD 1H3PH 3CFIC 3AC0A 5GGQL 5TPWH 1QRNA 1U93B 3QJFB 2BRRH 3HUJE 3F65A 4LGPB 3ZKMC 3A6BH 5BV7L 2J5LB 4ZTOH 1R3JA 3HPJB 3QEQB 4W6YB 5IG7B 1CFSA 2DIBA 4PRNA 3GMLB 3VG9C 1NC4D 4MLIA 2HG5A 1IZJA 4U05A 4PJGA 1OT1A 1SVZA 4NBZB 3MGTB 5ITBL 2F8VA 3QNZB 4Z77B 3LDBB 3TYGH 4NC1E 3RY6A 1HZHL 3B43A 1AXTL 2K7QA 4JO1H 3RUGB 4HX1A 4EI6B 2UYLA 3MRNA 4AEHL 1X9QA 2J88H 3DX9A 4X5XA 1JTTA 4P5TD 5JDJA 2VZOA 3ZTJH 2MCPL 3MBXH 3PNWB 1N2RA 4WGWB 1JPGA 4E42B 1IC7H 3UBXA 2CK0H 1ZS8A 4LLAA 3MLTA 1VFAA 3B2UC 3IF1A 4NCDA 3WHXB 5I6XB 1TZGH 2V9TA 3MUHL 3ZE2F 5F7MC 5GHWL 2DWDB 2WBJD 5GGRB 4F3FB 1U95B 4LHUB 2DS4A 4JZJA 7CGTA 1WBXB 1J5OH 4UILH 1WFTA 3JV4B 5C0GB 5EUKB 3EJZD 4OM1L 3DTXA 2IPTH 1L0YA 1NCCH 4EOWH 2R4RL 1RUQL 4FQXC 2DQIH 2G2RA 3CFJA 43C9B 3BIAX 5F7NC 4L4TD