4WU7A

Hla-a24 in complex with hiv-1 nef134-8(2f)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Nef134-8 epitope presented by HLA-A24
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
total genus 70
structure length 274
sequence length 274
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wu7A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4wu7A01
3CLEL 1H3VA 2JB5H 1B9ZA 3DXAD 2V7HA 2R4RL 1U95B 4HX1A 5FYJH 1K85A 4LAQH 2X4OA 1NMCC 4QHUA 1EHNA 3WCYA 4MXQA 1Q38A 2W0FA 4OCXL 5TDOB 1NEZG 2ZG2A 4HCRL 4Z8FL 3OXSA 3PL6C 3DYPA 1T1YA 3RWEA 4EOWL 3EOAA 5EBWB 3IYLW 1KCUL 1N0XH 4FQLH 4P23C 4U1NA 1CXHA 4NN6C 1XF4B 1A1NA 2OTWB 1I8MA 4OF8A 3DVNB 5BS0B 3AROA 1FAIL 5JPMB 3U36B 3D87B 4JFZL 2OR9L 4OF3A 3KPSD 3TBWA 5D1ZA 1MHEB 2I07B 5J6GA 1F02I 2ILLA 5TE4H 4CU6A 4G8FB 1O7VA 5A3ID 1FN4A 1UWEH 5F1SA 1XCQB 1D5IL 4QRPD 1L6ZA 4FMKA 1UM4L 4WU7B 3GSQA 3TP4A 4PLKD 5LQBH 2JIXB 2LABA 1CT8A 2DQDH 4U1IB 3T4AA 3ARGD 1P2CB 4XBPB 3BP7A 4QHMB 1FYTA 3HRZB 2VNCA 4OT1H 3DBXA 3CFCH 3IGAB 4HFUH 1NFDF 3HG1D 5ICZA 1A3RH 4W4OA 1J0ZA 4PJFE 5CBAA 3SE4C 1ZA3A 3MLTA 4QXWA 1NC4D 4HG4J 1HDMB 3L3GA 4Z7UF 1DP0A 3M17A 5IBLD 1LK2B 3ECBB 4PBXA 2RIKA 1MQKH 4P4KD 4U6YB 1R24A 2BXYA 1M05A 4HWZB 3S5LB 5KVDH 2I25N 3QH3B 3U6RA 2NZIA 3X12A 3QI9D 1JK8B 3RUGA 4PRNB 3TWCL 1JNHB 3B8SA 3E6HA 1FFOB 5L88L 5BZDA 1AHWC 3ZDZF 4AYFA 4QHKI 4NRZA 4U3CA 3MLRL 4NPYA 5JQHC 1JYVA 2QR0A 3SO5A 1FDLL 4O51B 2NY6C 5FYKH 1Y0LA 3AREB 5C6WH 1I85A 3VWJB 1Q94B 4YNYA 1KYOJ 1GAFH 3FQUB 1BQHG 4JFPB 3O9WA 1UWGH 1RZFH 2VDOH 3WJJC 4QCIB 3ZYZA 1CWVA 1DEEA 1PG7W 1SY6H 3NIDF 4HBCH 4OB5L 4OZIB 5FHBL 5IQ7H 2FO4B 3VFPB 4R7DA 1F6LL 5E7FA 5D1QD 3KPPA 5F3BA 1TQCC 1XF4A 1KLGB 4YQXH 4WUKH 2D9QB 3J8F7 1GHFL 3H7BA 4H88H 2FH6A 1UADC 5JZ7C 5GISL 3TIEA 4RX4D 2WZPD 1YJDL 2IG2L 4I13B 4QO1A 1OTUD 1A7QL 4K9EL 3RY5A 3IXTA 1DZBA 4JR9L 1A9EB 1AIFB 5HHNB 4YHNA 3R4DA 4NWTL 4UTBL 4IOIB 1JUFA 4RBPK 2VXQH 5GJSL 4OUOA 3FRPA 2VDQH 3BUYA 3WIIL 2MTPA 2R0LH 3MXWL 4UDTB 4YDJB 1KCVH 3LKNB 3QIUB 1OAYL 1CVSC 3S36H 1B0RA 4CN1A 2FGWH 2J88L 5GGSB 5D7KD 3NCYS 4G6ML 4HUNB 3BH8A 3HLAB 1OD7A 3ROOB 5BVPH 3Q3GB 1YZZA 4MDJB 4LKCB 5B22A 3EOTL 5DHYB 4MDJA 1FL5A 5FIEA 3U2SB 3D25A 3MUHL 2VRAA 4JQVC 4APQB 3DIFA 2X6MA 4FQXB 2BOBB 2X89D 5C09E 3UO1H 3K0WA 5E2UH 5D4QA 4KI5E 3UAJC 4BFGA 4K07A 5TGBA 5T1KD 1KELL 3MXVL 4P5MA 4BK4A 4HWNA 5HVWA 4E0RB 1F4WL 3A6BL 3OHXB 2FR4B 1FHGA 3VXUB 3WN5A 1HIMH 1U8MA 5EULV 2AJUL 2G60H 1BX2A 5E6IA 4KK6D 1G9EA 3QQ9D 2BHYA 4GBXB 5GSRA 5C07E 4G80A 3G5XA 2VZOA 1WGOA 1HSAA 43C9A 4ONHA 1INDH 2Y4SA 1EX0A 5FYKE 4WFHD 4JQXC 3GJFK 1TTFA 4OI9A 4EUPG 3QDJB 1CDHA 1UM5H 2XWTB 1IBGL 3NABH 1XF5A 2XN9E 4CNIB 2LQRA 5DD3H 4GSDL 1IL1A 3UBXB 1Q9WA 4YPGA 1CL7H 5DJDB 1JFMA 4JZOA 2YKLH 3O8XC 1MWAB 4UQ2B 4K3HA 1RSFA 1QVOA 3KPRE 3IFOB 1XR9A 5KAQG 1I7RA 4U7SA 1RUAL 3ES6B 3CFJA 4PJCE 1RIVL 1V7ML 3HB3D 4N0FA 4M3KB 5ACLA 3D39A 1FO0L 5CP7A 1HN1A 4TUJA 5FYJU 2X1WL 4LSRL 1IZKA 2AXGA 3U36A 5IFAH 1CDUA 1Y18B 1I8IA 1Q1JH 1N6UA 5B8CA 4LSUL 1AFVH 3MJ6A 4X9BA 4ZFGL 1BJ8A 4QRTA 2BJML 3SDDC 5IR1B 1IM9D 1FNEA 1XCTA 5FA4A 3ZYOA 3MLUL 1DDHA 2DLGA 4PP2A 1MCEA 2DB8A 1GAFL 1SY6A 3BD3A 3BPCA 3G04A 2EDQA 3I3EA 2GCYB 4R0LC 3P9MB 3VJ6A 1U3HA 3UXFA 3BH9B 3NA4A 2ADGB 3RDTC 2JJTC 4PJCF 3VGAC 3HA0A 1VFUA 1A6UH 3QWQB 4KDTA 4ZAKD 1NLDL 2J6EH 4FFVC 1NC2D 1K9TA 5GS1A 3J7HA 4XMLH 2EH8H 5FGCB 5CLWA 3TVMA 3GSNA 4GW4B 4LSVL 2R56L 3RDTB 1QFUL 1U8JB 3CCHA 3S88L 1CBVH 5KTEH 2LVCA 1IC5L 3O4OC 3KPQB 4OF7A 1NGXB 3MV8B 1CIUA 4N0CA 4Y2DA 2H45A 2XI9A 2M26A 3KXFB 4EI5D 3MROB 3GSRA 3MRQA 4R3SB 1BIHA 4KQ4L 4PJBE 3WDJA 1FORL 4HUXA 4OD3L 2VYRE 5I75B 2GJ6D 2VDQL 2FL5B 1PJ9A 3WKNA 2ZCKL 3P9LA 3QYCA 1TFHA 3O6FC 1JWUB 1WV7T 2C4FT 3C5SA 4Z95L 2VXTL 5DMIL 3ZDYE 4UBDC 1X5IA 3DGGA 2EE2A 5E2WL 4NO3B 1UVQA 3ABZA 2ADFH 4X9GA 3BQUA 2BNQE 3NZHL 1S9XA 4FQHA 5EORL 3Q6FB 1MJ8H 1YYML 1U8MB 1OB1B 4KI5D 2GT9B 3LIZL 5D7LD 2C5DC 4Y8AA 1I1FB 1CI5A 1P84K 4I0CC 3T8XB 2VAAB 4FTVA 4L8SC 1ED3B 4MMZC 5KSAB 1TCRB 3IFNL 2EECA 4LBEA 5EIIB 1A3RL 2D7OA 2VUOA 3BIBX 2Z4QA 4EN3B 3BEWB 1CFSA 5CZVL 5IGXL 4HKBA 4NQVB 1KULA 4Z78A 3BD4A 5C07D 2P46B 3DRTB 4L29A 2MPAL 4NCC2 4MD4B 3LKSB 4PJDB 1FFNB 2KZWA 3L7FA 4ZD3H 2LAGB 2VIRA 5ID0B 1KJ2L 4N90D 1S7SB 4I3SH 2FWOA 1KACB 4GBXC 4N5ED 4F9LA 4X8XA 4YHYB 5GGTH 2H26B 1ETZB 3VD3A 5FHAL 2G60L 3U7AA 1AO7B 1A6TA 2HT3D 4JFDA 2A6KA 3WNPA 3QUMH 3X13B 1YC7A 3QG7L 3T77A 2FATL 3BWAB 4PGCB 4JO1H 2M8XA 3HI5L 4N8VG 5HHXL 1B0RB 1NAMH 2H2SD 1HQ4A 4LK4A 2VR5A 1NDMB 3B2VH 1FRGL 5ENWA 3RWGA 4WEMB 1UXSA 5F70A 4HD9A 4G7YH 4I77H 4P5KB 5C09B 3C5ZB 2DICA 3GMLB 1YPZA 3GMPA 1W0WA 2X4UB 4JFYA 4XT1C 4Q6IB 5DD3L 2NW2B 5E9DE 4MNQB 3LD8B 1OY3B 3ALXA 2R8SH 1OW0A 4D94A 5GISH 2N4IA 1MCKA 1T7ZA 4ZTPH 1OB1A 1XF3A 3ET9F 5J56B 3IU4L 3X13A 1MNUL 5I66B 2BSSB 5C3TA 1MIEL 2ZJSH 4PGEB 5CKGA 4YQXL 5F7EL 5ABDE 3O2VL 2BNRD 4WGWB 5B4MC 2NY4C 5K59E 3R8BB 4Y5VB 4Z7VB 5F96L 4EIZC 5KVFH 3KWWB 3TPKA 4PJIA 1I8LA 4LLWB 1MCCA 1T0NB 4YXKL 2VDRL 4FS0A 4ZAKA 1CGUA 3BIKA 3QFJD 2EXYC 3G9AB 4U6XB 2ICES 5JIPA 1A4KA 1EEZA 3HE6C 1OGAB 5IHLB 3OKLB 5IEKA 3VWJA 1QBMH 4IHOA 4FTVB 2FEDC 4F9LC 4L4TD 1YNTB 4N5EC 4OI8A 2FJGB 2YSSB 3STLA 4DN4H 2HTKC 2P24B 4ZDHB 1JWSB 4WO4C 1OGAD 2JELH 1V05A 3X3FH 1RUMH 1NEZB 3EJJX 4YHIB 2OP4L 4JQIH 3WEXA 4L3EE 1K6QL 5DWUL 4XPFH 5CKAA 3S88H 2VLLA 3VD5A 2XZQL 3MLYL 1N3NB 1RZJL 1H8NA 3LKPB 3F7QA 1GRWA 4AEIL 2P5WB 5AZ2L 2BNRB 1CDJA 1CVRA 1OW0C 3OPZL 1QFWL 4PB0H 4F80A 3CVHA 3N9GH 2OSLB 1DDHB 3RGVA 1NFDE 1BVLA 4RWYL 4M7KH 1EFQA 1NCAH 1X5XA 5LBSL 5TE6H 2Y1VA 5D9SB 1QFOA 1WAAF 3FO0H 4YWGL 4JB9H 4NO0D 5JDJA 2V5YA 3FB8A 4Q9CA 2DJUA 4YFEA 1GGCL 2YMXL 3SKNA 3TYFB 4IMLA 1A7PL 3FZUD 3GSQB 3I75A 1ES0A 1B4RA 3C2AH 3KR3L 3OAUL 2ADGA 3I6KA 3PV7A 1VDGA 4ORZC 3LIZH 3BMWA 1BZ7B 1CR9L 1MF2L 4KROB 2QL1A 3O4LB 3OKEB 1A14H 3PWVA 4RMRA 5GGSY 5C08E 3UTZB 3MRFB 2EIDA 1N5AB 4KUZH 3E0GA 4N5EA 3DETD 4FQIH 2ICWI 4YIQB 4YC2C 2ATPA 4D9RD 2DN7A 4NM4H 4LF3A 4NO5A 4N0YH 1HH9B 2ICWJ 4BFEA 1YECL 2DQIH 3SKJH 3TN0A 3REVB 1Y18A 1AXSB 4NN7C 4Y4FD 1JMZA 1VADA 2MPAH 4HH9A 1TZGH 4HUWB 1LILA 3QEUB 1AGEA 3OJDA 2BJMH 4BH8B 4LRNL 1JF1B 4OGZA 3TT1H 2WINB 1A4JA 1LO5B 4I48A 4OKVB 4OGYL 1IMHC 5TFSH 4RCAA 4KKLC 1FZOA 5KW9H 3MRFA 3EO9L 5KANG 4GRWE 3DLQR 5JLZB 5EZJB 4NQXA 2QQKH 4EZMA 3VRLF 1MJUH 2Y6SD 3GMLA 3H9SD 3MRHB 1DE4B 4LCYB 5HPOA 2BDNL 4LSPH 4O4YH 2RFXA 3INUL 4HAGA 2XWTA 2XA3A 4GKZB 3UJJH 1A7NH 3VH8G 3GSUA 4XP6H 1IEBA 2PTTB 3ARBC 3B9KB 3NFPB 4KY1H 1N5YL 5D1XA 4WHTB 1U6AH 4TTDC 1D5XB 4ZS7H 3NIFF 4S1SL 4F7CB 1CLCA 4X99A 1VHPA 5HHPA 3QWRA 3LEVH 2C26A 5D72H 1KBGL 3FRUA 2PUQT 3EOBA 1WFNA 3OKOA 5ID1A 1G7IA 3DUUB 4RSVA 2UZYB 1TMCB 3GSWA 4NBZB 1RMFH 4AL8L 1HH6A 3B9DA 3QIUA 1SJHA 3GGWA 4C83A 1BBJB 2EO1A 2AV7B 2EDOA 4YH6A 5T1MB 3QO1B 4OIAA 4NZTL 5EZOL 4GAJL 1I7UB 3ULUL 1U8OA 2UVEA 1KN4L 5EG6C 1LK3L 3WD5L 5ICXA 4KKBC 5TF0A 3CPLB 3MRRA 3P4MB 2AK1H 1AD0B 2JKXA 5EZIL 3E3QE 3WN5C 1JYXA 1J88A 3DXAA 5E8PA 3HMWL 3U4EB 3NIFE 1O5DT 1H3TA 2LU4A 4RGMB 3L7EA 3MOBL 4LHUG 4QY8A 5D1XC 3N1QC 3ESUF 3HNVH 1UCBL 4KVCL 1VFOA 2VISB 1EO8L 1AP2A 1OVZA 3UTTB 4TQEH 4NO5B 3GSUB 4OCWH 5BVJA 2FLBT 1PEZA 1FL3A 1XGQB 3BW9A 2GITA 4KHTL 1TXKA 3UTTA 2LU3A 3NGBC 1W0YT 5F97E 1NCCL 3VG9B 4ZFOA 3GMMB 2ADIB 1MCLA 1FP5A 2JK5A 1YEJL 4LVHC 5JTWA 5TH2B 3FOMB 5AWNH 2NCMA 3T0WA 1I9RL 3QEHA 4HPOL 3HPJA 1XGRA 2D2OA 2HJLB 3PG2A 2QLVB 3QQ9C 3I6LE 1ZGLB 3O3BB 4OV5A 5T3ZD 1UCTA 2Y7QA 4JG1H 1VADB 3BWUC 4JFYB 4LOUC 1XGTA 3BN9C 2I5YH 3F58H 3RL1A 4D8PA 5SWZB 4L4VD 1XEDA 1BFOA 3C8KB 4OZGF 3HG1A 4UQ3B 4G9DA 4YDIL 4RAVA 1RUKH 1T4KA 5C0AE 1YYLL 2NY1C 3ARBA 1F4HA 5DS8A 3N1PC 3DUSB 4X7SH 4DCQA 5MENE 4HQQL 3MUGA 4PJFF 5A16A 3SPVA 1CLOL 4PV8B 4Q9BA 3OAZK 5I76B 1KN2L 2CKBB 1VCAA 5MEQA 3BFOA 4I0PB 2FJFB 3QR2A 2X42A 4GXUN 3RY4A 1NGYA 4KKLD 4Z7WA 3V8CA 4R4NC 3VI3E 3GI9L 4C56B 5EU7E 3G5ZB 5T1KB 5D70H 3CK0L 5K9QI 4N0FB 3WE6A 1UGNA 3ARFD 1L9NA 3ARYA 4LPWA 5DVKA 3ARWA 3ME0A 5I1KH 5HY9B 3TO2B 4I3GA 3ULVE 4R4ND 1JFQL 3HI1A 3E8UH 5IKCB 4E41B 4PP1D 3VFRB 1HINL 3MLTB 3RJQB 1CYGA 4MNGA 2CR3A 4UTAL 1N8ZB 1T0NA 1XAUA 2OI9B 4K23L 1G7QB 4N8CH 4ENED 5LVEA 3VWKA 3GSOB 2E27H 3BQUB 2BY3A 4LLDA 5DQ9B 3SCMD 1JV5A 3ZSTA 1AGEB 3OJDB 4YK4C 4WHYG 3C6SB 1QEWB 5D8JH 5IJVB 4Q9RH 4H8WC 4J3XA 5F71A 3QIUD 2ZSVB 1OM3H 3SO3B 4HBCL 4X7FC 4ZOEA 3VE0A 4EVNA 5FDWA 3CSPA 3RIFF 4YIQA 5KANI 5HY9A 3DOSA 1BZ9A 2X7LA 3KS0H 4Z7WE 2ZOKB 5IKCA 4P2OC 4M7KL 1CFNB 2NTSP 3ZHLA 5C0CB 4ZUSB 1QQDB 4WWID 2AJSH 1CN4A 5FYLL 4PS4L 1MHEA 2I07A 5EOQH 2XZQH 2HJFB 2X4UA 4HIIA 2HRPL 2E9WA 4AEIH 4Z7WB 1HSBA 4ORGA 2FYYB 5EZOH 1AI1H 4OF6A 5E2VH 3H9SB 5C8JA 3I75B 4NWTH 3L3IB 1FGNH 3SGJC 3WFDH 2NR6D 3HG1E 3IAGC 3U2SA 3QFJE 5F8QC 3F7YB 1CK0H 1QNZL 5LKNA 3KAAA 5LQBL 3V95A 2EEDA 3S9DB 1KB5H 3FFCA 2AS5M 2DQCL 4XB7A 3VRJA 3H9SE 2BOCB 4YWGH 3WFZA 4D3CH 1GXEA 3QIWA 4YBLB 3GDBA 4ODVH 2DLEA 5EPMA 5JW3L 3AAZA 2PYFB 1GGCH 2YMXH 2W65A 3PF2A 3FO2A 3VXUA 1C7SA 3ARED 3QISA 4KJYA 4OV5B 3JBG7 3ZTNH 3ZL4H 1GYAA 3OR7A 1MQKL 1HKLL 3MV9D 5CD5D 5KG9B 1B6UA 5JOFB 4G6FB 2VC2L 2CDGA 4LQFH 5I1EH 1BAFH 3FOMA 1BQLH 3PABA 1J05A 1MCNA 1URLA 2ATKA 5D6CA 4KZDH 3OKNA 4MA3B 5JHDE 1RZIB 1R5IB 3TO4A 3PE9A 3GUTA 4ZPVA 2AV1B 3MLSL 5FM8A 5HVHB 1JTOA 5LCVH 4MB5A 2Y07L 3UDWC 1QLFB 3GIVA 4IIQA 1C5DA 4LSSL 1OOAA 1ZLWK 4NO0B 3UJJL 3PQYD 4EI6A 4M8QA 1DVFB 1AE6H 4WV1B 1RAMA 3DSNA 3SDCD 1TTUA 1NMBL 4OLXH 1IGJB 5GGUA 4NOFA 2F9BT 3WS3A 4M62H 1KSRA 3KLDA 1HXMB 2XQBL 4WI5A 5DK3A 2A6DB 4EI5A 4HIJB 3TNMA 4NQEB 5GHWH 4NQDA 4DEPB 4QRPB 4CVXB 3QUZD 1U3HD 5DUMH 5GS3A 4LIQL 3OJVC 1CD1B 3P30H 5FUOH 1T7XA 2VLJE 2OTPA 3OHXA 4WTZG 3KPSB 4HV8A 5CJXA 1DBKH 3ZE2E 3SDAC 2IMMA 5AZEL 1NCNA 3LEVL 1LK3H 1NFIB 3BH9A 4W70A 2VLJB 5DJ8A 2Z8WC 3EYOB 1RHFA 3SCMC 3O3DB 5EZIH 1F45A 4P46C 2VJXA 4U1HA 4OBRA 4NKMB 3ZKMC 2BRQA 2EDJA 5BMFL 3MCKB 1JJUA 3B3IA 5CMAA 1QSFD 5K93A 5CSZB 5CEYA 3CFEA 2IWGA 3NACL 3G6JB 2FWOB 4KC3B 4XC3L 1M7IA 1FPTH 3DV6A 3M45A 3DYOA 2MHAB 2F54E 3LN9A 1GGBH 4KV5F 2PTUA 1WIUA 3VU2A 3MLXH 3UPRB 5GRVL 4HPYH 4MZ2A 5GSVA 5BCAA 2M1KA 3LN4A 5IB1A 1FYTE 2PR4H 2X9WA 1TCRA 4LBEB 3D9AL 4PYGA 3U0TB 1WBXB 2CXGA 1IQDA 2OJEA 4NKIH 1KG0A 2R56H 5AYUH 4DTGH 5I15H 4KDWA 2C7UB 2YXFA 5IMOB 4PP2B 5HI3D 4UUJA 4WY7L 1A6AB 2F8VA 1Y6MR 3C6SA 4X4ZA 3V6FB 3C5ZD 4JFQB 4JFXA 1B0GA 2ZNWA 4HKJA 2HFFA 4IDJH 3V6FA 1AD9A 1FORH 3MRIB 4LEOA 3HC0B 3VXOA 4AK1A 1OQXA 1MLCA 1BIIB 4PLNC 5L2KA 4PTUA 5SX5K 4WUUB 1G6VK 1T1WA 2PKDA 1ZHLA 4FXGB 3BXNB 5FKAA 5SWSA 1MSPA 3U0TA 3C2SA 1BM3H 4JY4A 4QT5A 2XG5A 1JHKL 1ODAA 3QUZB 3ZKND 2X44D 1I9JL 4LDLB 4JY4B 2ADFL 1YEGH 1PZUB 2WUBH 3G6AA 3MFFB 3V5KB 3VCLB 1OARL 1VA9A 4PRPD 1QYGH 4RNRB 5C07B 1J12A 2XICA 4O51A 4TSBL 3H42H 2HVKA 5TQ2H 2OR7A 4PJHF 3I6GB 1U91A 5D2NC 1C1EH 4DZ8A 2NYYD 2IF7A 1H3GA 2PF6A 4U1NB 1DVFD 4MHHI 4Y5VC 3PQYB 3S96B 4UOJA 3RGVB 3WIHH 1FO0H 4MNHB 3R0MA 2J5LC 1WICA 1MRDL 1N7MH 4QT5B 2HH0H 1BF2A 5CCKH 1JGEA 1QLRA 4BSWA 2DBLH 5BV7C 4JFDD 5F7LB 5FB8A 3EYQC 3TBSA 1L0XA 5C7XH 4PJEE 4UINH 3TGXA 2BNRA 5D7SH 2HYMA 3LD8C 5DC4B 1INQA 3LQZA 3MGOA 3UPRA 2OJZH 2Z35B 3LMJH 1MLBA 2D4FA 5DGRA 3D48R 1IAOB 2FHCA 1BGXH 4X6DA 1G7MA 3IS0X 5JNYB 1E6JL 4TVSa 2GJ6B 5F1NB 4AQ1B 5C0JB 1FNSL 3D0LA 3QPQD 4OLXL 1OM3L 2FEEI 3WSQH 4XVTH 4G6AD 3FKUS 2XKNB 3UTTE 4PV9A 2AGJL 4S1RH 1MCSA 3GI8H 4RGOH 4I3RL 1CD0A 1F3JA 4GRLC 4ELME 1JCKA 2FRGP 5KTEL 3C5JA 2QSTA 1OGAA 1DSFL 3PWLA 4GW5A 4PJ9A 4J23A 3FB6A 1CDCA 3C6LA 1PG7X 1BIIA 5L2KB 4NBXB 3UZEA 3S6CA 2GFBB 3EO1A 2ORBL 1QSFE 1DEEB 5KSVB 2WWMC 1MCIA 3H3KA 4G7VL 3W39B 1KPRA 3LEXA 4HZAA 1KCGC 5EOQL 2MCPH 5T33L 4JDZA 2NY5H 4CVXA 1HSAB 43C9B 5EC1A 1FAKT 2IFGA 3TT3L 3Q5YA 5J13B 4U6HB 1K8DB 2BVQA 2B0SL 4NPYB 3L5XL 4X5WB 1JZ4A 2CO6B 4UILH 3W39A 1OF2B 3D18A 4V1DE 3C60A 5A1AA 2GQHA 4YLQT 5LGJB 3RL2B 3FT4A 3ZYIA 3RNKB 4U0RC 4A2LA 2FO4A 4JKMA 1PX3A 2QSQA 4GAYA 3SCMB 1TJGH 5C0BE 1B2WL 4L8DB 5T3XE 1XGUA 3D9AH 1SYVA 4NDMB 1VGKA 4DAGL 3O41B 5FO9B 4YHLL 3SE8L 1C08A 2F5BH 1E0OB 1KCSL 1T1ZB 2IBBA 4JRXE 5FO9A 2I60H 3HFMH 5CGYD 3BI9X 3PDDA 1E4KC 2ZKHH 5DJAB 3GJEB 1AGDB 1SMAA 4LPXA 4MD0B 3RWJA 1KCUH 4EDXA 4JLRA 2D31A 2GSGA 4EI6B 2NY2B 8FABB 2BCKA 5L8KB 2DTML 4HT1L 3NZ8B 3HMXH 4JFFA 3LKNA 1NC4A 2OR9H 1PVHA 4NC1E 4OLUH 1S7TA 4L3CB 3RA7L 4MJIA 1RZIA 4FN0A 4HIXL 4XCCL 2A6IB 3CVIL 3OSKA 5T3ZL 2VDPH 2PYFA 1U58A 4LRIA 1YEKL 1FVCB 4R4BA 5D1ZB 2B4CH 5DQDL 5L7XH 1OARH 3QDGB 3VFVA 1LEGB 4FFVD 1C12A 2WQ8A 3OGOE 4JPWL 3FN0H 3MRIA 5IWLA 1PQZA 3GB7A 5DJCB 1RUPL 3GHBH 4FNLL 3U46B 3WBDA 2YBRA 4XAWL 3V6BR 3TN0D 4XMPL 1XF2B 2V9RA 3FONA 1EXUA 4APQD 5I19H 3AS2A 2P8LA 4KV5E 3VFRA 5HI5C 5CEZD 1HQRB 2N7AA 4JHBA 5T1DL 1KB9J 4HKXA 2AEQL 2DQIL 1ADQL 2OMNA 5F44A 4L4TE 3G6AB 4KHXL 4A2MA 1I7TA 4TSCH 3KPQA 4XPHL 3RIAF 3HI6H 1OAZH 4TUKL 5CAYB 1Q94A 4HW6A 3MRJA 4V2CB 2ZUXA 3UJTH 3LV3B 3IFLL 3SEPA 4NFCA 4WTXA 3WFEH 4NUGL 2DQJL 5TE7H 1E6JH 1A9BA 3L1OL 3FB7A 3MNZB 4XVTL 3ZE1F 2YC1A 7CGTA 1BVLB 2XXCB 1EMTH 1CF8L 1REIA 1A1MA 5DUBB 1N59A 1T1XA 3IFPB 5DURD 4X6DE 4NKIL 2A6JB 6FABL 1I8LC 1S7UA 4CADB 4OAWA 3AAZB 3TBYA 1QFWM 3CFKB 3MLYH 3BT2H 5D1QB 4Y19E 3EHBD 4FP8L 3BGFB 2J8OA 4JAMA 3VW3L 4X5XB 3HZYA 1A9BB 4XHJD 5I1AB 1KT2A 2YPKB 4GG6B 5ADOH 2GJ6E 5SX4I 3ES6A 4FQXC 3STLB 2IALA 3T2OA 1KEGL 3JWOH 4NQDB 4XTRD 5HGHA 4PD4K 4Z7UA 3QO0A 5EU7C 2XZZA 4J8RA 4G6KL 3JTTB 2NZ9C 4ZNEE 1DUZB 2BFVL 2OQJA 3B3IB 4XVUD 1EUUA 3RIAK 4OLVL 4K3GA 4ELMA 2EDRA 3AB0C 3SHSA 1ZLUK 3TA3B 4CJ1A 3WHE0 4R90H 3DX9A 2PXYB 2WIIA 2GJZB 3TN0C 4NRXB 5JXEA 3W9DB 4D8PB 5IW3A 5T1KA 4AM0A 2Q86A 1DQLH 4GFTB 1FCCA 2YD7A 4JRXD 1FZKA 2J88H 3DVNA 2PYEE 1CICC 1M71B 1X5JA 3MMEA 4Z7VF 4F3FB 4FA8A 4GBXA 1G7QA 4FXKB 3CX5J 5BVPL 1YC8A 2DDQL 1R3KA 1YMMD 1E28B 1YPZE 2DI9A 5D2LE 3H42L 4Y2DC 4HXAL 3GBML 5ICYA 5H37H 1WTLA 4DUWA 1TZGL 3P4MA 1BEYL 4Y5XA 3SDXA 2K1MA 1Q8MA 3OX8B 3QJHA 1LO3H 4Q6IA 1F11A 1OSPL 2ZPKH 3MODL 4RBPH 2APWA 1W2KT 3DXAE 1WF5A 3RHWK 4MXQD 3OV6A 4YEEA 5L88H 2X1OA 5BRZD 5F8RC 2JIXD 2V9QA 5HHOD 4AIOA 5IVXA 3JTSA 4F15C 5GQBA 3MV7E 3V6OA 5KVMC 4QOKE 3DROA 2R9HC 3SY0B 2G5RA 4G5ZL 4K7PY 1BD2B 2AGJH 3R06A 1B6DA 1G1YA 3BDYL 4P49A 1XGPA 3TCLB 3INUH 4PRID 1HHKB 3BSZL 3VMOA 4Y7MA 3MBEB 1IT9H 3SDDA 3U30C 1T04A 3GK8H 3SDAA 2HT4D 4KROD 2PCPB 4X6FB 1U6AL 1HHHA 1FIGH 1CGWA 4MX7B 2UWEA 2VSCA 3B5GA 2QKIB 5CD3B 1ZXQA 1ED3A 3O3BA 5L0QC 3ARGA 3Q0HA 3NN8A 1DFBL 4QY8B 5C0CA 5BZWA 1TCMA 5EC1B 3QEQB 4I18C 2IFFL 2APFA 4KK8C 1FE8L 4H5SA 3BO8B 5ESQB 4HGWB 4OCLC 5TDNB 1OP3K 4OLZL 3CPLA 1RJLB 2F19L 2R69H 3F65A 1J18A 3ULVF 2DM4A 2P5WD 1IGML 4GRLD 5D1XB 3RVTC 4JQXA 1NQBA 2NXZC 5F89B 2Q8AL 1SVZA 4IRSA 5IFAL 4XWGL 1MFCL 1V8HA 1AY1H 2YZ8A 2J7LA 4LNRA 1CGSH 3WNNA 1T83A 4N0CD 3VFOA 2Z31D 5CJQL 3H2WA 1T22A 4AENB 3GMNB 4KVCH 1ZGLP 5CZXC 2CK0L 3HE7D 5IF0A 1KTDB 3PQYE 4NNPL 4YHLH 1T2QH 1S5HB 2DLFH 3MV8A 5ELIA 4G8EB 1G6RB 5EFIB 2CSPA 3BT2L 5E08L 1J1PH 3CXDL 3O2DH 3HUJE 4OKVA 3NTCL 1FG9C 2A9NH 2DMBA 4WNQA 4EVNB 1A6UL 4JFZH 3MPCA 3UZVB 1HWGB 5D96C 4RZCB 4K8RL 3QFJB 4HKZB 4X9FA 3OJ2C 1NGQL 5I0ZA 3VXQB 3CLFL 1JK8A 4ONFL 2X9YA 4ZS6D 3MV9A 1CQKA 3B5TA 4R2GD 4QXTA 2KDGA 3E6HB 2W1NA 1K3IA 3GGWB 2HTKD 4PJHE 4G6KH 5IOPB 3FFCE 3LB6D 1OAUL 1ZLVH 5BV7H 5MEPA 4QTHA 5TQ0H 1WISA 4PG2C 4YZFE 1AH1A 1FGNL 3DX8A 5IW1B 3WFDL 1S9KC 2DTMH 2AK4A 4CADA 1BFOB 4E5XB 4C55A 3UMTA 2DQHL 2FDBP 4Y19A 4O2EA 2CDEA 2M2DA 3V6OC 4A6YL 1A1MB 4LFHD 4HAFA 2B1AL 4CU7A 3AU1B 3MRKA 3PQYA 3MNZA 5I1GL 1DL7L 3UJIL 3ZYJA 1YPZF 5AG9A 4D0DB 3ZKNC 3MSPA 2HVKB 2YKLL 3U9UA 2AEQH 5CGTA 3D69A 4HJJL 1KTDA 1RD6A 3GBMH 3JV4A 4CVZA 5EO0A 2YD4A 1BEYH 3TBWB 1A0QL 5D5ME 3KPMA 4TVPL 3UBXA 3AS1A 2VC2H 2R0ZL 3CVHB 4HZLA 4HXBL 2E7LC 2GAZB 2EC9T 1BAFL 1WT5A 4HMCA 3HC0A 1ITBB 3BGAA 3O3AB 4JZNB 3C8KA 4PTUB 1JMXA 4P59H 1H3PH 2DQJH 3PXHA 5TE7L 2NY0C 3V6ZB 4JZJB 3RPIA 4ZFGH 3MZTA 2HT2C 3O9WC 2FD6H 1HH9A 1UWGL 4U1KA 1P9MA 4I0PC 4YE4L 2J1KA 4L3AA 4P2QB 5GGTL 2ZUWA 4XCYB 5K9JL 2XZCL 4BFIA 3L3HB 5TF1L 1RJZB 1UM6L 3BPNB 1LP9F 3QNYB 4YX2L 1E4WL 2RGSA 2X4PA 3K46A 2F58L 4DKEL 5E8DL 2UY7A 1YMMB 4I5BB 1EMTL 3Q48A 5CWSA 2PXYC 5HD8C 1NAMB 1YQVH 4DGYH 4Z6AT 3KG5A 4LRIC 2IJ0C 2X4RA 3AB0B 1OAXL 1N64L 2NXZB 2E6JA 3WNLA 1UACH 5DO2D 4L8CB 2XPGB 2YRZA 3MFGB 4M43H 5AAWA 5IB2A 1AP2B 3FN3A 3RVTD 3LRGA 2GEEA 5K9OA 1NGYB 1WZKA 4DGVL 2V5RA 3MUY1 4U3XA 1C16B 1ZKAA 1T0MB 5CBEB 2XTJC 2W9DH 5ISZB 1AI1L 5E2VL 1XGPB 4Y0GA 1D3CA 4KQ4H 1T0MA 5CBEA 3BH8B 1HI6B 1F58H 1MIEH 2DM2A 1CE1H 1LO4H 5JHLL 3S36L 2B20A 4HWEL 1P6FA 4XVUC 5GGTA 3MRRB 3MLZL 3O3DA 1EO5A 5D1QC 5GGQL 4LNRB 4L8DA 3NFSL 4BSVB 2A73B 4NZRL 5GS0D 4FQQB 5SWZA 1M4KA 2AERT 1OP9A 3MRBB 4PJIB 5D7JC 2DQTL 5EOCH 4J4PA 3BHBB 5LWYH 3F7VB 1IGTA 4XVJH 5B39B 3MRBA 1Q0YL 3PWPB 2ARJB 1RURL 1UXSB 1NLBH 4JVWA 3W82A 4RGND 3D18B 2P5EA 2DDQH 3CZFA 1JBJA 2EIZB 5B39G 2DWEA 2GTZA 4HXAH 3DI2B 4H1LA 1WTGT 4HWBA 4JY6B 4PJGB 2FJGA 1AGBA 3I2CL 1A6TB 1IVLA 1JF1A 1LO3L 1IC4H 1TQBC 5J7CC 1UB5A 3UDWA 1GOHA 3QWOB 4O02H 1ZLSH 4OSUL 1F8TH 4WIQA 3MBXH 1IM9B 3WS3B 5B21A 1U93B 5CZVH 1LVEA 1VERA 2CIIA 3UTQA 3TFKA 2D4DA 2CR6A 5CEXA 1KJ2H 4KFZC 3K8MA 3MRMB 4PJ9B 3V0VA 1RZKL 3O0RL 2WP3O 2QEJA 3QNYA 4Y2DB 5DXWA 1M7DA 5EDXA 3EDEA 4XP4L 4PJGF 5GS2H 2CIKB 3A6CL 4DW2H 4UT7L 3V4UL 4X6DB 2FO1A 4GSDH 1KJ3L 3FQTB 3QDHA 4K3EH 1MREH 1J8KA 4M1GL 2R2EA 1T03L 2R2CA 5CD3A 4YEFA 5JHDA 1MAKA 1YEGL 3F8UB 5D9SA 4GMTH 1IT9L 5GZOD 1F4XL 2BVYA 4PJCB 4XCFL 3TN0B 1U42A 4LIQH 2FB4H 2ED7A 1BBJA 4X7EC 1FO0A 2ICEB 3HR5B 5K9KA 1YY9D 1HDMA 2PCPA 1T1XB 3L3HA 1JPTL 1A14L 4D9LL 3GBLA 3S4SB 4U31A 4UT9L 5D1ZD 1J1XL 2CLRA 3ZKQD 4ZNEA 3VFNA 2NY2C 4RISH 1MJJA 3S96A 2VL5A 4JPIA 2WIMA 4QF1B 1KV3A 5F9OH 5D7LA 3PDOA 3UTTD 1MCQA 2HH0L 3FL7A 5BQ7B 5BRZE 2E7MA 2APXA 4L8CA 4DK3A 4JGUA 4NQVA 4L3ED 2R0KL 3FJTA 2E9IA 2BY0A 2DKUA 4IBLT 2RR3A 2ZZUT 3NACH 1H8SA 4ZO7A 5IMKA 4YC2B 4ELMB 3WLWD 4X9IA 4HIIB 3JTCA 3ZKMD 1S5HA 1F11B 1S7RB 3VDCA 1KCLA 3WO3B 3TPUB 4MHHG 4JZOB 3BPCB 3NPSB 4IRJB 1EGJL 2MMXA 4RGNB 4XNYH 4L9LC 1PZ5B 1GIGL 3U7YH 5FA3A 4B50A 4JO3H 4S1RL 4OFVA 2H2PD 1VGEL 4KKCC 3D85A 3QXWA 4UAOC 4GG6F 4UB0H 2ED9A 1FBIL 1PD6A 1S7QB 12E8L 3C8HA 3QB7C 1FFQA 3LS4H 4PY7A 3FQNA 3NTCH 5EBLB 4QLRA 2X4OB 5IUSA 2GJZA 4KRPD 2NLJA 1U58B 2ITCA 4P2QE 1UB6A 3G04B 3BO8A 5ESQA 4B0MM 2IAMA 2ORBH 1BJMA 1ZEAH 2RCSL 5LXGH 3OL2A 4AIZB 2K9UA 5E0QA 5JPNA 3QIBB 2X9XA 4PRAB 1N0LA 1T6VN 3FB7B 3O8XA 2GUOA 1L8JA 4F7EA 3MYZA 4M7ZB 3ULUH 3TT3H 4JFEB 4ZXBB 3UJIH 1X5YA 3LKRA 1NDGA 3QPXH 1TLKA 43CAB 2XXMB 5E9DA 5J12C 4M9OA 2AK1L 1RI8A 3SDDB 1CFTB 5E4EB 2V2XA 4AEHL 5D1QA 5ITBH 1PY9A 5E5MA 3BKJL 1A0QH 1MWAA 3ZHDA 4PJ7B 1OTTC 4CW1A 3EGSA 1S7SA 1RJCA 1K4DA 1NGWB 4M3JA 1YEIH 4Y4FC 3EHBC 2IANE 4L9LA 1UCBH 2WMPA 3ARDB 5F7FA 5IROA 4OZHB 5J57B 4TQEL 4LASL 4PJIE 5BV7B 1DLFL 5D71H 1AR1C 1QUNA 4QTIL 4TVPH 1TJIL 1V3LA 4YHIA 1MHCB 4TUJB 2BSTB 3IKKA 1RZKH 5B3JF 5JMOC 1I9IL 3QDGE 4K71C 5KSUB 5C0NC 1C5CH 1KFAH 2YD1A 3SN6N 5JQ6L 3IDJA 2VDMH 4CAGA 3ALPA 3WFHB 4ZMAT 4JFDB 4LFHG 1EFXB 5KSVA 1K8IB 4WFFE 1JRHH 5IQ9A 4JREC 2Q76B 3HUJA 4K3EL 3NZ8A 4RRPG 3RGVD 2DMKA 1E4JA 5I1DB 4HULB 2EE6A 3ARFA 3HUJB 4FFWC 1KLFA 3L6FB 5IBLC 2AV1A 1AGDA 3PIQA 2X40A 4OCSH 2C3GA 1C5DB 2QADD 2GW5A 3MNWA 5J13C 5F7EH 4JRYA 1XR8A 3WFCH 2EKSA 3KPNA 5IHZB 3BKYH 1EBPA 3TJHC 1KBGH 4XXCC 2R23B 4KRNA 1NFDA 3U4EA 4FQ2H 3WKML 3ETBF 3QEQA 1YN6A 4FXKA 1CGYA 3QNZA 4ODHH 3NFSH 4XX1G 3KPPB 3ZE2F 2Z9TA 4YDJA 1FZKB 4RQQB 3KDMB 3GSWB 4NHCL 1NLBL 3TV3H 1JN6B 3GKZA 5JOPE 1FC1A 3P9MA 4NQTA 3P0VH 2B39A 4CW1B 3VXPB 1A9EA 1AIFA 3TA3A 1J5OH 2WP3T 5I1IH 2JELL 3LN5B 4NZRH 5B38G 4PJFB 1JFQH 3RUGE 3MNVA 2EXWC 3HKFA 3QRGH 4G6MH 3FO9B 2YD3A 4N1CA 5HGHB 1SEQH 3UAJD 1BD2A 2IQAA 2W9EH 1E27A 4YAQB 1DBML 3MRHA 4JKPL 2DL9A 5E8EB 3T3PE 5CJXC 2IAMC 2XPGA 4ZUTB 5IT2L 3MJGX 1U8KB 2YD2A 1FAIH 5GS0C 3H9SA 5C8JB 3MFFA 2C3WA 3DX9B 2YA1A 1QOKA 3VFWB 2OTUA 2V2WA 4FG6C 5FCUL 3QQ3A 1DE4A 4PJXE 3VW3H 4YNYB 1CFVL 4PRIA 2OR8A 5TE4L 3LHPH 1QTYT 1D5IH 3PGFH 4YXHL 4WEBH 4OI7A 4TVPE 1ZHKB 2GT9A 3P4LA 4MNQD 4MQ7B 2IALB 4D0CB 1MFDH 5DJXA 4MQSB 3C2AL 3FCTA 3KR3H 4P2RA 4EEEA 4PJ7F 3RRQA 4I4WA 4ODXB 5B8CB 4YHML 1CGTA 1I3GL 4LCIL 4MCYB 4HK0B 1T83C 1C12B 4XP4H 4OZ4A 3CFCL 5HHMB 5HDOA 3REVA 3OQ3B 4P4RA 1R24B 3UYOD 4AEHH 2QSCL 1YJDC 3TO4D 2VH5L 2NX5B 5ESAB 4PRIB 3G6JE 4WFGE 5ACZB 3BZEB 3MREB 4NQSB 3PGCA 4R0LB 3NMEA 4JFPA 3IFOA 2Q7YB 4OFYA 5F7DA 4BZYA 4K3DH 5J9PA 4U1GC 1ZANH 4NQED 5J8OA 3FFDB 4FHBD 3ZE0F 4JFFB 2FB4L 5J12B 1EEQA 4WJ5B 4IM8A 4NJAL 2QADB 1D6EB 5CUSH 5C0IA 3S35L 1FYTB 2J2ZA 1KEML 4OGXH 3RDTA 1W72B 5EIQA 2EYRA 4PLJC 5F7WC 4YHYC 5CJ5A 4I0PA 5CEYB 2ERJB 4NYLB 4JRWA 2Z31A 3UJTL 5FM5M 1BQLL 1DR9A 4RMQA 1U2CA 2IMNA 4HUMB 4NQSA 4G80B 5FYKL 5A2KH 1T4KB 1EEYB 1I75A 2EDKA 2P7TA 1LO2H 3X11A 5DC0A 4GAGH 3SPVB 1CF8H 3KYNA 3JUYA 3EKCA 1TITA 1KJVB 4OCXH 5DD1L 2VAJA 3MLUH 1NCWH 3BSZH 4EOWH 1L7IH 4YBQD 4ZSOE 2X89A 3BN9D 4PJCA 4G6FD 4OCSL 1GZQB 5H8DA 2EDXA 1FVDB 4JDTH 3CSGA 1EGJH 3HPJB 1DBJH 4O2CB 4MD0A 2P8PB 1NEZA 3CU7A 2DMCA 5JXAH 4N9GA 3WFCL 5C07A 4PBWD 3QCTL 4EI5B 5FO7A 3MV8D 4LP4A 5IMMB 1VGKB 2A2QT 3CFIC 1IC5H 4R9HA 5FKAB 4LLWA 5SWSB 4HKXB 4JY5H 2EDFA 1X6LA 4PBVC 1RZ7H 1U8PA 4M6MH 3TBVA 1I1CA 1JHLH 4ZQKB 5C0GA 3LKOA 4P2OB 5IB4B 1NL0L 2F8XC 1CDBA 3EYSH 3RTQC 5GRZA 3O6FA 3WHXB 3L3OA 4Z76B 1IGMH 3I02A 1DQJB 2FZ3B 1X5FA 4JDVA 3SO3C 2WK2A 2PTVA 3RI5K 1ORQB 4H25A 1EO8H 3CNKA 5DMIH 5HHNA 1LE9B 4LSTL 5GSRB 5GJTH 3QUYA 4UNVA 3QQNA 1WBXA 1J7VR 1JPGB 3RZWA 3VGAB 3QXDB 3KPRB 1FFPA 3PWJB 3AFLA 5C0BD 1ZSDA 2Q6WA 2ESVE 4Z7VE 1EHLL 4LGPB 5BZWB 3ZL4L 1DVFC 1KLGA 4WV1C 5C6TL 1YEDB 1JNHA 4MNQA 3LZFL 1TVBB 3DMMA 3O3EB 4U1JB 4X98B 4NKDA 3LPGA 5A2JH 5DFTA 1F90H 3HNSH 1KELH 4Z0XA 1JPSH 3SDYH 1VPOH 3S97C 1ZTXL 4JPVL 4K8RH 4D9QE 4XP1L 3LHPL 3VRJB 5SWQB 3VI4F 4E41D 4LKXB 4JDZB 1P69B 2EDLA 1BQHA 2ZWLT 2APTA 4QTIH 1HKFA 4L4TA 5DGQA 3QDJD 5D7IB 3JV0A 3L5JA 1RK1A 3ARFB 3O6KL 4QRRE 3TFKC 4NRZB 4L3EB 1HNGA 2BY1A 5DJYA 3F6LA 4R26H 4BM7A 4QRSB 3MRNA 2ZUQC 1S5IH 2Q7YA 1BZQK 4X5WA 5T5NG 3TEUA 4H88L 1BZ9B 2X7LB 3K4ZA 2P45B 1HK6A 4LHJB 3P4NB 1WUNT 1I9JH 5GHWL 1NFDB 4ODTH 1J0HA 1OL0A 5IVZB 5HDBE 1QO3B 3GSNH 4UU9A 4JR9H 1OSZA 2EC8A 1SQ2N 1GZPB 3VXSA 1IGCH 1ACYH 1P4BH 2GJ6A 2HLFC 1KNOA 5HDLA 2OTWA 1UZ6E 2FX9H 3WIIH 4AIXA 4UV4H 5SWZD 2O5ZH 5E5UB 3BP6B 1EV2E 5F3BB 3WJJA 2BHUA 2R0ZH 2OI9A 3FQWA 4F37F 1FJ1B 4HXBH 3GJFA 3GMOB 1QA9A 3FO2B 2R69L 3SE3C 2I27N 1Z9SA 5HHME 1EPFA 2VE6A 4DWHA 1HINH 3IJHA 4Z7WF 1VEPA 5IFHH 3LDBB 2J8UF 4YHOH 3F7PC 3WXVH 5HYEA 2KZ1B 4UIKH 4UZGA 3SE9L 3IF1B 3BPLB 5F7UA 5I30H 1JYNA 1DUZA 5C0RH 3T0AA 4M7JH 2D3VA 2HAZA 2F74B 2IGFH 1DBMH 2IBZY 4OZFH 3CCHB 2OCFD 4LEXL 5EN2A 5ESVB 1FNHA 4NP4L 2OI9C 1JNLH 1J8HA 4OZHE 1EAPA 5E8DH 4PLKC 2WUCH 1K2DB 3QRGL 4JQVA 1KYOK 5FYLH 4LVNB 1FH5L 1JYWA 4HEME 4OCMC 3VFTA 1HIML 2Q8BL 3EGSB 4NFBA 4PY7B 4GXUM 1S78D 1A02N 1UT9A 3DURA 3BN3B 4TUOB 1ND0B 4JZJC 4M6ML 1INDL 2NY0B 5E2TL 1QEWA 4OIIH 2ZCKH 3N9GL 4LCIH 3KPSA 1ZT4B 4HV8B 3FHAA 5C0BA 3V4PL 5IB3A 2MHAA 3TH2T 4XCNB 3EFDH 5F3HB 4Z77A 4PJAB 3F62A 4J2XA 1Z3GH 2WBKA 4QHLB 3TZVC 1MFDL 3VFUB 3C60C 2R23A 5F21B 2QSCH 5JORA 3ILQD 3AS0A 1RIUH 4ONGH 2B1AH 3VWJD 4HIJA 3TNMB 3B9KC 4MLIA 3QDMA 5MEND 3MRLA 3OKLA 2MKLC 3TO2A 3JWNC 3GMMA 1Q0YH 2R2HA 2IH3B 3KYOB 1YNTA 2B0SH 1WWBX 3UTOA 4P9HH 5ISZD 4QRQA 2AI0H 5GRXG 4LQFL 3MOAH 4ZUUB 5J6GB 4K2UL 1NGPH 5DSCB 4Z7OE 4WHCA 5E8EA 3LB6C 1IC1A 2IANA 5I8KH 1WFTA 2A83A 3PP4H 4XPTL 3W9EA 2NW3B 4HFWA 4AG4L 5C9JA 5KSBF 2FJFA 3RQ3A 1OCWL 3FTGA 4J7RA 4M93C 5EU5B 4R7NB 4XXDB 4JY6A 4PJGA 3KYKH 1FG2B 3QULB 5CCKL 5CUSL 5I17B 4BA8A 2EDWA 5E94B 5DD0L 4LVHB 4J3UA 2DQGH 1QO3A 4UU9B 4TPRH 4TVPD 4GAGL 3QUML 4M4RA 3VG9C 2DI8A 3IAPA 4AT6A 4Z7QE 4YE4H 3UYRL 1XGTB 4P2QD 1HNFA 3BIAX 1CZ8H 2F53A 2UWEE 4E0RA 1AQKH 3BAEH 2DI7A 2FBOJ 3CMOL 3PV6A 4M8QB 1GVIA 4MXWL 2HP4A 5I9QC 5CZXD 1U8IB 1OPGH 1WT5C 4OM0H 2UZXB 3QJFA 3EUUA 1MHHA 4RGMC 5DLML 4O4YL 1CDGA 4HC1H 3HZMA 1LE9A 3FO9A 1R5IA 3RVXC 2Z92B 3TO4B 2FLRT 2A6DA 4I3RH 1MVUA 3GUTB 5DJ0A 3EDJA 1D5BB 4WUUD 3BWAA 4PGCA 4M43L 3MRMA 5DRWA 4KY1L 5J1AA 5HHMD 2X41A 3KJ4B 4NKMA 4YR6A 2J8UB 4FQCH 1MCDA 3TCLA 4GKZA 5BS0D 4MWFA 1YMME 4RFNC 5E6ZA 4AEFA 2X1XR 1J1XH 1SBSL 3OR6B 1CE1L 3SE3A 1VB9A 2VXTH 4NQUA 2DTSA 3FZUC 1RMFL 4AL8H 3IJYA 2OZ4A 3TPUE 2MCPL 4NJ9L 2FNBA 2ZOKA 5EORH 4KHXH 5HD8D 3DXAB 5ITFA 1U8NB 5FDWB 3V79C 1G9MH 4GMSH 2BSRA 4MYWB 1UJ3A 5I1JL 2OL3H 5GGVY 32C2A 2UZIH 4HS3A 5HI3C 3ILPA 1CXEA 4DOHB 4LPVA 2HA1A 2EDEA 5F93C 3IS1X 3NA9L 2GAZA 4OZFA 1DQDL 3O81A 2XNAB 1NGWA 1JZ5A 4TRPH 4ALAH 3GIZL 3GHEL 1RZJH 1T7YA 3UC0L 3LRSB 1PSKH 1YUHB 2F5BL 3QZWB 3U9UB 4XTRC 3IETB 4WTZA 1RQ5A 1BFSA 4KQ3L 2Y23A 3LS4L 1MUJB 3HE7B 2O5XH 3FMGH 4FP8H 2P5EE 2VDNL 4WGVB 3TYFA 1U8HA 2Y25A 3BYTA 3IDYB 4W6WB 3O6MH 2R2BB 4ZYKA 5A2IH 4G7YL 2YD8A 1MCOH 4X6CF 1QSEE 3CH1B 3STZA 4CN4A 4Y5YA 4P3WA 5FM5O 1U3HB 4OQTH 1R3JA 4ONOA 3SE4A 4PUBH 3FQRB 2FHFA 1U41A 5HPMA 1TMCA 2OSLA 5F7DB 1F00I 2DQDL 4Q6IC 5JW4N 5DS8B 3BPLC 3KYNB 2HG5A 3MO1B 1HILA 3TF7C 3VGBA 3CH1A 3QEQD 4PJ5E 4NKOB 2HTLC 2YK1L 2BHZA 3T09A 4XAWH 5E9DB 3PP4L 4XPTH 1FLRH 3SKJL 1QR4A 2BVPB 1A2YB 2FECI 5C0EA 1BWWA 2AEPL 5E8OA 3UEZA 1T3FB 3GM8A 2DBLL 3LCYA 4X6CB 4YXKH 2DIJA 1G9NC 2XN9A 4NWUH 4YDKH 4OTXH 1JIBA 5CP7B 4U6VH 3GMQA 3TT1L 4WW2A 1S9YA 5JLZA 2CKBA 2MSPA 3UP1A 4IHOB 2JTDA 4IOSD 5D70L 1DUYA 1ZAGA 3IF1A 3TJEL 2A1WH 2ICWA 3OKKB 4X4XA 2MFNA 5CEXB 2NTFB 5C0RL 1XF5B 3NAAL 2Y5TB 5D7JD 5T3XD 3MRCB 1BD2D 3CLEH 1T20A 3ILPB 4HH9B 3OXSB 1KGCD 5IJVA 2EDDA 2Y7QB 4CVWA 5BRZB 4TOYL 1UB5B 4QOKD 4UIKL 5JDSB 3NIDE 1K6QH 4Y2OA 4BQBA 4N8CL 2KQNA 2HJLA 5E8PB 4ETQA 2A6IA 3ZZ1A 2ICWB 1FFRA 4FFYH 4GRLA 1NC2A 3WUWG 3R8QA 4CMMB 2CLVA 5TGBB 4C57C 2OK0L 4M1DL 4JKKA 1A64A 3G5VA 1S9VA 8FABA 3KYMB 2OM5A 4LLMB 2FR4A 1FH5H 4U1LB 1CU4L 2P1YA 4MGXA 1EHAA 1PX4A 1YEFH 1ZS8A 3GJEA 2W0LA 3Q2CA 4HG4K 4GH7B 5GZNC 3C09B 1JNNH 1LP9E 2AEWA 2NY4B 5DVNA 1KIUA 2BXZA 4ZFZA 3PWUA 4YHKL 2OLDA 2PYED 3NFNA 1O7SA 1KN4H 3EYVA 2H1PH 1MAJA 2IFFH 2KUTA 1QR1B 4F7CA 3KJ6L 1P4IL 1RIHH 5EA0H 2OYPA 2MOVA 4KRPB 5I76A 3TZVD 2F53E 2AVGA 3BPOC 2OL3L 3QSKB 4PRDB 4MQXD 4AENA 2HRLA 4OD1H 1BBDH 4ZPTB 1V5JA 1MRCH 1NGPL 4QRUA 1IEBB 3VXPA 2DD8L 2QJDA 2W38A 3BQUD 2YD9A 1KPUB 4GAFB 3C87A 4ZTOL 2G2RB 2H3NB 5I8KL 3T0DA 1U8OB 1UQSB 2PW1A 2R4SL 4G3YL 4HUUA 3QAZB 3T65B 3JV5A 5HYFA 4GLRH 1E4XL 2DRUA 2WW8A 4P9HL 3ZT6A 4CDHA 3D1MC 3MOAL 4X6BB 4OZIE 1YN7B 2AK4D 2P24A 3QXUA 4ZDHA 3CVHL 4MNGE 4HJGB 4U05A 1DLFH 5D71L 3A67H 2LE9A 4LCWB 1A6PA 1W0VA 4YO0A 1X7QA 4G8GE 1G6RA 3MX0A 2VR9A 4UOW0 1WJ3A 3DTXB 1FNGB 1OSPH 5FGRA 5DURB 2BX5A 3F12B 1KXVC 2NW3A 1PEWA 5EC2B 4PD4J 5I74B 4KJQD 4G8GB 1NFKA 3RP1A 4MX7A 1MFEL 5DTFA 1MELA 4I0PD 1ORSA 3TNNA 2DQGL 3EO1B 2OXHA 1PFCA 1MFBH 4LLYA 5IV2A 2YA2A 3VI3F 3UTPE 3F7RA 1TZIA 2QTEA 3FRUB 2GTWA 3KLHD 1K5NA 3D2UA 4KDVA 5FOJA 4EJ1C 1GC1C 1HOCB 1P1ZA 4GG8A 4L4VB 1MFAH 4D0DA 1FFNA 1KN2H 1H3WM 3WLBA 4A6YH 2BVPA 2P5EB 4U0RB 4CJ0A 4EBQL 3D0LB 1SYSA 4BH7B 3KYMA 1ZANL 5M94B 3CFBA 1X5AA 5I16B 1YDPA 5JXED 4DZBB 3EJZD 3P30L 4FQCL 4L4JA 3X3GH 3SOBL 3UTPD 1F5WA 3IFLH 1GC1H 1NJ9B 5I2IA 3OKMB 3QDGD 3TJEH 3T0EC 1FZJA 2R0LL 2AJVL 1G0YR 3P77A 3QIWD 1RULL 2ITCB 2XZAH 3MYJB 5I1JH 5EU3A 4YGVB 1CDYA 1Q1JL 2H26A 5LG1A 5CEZL 1AFVL 2FGWL 5CJBA 1UVQB 4HH8A 4P46A 9CGTA 4JRYE 3VXUD 3TFKD 2VLRE 3L7FB 2I9LA 3HNVL 1NCUA 5HDQH 4PJDF 3OBAA 4BQ8A 1G9NL 4Z7NE 1U8LA 1P6AB 4NRXA 5K33A 3O3AA 4XB8A 5B8CC 2O5YH 1E4KA 5GGRA 4NNXB 1P2CA 4P57A 1NAKH 1OGAE 3OKEA 5DVLA 4PRBB 2QQQA 4X7TA 1T1WB 4FXGA 3SDXB 3ULUD 4HCRA 5E5RB 1IKNA 2AJXL 2Y36H 5CHNB 1I9RH 5F3HA 5A3IC 4HIHA 4JKLA 1ES0B 3QCTH 1DLHA 5EBLA 3M07A 5DJCA 5JDSA 4ONFH 4X5XA 4GQPH 5AYUL 2A83B 4PJBA 3WNOA 3DURB 2W0FB 5TDOA 4DKAA 1A1NB 1I8MB 1DBAH 2VL5B 3SDCC 2NY5C 3QA3A 4JFOB 2DWDA 4XNUL 4ZODA 4PJXB 1HCVA 2GY7B 1N59B 4P2YA 1YEEH 4O58L 3D3VA 1BREA 1QSFA 1U95A 5DJYB 1N26A 5JIKA 3STZB 2XV6B 2BCKB 3WEXB 4ZOCA 4ZTOH 4Y88A 3OMZA 4OUUA 1BLNA 4WI3A 3EFFA 1KT2B 2X05A 5I1GH 3RWJB 3QFJA 2AEPH 3VRIA 1J10A 1MI5E 5A2LH 3IU3B 3HZYB 3T0EE 5L2KD 4RGNE 5F9WB 1KTRL 5I1EL 4HJJH 3DYMA 1CXFA 4LLUB 4ODWB 3S35H 1R3LB 4CU8A 3QZWA 2DIAA 4G9FB 3C5ZC 1AQDA 2YXMA 4KJPD 4KK6C 5GRJL 5IF0B 4JO2H 4PRHA 5C1MB 1S7UB 3T0EB 5C2UB 5JR1L 3PHQB 1HQRA 1NBVH 1U8IA 3OGCB 4OSUH 4EDWH 1ORSB 4NCDA 3E2HA 2D7QA 1JN6A 5T1LD 1KB5B 1MEXL 2Q87A 2YWYA 1ZSDB 2Q6WB 3AGVA 3JZ7A 2A1WL 4APQC 5D8JL 2FD6L 5B3JE 4UINL 4Y16A 3RWIB 3CSYA 1NSNH 4M6OH 4M62L 2KKQA 1GOFA 1JWSA 1OGTB 1H0DB 4O9HL 2EXWD 1FRGH 3ZT7A 2ID5A 2B4CC 4B41A 3DNKA 4I77L 2ZUYA 5EFIA 3S37X 4JE4B 4EN3C 5EU4B 2A74B 3T1FA 3CZFB 1FIEA 1IGYB 2GYSA 1MCWW 4PRPA 3NCBB 1QFUH 3QEGH 4OGAD 2DS4A 2JCCB 4M1GH 1UQSA 1VEOA 2PW1B 1N64H 1NBZB 3GSNL 1XF2A 3P9LB 4OCRL 4KMQA 4P46D 5IB5A 4OLEA 4IRSB 5BXFA 4WO4D 5GRUL 3L9RB 1KNOB 4QRRA 3HE6A 2PN5A 3T1WA 1CLYL 1GC1L 3O2VH 4N0UE 4PRPB 2FJHB 4D9LH 3JWOC 2DKSA 2EYSA 1F58L 2VXSL 2B1HH 1JWMA 3BZ4A 3R06B 3WLWC 4NN6B 3BDBA 1JNJA 5JW3H 4G7VH 4L4VE 3QXVA 3S3PA 1FVDA 4NKDB 1WCQA 3FAXA 2VWEC 5DEGA 5F9JB 2NY5L 1NKRA 1V7NH 4NN5B 1P84J 3RWCB 2VQUA 2X4RB 5AYQA 4JN2A 3X12B 3U6RB 4JG0L 4M03A 5B38B 3O4OB 4JFDE 5E6IC 3IRZA 5FB8B 4OZHA 4I2XA 5HGGS 3O2DL 4MD5A 2FL5A 5J11C 3SGDI 4WFFD 4L4TB 3B5HA 3D25B 1JVKA 3ILQC 4HEPG 4P9ML 3NVQA 3BPOB 3T3PF 4Q2ZB 2FIRT 1JNLL 1ZHNA 5IFJA 4RFNB 2AQ3A 4KI5F 4ISVB 1TJGL 1G7LB 3HMXA 2XWBA 5C2BH 3MBXL 2GFBA 1QLEL 4IRZH 3B9EA 5DUPH 1OAUH 2XA8L 5D1XD 3FB6B 1JE6A 4OFIA 1T7VA 3CJJA 4ZOAA 2FATH 1OAQL 4OZGA 3RZCB 3O45B 2FBJL 3OKKA 3HS0B 1GL4B 3Q1SH 2CLVB 3B2VL 3RPKA 8CGTA 1K8DA 2BVQB 1QSFB 4JFHE 1TPXC 4PRBA 4S2SA 4AIZA 1YY8B 4R26L 2FGZA 3D69B 1KPVB 2HFTA 3A6CH 1TTGA 2ZSVA 1QACA 4ZOBA 4DW2L 1Z3GL 1U0QA 3V0WH 3GJFB 3GMOA 5GGRB 4OZGE 3P4OA 5ERWA 2V2TA 5IB3B 3LEXB 5C09D 3EZ8A 2VLJD 3U46A 4TSBH 5C71A 1L4IA 4KVNL 5IHUL 5DVOA 4XC1H 1JF5A 2R15A 3AU1A 4G42A 5IK3A 3LRHA 4RWHA 1DBKL 1OWWA 3UBXG 3RUGB 3VFPA 3C5SB 4MSWA 1LO0L 4K2UH 3VXNB 5FYKU 5ACMA 1AXIB 3MBED 2Z8SA 5FO8A 4HIHB 1PBYA 4D9QD 5GRJH 4N0YL 4ZPTA 3K4DA 3ROLA 4CRPA 2NTFA 1N7ML 4AG4H 2XZAL 5JW4R 5FGBA 1H5BC 1C7TA 5L6YL 4EDWL 5M7QA 3MCG1 1A21A 2B8OT 4IMKA 3VGHA 1SJEB 1RFDH 2HKHL 4HF5H 4YPGB 3ZO0A 2GHWB 2YN3A 4YHOL 3VFUA 1R5VA 2Y6SC 4LASH 4RMUA 4EN3D 2OJZL 1R5VB 4LARH 4FABL 4APQA 5GRWA 5KSAD 2CDFB 2D7MA 5CMAB 1MUJA 1GGUA 4K7PX 3D0VB 2IGFL 4MJID 5F7HA 3O41A 5HYQB 4UQ2A 4ENEC 4YFLF 1V3KA 2EICA 4TNVK 2OP4H 4JQIL 4OM0L 2AABL 3U7YL 3U4BH 5HHMA 4PJ9C 4ETQB 4JRXB 4OZFB 3IJSA 3VXOB 4MVBD 4OZHF 2VZSA 3BP4A 1VENA 2IG2H 4YK4B 2C4FU 4KZEH 4DFHA 4O00A 1EVTC 1I8IB 4R4FH 3FB5A 3EOAB 2PXYD 3MV9B 4UB0L 4ZFOL 2OL3B 1IGIL 3FCTB 1QBAA 4RMSA 3TA3D 3HZVA 2VXQL 3BP7B 1RVFL 4KRLB 2AJXH 2Y36L 2H32A 1ROWA 4JPKL 4XAKE 2YR3A 2OJEB 3KXFD 2DL2A 4CMHC 1CICD 2V7HB 1G1CA 5FECA 4M48L 4NQDD 4XWOD 3MJ8A 5I71C 5DJ2B 1EAJA 1TNNA 4XRCB 1I7TB 2I24N 3LN4B 5LWYL 3RDTD 4QRSA 3OTTA 5KJRL 3JWOL 5FFLA 3OAUH 4UDUA 5MHSE 1JTTA 4HWUA 4LLYB 5IV2B 1OTSC 4X6CA 2IBZX 2X4SA 2MKWA 2QV2A 3DIFB 4C4KO 2AI0L 1PYWB 4BZ1L 1SVCP 2XN9D 5J3HD 3QRFM 4M02A 3VXSE 4OV6F 2EKJA 1GZPA 3WS6A 1UJ3B 1G7PB 5KN5A 3GSXA 1FNGA 5IG7B 5BW7A 2XYCA 1T66D 4TNVF 1RUQL 2CDGB 5D7JA 5LAXB 3WO4B 1VKXB 2WLYA 5GSVB 5C70A 3HC3L 1BWMA 5DUPL 4H0GA 2OS7A 3TWCH 3MJ9H 4YDVA 3VWJC 1JF6A 5L9DH 4PRNA 1PG7L 1Z9OA 2D7TL 4GQ9L 1KJVA 3FT2B 5F1IA 3OKOB 5DYOB 1NMAL 2NY7H 2ZPKL 1T5WA 3FMGL 1FV1A 2QQLH 3MLRH 5FYLD 2BVOA 4HPOH 5HHPB 4UT7H 1NCDH 3V4UH 4C54A 1FNFA 3A6BH 5HGDB 1UWXH 1AHWB 2EYSB 1AQKL 1G7PA 5KN5B 5GIRB 1MREL 4P3CH 4MXWH 1MHPH 1NCTA 3EYFB 3B9KA 4XXCA 3QBTB 1NBZA 3NCMA 3FN0L 4LGRB 4FZ8L 4XI5D 1H5BA 1QFPA 4RAHA 2F5AH 4AM0B 1NH6A 4ZFFB 4RQQA 3O8XD 4PRAA 4U1MA 5GRUH 4MS8D 4UDTA 4QXGL 4UOW1 4JANA 4GBXD 4LLQB 4HDIB 4JM2B 4YHPB 3U48A 2HMIC 3VGFA 3OX8A 4CMHB 3GSVA 1F6AB 4NQEE 2H8PA 4P2RE 5ILTH 4QHLA 3HE7C 5MEOA 1JZ6A 5J89A 2LFGA 1J1OH 5IK3B 4JM4L 2HFFB 5C0EB 2WBWB 1IZJA 1KB5A 2AW2A 4U1KB 1S3KL 1A6WL 3V5DB 2HVJA 4F8TA 4LSRH 4CVUA 3N85H 3V6ZA 3QP3A 3JUZA 4P2RB 4MZ3A 3L1OH 4E41A 3BD5A 3T0EA 4ODBD 4RDQF 3TBYB 5I1IL 2Y5EA 5KS9F 1B2WH 1VESA 1I3RB 1X5ZA 2A74A 3T1FB 1LO2L 1WBYA 4DAGH 4WHDA 1SM3H 5JA9A 4OCWL 3LKQA 3AC0A 3PL6B 5DC9B 3KXFA 1EAPB 4TRPL 4XCEB 3MA7A 1N6VA 4N9GB 4X83A 5JORB 2E6QA 3GMRB 3SGEI 1NANH 4AZ8A 1W8NA 1QSED 3MR9A 4QF1A 1GZQA 4OFDA 3OXRA 1A1OA 4XBEL 5JO5B 5BZDB 5MEQB 3D39E 5LXGL 4EI5C 2OK0H 2VB5A 3MXVH 4LLVB 4X4YB 2W60A 3LEYL 3ULUF 1W72H 2E8YA 1F4WH 1J86A 3FQXA 2HRPH 3S3SA 4PJXF 5FK9B 5DHXB 4WTWA 5T3ZH 2B7DT 2HKFH 2X4QA 1X4XA 4K7FB 4OQTL 1SMOA 3VXRA 1ZMYA 5ALBH 4OJFH 5C08B 2J4WL 5E94A 2YEZA 3IDGB 1ACZA 3DMMD 1RZ7L 5L2JB 2P5WA 4EKXA 3C6LD 3RWCA 5TQ0L 4G42B 1CE6A 3TO4C 1A1OB 3W0WB 3PP3H 1QRNE 2EYRB 2VQ1A 2W91A 4FMFA 5EN2B 5ESVA 1LO0H 4MNGB 4Y1AD 5JW5B 2ZNXA 1MRCL 4E42B 5HYSA 3V0WL 2AJZB 4PTTB 1JWMB 5TPWL 4LL9A 3U9PH 2YK1H 1CL7L 2EKSB 3B83A 3HE7A 3KPNB 5IHZA 3DX7B 2ERJC 3C6LC 3VMNA 1WCBA 3BMVA 4MXVF 4K3DL 3MNWB 5I1HH 2W59A 4XNZB 5IB1B 1RJYB 4XNMA 3BZEA 3LDBC 3RZCC 5FUZH 5C0FB 2WWKT 3ARZA 3AY4C 2C3VA 3GMNA 3TH3T 1ERNA 2AJZA 4PTTA 3ZDYF 3R1GL 4WDIA 4XNQB 2Q76A 1C5BH 5JPMA 4NGHL 3DHJA 1F90L 2HVJB 3CX5K 3HNSL 4LLDB 3L7EB 4X8JA 4P4KB 2VXUL 5HSFA 1FVEB 1UEYA 1ZHNB 1X4ZA 2DM3A 1A6AA 4FFEX 4KGJA 3IAQA 3VXSB 2YS4A 5CINH 1AC6A 4MA1C 1YNLH 1Q9KA 5HYJA 5FHAH 3MBEC 3TPUA 4UV7H 2JJSC 5C3LD 3SJVE 3HG1B 4HLZH 1KIRA 3U4BL 5D2NE 2BNQD 2ITDA 5ITFB 4I9WE 4Q9RL 2VERN 1S7VA 1NMBH 3VFMB 1QZ1A 3N1MC 4A6YB 4WW2C 1KJ2B 4TNWF 5LGHH 5IVXE 2XG4A 3ARGB 5JA8B 3DVFA 1G6RH 1L9MA 4HWBL 5AUMB 2ZJSL 3K2MC 1ZK9A 3U7WL 3VXMB 3CC5B 5DD5L 3WKMH 1M7IB 1KIRB 1UH2A 3IDXL 4DVBB 1HOCA 1P1ZB 5C0DA 1G7JB 3K1DA 2CUIA 5ISZA 5IG7A 4MJ6B 5TDPA 5HYJB 3DPBA 2L0DA 3VFGL 1XF1A 1A22B 2X4NB 3I85A 3FFCB 1IARB 5D2LA 1T89C 2VLRB 3QCVL 3M1BB 3O4LD 2ZCLH 4KPHL 2A6KB 2X4NA 4PJDA 4WCYH 1IGIH 5GGUB 5JIIA 4DGVH 1WAAA 4K94C 4OLZH 3EDFA 5FYLE 4UQ3A 3FOLB 4X7CC 1P4IH 1RIHL 5EA0L 5INCA 3DROB 1TETH 2CXKA 5B38A 3EO0B 3K74B 3DRTA 1LE5A 1FJ1A 4PB9H 3O3EA 3GBNH 4LVNC 1CGSL 1XZ0B 1IAII 3SJVA 3C5JB 2L4OA 1D9KD 2E3VA 3BP6A 4TTDD 4NZUH 3N0PB 4POYA 4XRCA 1I9EA 3OAZH 4JHWL 4PGZA 1ZT7A 2UYLB 2W9EL 1MJ8L 1YYMH 4JCMA 5A2FA 2A77H 3FRPG 2NLJB 1GGIH 3UYPA 3GSVB 1JGUH 3HHRB 4LCCA 4HPYL 3WL9A 2JB6B 3BHBA 4F58H 1NANI 1QFWH 1QSVA 2PR4L 4LLQA 4ZO8A 3AMKA 2B5IB 4GKSB 3S37H 3ZDXE 4R7DB 2L7UA 2BRRL 4LDEB 4XZUA 3MV7D 3QDMD 5F72S 3PJSB 4PJ8A 1QHOA 4G8IA 4QNPF 1J0IA 1V3MA 3MROA 4K7FA 1DBBL 3HCVB 3SBWA 4ESKA 1S7RA 4ZUVB 2MJWA 5JIHA 2V2XB 2X10A 1F97A 3BZDA 1BVKB 2E8ZA 5IVNA 4PIRF 4NUJB 5CJOL 5F9WC 4DN3H 4FTVD 4JO1L 3SQBA 2GK0A 4WRLA 5HJ3A 1WC7B 4GT7A 3OXRB 3S34H 1MCPL 1FV1B 2VH5H 5HVGB 1BM3L 2O61A 2AJ3A 4J4PD 4NCC1 1A3LL 3TVMB 4Y4KD 3KLAB 4MLSA 3WS6C 4JFFE 4PV8A 1UXWB 4IOFC 2R1YA 1CIDA 1WBYB 4YPJA 2HLFD 1KTLA 4KGLA 2WBJB 1X5HA 4X99B 4HK3J 3I9GL 3WHE1 5KVDL 5F6IB 5ADPH 2D03L 3RL1B 3KPOB 2X70A 1U3JA 4KI5C 1EJOH 2CRIA 3SDCB 3X3GL 4FQIL 2BVUA 1FNAA 4TN9A 2W60B 4P9HC 4OGAC 1JPTH 2CDFA 1YECH 1D9KC 4P59L 2Q8AH 3LKRB 1IFHL 3O6FB 3WHXA 3UCRA 3VGDA 3HRZA 1OCWH 5JOPD 5T5NF 2QQKL 3LKOB 4P2OA 2VDRH 4G8EA 5IFHL 3RAJH 1YY9C 2ZUSA 3BYYA 3CH8A 4XC3H 2CK0H 1R3IH 2QQNH 1SM3L 3P4NA 4XP6L 1MAML 3RTQD 1A4KB 5AEAA 2E7LA 4H26B 5DRNB 1L0YA 2PO6C 3N85L 5AAMA 2DLIA 4J1UB 4R97C 5IW6A 1I8KB 2QSVA 4Q6YA 1S9WB 4NC2B 3WFBL 4P5TC 2F54A 3CMOH 2VISA 5KSBB 4TYUA 1AXSA 4GW1B 4UMGA 3JV6A 3LQAC 1DLHB 2K3TA 1AO7E 2E9JA 4R97B 3FHQA 4HCRH 1MIMH 2XKSA 1DN0A 1J9CT 2PO6B 2VLKA 1KCRL 3G5YB 4QRRD 3TESA 1KTLB 1P7QA 1A7QH 4K9EH 1A6ZB 3QCVH 4P5TD 4XVSL 2EEAA 3HI1B 5FF6A 5FAAA 5ETUB 1EEYA 3BZFA 3KPLA 3FT2A 4JN1H 4R2GC 4JHAH 3MLZH 5GGQH 4WWKB 5DHVH 3WUWB 4WNQB 1T21B 2C1PA 3STBA 3CAFA 3ESVF 4HUKB 2MQCA 4OJFL 5C0CD 1IKNC 1RIUL 1UM4H 4ONGL 4GG8B 2OZ4H 1AR1D 3BZ4B 4LCUB 2DYPA 5I8EA 1M7DB 1MRFL 5DDHA 4H25B 1CLZL 5MP6L 1MF2H 1CR9H 4PJ8D 3PL6A 2GTWB 1Q9OB 2Z93B 2V7NA 4JJHA 3JTSB 4WHYH 5EO9A 5CJ8A 1PDKA 3EYOA 1C8PA 4DZBA 1MRDH 3KWWA 5GS0H 1WZLA 2EEBA 3BE1H 4NKQB 3QJHB 1KCSH 2V17H 4HC1A 1NC2B 1IGYA 1OF2A 2C4XA 5FUZL 1QLEH 1MH5B 1GH7A 3VD7A 1GGYA 2CIKA 4M7LL 5F9DC 3TC9A 5E95B 5TFSL 1E6OH 1RZJC 1F4YL 2EO9A 2WINA 1J05B 3QI9A 3R1GH 3MMEB 4F33B 2VL4A 5CSGA 5HHOA 4BUHA 4GKNA 1NSNL 4M6OL 3W11C 2P48B 1N6QL 4C56D 2DJ4A 1KOAA 1IGJA 1JWUA 4XCCH 3JSSA 2VDPL 2B5IC 1T03H 5KVGH 1NUDA 4J3OC 4JJ5A 2VKWA 4GMTL 1KJMA 3D85D 2EC9U 2CLZA 3SKOA 5IP4A 3OF6A 3EW3B 1JI1A 4JREB 4U7KA 3K2UH 4R3SA 1D5ZB 1LWRA 3SDAD 4L1HA 4YDIH 2K7PA 4KRPC 2FX9L 3IXAB 4WFGD 1A7OL 4F7MA 2GIYA 4N68A 4S1SH 4X7SL 1HXYB 4WI8A 1MHHB 4OCNC 1TVHB 5I19L 1I1YB 3IDYC 5D6CB 3G6DH 4Y19D 3U7WH 3I3DA 1NUGA 2VN4A 4R96A 4KAQL 5GZND 2FECL 1LEKA 3KLHC 1OT2A 3QIUC 3UTSB 2RFXB 4NNYB 5GGVL 3GMPB 3GI9H 4FQ2L 4XPHH 2DQTH 3BEVB 4J6RL 4NT6A 5EOCL 1YMMA 3QUKA 4I5BA 4UNTA 3VH8A 2AV7A 2CKBL 1R6VA 3TLRA 4HF5L 3S4SG 4DKFH 3LQZB 1INQB 1DQQB 3D3VE 2IAND 4LU5L 4M7JL 1SJVA 3ARDA 1Y6NR 1A7RH 1FZOB 2IAMB 5FYKD 1MAMH 5DJZB 2DWDB 1QG3A 1MVUB 4NUGH 2IH1A 3FTGB 1JGEB 1QLRB 1L6XA 2VLKD 1D5MA 4BSWB 2ADJA 4KMTL 4QXTB 5KSBA 3SY0A 4P9MH 3NFNB 1QKZL 2IANB 3LOWA 3T4AB 5ICZB 4XMLL 3REWB 1ZLWH 2VZTA 4LSVH 5IBUG 3OKDB 2PXYA 4ORGB 1I7RB 2ESVA 2YSSA 2HMID 4FQXD 3GIZH 1S9VB 2ZKHL 4GRWB 4G43A 4QGTA 2IPKA 4OD3H 5CJOH 3QULA 4DN3L 3VFOB 5JW5A 2VITB 4XPBH 2YPKA 3ZMRA 4ODUB 1MCPH 4Z7UE 5I6XB 2AJYH 1VACB 3U0PA 4H1LH 4UAOB 3T3MF 1JZ3A 3RKDC 2CRYA 3D85B 5EIVA 1MHCA 3BOVA 1XGYH 1U8QB 2EDYA 4RIRB 4MS8A 4XCFH 1BFTA 3K81A 3NCEB 4QHUB 3VJ6B 4BQCA 4R90L 2DLTA 2VLMD 3ZTNL 1IGFH 4L9LB 4PFEA 1S7XB 3WDIA 3P73A 4RAVB 1OP5H 1RUAH 5EUKB 1OLZA 1R3HB 1BBDL 1IM3A 4I2XB 1KC5L 3B9KD 2WNGA 1YEIL 3HC4H 4HK3N 2Y72A 5JHDB 4KZDL 3RIFK 4IMLB 5CSBA 43CAA 5L6YH 3ZHKA 4HS8H 3GKWL 4HIEA 3SDXE 4X6FA 1OAZL 1T89A 4ZO6A 1NCBL 1RFDL 2HKHH 4NHUE 3RAJL 4OUUB 4LKCA 4L4VA 4TSAH 4I3SL 3RWHA 3H0TB 1KEMH 4GJTB 5ANMB 3IXAA 1JI2A 2NXYB 3DVGA 2D7TH 2GCYA 4M9PA 1KF9B 3D2UB 4G6AC 5IEKB 5EUKA 2ADIA 3D39D 2HG5B 3BAEL 3MO1A 1IAKA 2ZG1A 5E1AB 3MCKA 3PHOA 3RWDA 4NQCE 4HJ0D 1BF8A 4BFBD 3RVUC 4Y4FB 3UTQB 1EGJA 5ANME 3PIQB 3HR6A 3QA3B 2J6EL 4K23H 1MJ7L 1OHQA 2VLLB 4QRPE 2E27L 2F8OA 4TOYH 2BC4B 5DMGC 4LPTA 2AP2A 5MEOB 4J3WA 5SX5H 1XIWA 3BKML 3SDXF 5DD1H 4WWKD 2FIKB 3Q5TA 5H2BA 2KL6A 5DMJB 3QI9B 2VDKH 1FIGL 4WI2A 3IDJB 1I1YA 2ZSWB 3MGTA 1XR9B 1UKTA 4XXDA 4O5LH 4RA3A 2D7NA 2LVEA 4NQEA 5D93C 4KKBD 2AKRB 4W4OC 5DRXB 1NC4B 3ZKXB 3HAEH 4JHAL 1DFBH 2PO6D 4QRRB 1CU4H 1YPZB 4XZUB 4CNIA 1KCRH 2P47B 1H8OA 5SWZE 3ULVH 3OG6B 3SKMB 5I1LA 4OLVH 3FT3B 4U6TA 5DZLA 4NHCH 3EYFA 3OGCA 1K4DB 3C09C 1D5BA 3P0VL 1A6WH 3QWOA 5IESL 4YGAB 1CLZH 5MP6H 2OXGA 5DT1L 2IC2A 2NX5E 3MYJA 3OB0H 4YBLC 2A38A 1AKJB 4LQ1A 4KMTH 4OIBA 1MCWM 2A9MH 4GG6A 5DYOA 2VXVL 4UT6H 3CSYB 1ZT4A 1RUML 3EDDA 4RGNC 5IBTL 4X0KA 4JFEA 5ICXB 4ZXBA 1CL7I 3TM6A 3MLPA 2HT2D 2IADA 3F5WA 3O11B 4DTGL 1UKSA 5KVEL 3O6FD 5DFWH 2E7BA 3OR7B 1KPUA 4WY7H 4Z8FH 4U6YA 3NIGF 4MXQC 2W0KA 1FSKB 4F7PB 3S8WA 4ZSOB 5EOTA 1I9IH 2JCCE 3ULUE 1C5CL 1KFAL 3FO1A 4R7NA 3HI5H 2HFGL 3HZKA 3DO7A 2XTJB 4GXVL 2MQ3A 4JPVH 6CGTA 5K9OB 4RRPA 3LKSA 3QQ4B 3HN3A 5AUMA 4J3VA 4W6YB 1XGYL 5EZLA 1IEHA 3FT4B 1I3GH 1SEBB 3E3QC 5I1LB 4Y4KB 5ALBL 2K7QA 1MFBL 3QG7H 3CFJB 5FA3B 1ZV5A 4BQ6A 1I3VA 3KYOA 3MA9L 4MAUH 4ZTPL 1N6QH 5TQ2L 4RFEA 2WM0A 3MRLB 4PJ8C 3BXNA 4PY8I 4NBYB 4PR5A 3TYGH 2R1XA 2B2XH 3G08B 3CXHJ 2Y9RT 5EB9A 5E4IA 3PP3K 2Q20A 1E28A 1EXUB 3ARTA 1I1AB 1P5UA 3FB5B 1H15B 1X6NA 2N7BA 3GSNB 4EBQH 3TZVA 1X5KA 1I3UA 3RWIA 1HHIA 3LPFA 1TJHH 3GKWH 4HJ0C 2BC4A 4DK6A 4UUJB 3WXWH 4HUUB 1T20B 3MUJA 3T4YA 4XBGB 4L8BB 3G6DL 2CGRL 4H8WH 4K9EC 1AO7D 3R0NA 1HILB 1HYSC 1S3KH 5KS9B 2V7NB 1SBBA 4JO2L 2AJVH 3K1KC 5F96H 5KVFL 5KW9L 1BGXL 1A6VL 5HPMB 1RV6X 5CBAB 4DN4L 3O4LA 1FNEB 3K4AA 2RAMA 5LJYH 4WEUD 3QO0B 4G9FA 2J12B 1TQBB 4WW2F 5MI0B 3BEVA 5HYSB 2W0PA 5C92A 1P4LA 1W72A 5E00B 3RNQB 1L7IL 3QXTA 4MA7H 3MC0A 4YUEL 5I30L 3DO3A 2CUMA 1YMHA 5CEZE 2EH7H 3MLXL 2H41A 5DEFA 5LGHL 5D7LB 3CX2A 3GRWL 3QH3A 5J0BA 3U1SL 2ADJB 4OZFG 2DQUH 5ETUA 1R3HA 3CMGA 3GI8L 1ZVYA 5HI4C 1D6VL 3DWTA 2P4AB 2XNAA 3PGFL 2RQ8A 4YXHH 5GGSA 4QTHB 1ZT1A 3IDXH 2PETA 1W72L 2QHRH 3MV11 1XMWA 2COQA 5D7KE 4JO4H 4JJ5B 3FQWB 3QUXB 4JVUA 1ZWIA 4CN6A 3K8KA 5D7IE 1OTTD 4ODXA 3ULVL 2W9DL 2I9TA 1G7HA 1U8QA 3DV4B 1RPQA 2ZCLL 4AH2A 2NY3D 1NL0H 1SYSB 4BH7A 3O3UN 1DBAL 4V3DB 4U1IA 4OD1L 4POZD 3D39B 4TTGA 5DFVD 2NXYD 3FO0L 4GS7B 2V9TA 4WI7A 4X6BA 4JM2F 2HT3C 1YUHA 1A7BA 3U82B 1F42A 2ARJA 3LH2H 2XFXA 3VXSD 3IJHB 3WJLC 4BZ2H 3QQ4A 4ZAKB 4HK0A 5BO1H 5K9QG 3CVHH 4P5KA 1T66C 3LY6A 1GGIL 3OKDA 2VOTA 1IAMA 5F9AC 3B8YA 1G7LA 4U7MA 3B9VA 1WBZA 3O9WB 1A5FL 5I9QB 3ELAT 4IOFD 1ZTXH 3E3QA 4PGEA 4U1HB 3MTRA 4MA8L 5JR1H 2YD6A 5EU3B 4PP8C 4MD5B 3SE8H 1OTSD 3HLAA 5ID0A 4S1QL 3FN9A 5I8OH 3ZKSD 5JOFA 5DD6B 2EIZA 4HIXH 1OLLA 2V5MA 5L0QB 5D7SL 4ZG1A 4MS8C 5DD0H 5FM4A 4P5MB 3NOIA 4M6AA 4Y5YB 1NAMA 1CD1A 1Z5LB 1OAQH 5KAQF 3V8OA 3UYRH 3L5HA 2G2RA 2H3NA 4XP5L 4JDTL 3RVXD 1AKJA