4WU8A

Structure of trptnap-ncp145
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
96
structure length
96
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stereochemical control of nucleosome targeting by platinum-intercalator antitumor agents.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords DNA (145-MER)
total genus 31
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wu8A00
3NQUA 1KU5A 4H9NA 5CP6B 3MNND 2FJ7C 3LZ0B 1ID3A 5B1LD 5JRGD 2F8NB 3AZNC 4WNNB 4CAYA 3AFAA 4Z66D 4Z66C 2CV5B 3REKD 3AZJC 1KX3A 4KGCA 5AV6A 3AZKD 3WTPE 1AOID 1BFMA 2HIOB 1HQ3B 1TZYD 3AFAB 3V9RA 3AN2D 3B6FD 1S32A 4R8PA 3MNNC 1P3FD 4YS3A 5B0ZA 5BO0B 3AZID 1P3BD 2PYOB 3MGSC 3AZMD 5G49A 3WA9D 5AVBB 4J8UD 1P3GA 1P3GC 3LZ1B 5G49B 1P3OB 5GT0A 3REHA 1WWIA 4H9PB 3MGSD 4QLCD 1P3OA 1ID3D 3AZIC 5CP6A 4ZUXA 1S32C 3REKA 5AV9D 4YM6C 5GXQD 2JSSA 2NZDB 5B2JD 1TZYA 4Z66B 3KUYA 5AV6C 2YFVB 2FJ7B 1M18B 3AFAC 1AOIC 3REKC 3AZJD 1ULYA 4X23A 5BO0A 2BYMB 5KDMB 1ID3C 3REJC 4J8XB 5CPJB 3AZMA 5KDMA 5FUGB 4Z5TD 5C3IB 4H9SC 3WA9A 3KWQC 3WKJA 5AVCD 3MVDC 5B24D 4J8WC 4J8UB 1P3GB 3MVDD 3MGSA 4HGAC 5CPKC 3W98A 4G92C 3MGSB 3VH5W 4WU8B 5AV8A 4H9NB 3REID 1ZLAC 1HTAA 2HIOC 2F8NA 5DNNA 3AZKC 3KSYA 2NZDD 4J8VB 3AZNB 4E45A 5AY8D 4Z66A 1KX3D 5AV6B 5DNMB 3AZNA 1M18D 3MGQD 5B2JC 1HQ3C 2AROC 5F99A 5AV9C 4YM6D 3UTBA 1BH9A 1P3LC 1B6WA 5CPJD 3C1BD 4J8XD 5B0ZB 3LELD 1KX4C 3W99C 5B2IB 3LZ1C 3WKJD 4XUJB 3A6NA 1EQZC 2PYOA 4CSRA 3KWQB 3AZED 4XUJA 3A6NB 5AVBA 5B24B 3R45B 3VH6A 3LZ0A 4J8UA 1P3GD 1M19C 3UT9C 1P34D 1JFIA 3REIA 5CPID 4H9PA 3AV1B 3C1CB 3RELC 2NQBB 2F8ND 4JJNC 1U35C 5B31A 3AZGA 3AYWB 3AV1A 2NQBA 3REKB 3B6FC 3MGRC 4KUDD 3AZKB 5DNNB 3WTPA 2F8NK 4J8VC 4NE3A 3MGQA 4WU8C 2YFVA 5DNMA 3AZFC 5BT1C 4LD9B 1M1AC 3LELA 1BH8A 2BYMA 5B1LC 3UTBB 4AWLB 3W99B 2PYOD 3O62C 3AZMB 1B67A 3VH5A 4XUJD 3O62D 2AROB 3W96C 4ZUXB 4DRAA 5B24A 1JFIB 3MGPB 2LY8A 5BT1D 5B33C 3KXBC 3TU4B 5CPIB 3WAAB 3UTAC 3AV1C 3AV1D 2NQBD 2NQBC 5B31C 4KUDA 4WZSB 3X1TA 3W97B 4JJNA 1U35A 4CAYB 3X1UD 2CV5A 3KXBD 4H9OB 4KGCB 3MGRB 4KUDB 3RELD 5DNND 4Z2MG 3LJAB 5B40C 4WU9A 5FUGA 1P34C 3UT9D 4XUJC 4UUZA 1TAFA 5B0YD 5B32C 3UTBD 5E5AD 3A6NC 1EQZD 3W99A 1KX4A 4NE5A 1M1AB 2AROA 5B32A 3AZHC 3LZ0D 4XZQC 1P34A 5BS7C 3TU4D 5AV5A 3W97A 3X1TB 5DNNC 3AV2B 5GT3D 5B40A 1P3IC 5BNXA 3C1CC 3B6GA 2CV5C 2HIOD 4JJNB 5JA4A 4J8VD 1U35B 1ZLAD 1P3KB 3KXBB 4WU9B 3UTAD 3AYWC 3MGRD 1N1JB 1BH9B 4KUDC 4G91C 4EO5B 3B6FB 3W98C 5CPKA 3LJAA 3WAAC 4UUZB 1P3MC 1F66D 1P3KA 5B0YA 3X1SB 5B33D 4J8WA 4LD9A 4NFTA 3X1SA 5B0YB 4CSRB 3KWQA 1P3PB 3W96A 3C1BC 3WA9B 3MNNB 5JRGA 3O62A 5GSUB 3REJD 5AY8C 5B32B 1AOIA 3AZLB 3MGPA 4J8XC 5CPJC 1P3LD 3KUYB 1HQ3D 3AZLA 4R8PD 1P3FA 1WWSA 5GT3B 5B40B 3WTPC 5B1MD 2RVQD 4X23B 3B6FA 1P3FB 4JJND 1U35D 3AZIA 1ZLAB 1KX5D 3VH6T 1P3AC 2YFWB 3RELA 1S32B 4LD9D 5CPKB 1F66B 5F99B 4KHAA 5AVCC 1P3PA 4G92B 1Q9CA 3REHD 3UT9A 4KHAB 4QLCA 1P3OD 3W98B 5E5AA 1P3AD 1P3MB 1ID3B 5B0ZC 3MVDB 5GT0B 1KX4B 1EQZA 3MNNA 5B2IC 3R45A 5B1MC 5C3IC 1P3LA 3REIB 5AV9B 1HQ3A 3AZLD 3AZJA 1KX3C 3W97D 4R8PB 1TZYB 3AFAD 5GT3A 5AY8B 1KX5A 5AV6D 3AZKA 3RELB 2FJ7A 4YS3D 3MGQB 2L5AA 1ZLAA 3B0DB 5B2IA 1S32D 5CPKD 3C1BB 1P3BA 5B0ZD 3LELB 3REHB 4QLCC 3MVDA 3KWQD 1EQZB 4DRBA 1P3PC 3W98D 3WA9C 3AN2C 3AZMC 2NZDA 2IO5C 1KX5C 3REJA 5AV8B 5GT3C 3X1VB 4X23C 5GXQA 3AZND 1M18A 2F8NH 1P3FC 3AZLC 1KX3B 1R4VA 3KUYC 3VH6W 2FJ7D 4J8XA 5CPJA 4NE6A 1TZYC 1BH8B 4YM6A 5B1MA 3UTAB 3AZIB 4ZUXC 5CP6C 5B33B 5JRGC 4Z5TA 5AVBD 5E5AC 1P3OC 4AWLC 1P3PD 5AVCB 3REHC 2CWEA 5GT0C 2F8NG 3O62B 4H9QB 3B0DC 3AZFB 4LD9C 5AVCA 1H3OB 1P3MA 3WAAA 3LJAC 1P3AA 3AZGD 3REJB 1H3OA 2RVQC 3AYWD 4YS3C 4R8PC 3VH5T 3C1CA 5AV8D 3B6GC 1P3IA 5B31B 3W97C 5AV5C 5BS7A 3MGPC 5DNMD 4XZQA 4KGCC 3TU4C 5AY8A 1KX5B 1N1JA 4YM6B 3AZHD 4Z5TB 1F1EA 5F99D 5B2ID 5BNVB 5E5AB 3C1BA 3AZEA 3X1SC 3A6ND 1P3MD 4H9QA 4WU8D 1P34B 5B0YC 5JRGB 1P3KC 4WU9C 4G91B 4EO5C 3X1VC 3AV2A 5GSUA 3AYWA 3AZGB 2CV5D 3C1CD 5CPIA 3X1TD 4Z2MH 5JA4B 3X1UA 2HUEC 3X1TC 5GSUC 2IO5B 3AV2C 3X1VA 3WTPD 1P3IB 5B31D 4WV4B 4H9OA 4WU9D 3AZHA 4J8WB 1M19D 4XZQB 4H9RA 3B0CT 4YS3B 3AZEC 1P3BB 3WKJB 3LZ1D 2BYKA 4ZBJB 3NQJA 3W99D 3NQUB 2BYKB 2AROD 5B1LA 4E44A 3TU4A 1M1AA 3AZFA 5GSUD 5DNMC 4M6BA 5GXQB 5B2JB 4J8VA 3WAAD 1F66C 5CHLB 1P3LB 3MGRA 5AV5B 3X1VD 3AZJB 3X1UB 1P3KD 5B32G 5B1MB 3UTAA 5BNXB 3B6GB 3WTPB 1P3ID 3LJAD 1F66A 1TAFB 3X1SD 3KXBA 5B33A 3W96D 5B24C 4J8WD 1M19B 4XZQD 3B0CW 3UT9B 3LZ0C 3NQJB 4Z5TC 2PYOC 4ZBJC 5B31G 5CP6D 4ZUXD 3MGPD 1P3AB 1M1AD 3AZFD 3LELC 5B1LB 5B32D 3UTBC 1KX4D 5AV9A 5F99C 5B2JA 3KUYD 4WU8A 3MGQC 2HUEB 1M18C 1AOIB 5GXQC 4WNNA 3V9RB 3AV2D 5B40D 4KGCD 4X23D 1A7WA 3AN2B 3AZGC 2NZDC 5AV5D 2HIOA 3X1UC 3AN2A 5CPIC 5AV8C 3B6GD 3REIC 3W96B 3AZHB 2YFWA 4J8UC 5BNVA 1M19A 4H9RB 3B0BA 5AVBC 4HGAB 3AZEB 1P3BC 3WKJC 4H9SA 3LZ1A 4QLCB 5GT0D
chains in the Genus database with same CATH superfamily
3NQUA 1KU5A 4H9NA 5CP6B 3MNND 2Y2IA 2FJ7C 3LZ0B 1ID3A 5B1LD 5JRGD 2F8NB 3AZNC 4WNNB 3KFUG 3P5JB 4CAYA 3AFAA 4Z66D 4Z66C 2CV5B 3REKD 3AZJC 1KX3A 4KGCA 5AV6A 3AZKD 3WTPE 1AOID 1BFMA 2HIOB 1HQ3B 1TZYD 3AFAB 3V9RA 3AN2D 3B6FD 1S32A 4R8PA 3MNNC 1P3FD 4YS3A 5B0ZA 5BO0B 3AZID 1P3BD 2PYOB 3MGSC 3AZMD 5G49A 3WA9D 5AVBB 4J8UD 1P3GA 1P3GC 3LZ1B 5G49B 1P3OB 5GT0A 2FFFB 3REHA 1WWIA 4H9PB 3MGSD 4QLCD 1P3OA 1ID3D 3AZIC 5CP6A 4ZUXA 1S32C 3REKA 5AV9D 4YM6C 5GXQD 2JSSA 2NZDB 5B2JD 4WJ3C 1TZYA 4Z66B 3KUYA 5AV6C 2YFVB 2FJ7B 1M18B 3AFAC 1AOIC 3REKC 3AZJD 1ULYA 4X23A 5BO0A 2BYMB 5KDMB 1ID3C 3REJC 4J8XB 5CPJB 3AZMA 5KDMA 5FUGB 4Z5TD 5C3IB 4H9SC 3H0MC 3WA9A 3KWQC 3WKJA 5AVCD 2JE5A 3MVDC 5B24D 4J8WC 4J8UB 1P3GB 3MVDD 3MGSA 4HGAC 5CPKC 3W98A 4G92C 3MGSB 3VH5W 4WU8B 5AV8A 4H9NB 3REID 1ZLAC 2Y2LA 1HTAA 2HIOC 2Y2NA 2F8NA 5DNNA 3AZKC 3KSYA 1PZRA 2NZDD 4J8VB 3AZNB 4E45A 2G5HC 5AY8D 4Z66A 1KX3D 5AV6B 5DNMB 3AZNA 1M18D 2UWXA 3MGQD 5B2JC 1HQ3C 2AROC 5F99A 5AV9C 4YM6D 3UTBA 1BH9A 1P3LC 1B6WA 5CPJD 3C1BD 4J8XD 5B0ZB 3LELD 1KX4C 3W99C 5B2IB 3LZ1C 3WKJD 4XUJB 3A6NA 1EQZC 2PYOA 4CSRA 3KWQB 3AZED 4XUJA 3A6NB 5AVBA 5B24B 3R45B 3VH6A 3LZ0A 4J8UA 1P3GD 1M19C 3UT9C 1P34D 1JFIA 3REIA 5CPID 4H9PA 3AV1B 3C1CB 3RELC 2NQBB 2F8ND 4JJNC 1U35C 5B31A 3AZGA 3AYWB 3AV1A 2NQBA 3REKB 3B6FC 3MGRC 4KUDD 3AZKB 5DNNB 3WTPA 2F8NK 4J8VC 3MGQA 4WU8C 2Y2KA 2YFVA 2ZY5A 3EPHA 5DNMA 3AZFC 5BT1C 4LD9B 1M1AC 3LELA 1BH8A 2BYMA 5B1LC 3UTBB 4AWLB 2ZY2A 3W99B 2PYOD 3O62C 3AZMB 1B67A 2Y2PA 3VH5A 4XUJD 3O62D 2BG1A 2AROB 2Y2GA 3W96C 4ZUXB 4DRAA 5B24A 1JFIB 3MGPB 2LY8A 2RIQA 5BT1D 5B33C 3KXBC 3TU4B 5CPIB 3WAAB 3UTAC 3AV1C 3AV1D 2NQBD 2NQBC 5B31C 4KUDA 4WZSB 3X1TA 3W97B 4JJNA 1U35A 4CAYB 3X1UD 2CV5A 3KXBD 4H9OB 4KGCB 3MGRB 4KUDB 3RELD 5DNND 4Z2MG 3LJAB 5B40C 4WU9A 3A1KA 5FUGA 1P34C 3UT9D 4XUJC 4UUZA 1TAFA 2Y2MA 5B0YD 5B32C 3UTBD 5E5AD 3A6NC 1EQZD 3W99A 1KX4A 4NE5A 1M1AB 2AROA 5B32A 3F6TA 3AZHC 3LZ0D 4XZQC 1P34A 5BS7C 3TU4D 5AV5A 3W97A 3X1TB 5DNNC 3AV2B 5GT3D 5B40A 1P3IC 5BNXA 3C1CC 3B6GA 2CV5C 2HIOD 4JJNB 5JA4A 4J8VD 1U35B 1ZLAD 1P3KB 3KXBB 4WU9B 3UTAD 3AYWC 3MGRD 1N1JB 1BH9B 4KUDC 4G91C 4EO5B 3B6FB 2F2AC 5CPKA 3W98C 3LJAA 3WAAC 4UUZB 1P3MC 1F66D 1P3KA 3X1SB 5B0YA 5B33D 4J8WA 4LD9A 4NFTA 5B0YB 3X1SA 4CSRB 3KWQA 1P3PB 3W96A 3C1BC 3WA9B 3A1IA 3MNNB 5JRGA 3O62A 5GSUB 3REJD 5AY8C 5B32B 1AOIA 3EG5B 3AZLB 3MGPA 4J8XC 5CPJC 1P3LD 3KUYB 1HQ3D 3AZLA 4R8PD 1P3FA 1WWSA 5GT3B 5B40B 3WTPC 5B1MD 2RVQD 4X23B 3B6FA 1P3FB 4JJND 1U35D 3AZIA 1ZLAB 1KX5D 3VH6T 1P3AC 2YFWB 3RELA 1S32B 4LD9D 5CPKB 1F66B 5F99B 4KHAA 5AVCC 1P3PA 4QLCB 1Q9CA 4G92B 3REHD 4DQYB 3UT9A 4KHAB 4QLCA 1P3OD 2XD5A 3W98B 5E5AA 1P3AD 1P3MB 1ID3B 5B0ZC 3MVDB 2ZY3A 5GT0B 1KX4B 1EQZA 3MNNA 2VQRA 5B2IC 3R45A 3EPLA 5B1MC 5C3IC 1P3LA 3REIB 5AV9B 1HQ3A 3AZLD 3AZJA 1KX3C 2DQNC 3W97D 4R8PB 1TZYB 3AFAD 5GT3A 5AY8B 1KX5A 5AV6D 3AZKA 3RELB 2FJ7A 4YS3D 3MGQB 2L5AA 1ZLAA 3B0DB 5B2IA 1S32D 5CPKD 3C1BB 1P3BA 5B0ZD 3LELB 3REHB 4QLCC 3MVDA 3KWQD 1EQZB 4DRBA 1P3PC 3W98D 2JCHA 3WA9C 3AN2C 3AZMC 2NZDA 2IO5C 1KX5C 3REJA 5AV8B 5GT3C 2Y2JA 4X23C 3X1VB 1Z2CB 5GXQA 3AZND 1M18A 2F8NH 1P3FC 3AZLC 1KX3B 1R4VA 3KUYC 3VH6W 2FJ7D 4J8XA 5CPJA 4NE6A 1TZYC 2Y2OA 1BH8B 4YM6A 5B1MA 3UTAB 3AZIB 4ZUXC 5CP6C 5B33B 5JRGC 4Z5TA 5AVBD 2ZY4A 5E5AC 1P3OC 4AWLC 1P3PD 5AVCB 3REHC 2CWEA 5GT0C 2F8NG 3O62B 4H9QB 3B0DC 3AZFB 4LD9C 5AVCA 1H3OB 1P3MA 3WAAA 3LJAC 1P3AA 3AZGD 3REJB 1H3OA 2RVQC 3AYWD 4YS3C 4R8PC 3VH5T 3C1CA 5AV8D 3B6GC 1P3IA 5B31B 3W97C 5AV5C 3IP4C 5BS7A 3MGPC 5DNMD 4XZQA 4KGCC 3TU4C 3FDDA 2DF4C 5AY8A 1KX5B 1N1JA 4YM6B 3AZHD 4Z5TB 1F1EA 3H0LC 5F99D 5B2ID 5BNVB 5E5AB 3C1BA 3AZEA 3X1SC 3A6ND 1T3UA 1P3MD 4H9QA 4WU8D 1P34B 5B0YC 5JRGB 1P3KC 4WU9C 4G91B 4EO5C 3X1VC 3AV2A 5GSUA 3AYWA 3AZGB 2CV5D 3C1CD 5CPIA 3X1TD 4Z2MH 5JA4B 3X1UA 2HUEC 3X1TC 5GSUC 2IO5B 3AV2C 3X1VA 3WTPD 1P3IB 5B31D 4WV4B 4H9OA 4WU9D 3AZHA 4J8WB 1M19D 4XZQB 4H9RA 3B0CT 4YS3B 3AZEC 2G5IC 1P3BB 2W8SA 3WKJB 3AL0C 3LZ1D 2BYKA 4ZBJB 3NQJA 3W99D 3NQUB 2XD1A 2BYKB 2AROD 5B1LA 4E44A 3TU4A 1M1AA 3AZFA 5GSUD 5DNMC 4M6BA 5GXQB 5B2JB 4J8VA 3WAAD 1F66C 5CHLB 1P3LB 3MGRA 5AV5B 3X1VD 3AZJB 3X1UB 1P3KD 5B32G 5B1MB 3UTAA 5BNXB 3B6GB 3WTPB 1P3ID 3LJAD 1F66A 1TAFB 3X1SD 3KXBA 3H0RC 5B33A 3W96D 5B24C 4J8WD 1M19B 4XZQD 3B0CW 3UT9B 3LZ0C 3NQJB 2ZM5A 2J8PA 4Z5TC 2PYOC 3EPKA 4ZBJC 5B31G 5CP6D 4ZUXD 3MGPD 1P3AB 1M1AD 3AZFD 3LELC 1W2EA 5B1LB 5B32D 2Y2QA 5AV9A 3UTBC 1KX4D 5F99C 5B2JA 3KUYD 4WU8A 3MGQC 2HUEB 2Y2HA 1M18C 1AOIB 5GXQC 4WNNA 3V9RB 3AV2D 5B40D 4KGCD 4X23D 1A7WA 3AN2B 3EPJA 3AZGC 2NZDC 5AV5D 2HIOA 4UPKA 3X1UC 3AN2A 5CPIC 5AV8C 3B6GD 3REIC 3W96B 3AZHB 2YFWA 4J8UC 5BNVA 1M19A 4H9RB 3B0BA 5AVBC 4HGAB 3AZEB 1P3BC 3WKJC 4H9SA 3LZ1A 4NE3A 5GT0D
chains in the Genus database with same CATH topology
3NQUA 1KU5A 4H9NA 5CP6B 3MNND 2Y2IA 2FJ7C 3LZ0B 1ID3A 5B1LD 5JRGD 2F8NB 3AZNC 4WNNB 3KFUG 3P5JB 4CAYA 3AFAA 4Z66D 4Z66C 2CV5B 3REKD 3AZJC 1KX3A 4KGCA 5AV6A 3AZKD 3WTPE 1AOID 1BFMA 2HIOB 1HQ3B 1TZYD 3AFAB 3V9RA 3AN2D 3B6FD 1S32A 4R8PA 3MNNC 1P3FD 4YS3A 5B0ZA 5BO0B 3AZID 1P3BD 2PYOB 3MGSC 3AZMD 5G49A 3WA9D 5AVBB 4J8UD 1P3GA 1P3GC 3LZ1B 5G49B 1P3OB 5GT0A 2FFFB 3REHA 1WWIA 4H9PB 3MGSD 4QLCD 1P3OA 1ID3D 3AZIC 5CP6A 4ZUXA 1S32C 3REKA 5AV9D 4YM6C 5GXQD 2JSSA 2NZDB 5B2JD 4WJ3C 1TZYA 4Z66B 3KUYA 5AV6C 2YFVB 2FJ7B 1M18B 3AFAC 1AOIC 3REKC 3AZJD 1ULYA 4X23A 5BO0A 2BYMB 5KDMB 1ID3C 3REJC 4J8XB 5CPJB 3AZMA 5KDMA 5FUGB 4Z5TD 5C3IB 4H9SC 3H0MC 3WA9A 3KWQC 3WKJA 5AVCD 2JE5A 3MVDC 5B24D 4J8WC 4J8UB 1P3GB 3MVDD 3MGSA 4HGAC 5CPKC 3W98A 4G92C 3MGSB 3VH5W 4WU8B 5AV8A 4H9NB 3REID 1ZLAC 2Y2LA 1HTAA 2HIOC 2Y2NA 2F8NA 5DNNA 3AZKC 3KSYA 1PZRA 2NZDD 4J8VB 3AZNB 4E45A 2G5HC 5AY8D 4Z66A 1KX3D 5AV6B 5DNMB 3AZNA 1M18D 2UWXA 3MGQD 5B2JC 1HQ3C 2AROC 5F99A 5AV9C 4YM6D 3UTBA 1BH9A 1P3LC 1B6WA 5CPJD 3C1BD 4J8XD 5B0ZB 3LELD 1KX4C 3W99C 5B2IB 3LZ1C 3WKJD 4XUJB 3A6NA 1EQZC 2PYOA 4CSRA 3KWQB 3AZED 4XUJA 3A6NB 5AVBA 5B24B 3R45B 3VH6A 3LZ0A 4J8UA 1P3GD 1M19C 3UT9C 1P34D 1JFIA 3REIA 5CPID 4H9PA 3AV1B 3C1CB 3RELC 2NQBB 2F8ND 4JJNC 1U35C 5B31A 3AZGA 3AYWB 3AV1A 2NQBA 3REKB 3B6FC 3MGRC 4KUDD 3AZKB 5DNNB 3WTPA 2F8NK 4J8VC 3MGQA 4WU8C 2Y2KA 2YFVA 2ZY5A 3EPHA 5DNMA 3AZFC 5BT1C 4LD9B 1M1AC 3LELA 1BH8A 2BYMA 5B1LC 3UTBB 4AWLB 2ZY2A 3W99B 2PYOD 3O62C 3AZMB 1B67A 2Y2PA 3VH5A 4XUJD 3O62D 2BG1A 2AROB 2Y2GA 3W96C 4ZUXB 4DRAA 5B24A 1JFIB 3MGPB 2LY8A 2RIQA 5BT1D 5B33C 3KXBC 3TU4B 5CPIB 3WAAB 3UTAC 3AV1C 3AV1D 2NQBD 2NQBC 5B31C 4KUDA 4WZSB 3X1TA 3W97B 4JJNA 1U35A 4CAYB 3X1UD 2CV5A 3KXBD 4H9OB 4KGCB 3MGRB 4KUDB 3RELD 5DNND 4Z2MG 3LJAB 5B40C 4WU9A 3A1KA 5FUGA 1P34C 3UT9D 4XUJC 4UUZA 1TAFA 2Y2MA 5B0YD 5B32C 3UTBD 5E5AD 3A6NC 1EQZD 3W99A 1KX4A 4NE5A 1M1AB 2AROA 5B32A 3F6TA 3AZHC 3LZ0D 4XZQC 1P34A 5BS7C 3TU4D 5AV5A 3W97A 3X1TB 5DNNC 3AV2B 5GT3D 5B40A 1P3IC 5BNXA 3C1CC 3B6GA 2CV5C 2HIOD 4JJNB 5JA4A 4J8VD 1U35B 1ZLAD 1P3KB 3KXBB 4WU9B 3UTAD 3AYWC 3MGRD 1N1JB 1BH9B 4KUDC 4G91C 4EO5B 3B6FB 2F2AC 5CPKA 3W98C 3LJAA 3WAAC 4UUZB 1P3MC 1F66D 1P3KA 3X1SB 5B0YA 5B33D 4J8WA 4LD9A 4NFTA 5B0YB 3X1SA 4CSRB 3KWQA 1P3PB 3W96A 3C1BC 3WA9B 3A1IA 3MNNB 5JRGA 3O62A 5GSUB 3REJD 5AY8C 5B32B 1AOIA 3EG5B 3AZLB 3MGPA 4J8XC 5CPJC 1P3LD 3KUYB 1HQ3D 3AZLA 4R8PD 1P3FA 1WWSA 5GT3B 5B40B 3WTPC 5B1MD 2RVQD 4X23B 3B6FA 1P3FB 4JJND 1U35D 3AZIA 1ZLAB 1KX5D 3VH6T 1P3AC 2YFWB 3RELA 1S32B 4LD9D 5CPKB 1F66B 5F99B 4KHAA 5AVCC 1P3PA 4QLCB 1Q9CA 4G92B 3REHD 4DQYB 3UT9A 4KHAB 4QLCA 1P3OD 2XD5A 3W98B 5E5AA 1P3AD 1P3MB 1ID3B 5B0ZC 3MVDB 2ZY3A 5GT0B 1KX4B 1EQZA 3MNNA 2VQRA 5B2IC 3R45A 3EPLA 5B1MC 5C3IC 1P3LA 3REIB 5AV9B 1HQ3A 3AZLD 3AZJA 1KX3C 2DQNC 3W97D 4R8PB 1TZYB 3AFAD 5GT3A 5AY8B 1KX5A 5AV6D 3AZKA 3RELB 2FJ7A 4YS3D 3MGQB 2L5AA 1ZLAA 3B0DB 5B2IA 1S32D 5CPKD 3C1BB 1P3BA 5B0ZD 3LELB 3REHB 4QLCC 3MVDA 3KWQD 1EQZB 4DRBA 1P3PC 3W98D 2JCHA 3WA9C 3AN2C 3AZMC 2NZDA 2IO5C 1KX5C 3REJA 5AV8B 5GT3C 2Y2JA 4X23C 3X1VB 1Z2CB 5GXQA 3AZND 1M18A 2F8NH 1P3FC 3AZLC 1KX3B 1R4VA 3KUYC 3VH6W 2FJ7D 4J8XA 5CPJA 4NE6A 1TZYC 2Y2OA 1BH8B 4YM6A 5B1MA 3UTAB 3AZIB 4ZUXC 5CP6C 5B33B 5JRGC 4Z5TA 5AVBD 2ZY4A 5E5AC 1P3OC 4AWLC 1P3PD 5AVCB 3REHC 2CWEA 5GT0C 2F8NG 3O62B 4H9QB 3B0DC 3AZFB 4LD9C 5AVCA 1H3OB 1P3MA 3WAAA 3LJAC 1P3AA 3AZGD 3REJB 1H3OA 2RVQC 3AYWD 4YS3C 4R8PC 3VH5T 3C1CA 5AV8D 3B6GC 1P3IA 5B31B 3W97C 5AV5C 3IP4C 5BS7A 3MGPC 5DNMD 4XZQA 4KGCC 3TU4C 3FDDA 2DF4C 5AY8A 1KX5B 1N1JA 4YM6B 3AZHD 4Z5TB 1F1EA 3H0LC 5F99D 5B2ID 5BNVB 5E5AB 3C1BA 3AZEA 3X1SC 3A6ND 1T3UA 1P3MD 4H9QA 4WU8D 1P34B 5B0YC 5JRGB 1P3KC 4WU9C 4G91B 4EO5C 3X1VC 3AV2A 5GSUA 3AYWA 3AZGB 2CV5D 3C1CD 5CPIA 3X1TD 4Z2MH 5JA4B 3X1UA 2HUEC 3X1TC 5GSUC 2IO5B 3AV2C 3X1VA 3WTPD 1P3IB 5B31D 4WV4B 4H9OA 4WU9D 3AZHA 4J8WB 1M19D 4XZQB 4H9RA 3B0CT 4YS3B 3AZEC 2G5IC 1P3BB 2W8SA 3WKJB 3AL0C 3LZ1D 2BYKA 4ZBJB 3NQJA 3W99D 3NQUB 2XD1A 2BYKB 2AROD 5B1LA 4E44A 3TU4A 1M1AA 3AZFA 5GSUD 5DNMC 4M6BA 5GXQB 5B2JB 4J8VA 3WAAD 1F66C 5CHLB 1P3LB 3MGRA 5AV5B 3X1VD 3AZJB 3X1UB 1P3KD 5B32G 5B1MB 3UTAA 5BNXB 3B6GB 3WTPB 1P3ID 3LJAD 1F66A 1TAFB 3X1SD 3KXBA 3H0RC 5B33A 3W96D 5B24C 4J8WD 1M19B 4XZQD 3B0CW 3UT9B 3LZ0C 3NQJB 2ZM5A 2J8PA 4Z5TC 2PYOC 3EPKA 4ZBJC 5B31G 5CP6D 4ZUXD 3MGPD 1P3AB 1M1AD 3AZFD 3LELC 1W2EA 5B1LB 5B32D 2Y2QA 5AV9A 3UTBC 1KX4D 5F99C 5B2JA 3KUYD 4WU8A 3MGQC 2HUEB 2Y2HA 1M18C 1AOIB 5GXQC 4WNNA 3V9RB 3AV2D 5B40D 4KGCD 4X23D 1A7WA 3AN2B 3EPJA 3AZGC 2NZDC 5AV5D 2HIOA 4UPKA 3X1UC 3AN2A 5CPIC 5AV8C 3B6GD 3REIC 3W96B 3AZHB 2YFWA 4J8UC 5BNVA 1M19A 4H9RB 3B0BA 5AVBC 4HGAB 3AZEB 1P3BC 3WKJC 4H9SA 3LZ1A 4NE3A 5GT0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQU A;  1KU5 A;  4H9N A;  5CP6 B;  3MNN D;  2FJ7 C;  3LZ0 B;  1ID3 A;  5B1L D;  5JRG D;  2F8N B;  3AZN C;  4WNN B;  4CAY A;  3AFA A;  4Z66 D;  4Z66 C;  2CV5 B;  3REK D;  3AZJ C;  1KX3 A;  4KGC A;  5AV6 A;  3AZK D;  3WTP E;  1AOI D;  1BFM A;  2HIO B;  1HQ3 B;  1TZY D;  3AFA B;  3V9R A;  3AN2 D;  3B6F D;  1S32 A;  4R8P A;  3MNN C;  1P3F D;  4YS3 A;  5B0Z A;  5BO0 B;  3AZI D;  1P3B D;  2PYO B;  3MGS C;  3AZM D;  5G49 A;  3WA9 D;  5AVB B;  4J8U D;  1P3G A;  1P3G C;  3LZ1 B;  5G49 B;  1P3O B;  5GT0 A;  3REH A;  1WWI A;  4H9P B;  3MGS D;  4QLC D;  1P3O A;  1ID3 D;  3AZI C;  5CP6 A;  4ZUX A;  1S32 C;  3REK A;  5AV9 D;  4YM6 C;  5GXQ D;  2JSS A;  2NZD B;  5B2J D;  1TZY A;  4Z66 B;  3KUY A;  5AV6 C;  2YFV B;  2FJ7 B;  1M18 B;  3AFA C;  1AOI C;  3REK C;  3AZJ D;  1ULY A;  4X23 A;  5BO0 A;  2BYM B;  5KDM B;  1ID3 C;  3REJ C;  4J8X B;  5CPJ B;  3AZM A;  5KDM A;  5FUG B;  4Z5T D;  5C3I B;  4H9S C;  3WA9 A;  3KWQ C;  3WKJ A;  5AVC D;  3MVD C;  5B24 D;  4J8W C;  4J8U B;  1P3G B;  3MVD D;  3MGS A;  4HGA C;  5CPK C;  3W98 A;  4G92 C;  3MGS B;  3VH5 W;  4WU8 B;  5AV8 A;  4H9N B;  3REI D;  1ZLA C;  1HTA A;  2HIO C;  2F8N A;  5DNN A;  3AZK C;  3KSY A;  2NZD D;  4J8V B;  3AZN B;  4E45 A;  5AY8 D;  4Z66 A;  1KX3 D;  5AV6 B;  5DNM B;  3AZN A;  1M18 D;  3MGQ D;  5B2J C;  1HQ3 C;  2ARO C;  5F99 A;  5AV9 C;  4YM6 D;  3UTB A;  1BH9 A;  1P3L C;  1B6W A;  5CPJ D;  3C1B D;  4J8X D;  5B0Z B;  3LEL D;  1KX4 C;  3W99 C;  5B2I B;  3LZ1 C;  3WKJ D;  4XUJ B;  3A6N A;  1EQZ C;  2PYO A;  4CSR A;  3KWQ B;  3AZE D;  4XUJ A;  3A6N B;  5AVB A;  5B24 B;  3R45 B;  3VH6 A;  3LZ0 A;  4J8U A;  1P3G D;  1M19 C;  3UT9 C;  1P34 D;  1JFI A;  3REI A;  5CPI D;  4H9P A;  3AV1 B;  3C1C B;  3REL C;  2NQB B;  2F8N D;  4JJN C;  1U35 C;  5B31 A;  3AZG A;  3AYW B;  3AV1 A;  2NQB A;  3REK B;  3B6F C;  3MGR C;  4KUD D;  3AZK B;  5DNN B;  3WTP A;  2F8N K;  4J8V C;  4NE3 A;  3MGQ A;  4WU8 C;  2YFV A;  5DNM A;  3AZF C;  5BT1 C;  4LD9 B;  1M1A C;  3LEL A;  1BH8 A;  2BYM A;  5B1L C;  3UTB B;  4AWL B;  3W99 B;  2PYO D;  3O62 C;  3AZM B;  1B67 A;  3VH5 A;  4XUJ D;  3O62 D;  2ARO B;  3W96 C;  4ZUX B;  4DRA A;  5B24 A;  1JFI B;  3MGP B;  2LY8 A;  5BT1 D;  5B33 C;  3KXB C;  3TU4 B;  5CPI B;  3WAA B;  3UTA C;  3AV1 C;  3AV1 D;  2NQB D;  2NQB C;  5B31 C;  4KUD A;  4WZS B;  3X1T A;  3W97 B;  4JJN A;  1U35 A;  4CAY B;  3X1U D;  2CV5 A;  3KXB D;  4H9O B;  4KGC B;  3MGR B;  4KUD B;  3REL D;  5DNN D;  4Z2M G;  3LJA B;  5B40 C;  4WU9 A;  5FUG A;  1P34 C;  3UT9 D;  4XUJ C;  4UUZ A;  1TAF A;  5B0Y D;  5B32 C;  3UTB D;  5E5A D;  3A6N C;  1EQZ D;  3W99 A;  1KX4 A;  4NE5 A;  1M1A B;  2ARO A;  5B32 A;  3AZH C;  3LZ0 D;  4XZQ C;  1P34 A;  5BS7 C;  3TU4 D;  5AV5 A;  3W97 A;  3X1T B;  5DNN C;  3AV2 B;  5GT3 D;  5B40 A;  1P3I C;  5BNX A;  3C1C C;  3B6G A;  2CV5 C;  2HIO D;  4JJN B;  5JA4 A;  4J8V D;  1U35 B;  1ZLA D;  1P3K B;  3KXB B;  4WU9 B;  3UTA D;  3AYW C;  3MGR D;  1N1J B;  1BH9 B;  4KUD C;  4G91 C;  4EO5 B;  3B6F B;  3W98 C;  5CPK A;  3LJA A;  3WAA C;  4UUZ B;  1P3M C;  1F66 D;  1P3K A;  5B0Y A;  3X1S B;  5B33 D;  4J8W A;  4LD9 A;  4NFT A;  3X1S A;  5B0Y B;  4CSR B;  3KWQ A;  1P3P B;  3W96 A;  3C1B C;  3WA9 B;  3MNN B;  5JRG A;  3O62 A;  5GSU B;  3REJ D;  5AY8 C;  5B32 B;  1AOI A;  3AZL B;  3MGP A;  4J8X C;  5CPJ C;  1P3L D;  3KUY B;  1HQ3 D;  3AZL A;  4R8P D;  1P3F A;  1WWS A;  5GT3 B;  5B40 B;  3WTP C;  5B1M D;  2RVQ D;  4X23 B;  3B6F A;  1P3F B;  4JJN D;  1U35 D;  3AZI A;  1ZLA B;  1KX5 D;  3VH6 T;  1P3A C;  2YFW B;  3REL A;  1S32 B;  4LD9 D;  5CPK B;  1F66 B;  5F99 B;  4KHA A;  5AVC C;  1P3P A;  4G92 B;  1Q9C A;  3REH D;  3UT9 A;  4KHA B;  4QLC A;  1P3O D;  3W98 B;  5E5A A;  1P3A D;  1P3M B;  1ID3 B;  5B0Z C;  3MVD B;  5GT0 B;  1KX4 B;  1EQZ A;  3MNN A;  5B2I C;  3R45 A;  5B1M C;  5C3I C;  1P3L A;  3REI B;  5AV9 B;  1HQ3 A;  3AZL D;  3AZJ A;  1KX3 C;  3W97 D;  4R8P B;  1TZY B;  3AFA D;  5GT3 A;  5AY8 B;  1KX5 A;  5AV6 D;  3AZK A;  3REL B;  2FJ7 A;  4YS3 D;  3MGQ B;  2L5A A;  1ZLA A;  3B0D B;  5B2I A;  1S32 D;  5CPK D;  3C1B B;  1P3B A;  5B0Z D;  3LEL B;  3REH B;  4QLC C;  3MVD A;  3KWQ D;  1EQZ B;  4DRB A;  1P3P C;  3W98 D;  3WA9 C;  3AN2 C;  3AZM C;  2NZD A;  2IO5 C;  1KX5 C;  3REJ A;  5AV8 B;  5GT3 C;  3X1V B;  4X23 C;  5GXQ A;  3AZN D;  1M18 A;  2F8N H;  1P3F C;  3AZL C;  1KX3 B;  1R4V A;  3KUY C;  3VH6 W;  2FJ7 D;  4J8X A;  5CPJ A;  4NE6 A;  1TZY C;  1BH8 B;  4YM6 A;  5B1M A;  3UTA B;  3AZI B;  4ZUX C;  5CP6 C;  5B33 B;  5JRG C;  4Z5T A;  5AVB D;  5E5A C;  1P3O C;  4AWL C;  1P3P D;  5AVC B;  3REH C;  2CWE A;  5GT0 C;  2F8N G;  3O62 B;  4H9Q B;  3B0D C;  3AZF B;  4LD9 C;  5AVC A;  1H3O B;  1P3M A;  3WAA A;  3LJA C;  1P3A A;  3AZG D;  3REJ B;  1H3O A;  2RVQ C;  3AYW D;  4YS3 C;  4R8P C;  3VH5 T;  3C1C A;  5AV8 D;  3B6G C;  1P3I A;  5B31 B;  3W97 C;  5AV5 C;  5BS7 A;  3MGP C;  5DNM D;  4XZQ A;  4KGC C;  3TU4 C;  5AY8 A;  1KX5 B;  1N1J A;  4YM6 B;  3AZH D;  4Z5T B;  1F1E A;  5F99 D;  5B2I D;  5BNV B;  5E5A B;  3C1B A;  3AZE A;  3X1S C;  3A6N D;  1P3M D;  4H9Q A;  4WU8 D;  1P34 B;  5B0Y C;  5JRG B;  1P3K C;  4WU9 C;  4G91 B;  4EO5 C;  3X1V C;  3AV2 A;  5GSU A;  3AYW A;  3AZG B;  2CV5 D;  3C1C D;  5CPI A;  3X1T D;  4Z2M H;  5JA4 B;  3X1U A;  2HUE C;  3X1T C;  5GSU C;  2IO5 B;  3AV2 C;  3X1V A;  3WTP D;  1P3I B;  5B31 D;  4WV4 B;  4H9O A;  4WU9 D;  3AZH A;  4J8W B;  1M19 D;  4XZQ B;  4H9R A;  3B0C T;  4YS3 B;  3AZE C;  1P3B B;  3WKJ B;  3LZ1 D;  2BYK A;  4ZBJ B;  3NQJ A;  3W99 D;  3NQU B;  2BYK B;  2ARO D;  5B1L A;  4E44 A;  3TU4 A;  1M1A A;  3AZF A;  5GSU D;  5DNM C;  4M6B A;  5GXQ B;  5B2J B;  4J8V A;  3WAA D;  1F66 C;  5CHL B;  1P3L B;  3MGR A;  5AV5 B;  3X1V D;  3AZJ B;  3X1U B;  1P3K D;  5B32 G;  5B1M B;  3UTA A;  5BNX B;  3B6G B;  3WTP B;  1P3I D;  3LJA D;  1F66 A;  1TAF B;  3X1S D;  3KXB A;  5B33 A;  3W96 D;  5B24 C;  4J8W D;  1M19 B;  4XZQ D;  3B0C W;  3UT9 B;  3LZ0 C;  3NQJ B;  4Z5T C;  2PYO C;  4ZBJ C;  5B31 G;  5CP6 D;  4ZUX D;  3MGP D;  1P3A B;  1M1A D;  3AZF D;  3LEL C;  5B1L B;  5B32 D;  3UTB C;  1KX4 D;  5AV9 A;  5F99 C;  5B2J A;  3KUY D;  4WU8 A;  3MGQ C;  2HUE B;  1M18 C;  1AOI B;  5GXQ C;  4WNN A;  3V9R B;  3AV2 D;  5B40 D;  4KGC D;  4X23 D;  1A7W A;  3AN2 B;  3AZG C;  2NZD C;  5AV5 D;  2HIO A;  3X1U C;  3AN2 A;  5CPI C;  5AV8 C;  3B6G D;  3REI C;  3W96 B;  3AZH B;  2YFW A;  4J8U C;  5BNV A;  1M19 A;  4H9R B;  3B0B A;  5AVB C;  4HGA B;  3AZE B;  1P3B C;  3WKJ C;  4H9S A;  3LZ1 A;  4QLC B;  5GT0 D; 
#chains in the Genus database with same CATH topology
 3NQU A;  1KU5 A;  4H9N A;  5CP6 B;  3MNN D;  2Y2I A;  2FJ7 C;  3LZ0 B;  1ID3 A;  5B1L D;  5JRG D;  2F8N B;  3AZN C;  4WNN B;  3KFU G;  3P5J B;  4CAY A;  3AFA A;  4Z66 D;  4Z66 C;  2CV5 B;  3REK D;  3AZJ C;  1KX3 A;  4KGC A;  5AV6 A;  3AZK D;  3WTP E;  1AOI D;  1BFM A;  2HIO B;  1HQ3 B;  1TZY D;  3AFA B;  3V9R A;  3AN2 D;  3B6F D;  1S32 A;  4R8P A;  3MNN C;  1P3F D;  4YS3 A;  5B0Z A;  5BO0 B;  3AZI D;  1P3B D;  2PYO B;  3MGS C;  3AZM D;  5G49 A;  3WA9 D;  5AVB B;  4J8U D;  1P3G A;  1P3G C;  3LZ1 B;  5G49 B;  1P3O B;  5GT0 A;  2FFF B;  3REH A;  1WWI A;  4H9P B;  3MGS D;  4QLC D;  1P3O A;  1ID3 D;  3AZI C;  5CP6 A;  4ZUX A;  1S32 C;  3REK A;  5AV9 D;  4YM6 C;  5GXQ D;  2JSS A;  2NZD B;  5B2J D;  4WJ3 C;  1TZY A;  4Z66 B;  3KUY A;  5AV6 C;  2YFV B;  2FJ7 B;  1M18 B;  3AFA C;  1AOI C;  3REK C;  3AZJ D;  1ULY A;  4X23 A;  5BO0 A;  2BYM B;  5KDM B;  1ID3 C;  3REJ C;  4J8X B;  5CPJ B;  3AZM A;  5KDM A;  5FUG B;  4Z5T D;  5C3I B;  4H9S C;  3H0M C;  3WA9 A;  3KWQ C;  3WKJ A;  5AVC D;  2JE5 A;  3MVD C;  5B24 D;  4J8W C;  4J8U B;  1P3G B;  3MVD D;  3MGS A;  4HGA C;  5CPK C;  3W98 A;  4G92 C;  3MGS B;  3VH5 W;  4WU8 B;  5AV8 A;  4H9N B;  3REI D;  1ZLA C;  2Y2L A;  1HTA A;  2HIO C;  2Y2N A;  2F8N A;  5DNN A;  3AZK C;  3KSY A;  1PZR A;  2NZD D;  4J8V B;  3AZN B;  4E45 A;  2G5H C;  5AY8 D;  4Z66 A;  1KX3 D;  5AV6 B;  5DNM B;  3AZN A;  1M18 D;  2UWX A;  3MGQ D;  5B2J C;  1HQ3 C;  2ARO C;  5F99 A;  5AV9 C;  4YM6 D;  3UTB A;  1BH9 A;  1P3L C;  1B6W A;  5CPJ D;  3C1B D;  4J8X D;  5B0Z B;  3LEL D;  1KX4 C;  3W99 C;  5B2I B;  3LZ1 C;  3WKJ D;  4XUJ B;  3A6N A;  1EQZ C;  2PYO A;  4CSR A;  3KWQ B;  3AZE D;  4XUJ A;  3A6N B;  5AVB A;  5B24 B;  3R45 B;  3VH6 A;  3LZ0 A;  4J8U A;  1P3G D;  1M19 C;  3UT9 C;  1P34 D;  1JFI A;  3REI A;  5CPI D;  4H9P A;  3AV1 B;  3C1C B;  3REL C;  2NQB B;  2F8N D;  4JJN C;  1U35 C;  5B31 A;  3AZG A;  3AYW B;  3AV1 A;  2NQB A;  3REK B;  3B6F C;  3MGR C;  4KUD D;  3AZK B;  5DNN B;  3WTP A;  2F8N K;  4J8V C;  3MGQ A;  4WU8 C;  2Y2K A;  2YFV A;  2ZY5 A;  3EPH A;  5DNM A;  3AZF C;  5BT1 C;  4LD9 B;  1M1A C;  3LEL A;  1BH8 A;  2BYM A;  5B1L C;  3UTB B;  4AWL B;  2ZY2 A;  3W99 B;  2PYO D;  3O62 C;  3AZM B;  1B67 A;  2Y2P A;  3VH5 A;  4XUJ D;  3O62 D;  2BG1 A;  2ARO B;  2Y2G A;  3W96 C;  4ZUX B;  4DRA A;  5B24 A;  1JFI B;  3MGP B;  2LY8 A;  2RIQ A;  5BT1 D;  5B33 C;  3KXB C;  3TU4 B;  5CPI B;  3WAA B;  3UTA C;  3AV1 C;  3AV1 D;  2NQB D;  2NQB C;  5B31 C;  4KUD A;  4WZS B;  3X1T A;  3W97 B;  4JJN A;  1U35 A;  4CAY B;  3X1U D;  2CV5 A;  3KXB D;  4H9O B;  4KGC B;  3MGR B;  4KUD B;  3REL D;  5DNN D;  4Z2M G;  3LJA B;  5B40 C;  4WU9 A;  3A1K A;  5FUG A;  1P34 C;  3UT9 D;  4XUJ C;  4UUZ A;  1TAF A;  2Y2M A;  5B0Y D;  5B32 C;  3UTB D;  5E5A D;  3A6N C;  1EQZ D;  3W99 A;  1KX4 A;  4NE5 A;  1M1A B;  2ARO A;  5B32 A;  3F6T A;  3AZH C;  3LZ0 D;  4XZQ C;  1P34 A;  5BS7 C;  3TU4 D;  5AV5 A;  3W97 A;  3X1T B;  5DNN C;  3AV2 B;  5GT3 D;  5B40 A;  1P3I C;  5BNX A;  3C1C C;  3B6G A;  2CV5 C;  2HIO D;  4JJN B;  5JA4 A;  4J8V D;  1U35 B;  1ZLA D;  1P3K B;  3KXB B;  4WU9 B;  3UTA D;  3AYW C;  3MGR D;  1N1J B;  1BH9 B;  4KUD C;  4G91 C;  4EO5 B;  3B6F B;  2F2A C;  5CPK A;  3W98 C;  3LJA A;  3WAA C;  4UUZ B;  1P3M C;  1F66 D;  1P3K A;  3X1S B;  5B0Y A;  5B33 D;  4J8W A;  4LD9 A;  4NFT A;  5B0Y B;  3X1S A;  4CSR B;  3KWQ A;  1P3P B;  3W96 A;  3C1B C;  3WA9 B;  3A1I A;  3MNN B;  5JRG A;  3O62 A;  5GSU B;  3REJ D;  5AY8 C;  5B32 B;  1AOI A;  3EG5 B;  3AZL B;  3MGP A;  4J8X C;  5CPJ C;  1P3L D;  3KUY B;  1HQ3 D;  3AZL A;  4R8P D;  1P3F A;  1WWS A;  5GT3 B;  5B40 B;  3WTP C;  5B1M D;  2RVQ D;  4X23 B;  3B6F A;  1P3F B;  4JJN D;  1U35 D;  3AZI A;  1ZLA B;  1KX5 D;  3VH6 T;  1P3A C;  2YFW B;  3REL A;  1S32 B;  4LD9 D;  5CPK B;  1F66 B;  5F99 B;  4KHA A;  5AVC C;  1P3P A;  4QLC B;  1Q9C A;  4G92 B;  3REH D;  4DQY B;  3UT9 A;  4KHA B;  4QLC A;  1P3O D;  2XD5 A;  3W98 B;  5E5A A;  1P3A D;  1P3M B;  1ID3 B;  5B0Z C;  3MVD B;  2ZY3 A;  5GT0 B;  1KX4 B;  1EQZ A;  3MNN A;  2VQR A;  5B2I C;  3R45 A;  3EPL A;  5B1M C;  5C3I C;  1P3L A;  3REI B;  5AV9 B;  1HQ3 A;  3AZL D;  3AZJ A;  1KX3 C;  2DQN C;  3W97 D;  4R8P B;  1TZY B;  3AFA D;  5GT3 A;  5AY8 B;  1KX5 A;  5AV6 D;  3AZK A;  3REL B;  2FJ7 A;  4YS3 D;  3MGQ B;  2L5A A;  1ZLA A;  3B0D B;  5B2I A;  1S32 D;  5CPK D;  3C1B B;  1P3B A;  5B0Z D;  3LEL B;  3REH B;  4QLC C;  3MVD A;  3KWQ D;  1EQZ B;  4DRB A;  1P3P C;  3W98 D;  2JCH A;  3WA9 C;  3AN2 C;  3AZM C;  2NZD A;  2IO5 C;  1KX5 C;  3REJ A;  5AV8 B;  5GT3 C;  2Y2J A;  4X23 C;  3X1V B;  1Z2C B;  5GXQ A;  3AZN D;  1M18 A;  2F8N H;  1P3F C;  3AZL C;  1KX3 B;  1R4V A;  3KUY C;  3VH6 W;  2FJ7 D;  4J8X A;  5CPJ A;  4NE6 A;  1TZY C;  2Y2O A;  1BH8 B;  4YM6 A;  5B1M A;  3UTA B;  3AZI B;  4ZUX C;  5CP6 C;  5B33 B;  5JRG C;  4Z5T A;  5AVB D;  2ZY4 A;  5E5A C;  1P3O C;  4AWL C;  1P3P D;  5AVC B;  3REH C;  2CWE A;  5GT0 C;  2F8N G;  3O62 B;  4H9Q B;  3B0D C;  3AZF B;  4LD9 C;  5AVC A;  1H3O B;  1P3M A;  3WAA A;  3LJA C;  1P3A A;  3AZG D;  3REJ B;  1H3O A;  2RVQ C;  3AYW D;  4YS3 C;  4R8P C;  3VH5 T;  3C1C A;  5AV8 D;  3B6G C;  1P3I A;  5B31 B;  3W97 C;  5AV5 C;  3IP4 C;  5BS7 A;  3MGP C;  5DNM D;  4XZQ A;  4KGC C;  3TU4 C;  3FDD A;  2DF4 C;  5AY8 A;  1KX5 B;  1N1J A;  4YM6 B;  3AZH D;  4Z5T B;  1F1E A;  3H0L C;  5F99 D;  5B2I D;  5BNV B;  5E5A B;  3C1B A;  3AZE A;  3X1S C;  3A6N D;  1T3U A;  1P3M D;  4H9Q A;  4WU8 D;  1P34 B;  5B0Y C;  5JRG B;  1P3K C;  4WU9 C;  4G91 B;  4EO5 C;  3X1V C;  3AV2 A;  5GSU A;  3AYW A;  3AZG B;  2CV5 D;  3C1C D;  5CPI A;  3X1T D;  4Z2M H;  5JA4 B;  3X1U A;  2HUE C;  3X1T C;  5GSU C;  2IO5 B;  3AV2 C;  3X1V A;  3WTP D;  1P3I B;  5B31 D;  4WV4 B;  4H9O A;  4WU9 D;  3AZH A;  4J8W B;  1M19 D;  4XZQ B;  4H9R A;  3B0C T;  4YS3 B;  3AZE C;  2G5I C;  1P3B B;  2W8S A;  3WKJ B;  3AL0 C;  3LZ1 D;  2BYK A;  4ZBJ B;  3NQJ A;  3W99 D;  3NQU B;  2XD1 A;  2BYK B;  2ARO D;  5B1L A;  4E44 A;  3TU4 A;  1M1A A;  3AZF A;  5GSU D;  5DNM C;  4M6B A;  5GXQ B;  5B2J B;  4J8V A;  3WAA D;  1F66 C;  5CHL B;  1P3L B;  3MGR A;  5AV5 B;  3X1V D;  3AZJ B;  3X1U B;  1P3K D;  5B32 G;  5B1M B;  3UTA A;  5BNX B;  3B6G B;  3WTP B;  1P3I D;  3LJA D;  1F66 A;  1TAF B;  3X1S D;  3KXB A;  3H0R C;  5B33 A;  3W96 D;  5B24 C;  4J8W D;  1M19 B;  4XZQ D;  3B0C W;  3UT9 B;  3LZ0 C;  3NQJ B;  2ZM5 A;  2J8P A;  4Z5T C;  2PYO C;  3EPK A;  4ZBJ C;  5B31 G;  5CP6 D;  4ZUX D;  3MGP D;  1P3A B;  1M1A D;  3AZF D;  3LEL C;  1W2E A;  5B1L B;  5B32 D;  2Y2Q A;  5AV9 A;  3UTB C;  1KX4 D;  5F99 C;  5B2J A;  3KUY D;  4WU8 A;  3MGQ C;  2HUE B;  2Y2H A;  1M18 C;  1AOI B;  5GXQ C;  4WNN A;  3V9R B;  3AV2 D;  5B40 D;  4KGC D;  4X23 D;  1A7W A;  3AN2 B;  3EPJ A;  3AZG C;  2NZD C;  5AV5 D;  2HIO A;  4UPK A;  3X1U C;  3AN2 A;  5CPI C;  5AV8 C;  3B6G D;  3REI C;  3W96 B;  3AZH B;  2YFW A;  4J8U C;  5BNV A;  1M19 A;  4H9R B;  3B0B A;  5AVB C;  4HGA B;  3AZE B;  1P3B C;  3WKJ C;  4H9S A;  3LZ1 A;  4NE3 A;  5GT0 D; 
#chains in the Genus database with same CATH homology
 3NQU A;  1KU5 A;  4H9N A;  5CP6 B;  3MNN D;  2Y2I A;  2FJ7 C;  3LZ0 B;  1ID3 A;  5B1L D;  5JRG D;  2F8N B;  3AZN C;  4WNN B;  3KFU G;  3P5J B;  4CAY A;  3AFA A;  4Z66 D;  4Z66 C;  2CV5 B;  3REK D;  3AZJ C;  1KX3 A;  4KGC A;  5AV6 A;  3AZK D;  3WTP E;  1AOI D;  1BFM A;  2HIO B;  1HQ3 B;  1TZY D;  3AFA B;  3V9R A;  3AN2 D;  3B6F D;  1S32 A;  4R8P A;  3MNN C;  1P3F D;  4YS3 A;  5B0Z A;  5BO0 B;  3AZI D;  1P3B D;  2PYO B;  3MGS C;  3AZM D;  5G49 A;  3WA9 D;  5AVB B;  4J8U D;  1P3G A;  1P3G C;  3LZ1 B;  5G49 B;  1P3O B;  5GT0 A;  2FFF B;  3REH A;  1WWI A;  4H9P B;  3MGS D;  4QLC D;  1P3O A;  1ID3 D;  3AZI C;  5CP6 A;  4ZUX A;  1S32 C;  3REK A;  5AV9 D;  4YM6 C;  5GXQ D;  2JSS A;  2NZD B;  5B2J D;  4WJ3 C;  1TZY A;  4Z66 B;  3KUY A;  5AV6 C;  2YFV B;  2FJ7 B;  1M18 B;  3AFA C;  1AOI C;  3REK C;  3AZJ D;  1ULY A;  4X23 A;  5BO0 A;  2BYM B;  5KDM B;  1ID3 C;  3REJ C;  4J8X B;  5CPJ B;  3AZM A;  5KDM A;  5FUG B;  4Z5T D;  5C3I B;  4H9S C;  3H0M C;  3WA9 A;  3KWQ C;  3WKJ A;  5AVC D;  2JE5 A;  3MVD C;  5B24 D;  4J8W C;  4J8U B;  1P3G B;  3MVD D;  3MGS A;  4HGA C;  5CPK C;  3W98 A;  4G92 C;  3MGS B;  3VH5 W;  4WU8 B;  5AV8 A;  4H9N B;  3REI D;  1ZLA C;  2Y2L A;  1HTA A;  2HIO C;  2Y2N A;  2F8N A;  5DNN A;  3AZK C;  3KSY A;  1PZR A;  2NZD D;  4J8V B;  3AZN B;  4E45 A;  2G5H C;  5AY8 D;  4Z66 A;  1KX3 D;  5AV6 B;  5DNM B;  3AZN A;  1M18 D;  2UWX A;  3MGQ D;  5B2J C;  1HQ3 C;  2ARO C;  5F99 A;  5AV9 C;  4YM6 D;  3UTB A;  1BH9 A;  1P3L C;  1B6W A;  5CPJ D;  3C1B D;  4J8X D;  5B0Z B;  3LEL D;  1KX4 C;  3W99 C;  5B2I B;  3LZ1 C;  3WKJ D;  4XUJ B;  3A6N A;  1EQZ C;  2PYO A;  4CSR A;  3KWQ B;  3AZE D;  4XUJ A;  3A6N B;  5AVB A;  5B24 B;  3R45 B;  3VH6 A;  3LZ0 A;  4J8U A;  1P3G D;  1M19 C;  3UT9 C;  1P34 D;  1JFI A;  3REI A;  5CPI D;  4H9P A;  3AV1 B;  3C1C B;  3REL C;  2NQB B;  2F8N D;  4JJN C;  1U35 C;  5B31 A;  3AZG A;  3AYW B;  3AV1 A;  2NQB A;  3REK B;  3B6F C;  3MGR C;  4KUD D;  3AZK B;  5DNN B;  3WTP A;  2F8N K;  4J8V C;  3MGQ A;  4WU8 C;  2Y2K A;  2YFV A;  2ZY5 A;  3EPH A;  5DNM A;  3AZF C;  5BT1 C;  4LD9 B;  1M1A C;  3LEL A;  1BH8 A;  2BYM A;  5B1L C;  3UTB B;  4AWL B;  2ZY2 A;  3W99 B;  2PYO D;  3O62 C;  3AZM B;  1B67 A;  2Y2P A;  3VH5 A;  4XUJ D;  3O62 D;  2BG1 A;  2ARO B;  2Y2G A;  3W96 C;  4ZUX B;  4DRA A;  5B24 A;  1JFI B;  3MGP B;  2LY8 A;  2RIQ A;  5BT1 D;  5B33 C;  3KXB C;  3TU4 B;  5CPI B;  3WAA B;  3UTA C;  3AV1 C;  3AV1 D;  2NQB D;  2NQB C;  5B31 C;  4KUD A;  4WZS B;  3X1T A;  3W97 B;  4JJN A;  1U35 A;  4CAY B;  3X1U D;  2CV5 A;  3KXB D;  4H9O B;  4KGC B;  3MGR B;  4KUD B;  3REL D;  5DNN D;  4Z2M G;  3LJA B;  5B40 C;  4WU9 A;  3A1K A;  5FUG A;  1P34 C;  3UT9 D;  4XUJ C;  4UUZ A;  1TAF A;  2Y2M A;  5B0Y D;  5B32 C;  3UTB D;  5E5A D;  3A6N C;  1EQZ D;  3W99 A;  1KX4 A;  4NE5 A;  1M1A B;  2ARO A;  5B32 A;  3F6T A;  3AZH C;  3LZ0 D;  4XZQ C;  1P34 A;  5BS7 C;  3TU4 D;  5AV5 A;  3W97 A;  3X1T B;  5DNN C;  3AV2 B;  5GT3 D;  5B40 A;  1P3I C;  5BNX A;  3C1C C;  3B6G A;  2CV5 C;  2HIO D;  4JJN B;  5JA4 A;  4J8V D;  1U35 B;  1ZLA D;  1P3K B;  3KXB B;  4WU9 B;  3UTA D;  3AYW C;  3MGR D;  1N1J B;  1BH9 B;  4KUD C;  4G91 C;  4EO5 B;  3B6F B;  2F2A C;  5CPK A;  3W98 C;  3LJA A;  3WAA C;  4UUZ B;  1P3M C;  1F66 D;  1P3K A;  3X1S B;  5B0Y A;  5B33 D;  4J8W A;  4LD9 A;  4NFT A;  5B0Y B;  3X1S A;  4CSR B;  3KWQ A;  1P3P B;  3W96 A;  3C1B C;  3WA9 B;  3A1I A;  3MNN B;  5JRG A;  3O62 A;  5GSU B;  3REJ D;  5AY8 C;  5B32 B;  1AOI A;  3EG5 B;  3AZL B;  3MGP A;  4J8X C;  5CPJ C;  1P3L D;  3KUY B;  1HQ3 D;  3AZL A;  4R8P D;  1P3F A;  1WWS A;  5GT3 B;  5B40 B;  3WTP C;  5B1M D;  2RVQ D;  4X23 B;  3B6F A;  1P3F B;  4JJN D;  1U35 D;  3AZI A;  1ZLA B;  1KX5 D;  3VH6 T;  1P3A C;  2YFW B;  3REL A;  1S32 B;  4LD9 D;  5CPK B;  1F66 B;  5F99 B;  4KHA A;  5AVC C;  1P3P A;  4QLC B;  1Q9C A;  4G92 B;  3REH D;  4DQY B;  3UT9 A;  4KHA B;  4QLC A;  1P3O D;  2XD5 A;  3W98 B;  5E5A A;  1P3A D;  1P3M B;  1ID3 B;  5B0Z C;  3MVD B;  2ZY3 A;  5GT0 B;  1KX4 B;  1EQZ A;  3MNN A;  2VQR A;  5B2I C;  3R45 A;  3EPL A;  5B1M C;  5C3I C;  1P3L A;  3REI B;  5AV9 B;  1HQ3 A;  3AZL D;  3AZJ A;  1KX3 C;  2DQN C;  3W97 D;  4R8P B;  1TZY B;  3AFA D;  5GT3 A;  5AY8 B;  1KX5 A;  5AV6 D;  3AZK A;  3REL B;  2FJ7 A;  4YS3 D;  3MGQ B;  2L5A A;  1ZLA A;  3B0D B;  5B2I A;  1S32 D;  5CPK D;  3C1B B;  1P3B A;  5B0Z D;  3LEL B;  3REH B;  4QLC C;  3MVD A;  3KWQ D;  1EQZ B;  4DRB A;  1P3P C;  3W98 D;  2JCH A;  3WA9 C;  3AN2 C;  3AZM C;  2NZD A;  2IO5 C;  1KX5 C;  3REJ A;  5AV8 B;  5GT3 C;  2Y2J A;  4X23 C;  3X1V B;  1Z2C B;  5GXQ A;  3AZN D;  1M18 A;  2F8N H;  1P3F C;  3AZL C;  1KX3 B;  1R4V A;  3KUY C;  3VH6 W;  2FJ7 D;  4J8X A;  5CPJ A;  4NE6 A;  1TZY C;  2Y2O A;  1BH8 B;  4YM6 A;  5B1M A;  3UTA B;  3AZI B;  4ZUX C;  5CP6 C;  5B33 B;  5JRG C;  4Z5T A;  5AVB D;  2ZY4 A;  5E5A C;  1P3O C;  4AWL C;  1P3P D;  5AVC B;  3REH C;  2CWE A;  5GT0 C;  2F8N G;  3O62 B;  4H9Q B;  3B0D C;  3AZF B;  4LD9 C;  5AVC A;  1H3O B;  1P3M A;  3WAA A;  3LJA C;  1P3A A;  3AZG D;  3REJ B;  1H3O A;  2RVQ C;  3AYW D;  4YS3 C;  4R8P C;  3VH5 T;  3C1C A;  5AV8 D;  3B6G C;  1P3I A;  5B31 B;  3W97 C;  5AV5 C;  3IP4 C;  5BS7 A;  3MGP C;  5DNM D;  4XZQ A;  4KGC C;  3TU4 C;  3FDD A;  2DF4 C;  5AY8 A;  1KX5 B;  1N1J A;  4YM6 B;  3AZH D;  4Z5T B;  1F1E A;  3H0L C;  5F99 D;  5B2I D;  5BNV B;  5E5A B;  3C1B A;  3AZE A;  3X1S C;  3A6N D;  1T3U A;  1P3M D;  4H9Q A;  4WU8 D;  1P34 B;  5B0Y C;  5JRG B;  1P3K C;  4WU9 C;  4G91 B;  4EO5 C;  3X1V C;  3AV2 A;  5GSU A;  3AYW A;  3AZG B;  2CV5 D;  3C1C D;  5CPI A;  3X1T D;  4Z2M H;  5JA4 B;  3X1U A;  2HUE C;  3X1T C;  5GSU C;  2IO5 B;  3AV2 C;  3X1V A;  3WTP D;  1P3I B;  5B31 D;  4WV4 B;  4H9O A;  4WU9 D;  3AZH A;  4J8W B;  1M19 D;  4XZQ B;  4H9R A;  3B0C T;  4YS3 B;  3AZE C;  2G5I C;  1P3B B;  2W8S A;  3WKJ B;  3AL0 C;  3LZ1 D;  2BYK A;  4ZBJ B;  3NQJ A;  3W99 D;  3NQU B;  2XD1 A;  2BYK B;  2ARO D;  5B1L A;  4E44 A;  3TU4 A;  1M1A A;  3AZF A;  5GSU D;  5DNM C;  4M6B A;  5GXQ B;  5B2J B;  4J8V A;  3WAA D;  1F66 C;  5CHL B;  1P3L B;  3MGR A;  5AV5 B;  3X1V D;  3AZJ B;  3X1U B;  1P3K D;  5B32 G;  5B1M B;  3UTA A;  5BNX B;  3B6G B;  3WTP B;  1P3I D;  3LJA D;  1F66 A;  1TAF B;  3X1S D;  3KXB A;  3H0R C;  5B33 A;  3W96 D;  5B24 C;  4J8W D;  1M19 B;  4XZQ D;  3B0C W;  3UT9 B;  3LZ0 C;  3NQJ B;  2ZM5 A;  2J8P A;  4Z5T C;  2PYO C;  3EPK A;  4ZBJ C;  5B31 G;  5CP6 D;  4ZUX D;  3MGP D;  1P3A B;  1M1A D;  3AZF D;  3LEL C;  1W2E A;  5B1L B;  5B32 D;  2Y2Q A;  5AV9 A;  3UTB C;  1KX4 D;  5F99 C;  5B2J A;  3KUY D;  4WU8 A;  3MGQ C;  2HUE B;  2Y2H A;  1M18 C;  1AOI B;  5GXQ C;  4WNN A;  3V9R B;  3AV2 D;  5B40 D;  4KGC D;  4X23 D;  1A7W A;  3AN2 B;  3EPJ A;  3AZG C;  2NZD C;  5AV5 D;  2HIO A;  4UPK A;  3X1U C;  3AN2 A;  5CPI C;  5AV8 C;  3B6G D;  3REI C;  3W96 B;  3AZH B;  2YFW A;  4J8U C;  5BNV A;  1M19 A;  4H9R B;  3B0B A;  5AVB C;  4HGA B;  3AZE B;  1P3B C;  3WKJ C;  4H9S A;  3LZ1 A;  4NE3 A;  5GT0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...