4WU8A

Structure of trptnap-ncp145
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
96
structure length
96
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (145-MER)
publication title Stereochemical control of nucleosome targeting by platinum-intercalator antitumor agents.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wu8A00
2FJ7D 5B1LA 3X1VA 3UTAA 1ZLAA 3W96D 3AZLB 3X1UD 3AN2D 1B6WA 3X1TC 4E45A 1ID3C 3NQJA 5F99B 4H9OA 5AV5D 5B31C 3X1SB 1P3IA 5AVCC 3R45A 4M6BA 4H9PA 4Z66A 4J8UB 4YM6D 5AV9C 5B31B 4X23B 3B6FB 2NZDB 4XUJB 1P3LC 5CPKA 5B40B 3MGPC 5AV6B 3AZHB 1AOID 4QLCA 3X1VC 1P3LB 3AZKD 4Z2MH 1P3GD 1TZYA 3AZFB 5AY8A 3W99D 1U35A 4WU8A 1F66D 4H9NA 3MGSA 1S32D 5B1LB 3WTPD 3X1VB 1P3IC 1P3AA 3UTAB 1ZLAB 1M18A 3WAAB 3VH5A 3REIA 1P3PA 5B31G 5B1MD 3AZMB 4R8PA 3R45B 2PYOD 5CPKC 3UT9A 4H9PB 5BNXB 1F1EA 4Z66B 3W96A 5B32A 3AN2A 4QLCC 3RELD 3B0DB 3MGQB 1N1JA 2L5AA 5JA4A 3AV1D 1U35C 4WU8C 5GSUD 3MGSC 1JFIA 4YM6A 1M18C 1TZYB 5AY8B 3AYWA 3O62C 3REIC 3AZLD 5B2IB 1U35B 3W98A 2JSSA 4WU8B 2F8NH 5F99D 1P3AB 2YFWA 3X1SD 1M18B 3UT9C 1B67A 3REIB 1P3PB 3AZKA 4H9QB 1P3GA 3W96C 5B32C 3X1UC 4JJNA 4R8PB 3AN2C 4J8UD 4H9SA 5B31D 4X23D 3B6FD 2NZDD 1F66A 4Z2MG 4XUJD 3WA9A 5AV5C 3AZEA 5B40D 3W96B 1H3OB 5B32B 5AV6D 3W97D 3AZHD 5GXQB 4YM6C 5DNNA 1P3LD 3AZFD 5JA4B 4J8VB 4NE6A 2IO5C 2F8NB 5B1LD 3X1VD 3UTAD 1ZLAD 3AYWB 3WAAD 5BS7A 3AZJA 3AZKC 3W98B 1P3GC 3RELA 2IO5B 2CV5A 4H9SC 3AZMD 5BO0B 3W99C 3AZGB 1F66C 3B0CT 5GSUA 3WA9C 5B32G 3AZEC 5JRGB 4JJNB 1KX4A 4Z66D 3AV2B 4KGCB 5B1MC 5F99A 5DNNC 3WA9B 3AZEB 5B2JA 3LJAB 2PYOC 2F8NG 3KSYA 3MGQD 2BYKB 4WNNA 3LZ0A 3C1BA 1R4VA 5DNNB 4XZQB 4J8UA 4WU9B 1HTAA 1TZYD 4H9RB 5AY8D 5BS7C 2NZDA 1M1AA 4XUJA 5B2ID 3RELC 1U35D 4WU8D 5C3IB 3REHA 3AV1C 1P3AD 5GSUC 3W97A 5AV6A 3AZHA 1M18D 4AWLC 3AZJB 2F8NK 1P3PD 3TU4A 2CV5B 3AZLC 3AZFA 4DRAA 4R8PD 1P3KB 3WKJA 5F99C 3C1CB 5GT0B 4AWLB 5B2JC 3B6GD 2RVQD 3X1SC 1KX4B 4HGAC 3WAAA 5B32D 5B33A 3AZIB 5GXQD 4J8UC 5B2JB 3AZMA 4X23C 3B6FC 2NZDC 4HGAB 2YFVB 4WNNB 3VH5W 4XUJC 5BNVA 3LZ0B 3AFAB 3C1BB 4J8VD 5B40C 5BNXA 3REHC 2F8ND 5AV6C 3W97C 3AZHC 3AYWD 1M1AB 3W98D 4J8XB 3AZFC 4YS3A 3REHB 2AROA 3WKJC 3MGQA 5B0YB 3W97B 3AZGD 5B1LC 3MVDA 3TU4B 5KDMB 3UTAC 5JRGD 1ZLAC 3WAAC 4JJND 3WKJB 3REJA 5B2IA 3AV2D 4KGCD 3AZMC 3WA9D 2CWEA 3AZED 1KX3B 3LJAD 3VH6T 5B33B 4H9QA 5GT3B 4Z66C 5FUGB 5DNND 4KUDA 4XZQD 4WU9D 5BNVB 3B6GA 3B0DC 1Q9CA 1P3OB 3MGQC 1H3OA 5GXQA 3AZJD 3MVDC 4LD9B 1TZYC 4YS3B 5AY8C 2CV5D 2AROB 1EQZB 3REJC 5B2IC 1P3KD 4J8VA 3C1CD 5GT0D 2F8NA 3MVDB 1P3AC 1KX4D 4G92B 3REJB 1P3PC 3KWQA 1HQ3B 3UTBB 3AZID 4R8PC 5B2JD 1P3FB 5BO0A 3AZGA 3AFAD 3LZ0D 3B6GC 2RVQC 3C1BD 5B24B 5JRGA 4KUDB 5GXQC 3AV2A 4KGCA 1KX5B 1M1AD 3B6GB 4NE5A 4J8XD 2NQBB 5BT1D 3LJAA 3REHD 1KU5A 3V9RA 4J8VC 5B0YD 2BYKA 2BYMA 3TU4D 4XZQA 4WU9A 3AYWC 4H9RA 3W98C 3WKJD 3AZGC 1KX3D 4CSRB 4Z5TB 5CP6B 5B33D 5JRGC 3KWQB 4JJNC 5GT3D 4ZUXA 3AV2C 1P3KA 4KGCC 4G91C 3C1CA 5GT0A 3LJAC 1P3OD 4G91B 5AVBA 5CPJB 4NFTA 3AZIA 1P34A 4LD9D 4XZQC 4WU9C 1P3BB 3VH6A 1EQZD 4YS3D 2AROD 3V9RB 5B0ZA 4J8WA 2YFVA 3AFAA 2BYMB 5C3IC 3MNNB 3MVDD 5AV8A 5CPIA 3NQUA 3AZJC 3A6NB 3REJD 2CV5C 3MGRA 4J8XA 1HQ3D 3UTBD 3LZ1B 1P3KC 1P3FD 3LELB 5B0YA 3C1CC 5GT0C 1KX4C 5KDMA 5B24D 4ZUXB 1TAFA 4KUDD 4UUZA 5AVBC 4WZSB 3AZIC 1P34C 1KX5D 5B0ZC 4J8WC 3X1TA 1KX3A 2NQBD 3AFAC 3LZ0C 3AZNB 3C1BC 5AVBB 5E5AA 1P34B 5GT3A 5AV8C 5AVCA 5FUGA 5CPIC 5B0ZB 5DNMB 4J8WB 1WWSA 1M1AC 2HUEB 4EO5B 3MGRC 4J8XC 5BT1C 1BH8A 1P3OA 3B0CW 5AV8B 5B0YC 5CPIB 3NQUB 4Z5TD 1P3MB 3REKB 5CP6D 3TU4C 4LD9A 3KWQD 3MGRB 1EQZA 1KX3C 1TAFB 4CAYA 4UUZB 5B33C 5E5AC 5GT3C 5CPJD 1HQ3A 3UTBA 1P3FA 3KXBA 3X1TB 1P3BD 1ID3B 2HIOA 5E5AB 1P3OC 5B24A 5AVCB 3MNND 4ZBJC 3A6ND 4LD9C 1KX5A 1EQZC 4YS3C 1BH8B 5AV9B 2AROC 2NQBA 3LZ1D 3LELD 4ZBJB 1BH9A 3MGPB 4G92C 3KUYA 4ZUXD 4DRBA 1M19A 1HQ3C 3UTBC 1P3FC 3KXBC 3O62A 4CAYB 3NQJB 4H9OB 3AZND 4CSRA 4Z5TA 2HIOC 5CP6A 5B24C 5AVBD 1P3IB 1P34D 4KUDC 3KXBB 2FJ7A 5DNMD 5B0ZD 4J8WD 1KX5C 2HIOB 3X1UA 2LY8A 2NQBC 5AV8D 5CPKB 5CPID 5AV5A 5CPJA 1P3MD 3REKD 3KUYC 3MGRD 4QLCB 1P3BA 1M19C 1BH9B 3MNNA 3VH6W 3KUYB 4H9NB 4Z5TC 1M19B 3MGSB 3A6NA 5CP6C 3KWQC 1AOIA 3O62B 3LZ1A 2FJ7C 4KHAA 3LELA 3X1TD 1ID3D 5E5AD 4E44A 3W99A 5AVCD 3UT9B 1S32A 2FJ7B 3WTPA 5CPJC 5CHLB 3X1UB 3AN2B 1P3BC 5AV9D 5B1MA 3AZNA 4WV4B 5AV5B 3MNNC 1N1JB 2PYOA 1WWIA 3MGPD 3A6NC 5DNMA 1JFIB 4YM6B 1A7WA 1AOIC 3LZ1C 3LELC 5G49A 3VH5T 2YFWB 3REKA 1P3ID 1P3MA 3AV1A 4ZUXC 3WTPE 1AOIB 1S32C 4KHAB 3WTPC 3KXBD 3AZKB 1P3GB 2HIOD 3AZLA 3W99B 1F66B 3AZNC 1ULYA 1S32B 3WTPB 5CPKD 3B0BA 3X1SA 4NE3A 5DNMC 4QLCD 5B1MB 1ID3A 2HUEC 4EO5C 5B31A 4X23A 2PYOB 3B6FA 3KUYD 5B40A 1M19D 3MGSD 1P3MC 3REKC 5AV9A 3O62D 5G49B 3REID 3RELB 1P3LA 1BFMA 3AV1B 3MGPA 5GSUB 3UT9D
chains in the Genus database with same CATH superfamily
2FJ7D 5B1LA 3X1VA 3UTAA 1ZLAA 3W96D 3AZLB 3X1UD 3AN2D 3H0MC 1B6WA 3X1TC 4E45A 1ID3C 3NQJA 2G5IC 5F99B 4H9OA 2ZY2A 5AV5D 5B31C 3X1SB 1P3IA 5AVCC 3R45A 2VQRA 4M6BA 4H9PA 2ZY3A 4Z66A 4YM6D 4J8UB 5AV9C 5B31B 4X23B 3B6FB 2NZDB 4XUJB 1P3LC 5CPKA 2G5HC 5B40B 3MGPC 5AV6B 3AZHB 1AOID 4QLCA 3X1VC 1P3LB 3AZKD 4Z2MH 1P3GD 1TZYA 3AZFB 5AY8A 2DF4C 3W99D 1U35A 4WU8A 1F66D 4H9NA 3MGSA 1S32D 5B1LB 3WTPD 3X1VB 1P3IC 1P3AA 3UTAB 1ZLAB 1M18A 3WAAB 3VH5A 3REIA 1P3PA 5B31G 5B1MD 3AZMB 4R8PA 3EPKA 3R45B 2PYOD 5CPKC 3UT9A 4H9PB 5BNXB 1F1EA 4Z66B 3W96A 2Y2LA 5B32A 3AN2A 4QLCC 3RELD 3B0DB 3MGQB 1N1JA 2L5AA 5JA4A 3AV1D 1U35C 4WU8C 5GSUD 3MGSC 1JFIA 4YM6A 1M18C 1TZYB 5AY8B 3AYWA 3O62C 2BG1A 3REIC 5B2IB 3AZLD 1U35B 3W98A 2JSSA 4WU8B 2F8NH 5F99D 1P3AB 2FFFB 2YFWA 3X1SD 1M18B 3UT9C 1B67A 3REIB 1P3PB 3AZKA 4H9QB 1P3GA 3W96C 5B32C 3X1UC 4JJNA 4R8PB 3AN2C 4J8UD 4H9SA 5B31D 4X23D 3B6FD 2NZDD 1F66A 4Z2MG 3H0RC 4XUJD 3WA9A 5AV5C 3AZEA 5B40D 3W96B 1H3OB 5B32B 2Y2OA 5AV6D 3W97D 3AZHD 5GXQB 4YM6C 5DNNA 1P3LD 3AZFD 5JA4B 4J8VB 4NE6A 2IO5C 2F8NB 5B1LD 3X1VD 3UTAD 1ZLAD 3AYWB 3WAAD 5BS7A 3AZJA 3AZKC 3W98B 1P3GC 3RELA 2IO5B 2CV5A 4H9SC 3AZMD 5BO0B 3W99C 3AZGB 1F66C 3B0CT 5GSUA 3WA9C 5B32G 3AZEC 5JRGB 4JJNB 1KX4A 4Z66D 3AV2B 4KGCB 5B1MC 5F99A 1T3UA 5DNNC 3WA9B 3AZEB 5B2JA 3LJAB 2PYOC 1Z2CB 2F8NG 3KSYA 3MGQD 2BYKB 4WNNA 3LZ0A 3C1BA 1R4VA 5DNNB 4XZQB 4J8UA 4WU9B 1HTAA 1TZYD 4H9RB 5AY8D 5BS7C 2NZDA 1M1AA 4XUJA 5B2ID 3RELC 1U35D 2RIQA 4WU8D 5C3IB 3REHA 3AV1C 1P3AD 5GSUC 3W97A 5AV6A 3AZHA 1M18D 4AWLC 3AZJB 2F8NK 1P3PD 3TU4A 2CV5B 3AZLC 3AZFA 4DRAA 4R8PD 1P3KB 3WKJA 5F99C 3C1CB 5GT0B 4AWLB 5B2JC 3B6GD 2RVQD 3X1SC 1KX4B 4HGAC 2W8SA 3WAAA 5B32D 5B33A 3AZIB 5GXQD 4J8UC 5B2JB 3AZMA 3KFUG 4X23C 3B6FC 2NZDC 4HGAB 2YFVB 4WNNB 3VH5W 4XUJC 5BNVA 3LZ0B 3AFAB 3C1BB 4J8VD 5B40C 5BNXA 3REHC 2F8ND 5AV6C 3W97C 3AZHC 3AYWD 1M1AB 3W98D 4J8XB 3AZFC 4YS3A 3REHB 2AROA 3WKJC 3MGQA 5B0YB 3W97B 3AZGD 5B1LC 3MVDA 3TU4B 5KDMB 3UTAC 5JRGD 1ZLAC 3WAAC 4JJND 3EPHA 3WKJB 3REJA 5B2IA 3AV2D 4KGCD 3H0LC 3AZMC 3WA9D 2CWEA 3AZED 1KX3B 3LJAD 3VH6T 5B33B 4H9QA 5GT3B 4Z66C 5FUGB 5DNND 2XD1A 4XZQD 2Y2GA 4WU9D 4KUDA 5BNVB 3B6GA 3B0DC 1Q9CA 1P3OB 3MGQC 1H3OA 5GXQA 3AZJD 3MVDC 4LD9B 1TZYC 4YS3B 5AY8C 2CV5D 2AROB 1EQZB 3REJC 5B2IC 1P3KD 4J8VA 3C1CD 5GT0D 2F8NA 3MVDB 1P3AC 1KX4D 4G92B 3REJB 1P3PC 3KWQA 1HQ3B 3UTBB 3AZID 4R8PC 5B2JD 1P3FB 5BO0A 3AZGA 3AFAD 3LZ0D 3B6GC 2RVQC 3C1BD 5B24B 5JRGA 2ZM5A 4KUDB 5GXQC 3AV2A 4KGCA 1KX5B 1M1AD 3B6GB 4NE5A 4J8XD 2NQBB 5BT1D 3LJAA 1W2EA 1KU5A 3V9RA 3A1KA 3REHD 4J8VC 5B0YD 2BYKA 2BYMA 3TU4D 4XZQA 4WU9A 3AYWC 4H9RA 3W98C 3WKJD 3AZGC 1KX3D 4CSRB 4Z5TB 5CP6B 5B33D 5JRGC 3KWQB 4JJNC 5GT3D 4ZUXA 3AV2C 1P3KA 4KGCC 4G91C 3C1CA 5GT0A 3LJAC 1P3OD 4WJ3C 4G91B 5AVBA 5CPJB 4NFTA 3AZIA 1P34A 3EG5B 4XZQC 4LD9D 4WU9C 1P3BB 3VH6A 1EQZD 4YS3D 2AROD 3V9RB 5B0ZA 4J8WA 2YFVA 3AFAA 2BYMB 5C3IC 3MNNB 3MVDD 5AV8A 3EPLA 5CPIA 3NQUA 3AZJC 3A6NB 3REJD 2CV5C 3MGRA 4J8XA 1HQ3D 3UTBD 3LZ1B 1P3KC 1P3FD 3LELB 5B0YA 3C1CC 5GT0C 3IP4C 3EPJA 1KX4C 5KDMA 5B24D 4ZUXB 1TAFA 4KUDD 2ZY5A 3F6TA 4UUZA 5AVBC 4WZSB 3AZIC 1P34C 2XD5A 1KX5D 4DQYB 5B0ZC 4J8WC 3X1TA 1KX3A 2NQBD 3AFAC 3LZ0C 3AZNB 3C1BC 5AVBB 5E5AA 1P34B 2Y2JA 5GT3A 5AV8C 5AVCA 5FUGA 5CPIC 2JCHA 5B0ZB 5DNMB 4J8WB 1WWSA 1M1AC 2HUEB 4EO5B 3MGRC 4J8XC 5BT1C 1BH8A 1P3OA 3B0CW 5AV8B 5B0YC 5CPIB 3NQUB 4Z5TD 1P3MB 3REKB 5CP6D 3TU4C 4LD9A 3KWQD 3MGRB 1EQZA 2F2AC 1KX3C 1TAFB 4CAYA 4UUZB 5B33C 3AL0C 5E5AC 1PZRA 5GT3C 5CPJD 1HQ3A 3UTBA 1P3FA 3KXBA 3X1TB 1P3BD 1ID3B 2HIOA 5E5AB 1P3OC 5B24A 5AVCB 2Y2KA 3MNND 4ZBJC 3A6ND 4LD9C 1KX5A 1EQZC 4YS3C 1BH8B 5AV9B 2AROC 2NQBA 3LZ1D 3LELD 4ZBJB 1BH9A 3MGPB 4G92C 3KUYA 4ZUXD 4DRBA 1M19A 1HQ3C 3UTBC 1P3FC 3KXBC 3O62A 4CAYB 3NQJB 4H9OB 3AZND 4CSRA 4Z5TA 2HIOC 5CP6A 5B24C 5AVBD 1P3IB 1P34D 4KUDC 3KXBB 3FDDA 2FJ7A 5DNMD 5B0ZD 4J8WD 1KX5C 2Y2QA 2HIOB 3X1UA 2LY8A 2NQBC 5AV8D 5CPKB 5CPID 5AV5A 5CPJA 1P3MD 3REKD 2Y2IA 3KUYC 3MGRD 4QLCB 1P3BA 1M19C 1BH9B 3MNNA 3VH6W 3KUYB 4H9NB 4Z5TC 1M19B 3MGSB 3A6NA 5CP6C 3KWQC 1AOIA 3O62B 3LZ1A 2FJ7C 4KHAA 3LELA 3X1TD 1ID3D 5E5AD 4E44A 3W99A 5AVCD 3UT9B 1S32A 2FJ7B 3WTPA 5CPJC 5CHLB 3X1UB 3AN2B 1P3BC 5AV9D 5B1MA 3AZNA 4WV4B 5AV5B 3MNNC 1N1JB 2PYOA 1WWIA 3MGPD 3A6NC 2Y2NA 5DNMA 1JFIB 4YM6B 1A7WA 1AOIC 2JE5A 3LZ1C 3LELC 3A1IA 5G49A 3VH5T 4UPKA 2YFWB 3REKA 1P3ID 1P3MA 3AV1A 4ZUXC 3WTPE 1AOIB 1S32C 4KHAB 3WTPC 3KXBD 3AZKB 1P3GB 2HIOD 3AZLA 3W99B 1F66B 2Y2PA 3AZNC 1ULYA 1S32B 3WTPB 5CPKD 3B0BA 3X1SA 4NE3A 5DNMC 4QLCD 5B1MB 1ID3A 2HUEC 2ZY4A 4EO5C 5B31A 4X23A 2PYOB 3B6FA 2Y2HA 3KUYD 2Y2MA 5B40A 3P5JB 3MGSD 1P3MC 3REKC 1M19D 5AV9A 3O62D 5G49B 3REID 3RELB 1P3LA 1BFMA 2DQNC 2UWXA 3AV1B 3MGPA 5GSUB 2J8PA 3UT9D
chains in the Genus database with same CATH topology
2FJ7D 5B1LA 3X1VA 3UTAA 1ZLAA 3W96D 3AZLB 3X1UD 3AN2D 3H0MC 1B6WA 3X1TC 4E45A 1ID3C 3NQJA 2G5IC 5F99B 4H9OA 2ZY2A 5AV5D 5B31C 3X1SB 1P3IA 5AVCC 3R45A 2VQRA 4M6BA 4H9PA 2ZY3A 4Z66A 4YM6D 4J8UB 5AV9C 5B31B 4X23B 3B6FB 2NZDB 4XUJB 1P3LC 5CPKA 2G5HC 5B40B 3MGPC 5AV6B 3AZHB 1AOID 4QLCA 3X1VC 1P3LB 3AZKD 4Z2MH 1P3GD 1TZYA 3AZFB 5AY8A 2DF4C 3W99D 1U35A 4WU8A 1F66D 4H9NA 3MGSA 1S32D 5B1LB 3WTPD 3X1VB 1P3IC 1P3AA 3UTAB 1ZLAB 1M18A 3WAAB 3VH5A 3REIA 1P3PA 5B31G 5B1MD 3AZMB 4R8PA 3EPKA 3R45B 2PYOD 5CPKC 3UT9A 4H9PB 5BNXB 1F1EA 4Z66B 3W96A 2Y2LA 5B32A 3AN2A 4QLCC 3RELD 3B0DB 3MGQB 1N1JA 2L5AA 5JA4A 3AV1D 1U35C 4WU8C 5GSUD 3MGSC 1JFIA 4YM6A 1M18C 1TZYB 5AY8B 3AYWA 3O62C 2BG1A 3REIC 5B2IB 3AZLD 1U35B 3W98A 2JSSA 4WU8B 2F8NH 5F99D 1P3AB 2FFFB 2YFWA 3X1SD 1M18B 3UT9C 1B67A 3REIB 1P3PB 3AZKA 4H9QB 1P3GA 3W96C 5B32C 3X1UC 4JJNA 4R8PB 3AN2C 4J8UD 4H9SA 5B31D 4X23D 3B6FD 2NZDD 1F66A 4Z2MG 3H0RC 4XUJD 3WA9A 5AV5C 3AZEA 5B40D 3W96B 1H3OB 5B32B 2Y2OA 5AV6D 3W97D 3AZHD 5GXQB 4YM6C 5DNNA 1P3LD 3AZFD 5JA4B 4J8VB 4NE6A 2IO5C 2F8NB 5B1LD 3X1VD 3UTAD 1ZLAD 3AYWB 3WAAD 5BS7A 3AZJA 3AZKC 3W98B 1P3GC 3RELA 2IO5B 2CV5A 4H9SC 3AZMD 5BO0B 3W99C 3AZGB 1F66C 3B0CT 5GSUA 3WA9C 5B32G 3AZEC 5JRGB 4JJNB 1KX4A 4Z66D 3AV2B 4KGCB 5B1MC 5F99A 1T3UA 5DNNC 3WA9B 3AZEB 5B2JA 3LJAB 2PYOC 1Z2CB 2F8NG 3KSYA 3MGQD 2BYKB 4WNNA 3LZ0A 3C1BA 1R4VA 5DNNB 4XZQB 4J8UA 4WU9B 1HTAA 1TZYD 4H9RB 5AY8D 5BS7C 2NZDA 1M1AA 4XUJA 5B2ID 3RELC 1U35D 2RIQA 4WU8D 5C3IB 3REHA 3AV1C 1P3AD 5GSUC 3W97A 5AV6A 3AZHA 1M18D 4AWLC 3AZJB 2F8NK 1P3PD 3TU4A 2CV5B 3AZLC 3AZFA 4DRAA 4R8PD 1P3KB 3WKJA 5F99C 3C1CB 5GT0B 4AWLB 5B2JC 3B6GD 2RVQD 3X1SC 1KX4B 4HGAC 2W8SA 3WAAA 5B32D 5B33A 3AZIB 5GXQD 4J8UC 5B2JB 3AZMA 3KFUG 4X23C 3B6FC 2NZDC 4HGAB 2YFVB 4WNNB 3VH5W 4XUJC 5BNVA 3LZ0B 3AFAB 3C1BB 4J8VD 5B40C 5BNXA 3REHC 2F8ND 5AV6C 3W97C 3AZHC 3AYWD 1M1AB 3W98D 4J8XB 3AZFC 4YS3A 3REHB 2AROA 3WKJC 3MGQA 5B0YB 3W97B 3AZGD 5B1LC 3MVDA 3TU4B 5KDMB 3UTAC 5JRGD 1ZLAC 3WAAC 4JJND 3EPHA 3WKJB 3REJA 5B2IA 3AV2D 4KGCD 3H0LC 3AZMC 3WA9D 2CWEA 3AZED 1KX3B 3LJAD 3VH6T 5B33B 4H9QA 5GT3B 4Z66C 5FUGB 5DNND 2XD1A 4XZQD 2Y2GA 4WU9D 4KUDA 5BNVB 3B6GA 3B0DC 1Q9CA 1P3OB 3MGQC 1H3OA 5GXQA 3AZJD 3MVDC 4LD9B 1TZYC 4YS3B 5AY8C 2CV5D 2AROB 1EQZB 3REJC 5B2IC 1P3KD 4J8VA 3C1CD 5GT0D 2F8NA 3MVDB 1P3AC 1KX4D 4G92B 3REJB 1P3PC 3KWQA 1HQ3B 3UTBB 3AZID 4R8PC 5B2JD 1P3FB 5BO0A 3AZGA 3AFAD 3LZ0D 3B6GC 2RVQC 3C1BD 5B24B 5JRGA 2ZM5A 4KUDB 5GXQC 3AV2A 4KGCA 1KX5B 1M1AD 3B6GB 4NE5A 4J8XD 2NQBB 5BT1D 3LJAA 1W2EA 1KU5A 3V9RA 3A1KA 3REHD 4J8VC 5B0YD 2BYKA 2BYMA 3TU4D 4XZQA 4WU9A 3AYWC 4H9RA 3W98C 3WKJD 3AZGC 1KX3D 4CSRB 4Z5TB 5CP6B 5B33D 5JRGC 3KWQB 4JJNC 5GT3D 4ZUXA 3AV2C 1P3KA 4KGCC 4G91C 3C1CA 5GT0A 3LJAC 1P3OD 4WJ3C 4G91B 5AVBA 5CPJB 4NFTA 3AZIA 1P34A 3EG5B 4XZQC 4LD9D 4WU9C 1P3BB 3VH6A 1EQZD 4YS3D 2AROD 3V9RB 5B0ZA 4J8WA 2YFVA 3AFAA 2BYMB 5C3IC 3MNNB 3MVDD 5AV8A 3EPLA 5CPIA 3NQUA 3AZJC 3A6NB 3REJD 2CV5C 3MGRA 4J8XA 1HQ3D 3UTBD 3LZ1B 1P3KC 1P3FD 3LELB 5B0YA 3C1CC 5GT0C 3IP4C 3EPJA 1KX4C 5KDMA 5B24D 4ZUXB 1TAFA 4KUDD 2ZY5A 3F6TA 4UUZA 5AVBC 4WZSB 3AZIC 1P34C 2XD5A 1KX5D 4DQYB 5B0ZC 4J8WC 3X1TA 1KX3A 2NQBD 3AFAC 3LZ0C 3AZNB 3C1BC 5AVBB 5E5AA 1P34B 2Y2JA 5GT3A 5AV8C 5AVCA 5FUGA 5CPIC 2JCHA 5B0ZB 5DNMB 4J8WB 1WWSA 1M1AC 2HUEB 4EO5B 3MGRC 4J8XC 5BT1C 1BH8A 1P3OA 3B0CW 5AV8B 5B0YC 5CPIB 3NQUB 4Z5TD 1P3MB 3REKB 5CP6D 3TU4C 4LD9A 3KWQD 3MGRB 1EQZA 2F2AC 1KX3C 1TAFB 4CAYA 4UUZB 5B33C 3AL0C 5E5AC 1PZRA 5GT3C 5CPJD 1HQ3A 3UTBA 1P3FA 3KXBA 3X1TB 1P3BD 1ID3B 2HIOA 5E5AB 1P3OC 5B24A 5AVCB 2Y2KA 3MNND 4ZBJC 3A6ND 4LD9C 1KX5A 1EQZC 4YS3C 1BH8B 5AV9B 2AROC 2NQBA 3LZ1D 3LELD 4ZBJB 1BH9A 3MGPB 4G92C 3KUYA 4ZUXD 4DRBA 1M19A 1HQ3C 3UTBC 1P3FC 3KXBC 3O62A 4CAYB 3NQJB 4H9OB 3AZND 4CSRA 4Z5TA 2HIOC 5CP6A 5B24C 5AVBD 1P3IB 1P34D 4KUDC 3KXBB 3FDDA 2FJ7A 5DNMD 5B0ZD 4J8WD 1KX5C 2Y2QA 2HIOB 3X1UA 2LY8A 2NQBC 5AV8D 5CPKB 5CPID 5AV5A 5CPJA 1P3MD 3REKD 2Y2IA 3KUYC 3MGRD 4QLCB 1P3BA 1M19C 1BH9B 3MNNA 3VH6W 3KUYB 4H9NB 4Z5TC 1M19B 3MGSB 3A6NA 5CP6C 3KWQC 1AOIA 3O62B 3LZ1A 2FJ7C 4KHAA 3LELA 3X1TD 1ID3D 5E5AD 4E44A 3W99A 5AVCD 3UT9B 1S32A 2FJ7B 3WTPA 5CPJC 5CHLB 3X1UB 3AN2B 1P3BC 5AV9D 5B1MA 3AZNA 4WV4B 5AV5B 3MNNC 1N1JB 2PYOA 1WWIA 3MGPD 3A6NC 2Y2NA 5DNMA 1JFIB 4YM6B 1A7WA 1AOIC 2JE5A 3LZ1C 3LELC 3A1IA 5G49A 3VH5T 4UPKA 2YFWB 3REKA 1P3ID 1P3MA 3AV1A 4ZUXC 3WTPE 1AOIB 1S32C 4KHAB 3WTPC 3KXBD 3AZKB 1P3GB 2HIOD 3AZLA 3W99B 1F66B 2Y2PA 3AZNC 1ULYA 1S32B 3WTPB 5CPKD 3B0BA 3X1SA 4NE3A 5DNMC 4QLCD 5B1MB 1ID3A 2HUEC 2ZY4A 4EO5C 5B31A 4X23A 2PYOB 3B6FA 2Y2HA 3KUYD 2Y2MA 5B40A 3P5JB 3MGSD 1P3MC 3REKC 1M19D 5AV9A 3O62D 5G49B 3REID 3RELB 1P3LA 1BFMA 2DQNC 2UWXA 3AV1B 3MGPA 5GSUB 2J8PA 3UT9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJ7 D;  5B1L A;  3X1V A;  3UTA A;  1ZLA A;  3W96 D;  3AZL B;  3X1U D;  3AN2 D;  1B6W A;  3X1T C;  4E45 A;  1ID3 C;  3NQJ A;  5F99 B;  4H9O A;  5AV5 D;  5B31 C;  3X1S B;  1P3I A;  5AVC C;  3R45 A;  4M6B A;  4H9P A;  4Z66 A;  4J8U B;  4YM6 D;  5AV9 C;  5B31 B;  4X23 B;  3B6F B;  2NZD B;  4XUJ B;  1P3L C;  5CPK A;  5B40 B;  3MGP C;  5AV6 B;  3AZH B;  1AOI D;  4QLC A;  3X1V C;  1P3L B;  3AZK D;  4Z2M H;  1P3G D;  1TZY A;  3AZF B;  5AY8 A;  3W99 D;  1U35 A;  4WU8 A;  1F66 D;  4H9N A;  3MGS A;  1S32 D;  5B1L B;  3WTP D;  3X1V B;  1P3I C;  1P3A A;  3UTA B;  1ZLA B;  1M18 A;  3WAA B;  3VH5 A;  3REI A;  1P3P A;  5B31 G;  5B1M D;  3AZM B;  4R8P A;  3R45 B;  2PYO D;  5CPK C;  3UT9 A;  4H9P B;  5BNX B;  1F1E A;  4Z66 B;  3W96 A;  5B32 A;  3AN2 A;  4QLC C;  3REL D;  3B0D B;  3MGQ B;  1N1J A;  2L5A A;  5JA4 A;  3AV1 D;  1U35 C;  4WU8 C;  5GSU D;  3MGS C;  1JFI A;  4YM6 A;  1M18 C;  1TZY B;  5AY8 B;  3AYW A;  3O62 C;  3REI C;  3AZL D;  5B2I B;  1U35 B;  3W98 A;  2JSS A;  4WU8 B;  2F8N H;  5F99 D;  1P3A B;  2YFW A;  3X1S D;  1M18 B;  3UT9 C;  1B67 A;  3REI B;  1P3P B;  3AZK A;  4H9Q B;  1P3G A;  3W96 C;  5B32 C;  3X1U C;  4JJN A;  4R8P B;  3AN2 C;  4J8U D;  4H9S A;  5B31 D;  4X23 D;  3B6F D;  2NZD D;  1F66 A;  4Z2M G;  4XUJ D;  3WA9 A;  5AV5 C;  3AZE A;  5B40 D;  3W96 B;  1H3O B;  5B32 B;  5AV6 D;  3W97 D;  3AZH D;  5GXQ B;  4YM6 C;  5DNN A;  1P3L D;  3AZF D;  5JA4 B;  4J8V B;  4NE6 A;  2IO5 C;  2F8N B;  5B1L D;  3X1V D;  3UTA D;  1ZLA D;  3AYW B;  3WAA D;  5BS7 A;  3AZJ A;  3AZK C;  3W98 B;  1P3G C;  3REL A;  2IO5 B;  2CV5 A;  4H9S C;  3AZM D;  5BO0 B;  3W99 C;  3AZG B;  1F66 C;  3B0C T;  5GSU A;  3WA9 C;  5B32 G;  3AZE C;  5JRG B;  4JJN B;  1KX4 A;  4Z66 D;  3AV2 B;  4KGC B;  5B1M C;  5F99 A;  5DNN C;  3WA9 B;  3AZE B;  5B2J A;  3LJA B;  2PYO C;  2F8N G;  3KSY A;  3MGQ D;  2BYK B;  4WNN A;  3LZ0 A;  3C1B A;  1R4V A;  5DNN B;  4XZQ B;  4J8U A;  4WU9 B;  1HTA A;  1TZY D;  4H9R B;  5AY8 D;  5BS7 C;  2NZD A;  1M1A A;  4XUJ A;  5B2I D;  3REL C;  1U35 D;  4WU8 D;  5C3I B;  3REH A;  3AV1 C;  1P3A D;  5GSU C;  3W97 A;  5AV6 A;  3AZH A;  1M18 D;  4AWL C;  3AZJ B;  2F8N K;  1P3P D;  3TU4 A;  2CV5 B;  3AZL C;  3AZF A;  4DRA A;  4R8P D;  1P3K B;  3WKJ A;  5F99 C;  3C1C B;  5GT0 B;  4AWL B;  5B2J C;  3B6G D;  2RVQ D;  3X1S C;  1KX4 B;  4HGA C;  3WAA A;  5B32 D;  5B33 A;  3AZI B;  5GXQ D;  4J8U C;  5B2J B;  3AZM A;  4X23 C;  3B6F C;  2NZD C;  4HGA B;  2YFV B;  4WNN B;  3VH5 W;  4XUJ C;  5BNV A;  3LZ0 B;  3AFA B;  3C1B B;  4J8V D;  5B40 C;  5BNX A;  3REH C;  2F8N D;  5AV6 C;  3W97 C;  3AZH C;  3AYW D;  1M1A B;  3W98 D;  4J8X B;  3AZF C;  4YS3 A;  3REH B;  2ARO A;  3WKJ C;  3MGQ A;  5B0Y B;  3W97 B;  3AZG D;  5B1L C;  3MVD A;  3TU4 B;  5KDM B;  3UTA C;  5JRG D;  1ZLA C;  3WAA C;  4JJN D;  3WKJ B;  3REJ A;  5B2I A;  3AV2 D;  4KGC D;  3AZM C;  3WA9 D;  2CWE A;  3AZE D;  1KX3 B;  3LJA D;  3VH6 T;  5B33 B;  4H9Q A;  5GT3 B;  4Z66 C;  5FUG B;  5DNN D;  4KUD A;  4XZQ D;  4WU9 D;  5BNV B;  3B6G A;  3B0D C;  1Q9C A;  1P3O B;  3MGQ C;  1H3O A;  5GXQ A;  3AZJ D;  3MVD C;  4LD9 B;  1TZY C;  4YS3 B;  5AY8 C;  2CV5 D;  2ARO B;  1EQZ B;  3REJ C;  5B2I C;  1P3K D;  4J8V A;  3C1C D;  5GT0 D;  2F8N A;  3MVD B;  1P3A C;  1KX4 D;  4G92 B;  3REJ B;  1P3P C;  3KWQ A;  1HQ3 B;  3UTB B;  3AZI D;  4R8P C;  5B2J D;  1P3F B;  5BO0 A;  3AZG A;  3AFA D;  3LZ0 D;  3B6G C;  2RVQ C;  3C1B D;  5B24 B;  5JRG A;  4KUD B;  5GXQ C;  3AV2 A;  4KGC A;  1KX5 B;  1M1A D;  3B6G B;  4NE5 A;  4J8X D;  2NQB B;  5BT1 D;  3LJA A;  3REH D;  1KU5 A;  3V9R A;  4J8V C;  5B0Y D;  2BYK A;  2BYM A;  3TU4 D;  4XZQ A;  4WU9 A;  3AYW C;  4H9R A;  3W98 C;  3WKJ D;  3AZG C;  1KX3 D;  4CSR B;  4Z5T B;  5CP6 B;  5B33 D;  5JRG C;  3KWQ B;  4JJN C;  5GT3 D;  4ZUX A;  3AV2 C;  1P3K A;  4KGC C;  4G91 C;  3C1C A;  5GT0 A;  3LJA C;  1P3O D;  4G91 B;  5AVB A;  5CPJ B;  4NFT A;  3AZI A;  1P34 A;  4LD9 D;  4XZQ C;  4WU9 C;  1P3B B;  3VH6 A;  1EQZ D;  4YS3 D;  2ARO D;  3V9R B;  5B0Z A;  4J8W A;  2YFV A;  3AFA A;  2BYM B;  5C3I C;  3MNN B;  3MVD D;  5AV8 A;  5CPI A;  3NQU A;  3AZJ C;  3A6N B;  3REJ D;  2CV5 C;  3MGR A;  4J8X A;  1HQ3 D;  3UTB D;  3LZ1 B;  1P3K C;  1P3F D;  3LEL B;  5B0Y A;  3C1C C;  5GT0 C;  1KX4 C;  5KDM A;  5B24 D;  4ZUX B;  1TAF A;  4KUD D;  4UUZ A;  5AVB C;  4WZS B;  3AZI C;  1P34 C;  1KX5 D;  5B0Z C;  4J8W C;  3X1T A;  1KX3 A;  2NQB D;  3AFA C;  3LZ0 C;  3AZN B;  3C1B C;  5AVB B;  5E5A A;  1P34 B;  5GT3 A;  5AV8 C;  5AVC A;  5FUG A;  5CPI C;  5B0Z B;  5DNM B;  4J8W B;  1WWS A;  1M1A C;  2HUE B;  4EO5 B;  3MGR C;  4J8X C;  5BT1 C;  1BH8 A;  1P3O A;  3B0C W;  5AV8 B;  5B0Y C;  5CPI B;  3NQU B;  4Z5T D;  1P3M B;  3REK B;  5CP6 D;  3TU4 C;  4LD9 A;  3KWQ D;  3MGR B;  1EQZ A;  1KX3 C;  1TAF B;  4CAY A;  4UUZ B;  5B33 C;  5E5A C;  5GT3 C;  5CPJ D;  1HQ3 A;  3UTB A;  1P3F A;  3KXB A;  3X1T B;  1P3B D;  1ID3 B;  2HIO A;  5E5A B;  1P3O C;  5B24 A;  5AVC B;  3MNN D;  4ZBJ C;  3A6N D;  4LD9 C;  1KX5 A;  1EQZ C;  4YS3 C;  1BH8 B;  5AV9 B;  2ARO C;  2NQB A;  3LZ1 D;  3LEL D;  4ZBJ B;  1BH9 A;  3MGP B;  4G92 C;  3KUY A;  4ZUX D;  4DRB A;  1M19 A;  1HQ3 C;  3UTB C;  1P3F C;  3KXB C;  3O62 A;  4CAY B;  3NQJ B;  4H9O B;  3AZN D;  4CSR A;  4Z5T A;  2HIO C;  5CP6 A;  5B24 C;  5AVB D;  1P3I B;  1P34 D;  4KUD C;  3KXB B;  2FJ7 A;  5DNM D;  5B0Z D;  4J8W D;  1KX5 C;  2HIO B;  3X1U A;  2LY8 A;  2NQB C;  5AV8 D;  5CPK B;  5CPI D;  5AV5 A;  5CPJ A;  1P3M D;  3REK D;  3KUY C;  3MGR D;  4QLC B;  1P3B A;  1M19 C;  1BH9 B;  3MNN A;  3VH6 W;  3KUY B;  4H9N B;  4Z5T C;  1M19 B;  3MGS B;  3A6N A;  5CP6 C;  3KWQ C;  1AOI A;  3O62 B;  3LZ1 A;  2FJ7 C;  4KHA A;  3LEL A;  3X1T D;  1ID3 D;  5E5A D;  4E44 A;  3W99 A;  5AVC D;  3UT9 B;  1S32 A;  2FJ7 B;  3WTP A;  5CPJ C;  5CHL B;  3X1U B;  3AN2 B;  1P3B C;  5AV9 D;  5B1M A;  3AZN A;  4WV4 B;  5AV5 B;  3MNN C;  1N1J B;  2PYO A;  1WWI A;  3MGP D;  3A6N C;  5DNM A;  1JFI B;  4YM6 B;  1A7W A;  1AOI C;  3LZ1 C;  3LEL C;  5G49 A;  3VH5 T;  2YFW B;  3REK A;  1P3I D;  1P3M A;  3AV1 A;  4ZUX C;  3WTP E;  1AOI B;  1S32 C;  4KHA B;  3WTP C;  3KXB D;  3AZK B;  1P3G B;  2HIO D;  3AZL A;  3W99 B;  1F66 B;  3AZN C;  1ULY A;  1S32 B;  3WTP B;  5CPK D;  3B0B A;  3X1S A;  4NE3 A;  5DNM C;  4QLC D;  5B1M B;  1ID3 A;  2HUE C;  4EO5 C;  5B31 A;  4X23 A;  2PYO B;  3B6F A;  3KUY D;  5B40 A;  1M19 D;  3MGS D;  1P3M C;  3REK C;  5AV9 A;  3O62 D;  5G49 B;  3REI D;  3REL B;  1P3L A;  1BFM A;  3AV1 B;  3MGP A;  5GSU B;  3UT9 D; 
#chains in the Genus database with same CATH topology
 2FJ7 D;  5B1L A;  3X1V A;  3UTA A;  1ZLA A;  3W96 D;  3AZL B;  3X1U D;  3AN2 D;  3H0M C;  1B6W A;  3X1T C;  4E45 A;  1ID3 C;  3NQJ A;  2G5I C;  5F99 B;  4H9O A;  2ZY2 A;  5AV5 D;  5B31 C;  3X1S B;  1P3I A;  5AVC C;  3R45 A;  2VQR A;  4M6B A;  4H9P A;  2ZY3 A;  4Z66 A;  4YM6 D;  4J8U B;  5AV9 C;  5B31 B;  4X23 B;  3B6F B;  2NZD B;  4XUJ B;  1P3L C;  5CPK A;  2G5H C;  5B40 B;  3MGP C;  5AV6 B;  3AZH B;  1AOI D;  4QLC A;  3X1V C;  1P3L B;  3AZK D;  4Z2M H;  1P3G D;  1TZY A;  3AZF B;  5AY8 A;  2DF4 C;  3W99 D;  1U35 A;  4WU8 A;  1F66 D;  4H9N A;  3MGS A;  1S32 D;  5B1L B;  3WTP D;  3X1V B;  1P3I C;  1P3A A;  3UTA B;  1ZLA B;  1M18 A;  3WAA B;  3VH5 A;  3REI A;  1P3P A;  5B31 G;  5B1M D;  3AZM B;  4R8P A;  3EPK A;  3R45 B;  2PYO D;  5CPK C;  3UT9 A;  4H9P B;  5BNX B;  1F1E A;  4Z66 B;  3W96 A;  2Y2L A;  5B32 A;  3AN2 A;  4QLC C;  3REL D;  3B0D B;  3MGQ B;  1N1J A;  2L5A A;  5JA4 A;  3AV1 D;  1U35 C;  4WU8 C;  5GSU D;  3MGS C;  1JFI A;  4YM6 A;  1M18 C;  1TZY B;  5AY8 B;  3AYW A;  3O62 C;  2BG1 A;  3REI C;  5B2I B;  3AZL D;  1U35 B;  3W98 A;  2JSS A;  4WU8 B;  2F8N H;  5F99 D;  1P3A B;  2FFF B;  2YFW A;  3X1S D;  1M18 B;  3UT9 C;  1B67 A;  3REI B;  1P3P B;  3AZK A;  4H9Q B;  1P3G A;  3W96 C;  5B32 C;  3X1U C;  4JJN A;  4R8P B;  3AN2 C;  4J8U D;  4H9S A;  5B31 D;  4X23 D;  3B6F D;  2NZD D;  1F66 A;  4Z2M G;  3H0R C;  4XUJ D;  3WA9 A;  5AV5 C;  3AZE A;  5B40 D;  3W96 B;  1H3O B;  5B32 B;  2Y2O A;  5AV6 D;  3W97 D;  3AZH D;  5GXQ B;  4YM6 C;  5DNN A;  1P3L D;  3AZF D;  5JA4 B;  4J8V B;  4NE6 A;  2IO5 C;  2F8N B;  5B1L D;  3X1V D;  3UTA D;  1ZLA D;  3AYW B;  3WAA D;  5BS7 A;  3AZJ A;  3AZK C;  3W98 B;  1P3G C;  3REL A;  2IO5 B;  2CV5 A;  4H9S C;  3AZM D;  5BO0 B;  3W99 C;  3AZG B;  1F66 C;  3B0C T;  5GSU A;  3WA9 C;  5B32 G;  3AZE C;  5JRG B;  4JJN B;  1KX4 A;  4Z66 D;  3AV2 B;  4KGC B;  5B1M C;  5F99 A;  1T3U A;  5DNN C;  3WA9 B;  3AZE B;  5B2J A;  3LJA B;  2PYO C;  1Z2C B;  2F8N G;  3KSY A;  3MGQ D;  2BYK B;  4WNN A;  3LZ0 A;  3C1B A;  1R4V A;  5DNN B;  4XZQ B;  4J8U A;  4WU9 B;  1HTA A;  1TZY D;  4H9R B;  5AY8 D;  5BS7 C;  2NZD A;  1M1A A;  4XUJ A;  5B2I D;  3REL C;  1U35 D;  2RIQ A;  4WU8 D;  5C3I B;  3REH A;  3AV1 C;  1P3A D;  5GSU C;  3W97 A;  5AV6 A;  3AZH A;  1M18 D;  4AWL C;  3AZJ B;  2F8N K;  1P3P D;  3TU4 A;  2CV5 B;  3AZL C;  3AZF A;  4DRA A;  4R8P D;  1P3K B;  3WKJ A;  5F99 C;  3C1C B;  5GT0 B;  4AWL B;  5B2J C;  3B6G D;  2RVQ D;  3X1S C;  1KX4 B;  4HGA C;  2W8S A;  3WAA A;  5B32 D;  5B33 A;  3AZI B;  5GXQ D;  4J8U C;  5B2J B;  3AZM A;  3KFU G;  4X23 C;  3B6F C;  2NZD C;  4HGA B;  2YFV B;  4WNN B;  3VH5 W;  4XUJ C;  5BNV A;  3LZ0 B;  3AFA B;  3C1B B;  4J8V D;  5B40 C;  5BNX A;  3REH C;  2F8N D;  5AV6 C;  3W97 C;  3AZH C;  3AYW D;  1M1A B;  3W98 D;  4J8X B;  3AZF C;  4YS3 A;  3REH B;  2ARO A;  3WKJ C;  3MGQ A;  5B0Y B;  3W97 B;  3AZG D;  5B1L C;  3MVD A;  3TU4 B;  5KDM B;  3UTA C;  5JRG D;  1ZLA C;  3WAA C;  4JJN D;  3EPH A;  3WKJ B;  3REJ A;  5B2I A;  3AV2 D;  4KGC D;  3H0L C;  3AZM C;  3WA9 D;  2CWE A;  3AZE D;  1KX3 B;  3LJA D;  3VH6 T;  5B33 B;  4H9Q A;  5GT3 B;  4Z66 C;  5FUG B;  5DNN D;  2XD1 A;  4XZQ D;  2Y2G A;  4WU9 D;  4KUD A;  5BNV B;  3B6G A;  3B0D C;  1Q9C A;  1P3O B;  3MGQ C;  1H3O A;  5GXQ A;  3AZJ D;  3MVD C;  4LD9 B;  1TZY C;  4YS3 B;  5AY8 C;  2CV5 D;  2ARO B;  1EQZ B;  3REJ C;  5B2I C;  1P3K D;  4J8V A;  3C1C D;  5GT0 D;  2F8N A;  3MVD B;  1P3A C;  1KX4 D;  4G92 B;  3REJ B;  1P3P C;  3KWQ A;  1HQ3 B;  3UTB B;  3AZI D;  4R8P C;  5B2J D;  1P3F B;  5BO0 A;  3AZG A;  3AFA D;  3LZ0 D;  3B6G C;  2RVQ C;  3C1B D;  5B24 B;  5JRG A;  2ZM5 A;  4KUD B;  5GXQ C;  3AV2 A;  4KGC A;  1KX5 B;  1M1A D;  3B6G B;  4NE5 A;  4J8X D;  2NQB B;  5BT1 D;  3LJA A;  1W2E A;  1KU5 A;  3V9R A;  3A1K A;  3REH D;  4J8V C;  5B0Y D;  2BYK A;  2BYM A;  3TU4 D;  4XZQ A;  4WU9 A;  3AYW C;  4H9R A;  3W98 C;  3WKJ D;  3AZG C;  1KX3 D;  4CSR B;  4Z5T B;  5CP6 B;  5B33 D;  5JRG C;  3KWQ B;  4JJN C;  5GT3 D;  4ZUX A;  3AV2 C;  1P3K A;  4KGC C;  4G91 C;  3C1C A;  5GT0 A;  3LJA C;  1P3O D;  4WJ3 C;  4G91 B;  5AVB A;  5CPJ B;  4NFT A;  3AZI A;  1P34 A;  3EG5 B;  4XZQ C;  4LD9 D;  4WU9 C;  1P3B B;  3VH6 A;  1EQZ D;  4YS3 D;  2ARO D;  3V9R B;  5B0Z A;  4J8W A;  2YFV A;  3AFA A;  2BYM B;  5C3I C;  3MNN B;  3MVD D;  5AV8 A;  3EPL A;  5CPI A;  3NQU A;  3AZJ C;  3A6N B;  3REJ D;  2CV5 C;  3MGR A;  4J8X A;  1HQ3 D;  3UTB D;  3LZ1 B;  1P3K C;  1P3F D;  3LEL B;  5B0Y A;  3C1C C;  5GT0 C;  3IP4 C;  3EPJ A;  1KX4 C;  5KDM A;  5B24 D;  4ZUX B;  1TAF A;  4KUD D;  2ZY5 A;  3F6T A;  4UUZ A;  5AVB C;  4WZS B;  3AZI C;  1P34 C;  2XD5 A;  1KX5 D;  4DQY B;  5B0Z C;  4J8W C;  3X1T A;  1KX3 A;  2NQB D;  3AFA C;  3LZ0 C;  3AZN B;  3C1B C;  5AVB B;  5E5A A;  1P34 B;  2Y2J A;  5GT3 A;  5AV8 C;  5AVC A;  5FUG A;  5CPI C;  2JCH A;  5B0Z B;  5DNM B;  4J8W B;  1WWS A;  1M1A C;  2HUE B;  4EO5 B;  3MGR C;  4J8X C;  5BT1 C;  1BH8 A;  1P3O A;  3B0C W;  5AV8 B;  5B0Y C;  5CPI B;  3NQU B;  4Z5T D;  1P3M B;  3REK B;  5CP6 D;  3TU4 C;  4LD9 A;  3KWQ D;  3MGR B;  1EQZ A;  2F2A C;  1KX3 C;  1TAF B;  4CAY A;  4UUZ B;  5B33 C;  3AL0 C;  5E5A C;  1PZR A;  5GT3 C;  5CPJ D;  1HQ3 A;  3UTB A;  1P3F A;  3KXB A;  3X1T B;  1P3B D;  1ID3 B;  2HIO A;  5E5A B;  1P3O C;  5B24 A;  5AVC B;  2Y2K A;  3MNN D;  4ZBJ C;  3A6N D;  4LD9 C;  1KX5 A;  1EQZ C;  4YS3 C;  1BH8 B;  5AV9 B;  2ARO C;  2NQB A;  3LZ1 D;  3LEL D;  4ZBJ B;  1BH9 A;  3MGP B;  4G92 C;  3KUY A;  4ZUX D;  4DRB A;  1M19 A;  1HQ3 C;  3UTB C;  1P3F C;  3KXB C;  3O62 A;  4CAY B;  3NQJ B;  4H9O B;  3AZN D;  4CSR A;  4Z5T A;  2HIO C;  5CP6 A;  5B24 C;  5AVB D;  1P3I B;  1P34 D;  4KUD C;  3KXB B;  3FDD A;  2FJ7 A;  5DNM D;  5B0Z D;  4J8W D;  1KX5 C;  2Y2Q A;  2HIO B;  3X1U A;  2LY8 A;  2NQB C;  5AV8 D;  5CPK B;  5CPI D;  5AV5 A;  5CPJ A;  1P3M D;  3REK D;  2Y2I A;  3KUY C;  3MGR D;  4QLC B;  1P3B A;  1M19 C;  1BH9 B;  3MNN A;  3VH6 W;  3KUY B;  4H9N B;  4Z5T C;  1M19 B;  3MGS B;  3A6N A;  5CP6 C;  3KWQ C;  1AOI A;  3O62 B;  3LZ1 A;  2FJ7 C;  4KHA A;  3LEL A;  3X1T D;  1ID3 D;  5E5A D;  4E44 A;  3W99 A;  5AVC D;  3UT9 B;  1S32 A;  2FJ7 B;  3WTP A;  5CPJ C;  5CHL B;  3X1U B;  3AN2 B;  1P3B C;  5AV9 D;  5B1M A;  3AZN A;  4WV4 B;  5AV5 B;  3MNN C;  1N1J B;  2PYO A;  1WWI A;  3MGP D;  3A6N C;  2Y2N A;  5DNM A;  1JFI B;  4YM6 B;  1A7W A;  1AOI C;  2JE5 A;  3LZ1 C;  3LEL C;  3A1I A;  5G49 A;  3VH5 T;  4UPK A;  2YFW B;  3REK A;  1P3I D;  1P3M A;  3AV1 A;  4ZUX C;  3WTP E;  1AOI B;  1S32 C;  4KHA B;  3WTP C;  3KXB D;  3AZK B;  1P3G B;  2HIO D;  3AZL A;  3W99 B;  1F66 B;  2Y2P A;  3AZN C;  1ULY A;  1S32 B;  3WTP B;  5CPK D;  3B0B A;  3X1S A;  4NE3 A;  5DNM C;  4QLC D;  5B1M B;  1ID3 A;  2HUE C;  2ZY4 A;  4EO5 C;  5B31 A;  4X23 A;  2PYO B;  3B6F A;  2Y2H A;  3KUY D;  2Y2M A;  5B40 A;  3P5J B;  3MGS D;  1P3M C;  3REK C;  1M19 D;  5AV9 A;  3O62 D;  5G49 B;  3REI D;  3REL B;  1P3L A;  1BFM A;  2DQN C;  2UWX A;  3AV1 B;  3MGP A;  5GSU B;  2J8P A;  3UT9 D; 
#chains in the Genus database with same CATH homology
 2FJ7 D;  5B1L A;  3X1V A;  3UTA A;  1ZLA A;  3W96 D;  3AZL B;  3X1U D;  3AN2 D;  3H0M C;  1B6W A;  3X1T C;  4E45 A;  1ID3 C;  3NQJ A;  2G5I C;  5F99 B;  4H9O A;  2ZY2 A;  5AV5 D;  5B31 C;  3X1S B;  1P3I A;  5AVC C;  3R45 A;  2VQR A;  4M6B A;  4H9P A;  2ZY3 A;  4Z66 A;  4YM6 D;  4J8U B;  5AV9 C;  5B31 B;  4X23 B;  3B6F B;  2NZD B;  4XUJ B;  1P3L C;  5CPK A;  2G5H C;  5B40 B;  3MGP C;  5AV6 B;  3AZH B;  1AOI D;  4QLC A;  3X1V C;  1P3L B;  3AZK D;  4Z2M H;  1P3G D;  1TZY A;  3AZF B;  5AY8 A;  2DF4 C;  3W99 D;  1U35 A;  4WU8 A;  1F66 D;  4H9N A;  3MGS A;  1S32 D;  5B1L B;  3WTP D;  3X1V B;  1P3I C;  1P3A A;  3UTA B;  1ZLA B;  1M18 A;  3WAA B;  3VH5 A;  3REI A;  1P3P A;  5B31 G;  5B1M D;  3AZM B;  4R8P A;  3EPK A;  3R45 B;  2PYO D;  5CPK C;  3UT9 A;  4H9P B;  5BNX B;  1F1E A;  4Z66 B;  3W96 A;  2Y2L A;  5B32 A;  3AN2 A;  4QLC C;  3REL D;  3B0D B;  3MGQ B;  1N1J A;  2L5A A;  5JA4 A;  3AV1 D;  1U35 C;  4WU8 C;  5GSU D;  3MGS C;  1JFI A;  4YM6 A;  1M18 C;  1TZY B;  5AY8 B;  3AYW A;  3O62 C;  2BG1 A;  3REI C;  5B2I B;  3AZL D;  1U35 B;  3W98 A;  2JSS A;  4WU8 B;  2F8N H;  5F99 D;  1P3A B;  2FFF B;  2YFW A;  3X1S D;  1M18 B;  3UT9 C;  1B67 A;  3REI B;  1P3P B;  3AZK A;  4H9Q B;  1P3G A;  3W96 C;  5B32 C;  3X1U C;  4JJN A;  4R8P B;  3AN2 C;  4J8U D;  4H9S A;  5B31 D;  4X23 D;  3B6F D;  2NZD D;  1F66 A;  4Z2M G;  3H0R C;  4XUJ D;  3WA9 A;  5AV5 C;  3AZE A;  5B40 D;  3W96 B;  1H3O B;  5B32 B;  2Y2O A;  5AV6 D;  3W97 D;  3AZH D;  5GXQ B;  4YM6 C;  5DNN A;  1P3L D;  3AZF D;  5JA4 B;  4J8V B;  4NE6 A;  2IO5 C;  2F8N B;  5B1L D;  3X1V D;  3UTA D;  1ZLA D;  3AYW B;  3WAA D;  5BS7 A;  3AZJ A;  3AZK C;  3W98 B;  1P3G C;  3REL A;  2IO5 B;  2CV5 A;  4H9S C;  3AZM D;  5BO0 B;  3W99 C;  3AZG B;  1F66 C;  3B0C T;  5GSU A;  3WA9 C;  5B32 G;  3AZE C;  5JRG B;  4JJN B;  1KX4 A;  4Z66 D;  3AV2 B;  4KGC B;  5B1M C;  5F99 A;  1T3U A;  5DNN C;  3WA9 B;  3AZE B;  5B2J A;  3LJA B;  2PYO C;  1Z2C B;  2F8N G;  3KSY A;  3MGQ D;  2BYK B;  4WNN A;  3LZ0 A;  3C1B A;  1R4V A;  5DNN B;  4XZQ B;  4J8U A;  4WU9 B;  1HTA A;  1TZY D;  4H9R B;  5AY8 D;  5BS7 C;  2NZD A;  1M1A A;  4XUJ A;  5B2I D;  3REL C;  1U35 D;  2RIQ A;  4WU8 D;  5C3I B;  3REH A;  3AV1 C;  1P3A D;  5GSU C;  3W97 A;  5AV6 A;  3AZH A;  1M18 D;  4AWL C;  3AZJ B;  2F8N K;  1P3P D;  3TU4 A;  2CV5 B;  3AZL C;  3AZF A;  4DRA A;  4R8P D;  1P3K B;  3WKJ A;  5F99 C;  3C1C B;  5GT0 B;  4AWL B;  5B2J C;  3B6G D;  2RVQ D;  3X1S C;  1KX4 B;  4HGA C;  2W8S A;  3WAA A;  5B32 D;  5B33 A;  3AZI B;  5GXQ D;  4J8U C;  5B2J B;  3AZM A;  3KFU G;  4X23 C;  3B6F C;  2NZD C;  4HGA B;  2YFV B;  4WNN B;  3VH5 W;  4XUJ C;  5BNV A;  3LZ0 B;  3AFA B;  3C1B B;  4J8V D;  5B40 C;  5BNX A;  3REH C;  2F8N D;  5AV6 C;  3W97 C;  3AZH C;  3AYW D;  1M1A B;  3W98 D;  4J8X B;  3AZF C;  4YS3 A;  3REH B;  2ARO A;  3WKJ C;  3MGQ A;  5B0Y B;  3W97 B;  3AZG D;  5B1L C;  3MVD A;  3TU4 B;  5KDM B;  3UTA C;  5JRG D;  1ZLA C;  3WAA C;  4JJN D;  3EPH A;  3WKJ B;  3REJ A;  5B2I A;  3AV2 D;  4KGC D;  3H0L C;  3AZM C;  3WA9 D;  2CWE A;  3AZE D;  1KX3 B;  3LJA D;  3VH6 T;  5B33 B;  4H9Q A;  5GT3 B;  4Z66 C;  5FUG B;  5DNN D;  2XD1 A;  4XZQ D;  2Y2G A;  4WU9 D;  4KUD A;  5BNV B;  3B6G A;  3B0D C;  1Q9C A;  1P3O B;  3MGQ C;  1H3O A;  5GXQ A;  3AZJ D;  3MVD C;  4LD9 B;  1TZY C;  4YS3 B;  5AY8 C;  2CV5 D;  2ARO B;  1EQZ B;  3REJ C;  5B2I C;  1P3K D;  4J8V A;  3C1C D;  5GT0 D;  2F8N A;  3MVD B;  1P3A C;  1KX4 D;  4G92 B;  3REJ B;  1P3P C;  3KWQ A;  1HQ3 B;  3UTB B;  3AZI D;  4R8P C;  5B2J D;  1P3F B;  5BO0 A;  3AZG A;  3AFA D;  3LZ0 D;  3B6G C;  2RVQ C;  3C1B D;  5B24 B;  5JRG A;  2ZM5 A;  4KUD B;  5GXQ C;  3AV2 A;  4KGC A;  1KX5 B;  1M1A D;  3B6G B;  4NE5 A;  4J8X D;  2NQB B;  5BT1 D;  3LJA A;  1W2E A;  1KU5 A;  3V9R A;  3A1K A;  3REH D;  4J8V C;  5B0Y D;  2BYK A;  2BYM A;  3TU4 D;  4XZQ A;  4WU9 A;  3AYW C;  4H9R A;  3W98 C;  3WKJ D;  3AZG C;  1KX3 D;  4CSR B;  4Z5T B;  5CP6 B;  5B33 D;  5JRG C;  3KWQ B;  4JJN C;  5GT3 D;  4ZUX A;  3AV2 C;  1P3K A;  4KGC C;  4G91 C;  3C1C A;  5GT0 A;  3LJA C;  1P3O D;  4WJ3 C;  4G91 B;  5AVB A;  5CPJ B;  4NFT A;  3AZI A;  1P34 A;  3EG5 B;  4XZQ C;  4LD9 D;  4WU9 C;  1P3B B;  3VH6 A;  1EQZ D;  4YS3 D;  2ARO D;  3V9R B;  5B0Z A;  4J8W A;  2YFV A;  3AFA A;  2BYM B;  5C3I C;  3MNN B;  3MVD D;  5AV8 A;  3EPL A;  5CPI A;  3NQU A;  3AZJ C;  3A6N B;  3REJ D;  2CV5 C;  3MGR A;  4J8X A;  1HQ3 D;  3UTB D;  3LZ1 B;  1P3K C;  1P3F D;  3LEL B;  5B0Y A;  3C1C C;  5GT0 C;  3IP4 C;  3EPJ A;  1KX4 C;  5KDM A;  5B24 D;  4ZUX B;  1TAF A;  4KUD D;  2ZY5 A;  3F6T A;  4UUZ A;  5AVB C;  4WZS B;  3AZI C;  1P34 C;  2XD5 A;  1KX5 D;  4DQY B;  5B0Z C;  4J8W C;  3X1T A;  1KX3 A;  2NQB D;  3AFA C;  3LZ0 C;  3AZN B;  3C1B C;  5AVB B;  5E5A A;  1P34 B;  2Y2J A;  5GT3 A;  5AV8 C;  5AVC A;  5FUG A;  5CPI C;  2JCH A;  5B0Z B;  5DNM B;  4J8W B;  1WWS A;  1M1A C;  2HUE B;  4EO5 B;  3MGR C;  4J8X C;  5BT1 C;  1BH8 A;  1P3O A;  3B0C W;  5AV8 B;  5B0Y C;  5CPI B;  3NQU B;  4Z5T D;  1P3M B;  3REK B;  5CP6 D;  3TU4 C;  4LD9 A;  3KWQ D;  3MGR B;  1EQZ A;  2F2A C;  1KX3 C;  1TAF B;  4CAY A;  4UUZ B;  5B33 C;  3AL0 C;  5E5A C;  1PZR A;  5GT3 C;  5CPJ D;  1HQ3 A;  3UTB A;  1P3F A;  3KXB A;  3X1T B;  1P3B D;  1ID3 B;  2HIO A;  5E5A B;  1P3O C;  5B24 A;  5AVC B;  2Y2K A;  3MNN D;  4ZBJ C;  3A6N D;  4LD9 C;  1KX5 A;  1EQZ C;  4YS3 C;  1BH8 B;  5AV9 B;  2ARO C;  2NQB A;  3LZ1 D;  3LEL D;  4ZBJ B;  1BH9 A;  3MGP B;  4G92 C;  3KUY A;  4ZUX D;  4DRB A;  1M19 A;  1HQ3 C;  3UTB C;  1P3F C;  3KXB C;  3O62 A;  4CAY B;  3NQJ B;  4H9O B;  3AZN D;  4CSR A;  4Z5T A;  2HIO C;  5CP6 A;  5B24 C;  5AVB D;  1P3I B;  1P34 D;  4KUD C;  3KXB B;  3FDD A;  2FJ7 A;  5DNM D;  5B0Z D;  4J8W D;  1KX5 C;  2Y2Q A;  2HIO B;  3X1U A;  2LY8 A;  2NQB C;  5AV8 D;  5CPK B;  5CPI D;  5AV5 A;  5CPJ A;  1P3M D;  3REK D;  2Y2I A;  3KUY C;  3MGR D;  4QLC B;  1P3B A;  1M19 C;  1BH9 B;  3MNN A;  3VH6 W;  3KUY B;  4H9N B;  4Z5T C;  1M19 B;  3MGS B;  3A6N A;  5CP6 C;  3KWQ C;  1AOI A;  3O62 B;  3LZ1 A;  2FJ7 C;  4KHA A;  3LEL A;  3X1T D;  1ID3 D;  5E5A D;  4E44 A;  3W99 A;  5AVC D;  3UT9 B;  1S32 A;  2FJ7 B;  3WTP A;  5CPJ C;  5CHL B;  3X1U B;  3AN2 B;  1P3B C;  5AV9 D;  5B1M A;  3AZN A;  4WV4 B;  5AV5 B;  3MNN C;  1N1J B;  2PYO A;  1WWI A;  3MGP D;  3A6N C;  2Y2N A;  5DNM A;  1JFI B;  4YM6 B;  1A7W A;  1AOI C;  2JE5 A;  3LZ1 C;  3LEL C;  3A1I A;  5G49 A;  3VH5 T;  4UPK A;  2YFW B;  3REK A;  1P3I D;  1P3M A;  3AV1 A;  4ZUX C;  3WTP E;  1AOI B;  1S32 C;  4KHA B;  3WTP C;  3KXB D;  3AZK B;  1P3G B;  2HIO D;  3AZL A;  3W99 B;  1F66 B;  2Y2P A;  3AZN C;  1ULY A;  1S32 B;  3WTP B;  5CPK D;  3B0B A;  3X1S A;  4NE3 A;  5DNM C;  4QLC D;  5B1M B;  1ID3 A;  2HUE C;  2ZY4 A;  4EO5 C;  5B31 A;  4X23 A;  2PYO B;  3B6F A;  2Y2H A;  3KUY D;  2Y2M A;  5B40 A;  3P5J B;  3MGS D;  1P3M C;  3REK C;  1M19 D;  5AV9 A;  3O62 D;  5G49 B;  3REI D;  3REL B;  1P3L A;  1BFM A;  2DQN C;  2UWX A;  3AV1 B;  3MGP A;  5GSU B;  2J8P A;  3UT9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...