4WU8D

Structure of trptnap-ncp145
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (145-MER)
publication title Stereochemical control of nucleosome targeting by platinum-intercalator antitumor agents.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 38
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wu8D00
5B0YB 5CPKC 2PYOC 2HIOB 3AZJC 5CPJA 1P3BA 1KU5A 3AZGD 3V9RB 1EQZB 5GXQC 3UTBD 5F99D 5GT3B 3LJAB 4JJND 3X1UC 2F8ND 2YFWA 5KDMB 3O62B 1B6WA 5B33A 3REIA 1P3MB 4R8PA 3MVDA 1P3IB 4Z66D 4HGAB 3MNNA 4YS3B 3AFAD 1M19D 5B1LD 4AWLC 2CV5B 4CAYA 2AROB 5B0YD 3AN2A 3AZMA 2HIOD 3C1CB 4Z5TA 1P3OC 2FJ7C 1EQZD 5JRGA 5GT3D 3LJAD 4G91B 3W96D 4H9NB 4KGCC 4KUDA 3B6GC 2BYMA 3O62D 1P3LB 3KWQB 3MGPB 1P3MD 4EO5C 2PYOA 4J8XB 3AZJA 3AZIC 3AFAC 4YS3D 4E45A 1M18A 5B0YC 2CV5D 2AROD 4H9PB 1BH8B 4CSRA 4X23A 3C1CD 3WKJC 5B1MB 5BNVA 4YM6B 1N1JA 3B6FA 2HUEB 5B31B 3AZHA 4LD9B 5AVBB 4H9OB 3W96A 3W97A 1P3LD 1ID3C 3KWQD 3C1BB 1BFMA 4J8XD 1F66C 4J8UC 1P3IC 1H3OA 4HGAC 5B32B 3AZGA 4J8WC 3UTBA 2LY8A 1KX3C 5F99A 5AVCA 4JJNA 4R8PB 2F8NA 1WWIA 3LELC 3LZ1C 3C1CC 5B1MD 4G91C 4YM6D 4Z66A 5B31D 1P3LC 4LD9D 5AVBD 1M19A 5B1LA 4M6BA 5GT0B 3MGPC 5B0YA 5JRGB 3AYWB 3C1BD 2HIOA 1P3AB 5B32D 4KUDB 4WNNB 1P34C 3V9RA 1EQZA 5GT3A 3LJAA 5GSUB 3AZEB 3X1TB 3REJB 5KDMA 3O62A 3W99C 1P3KB 1P3MA 5B2IB 5AV6C 4YM6C 2BYKA 4CSRB 4YS3A 2CV5A 5GT0D 3RELB 2AROA 5JRGD 3AYWD 1S32B 5JA4B 3C1CA 3WTPB 1P3GB 3AZHB 5B33C 1P3AD 4WZSB 3REIC 5E5AB 4R8PC 5GSUD 3AZED 4H9NA 5AV9B 3X1TD 3MVDC 3REJD 3B0CW 1P3LA 2L5AA 1P3KD 3KWQA 5CP6B 5AVCB 5B2ID 4J8XA 3AZKB 3AZMC 3B0DC 3NQUB 4UUZB 4Z5TC 3AV2B 5GT0C 2NQBB 5JRGC 5B40B 3RELD 5B0ZB 1S32D 4H9PA 1BH8A 4ZBJB 1P3AC 4KUDC 5B1MA 3WTPD 1P3GD 3VH5T 2NZDB 5E5AD 5GSUC 4YM6A 1P3FB 5BO0B 5B31A 5AV9D 4LD9A 5AVBA 4WU9B 1P3KC 4H9OA 1M18C 5B2IC 5CP6D 3C1BA 5AVCD 3AZKD 5B32A 4X23C 3AV2D 2NQBD 3KXBB 5B40D 5B0ZD 3B6FC 4QLCB 1P3GC 3AZHC 3W97C 3W96C 2NZDD 3A6NB 5AV9C 1P3FD 5C3IC 4WU9D 3AZGC 3UTBC 5GT0A 3AZLB 5B24B 5AVCC 5F99C 3KUYB 4JJNC 3AYWA 3AZNB 1HQ3B 5AV5B 5CPIB 1P3AA 5DNMB 4WNNA 1JFIB 3WAAB 4NE6A 4XZQB 5B40C 5GSUA 3AZEA 4E44A 3X1TA 3KXBD 3REJA 4QLCD 4Z66C 1P3KA 3NQJB 1M19C 5B1LC 1TAFB 4ZUXB 5B2IA 3A6ND 2HIOC 1ZLAB 3TU4B 1EQZC 2IO5B 3AZLD 5B24D 3RELA 5GT3C 3KUYD 3LJAC 1S32A 3AZND 5AV8B 1HQ3D 5JA4A 3WTPA 3O62C 5AV5D 5CPID 1P3GA 5DNMD 3WAAD 5E5AA 1P3MC 1TZYB 4WU8B 4XZQD 5AV9A 4NE3A 4YS3C 1M1AB 3A6NC 3W98B 5CP6A 2CV5C 4ZUXD 3AZKA 2AROC 1P3PB 1KX5B 3AV2A 3NQUA 4UUZA 1KX4B 5BS7C 1ZLAD 3TU4D 2NQBA 5B40A 5B0ZA 3WA9B 5AV8D 3X1SB 2NZDA 3KWQC 1TZYD 4WU8D 1P3FA 4J8XC 5CHLB 5BO0A 4WU9A 3VH5A 5DNNB 1M1AD 3W98D 1AOIB 3MGRB 1P3PD 4H9SA 1KX5D 3MGSB 3VH6A 5B1MC 1ZLAC 3TU4C 1KX4D 3REHB 3KSYA 3KXBA 3WA9D 4QLCA 2HUEC 5B31C 3AZFB 4LD9C 5AVBC 3X1SD 2F8NH 1TZYC 3A6NA 5BT1D 3C1BC 5B31G 5B32C 5BS7A 1M1AC 3AZLA 5B24A 5DNND 3KUYA 1AOID 3MGRD 4J8VB 3AZNA 5CPKB 1HQ3A 5AV5A 3MGSD 5CPIA 5DNMA 1JFIA 3WAAA 2RVQD 4XZQA 3REHD 3X1UB 3AZFD 3NQJA 1TAFA 4ZUXA 3AYWC 3LZ0B 1ZLAA 3TU4A 4AWLB 3VH5W 3AZEC 1ULYA 3X1TC 3B0CT 4J8VD 5AV8A 3REJC 5CPKD 1B67A 2RVQC 1P3OB 1TZYA 3VH6T 5AY8B 4WU8A 3REHC 2FJ7B 5GXQD 2JSSA 3X1UD 4KGCB 3B6GB 1M1AA 1R4VA 3W98A 3RELC 1S32C 1P3PA 1KX5A 3LZ0D 3WTPC 1A7WA 5B2JB 1KX4A 3AZIB 5E5AC 4XUJB 3X1VB 4J8VC 3WA9A 2F8NK 5BNXB 3X1SA 3WKJB 3UT9B 1P3OD 5G49A 5AY8D 5CP6C 3AZKC 2FJ7D 3REKB 4H9RB 4KGCD 3AV2C 3B6GD 5DNNA 2NQBC 1ID3B 1AOIA 3MGRA 3AV1B 5B0ZC 2F8NG 3UTAB 3LZ0C 1Q9CA 4KHAB 3MGSA 4ZBJC 1F66B 4J8UB 3B0BA 5B2JD 3MGQB 4J8WB 4H9QB 3AZID 2NZDC 3REHA 4WV4B 4XUJD 1KX3B 3X1VD 1P3FC 3AZFA 1F1EA 3LELB 3LZ1B 4WU9C 1BH9B 3WKJD 5AY8C 3UT9D 3REKD 4H9SC 1U35B 2CWEA 2YFVB 5FUGB 1ID3D 3KXBC 4J8VA 3AV1D 5CPKA 3UTAD 4QLCC 4G92B 1F66D 5B2JC 4J8UD 4Z2MH 1P3ID 3R45B 3MGQD 4J8WD 1P34B 4XUJC 5GXQA 3X1VC 1KX3D 3X1UA 3LELD 3LZ1D 3UT9C 3W99B 3AZLC 5B24C 2BYKB 3KUYC 3REKC 4DRBA 5AV6B 3AZNC 3LZ0A 1HQ3C 5CPIC 5AV5C 5CPJB 1U35D 5DNMC 1P3BB 3WAAC 4XZQC 5G49B 1WWSA 4NE5A 3AV1C 3MGPD 3UTAC 2YFWB 3MGQC 5B33B 1P3OA 5AY8A 1P34D 4ZUXC 3REIB 2FJ7A 4DRAA 3MVDB 4KGCA 3B6GA 3MNNB 3W99D 2IO5C 4NFTA 5AV6D 4CAYB 5AV8C 1U35C 3AN2B 3AZMB 5B2JA 5CPJD 3AZIA 3B0DB 3AFAA 1P3BD 4Z5TB 4WU8C 4XUJA 3X1VA 4G92C 5BNXA 3WKJA 2BYMB 3UT9A 5B33D 3W98C 3REID 3REKA 1P3PC 1KX5C 4R8PD 2PYOB 4H9RA 5B32G 3MVDD 3AZJB 1KX4C 3MNND 1ID3A 3AV1A 5GXQB 1M18B 3WA9C 3UTAA 4KHAA 1F66A 4J8UA 3AN2D 5CPJC 1P3IA 3AZMD 1P3BC 3X1SC 3MGQA 4X23B 4J8WA 4H9QA 5BNVB 4Z5TD 5BT1C 1KX3A 3LELA 1N1JB 3B6FB 3LZ1A 1BH9A 4KUDD 5DNNC 3W97B 3W96B 4Z2MG 1AOIC 3MGRC 1HTAA 3MGSC 1U35A 2PYOD 2YFVA 3WTPE 5C3IB 1H3OB 3MNNC 3AZJD 3AZGB 5FUGA 3UTBB 3MGPA 5F99B 3VH6W 4JJNB 1M18D 3AZFC 3AN2C 2F8NB 3R45A 4X23D 1P34A 4EO5B 3B6FD 4Z66B 3AZHD 3W99A 3AFAB 1M19B 3W97D 5B1LB 5AV6A
chains in the Genus database with same CATH superfamily
5B0YB 5CPKC 2PYOC 2HIOB 3AZJC 5CPJA 1P3BA 1KU5A 3AZGD 3V9RB 1EQZB 5GXQC 3UTBD 3FDDA 5F99D 5GT3B 3LJAB 4JJND 3X1UC 2F8ND 2YFWA 5KDMB 3O62B 1B6WA 5B33A 3REIA 1P3MB 4R8PA 3MVDA 1P3IB 4Z66D 4HGAB 3MNNA 4YS3B 3AFAD 1M19D 5B1LD 4AWLC 2CV5B 4CAYA 2AROB 5B0YD 3AN2A 3AZMA 2HIOD 3C1CB 3H0MC 4Z5TA 1P3OC 2FJ7C 1EQZD 5JRGA 5GT3D 3LJAD 4G91B 3W96D 4H9NB 4KGCC 4KUDA 3B6GC 2BYMA 3O62D 1P3LB 3KWQB 3MGPB 1P3MD 2XD1A 4EO5C 2PYOA 4J8XB 3AZJA 3AZIC 3AFAC 4YS3D 4E45A 1M18A 5B0YC 2CV5D 2AROD 4H9PB 1BH8B 2VQRA 4CSRA 4X23A 3C1CD 5B1MB 5BNVA 3WKJC 2G5IC 4YM6B 1N1JA 3B6FA 2HUEB 5B31B 3AZHA 4LD9B 5AVBB 4H9OB 3W96A 3W97A 1P3LD 1ID3C 3KWQD 3C1BB 1BFMA 4J8XD 1F66C 4J8UC 1P3IC 1H3OA 4HGAC 5B32B 3AZGA 4J8WC 2UWXA 3UTBA 2LY8A 1KX3C 5F99A 5AVCA 4JJNA 2XD5A 4R8PB 2F8NA 1WWIA 3LELC 3LZ1C 2Y2OA 3C1CC 5B1MD 3AL0C 2J8PA 4G91C 4YM6D 4Z66A 5B31D 1P3LC 4LD9D 5AVBD 1M19A 5B1LA 4M6BA 5GT0B 3MGPC 5B0YA 5JRGB 3AYWB 3C1BD 2HIOA 3P5JB 1P3AB 5B32D 4KUDB 4WNNB 1P34C 3V9RA 1EQZA 2Y2MA 5GT3A 3LJAA 5GSUB 3AZEB 3X1TB 3REJB 5KDMA 3O62A 3W99C 1P3KB 2ZY3A 1P3MA 5B2IB 5AV6C 4YM6C 2BYKA 4CSRB 4YS3A 2CV5A 5GT0D 3RELB 2AROA 2Y2QA 5JRGD 3AYWD 1S32B 5JA4B 3C1CA 3WTPB 1P3GB 3AZHB 5B33C 1P3AD 4WZSB 3REIC 5E5AB 4R8PC 5GSUD 3AZED 4H9NA 5AV9B 3X1TD 3MVDC 3REJD 3B0CW 1P3LA 2L5AA 1P3KD 4WJ3C 3KWQA 5CP6B 5AVCB 5B2ID 4J8XA 3AZKB 3AZMC 3B0DC 3NQUB 4UUZB 4Z5TC 3AV2B 5GT0C 2NQBB 5JRGC 5B40B 3RELD 5B0ZB 1S32D 4H9PA 1BH8A 4ZBJB 1P3AC 4KUDC 5B1MA 3WTPD 1P3GD 3VH5T 2NZDB 5E5AD 5GSUC 4YM6A 1P3FB 5BO0B 5B31A 5AV9D 4LD9A 5AVBA 4WU9B 1P3KC 4H9OA 1M18C 5B2IC 2Y2IA 5CP6D 5AVCD 3C1BA 3AZKD 5B32A 4X23C 3AV2D 2NQBD 3KXBB 5B40D 5B0ZD 3B6FC 4QLCB 4DQYB 1P3GC 3AZHC 3IP4C 3W97C 3W96C 2NZDD 3A6NB 5AV9C 1P3FD 5C3IC 4WU9D 3AZGC 3UTBC 5GT0A 3AZLB 5B24B 5AVCC 5F99C 3KUYB 4JJNC 3AYWA 3AZNB 1HQ3B 5AV5B 5CPIB 1P3AA 2ZY4A 4WNNA 5DNMB 1JFIB 3WAAB 4NE6A 4XZQB 5B40C 5GSUA 3AZEA 4E44A 3X1TA 3KXBD 3REJA 4QLCD 4Z66C 1P3KA 3NQJB 1M19C 5B1LC 1TAFB 4ZUXB 5B2IA 3A6ND 3F6TA 2HIOC 1ZLAB 3TU4B 1EQZC 2IO5B 3AZLD 5B24D 3RELA 5GT3C 3KUYD 3LJAC 1S32A 3AZND 5AV8B 1HQ3D 5JA4A 3WTPA 3O62C 5AV5D 5CPID 1P3GA 5DNMD 3WAAD 2Y2KA 5E5AA 1P3MC 1TZYB 4WU8B 4XZQD 5AV9A 4NE3A 4YS3C 1M1AB 3A6NC 3W98B 5CP6A 2CV5C 4ZUXD 3AZKA 2AROC 1P3PB 1KX5B 3AV2A 3NQUA 4UUZA 1KX4B 3KFUG 5BS7C 1ZLAD 3TU4D 2NQBA 5B40A 5B0ZA 3WA9B 5AV8D 3X1SB 2NZDA 3KWQC 1TZYD 4WU8D 1P3FA 4J8XC 5CHLB 5BO0A 4WU9A 3VH5A 5DNNB 1M1AD 3W98D 1AOIB 3MGRB 1P3PD 4H9SA 1KX5D 3MGSB 3VH6A 5B1MC 2Y2GA 1ZLAC 3TU4C 1KX4D 3REHB 3KSYA 3KXBA 3WA9D 4QLCA 2HUEC 5B31C 3AZFB 4LD9C 5AVBC 3X1SD 2F8NH 1TZYC 3A6NA 5BT1D 3C1BC 5B31G 5B32C 5BS7A 3H0LC 3AZLA 1M1AC 5B24A 5DNND 3KUYA 1AOID 3MGRD 4J8VB 3AZNA 5CPKB 1HQ3A 5AV5A 3MGSD 5CPIA 5DNMA 1JFIA 3WAAA 2JCHA 2RVQD 4XZQA 3REHD 2FFFB 3X1UB 3AZFD 3NQJA 1TAFA 4ZUXA 2DF4C 3AYWC 3LZ0B 2DQNC 1ZLAA 3TU4A 2F2AC 3EPKA 3VH5W 4AWLB 3AZEC 1ULYA 3X1TC 3B0CT 4J8VD 5AV8A 3REJC 5CPKD 1B67A 2RVQC 2G5HC 1P3OB 1TZYA 3VH6T 5AY8B 4WU8A 3REHC 2FJ7B 5GXQD 2JSSA 3X1UD 4KGCB 3B6GB 1M1AA 1R4VA 1Z2CB 3W98A 3A1IA 3RELC 1S32C 1P3PA 1KX5A 3LZ0D 3WTPC 1A7WA 2BG1A 5B2JB 1KX4A 3AZIB 5E5AC 4XUJB 3X1VB 4J8VC 3WA9A 2F8NK 5BNXB 3X1SA 3WKJB 3UT9B 3H0RC 1P3OD 5G49A 5AY8D 5CP6C 3AZKC 2FJ7D 3REKB 3EPLA 4H9RB 4KGCD 3AV2C 3EPHA 3B6GD 5DNNA 2NQBC 1ID3B 1AOIA 3MGRA 3AV1B 5B0ZC 2F8NG 3UTAB 3LZ0C 1Q9CA 4KHAB 3MGSA 4ZBJC 1F66B 4J8UB 2Y2NA 3B0BA 5B2JD 3MGQB 4J8WB 4H9QB 3AZID 2NZDC 3REHA 2Y2PA 4WV4B 4XUJD 1KX3B 3X1VD 1P3FC 3AZFA 1F1EA 3LELB 3EPJA 3LZ1B 4WU9C 1BH9B 3WKJD 5AY8C 3UT9D 3REKD 4H9SC 1U35B 2CWEA 2YFVB 2Y2HA 5FUGB 1ID3D 3KXBC 4J8VA 3AV1D 5CPKA 3UTAD 2Y2LA 4QLCC 4G92B 1F66D 5B2JC 4J8UD 4Z2MH 1P3ID 3R45B 3MGQD 4J8WD 1P34B 4XUJC 5GXQA 3X1VC 1KX3D 3X1UA 3LELD 3LZ1D 3UT9C 3W99B 3AZLC 5B24C 2BYKB 3KUYC 3REKC 4DRBA 5AV6B 3AZNC 3LZ0A 1HQ3C 5CPIC 5AV5C 5CPJB 1U35D 5DNMC 1P3BB 3WAAC 4XZQC 5G49B 1WWSA 1W2EA 4NE5A 3MGPD 3AV1C 3UTAC 2RIQA 2YFWB 2ZM5A 3MGQC 1PZRA 5B33B 1P3OA 5AY8A 1P34D 4ZUXC 3REIB 2FJ7A 2Y2JA 3A1KA 4DRAA 3MVDB 4KGCA 3B6GA 3MNNB 3W99D 2IO5C 4NFTA 5AV6D 4CAYB 5AV8C 1U35C 3AN2B 3AZMB 5B2JA 5CPJD 3EG5B 3AZIA 3B0DB 3AFAA 1P3BD 4Z5TB 4WU8C 4XUJA 3X1VA 4G92C 5BNXA 3WKJA 2BYMB 3UT9A 5B33D 3W98C 3REID 3REKA 1P3PC 1KX5C 4R8PD 2PYOB 4H9RA 5B32G 3MVDD 3AZJB 1KX4C 3MNND 4UPKA 1ID3A 3AV1A 5GXQB 1M18B 3WA9C 3UTAA 4KHAA 1F66A 4J8UA 3AN2D 5CPJC 1P3IA 3AZMD 1P3BC 3X1SC 3MGQA 4X23B 4J8WA 4H9QA 5BNVB 4Z5TD 5BT1C 1KX3A 3LELA 1N1JB 3B6FB 3LZ1A 1BH9A 4KUDD 5DNNC 3W97B 3W96B 4Z2MG 1AOIC 2W8SA 3MGRC 2ZY2A 1HTAA 3MGSC 1U35A 2PYOD 2YFVA 3WTPE 5C3IB 1H3OB 3MNNC 3AZJD 3AZGB 5FUGA 3UTBB 3MGPA 5F99B 3VH6W 4JJNB 1M18D 3AZFC 3AN2C 2F8NB 3R45A 4X23D 2JE5A 1P34A 2ZY5A 4EO5B 3B6FD 4Z66B 3AZHD 3W99A 3AFAB 1M19B 3W97D 5B1LB 1T3UA 5AV6A
chains in the Genus database with same CATH topology
5B0YB 5CPKC 2PYOC 2HIOB 3AZJC 5CPJA 1P3BA 1KU5A 3AZGD 3V9RB 1EQZB 5GXQC 3UTBD 3FDDA 5F99D 5GT3B 3LJAB 4JJND 3X1UC 2F8ND 2YFWA 5KDMB 3O62B 1B6WA 5B33A 3REIA 1P3MB 4R8PA 3MVDA 1P3IB 4Z66D 4HGAB 3MNNA 4YS3B 3AFAD 1M19D 5B1LD 4AWLC 2CV5B 4CAYA 2AROB 5B0YD 3AN2A 3AZMA 2HIOD 3C1CB 3H0MC 4Z5TA 1P3OC 2FJ7C 1EQZD 5JRGA 5GT3D 3LJAD 4G91B 3W96D 4H9NB 4KGCC 4KUDA 3B6GC 2BYMA 3O62D 1P3LB 3KWQB 3MGPB 1P3MD 2XD1A 4EO5C 2PYOA 4J8XB 3AZJA 3AZIC 3AFAC 4YS3D 4E45A 1M18A 5B0YC 2CV5D 2AROD 4H9PB 1BH8B 2VQRA 4CSRA 4X23A 3C1CD 5B1MB 5BNVA 3WKJC 2G5IC 4YM6B 1N1JA 3B6FA 2HUEB 5B31B 3AZHA 4LD9B 5AVBB 4H9OB 3W96A 3W97A 1P3LD 1ID3C 3KWQD 3C1BB 1BFMA 4J8XD 1F66C 4J8UC 1P3IC 1H3OA 4HGAC 5B32B 3AZGA 4J8WC 2UWXA 3UTBA 2LY8A 1KX3C 5F99A 5AVCA 4JJNA 2XD5A 4R8PB 2F8NA 1WWIA 3LELC 3LZ1C 2Y2OA 3C1CC 5B1MD 3AL0C 2J8PA 4G91C 4YM6D 4Z66A 5B31D 1P3LC 4LD9D 5AVBD 1M19A 5B1LA 4M6BA 5GT0B 3MGPC 5B0YA 5JRGB 3AYWB 3C1BD 2HIOA 3P5JB 1P3AB 5B32D 4KUDB 4WNNB 1P34C 3V9RA 1EQZA 2Y2MA 5GT3A 3LJAA 5GSUB 3AZEB 3X1TB 3REJB 5KDMA 3O62A 3W99C 1P3KB 2ZY3A 1P3MA 5B2IB 5AV6C 4YM6C 2BYKA 4CSRB 4YS3A 2CV5A 5GT0D 3RELB 2AROA 2Y2QA 5JRGD 3AYWD 1S32B 5JA4B 3C1CA 3WTPB 1P3GB 3AZHB 5B33C 1P3AD 4WZSB 3REIC 5E5AB 4R8PC 5GSUD 3AZED 4H9NA 5AV9B 3X1TD 3MVDC 3REJD 3B0CW 1P3LA 2L5AA 1P3KD 4WJ3C 3KWQA 5CP6B 5AVCB 5B2ID 4J8XA 3AZKB 3AZMC 3B0DC 3NQUB 4UUZB 4Z5TC 3AV2B 5GT0C 2NQBB 5JRGC 5B40B 3RELD 5B0ZB 1S32D 4H9PA 1BH8A 4ZBJB 1P3AC 4KUDC 5B1MA 3WTPD 1P3GD 3VH5T 2NZDB 5E5AD 5GSUC 4YM6A 1P3FB 5BO0B 5B31A 5AV9D 4LD9A 5AVBA 4WU9B 1P3KC 4H9OA 1M18C 5B2IC 2Y2IA 5CP6D 5AVCD 3C1BA 3AZKD 5B32A 4X23C 3AV2D 2NQBD 3KXBB 5B40D 5B0ZD 3B6FC 4QLCB 4DQYB 1P3GC 3AZHC 3IP4C 3W97C 3W96C 2NZDD 3A6NB 5AV9C 1P3FD 5C3IC 4WU9D 3AZGC 3UTBC 5GT0A 3AZLB 5B24B 5AVCC 5F99C 3KUYB 4JJNC 3AYWA 3AZNB 1HQ3B 5AV5B 5CPIB 1P3AA 2ZY4A 4WNNA 5DNMB 1JFIB 3WAAB 4NE6A 4XZQB 5B40C 5GSUA 3AZEA 4E44A 3X1TA 3KXBD 3REJA 4QLCD 4Z66C 1P3KA 3NQJB 1M19C 5B1LC 1TAFB 4ZUXB 5B2IA 3A6ND 3F6TA 2HIOC 1ZLAB 3TU4B 1EQZC 2IO5B 3AZLD 5B24D 3RELA 5GT3C 3KUYD 3LJAC 1S32A 3AZND 5AV8B 1HQ3D 5JA4A 3WTPA 3O62C 5AV5D 5CPID 1P3GA 5DNMD 3WAAD 2Y2KA 5E5AA 1P3MC 1TZYB 4WU8B 4XZQD 5AV9A 4NE3A 4YS3C 1M1AB 3A6NC 3W98B 5CP6A 2CV5C 4ZUXD 3AZKA 2AROC 1P3PB 1KX5B 3AV2A 3NQUA 4UUZA 1KX4B 3KFUG 5BS7C 1ZLAD 3TU4D 2NQBA 5B40A 5B0ZA 3WA9B 5AV8D 3X1SB 2NZDA 3KWQC 1TZYD 4WU8D 1P3FA 4J8XC 5CHLB 5BO0A 4WU9A 3VH5A 5DNNB 1M1AD 3W98D 1AOIB 3MGRB 1P3PD 4H9SA 1KX5D 3MGSB 3VH6A 5B1MC 2Y2GA 1ZLAC 3TU4C 1KX4D 3REHB 3KSYA 3KXBA 3WA9D 4QLCA 2HUEC 5B31C 3AZFB 4LD9C 5AVBC 3X1SD 2F8NH 1TZYC 3A6NA 5BT1D 3C1BC 5B31G 5B32C 5BS7A 3H0LC 3AZLA 1M1AC 5B24A 5DNND 3KUYA 1AOID 3MGRD 4J8VB 3AZNA 5CPKB 1HQ3A 5AV5A 3MGSD 5CPIA 5DNMA 1JFIA 3WAAA 2JCHA 2RVQD 4XZQA 3REHD 2FFFB 3X1UB 3AZFD 3NQJA 1TAFA 4ZUXA 2DF4C 3AYWC 3LZ0B 2DQNC 1ZLAA 3TU4A 2F2AC 3EPKA 3VH5W 4AWLB 3AZEC 1ULYA 3X1TC 3B0CT 4J8VD 5AV8A 3REJC 5CPKD 1B67A 2RVQC 2G5HC 1P3OB 1TZYA 3VH6T 5AY8B 4WU8A 3REHC 2FJ7B 5GXQD 2JSSA 3X1UD 4KGCB 3B6GB 1M1AA 1R4VA 1Z2CB 3W98A 3A1IA 3RELC 1S32C 1P3PA 1KX5A 3LZ0D 3WTPC 1A7WA 2BG1A 5B2JB 1KX4A 3AZIB 5E5AC 4XUJB 3X1VB 4J8VC 3WA9A 2F8NK 5BNXB 3X1SA 3WKJB 3UT9B 3H0RC 1P3OD 5G49A 5AY8D 5CP6C 3AZKC 2FJ7D 3REKB 3EPLA 4H9RB 4KGCD 3AV2C 3EPHA 3B6GD 5DNNA 2NQBC 1ID3B 1AOIA 3MGRA 3AV1B 5B0ZC 2F8NG 3UTAB 3LZ0C 1Q9CA 4KHAB 3MGSA 4ZBJC 1F66B 4J8UB 2Y2NA 3B0BA 5B2JD 3MGQB 4J8WB 4H9QB 3AZID 2NZDC 3REHA 2Y2PA 4WV4B 4XUJD 1KX3B 3X1VD 1P3FC 3AZFA 1F1EA 3LELB 3EPJA 3LZ1B 4WU9C 1BH9B 3WKJD 5AY8C 3UT9D 3REKD 4H9SC 1U35B 2CWEA 2YFVB 2Y2HA 5FUGB 1ID3D 3KXBC 4J8VA 3AV1D 5CPKA 3UTAD 2Y2LA 4QLCC 4G92B 1F66D 5B2JC 4J8UD 4Z2MH 1P3ID 3R45B 3MGQD 4J8WD 1P34B 4XUJC 5GXQA 3X1VC 1KX3D 3X1UA 3LELD 3LZ1D 3UT9C 3W99B 3AZLC 5B24C 2BYKB 3KUYC 3REKC 4DRBA 5AV6B 3AZNC 3LZ0A 1HQ3C 5CPIC 5AV5C 5CPJB 1U35D 5DNMC 1P3BB 3WAAC 4XZQC 5G49B 1WWSA 1W2EA 4NE5A 3MGPD 3AV1C 3UTAC 2RIQA 2YFWB 2ZM5A 3MGQC 1PZRA 5B33B 1P3OA 5AY8A 1P34D 4ZUXC 3REIB 2FJ7A 2Y2JA 3A1KA 4DRAA 3MVDB 4KGCA 3B6GA 3MNNB 3W99D 2IO5C 4NFTA 5AV6D 4CAYB 5AV8C 1U35C 3AN2B 3AZMB 5B2JA 5CPJD 3EG5B 3AZIA 3B0DB 3AFAA 1P3BD 4Z5TB 4WU8C 4XUJA 3X1VA 4G92C 5BNXA 3WKJA 2BYMB 3UT9A 5B33D 3W98C 3REID 3REKA 1P3PC 1KX5C 4R8PD 2PYOB 4H9RA 5B32G 3MVDD 3AZJB 1KX4C 3MNND 4UPKA 1ID3A 3AV1A 5GXQB 1M18B 3WA9C 3UTAA 4KHAA 1F66A 4J8UA 3AN2D 5CPJC 1P3IA 3AZMD 1P3BC 3X1SC 3MGQA 4X23B 4J8WA 4H9QA 5BNVB 4Z5TD 5BT1C 1KX3A 3LELA 1N1JB 3B6FB 3LZ1A 1BH9A 4KUDD 5DNNC 3W97B 3W96B 4Z2MG 1AOIC 2W8SA 3MGRC 2ZY2A 1HTAA 3MGSC 1U35A 2PYOD 2YFVA 3WTPE 5C3IB 1H3OB 3MNNC 3AZJD 3AZGB 5FUGA 3UTBB 3MGPA 5F99B 3VH6W 4JJNB 1M18D 3AZFC 3AN2C 2F8NB 3R45A 4X23D 2JE5A 1P34A 2ZY5A 4EO5B 3B6FD 4Z66B 3AZHD 3W99A 3AFAB 1M19B 3W97D 5B1LB 1T3UA 5AV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Y B;  5CPK C;  2PYO C;  2HIO B;  3AZJ C;  5CPJ A;  1P3B A;  1KU5 A;  3AZG D;  3V9R B;  1EQZ B;  5GXQ C;  3UTB D;  5F99 D;  5GT3 B;  3LJA B;  4JJN D;  3X1U C;  2F8N D;  2YFW A;  5KDM B;  3O62 B;  1B6W A;  5B33 A;  3REI A;  1P3M B;  4R8P A;  3MVD A;  1P3I B;  4Z66 D;  4HGA B;  3MNN A;  4YS3 B;  3AFA D;  1M19 D;  5B1L D;  4AWL C;  2CV5 B;  4CAY A;  2ARO B;  5B0Y D;  3AN2 A;  3AZM A;  2HIO D;  3C1C B;  4Z5T A;  1P3O C;  2FJ7 C;  1EQZ D;  5JRG A;  5GT3 D;  3LJA D;  4G91 B;  3W96 D;  4H9N B;  4KGC C;  4KUD A;  3B6G C;  2BYM A;  3O62 D;  1P3L B;  3KWQ B;  3MGP B;  1P3M D;  4EO5 C;  2PYO A;  4J8X B;  3AZJ A;  3AZI C;  3AFA C;  4YS3 D;  4E45 A;  1M18 A;  5B0Y C;  2CV5 D;  2ARO D;  4H9P B;  1BH8 B;  4CSR A;  4X23 A;  3C1C D;  3WKJ C;  5B1M B;  5BNV A;  4YM6 B;  1N1J A;  3B6F A;  2HUE B;  5B31 B;  3AZH A;  4LD9 B;  5AVB B;  4H9O B;  3W96 A;  3W97 A;  1P3L D;  1ID3 C;  3KWQ D;  3C1B B;  1BFM A;  4J8X D;  1F66 C;  4J8U C;  1P3I C;  1H3O A;  4HGA C;  5B32 B;  3AZG A;  4J8W C;  3UTB A;  2LY8 A;  1KX3 C;  5F99 A;  5AVC A;  4JJN A;  4R8P B;  2F8N A;  1WWI A;  3LEL C;  3LZ1 C;  3C1C C;  5B1M D;  4G91 C;  4YM6 D;  4Z66 A;  5B31 D;  1P3L C;  4LD9 D;  5AVB D;  1M19 A;  5B1L A;  4M6B A;  5GT0 B;  3MGP C;  5B0Y A;  5JRG B;  3AYW B;  3C1B D;  2HIO A;  1P3A B;  5B32 D;  4KUD B;  4WNN B;  1P34 C;  3V9R A;  1EQZ A;  5GT3 A;  3LJA A;  5GSU B;  3AZE B;  3X1T B;  3REJ B;  5KDM A;  3O62 A;  3W99 C;  1P3K B;  1P3M A;  5B2I B;  5AV6 C;  4YM6 C;  2BYK A;  4CSR B;  4YS3 A;  2CV5 A;  5GT0 D;  3REL B;  2ARO A;  5JRG D;  3AYW D;  1S32 B;  5JA4 B;  3C1C A;  3WTP B;  1P3G B;  3AZH B;  5B33 C;  1P3A D;  4WZS B;  3REI C;  5E5A B;  4R8P C;  5GSU D;  3AZE D;  4H9N A;  5AV9 B;  3X1T D;  3MVD C;  3REJ D;  3B0C W;  1P3L A;  2L5A A;  1P3K D;  3KWQ A;  5CP6 B;  5AVC B;  5B2I D;  4J8X A;  3AZK B;  3AZM C;  3B0D C;  3NQU B;  4UUZ B;  4Z5T C;  3AV2 B;  5GT0 C;  2NQB B;  5JRG C;  5B40 B;  3REL D;  5B0Z B;  1S32 D;  4H9P A;  1BH8 A;  4ZBJ B;  1P3A C;  4KUD C;  5B1M A;  3WTP D;  1P3G D;  3VH5 T;  2NZD B;  5E5A D;  5GSU C;  4YM6 A;  1P3F B;  5BO0 B;  5B31 A;  5AV9 D;  4LD9 A;  5AVB A;  4WU9 B;  1P3K C;  4H9O A;  1M18 C;  5B2I C;  5CP6 D;  3C1B A;  5AVC D;  3AZK D;  5B32 A;  4X23 C;  3AV2 D;  2NQB D;  3KXB B;  5B40 D;  5B0Z D;  3B6F C;  4QLC B;  1P3G C;  3AZH C;  3W97 C;  3W96 C;  2NZD D;  3A6N B;  5AV9 C;  1P3F D;  5C3I C;  4WU9 D;  3AZG C;  3UTB C;  5GT0 A;  3AZL B;  5B24 B;  5AVC C;  5F99 C;  3KUY B;  4JJN C;  3AYW A;  3AZN B;  1HQ3 B;  5AV5 B;  5CPI B;  1P3A A;  5DNM B;  4WNN A;  1JFI B;  3WAA B;  4NE6 A;  4XZQ B;  5B40 C;  5GSU A;  3AZE A;  4E44 A;  3X1T A;  3KXB D;  3REJ A;  4QLC D;  4Z66 C;  1P3K A;  3NQJ B;  1M19 C;  5B1L C;  1TAF B;  4ZUX B;  5B2I A;  3A6N D;  2HIO C;  1ZLA B;  3TU4 B;  1EQZ C;  2IO5 B;  3AZL D;  5B24 D;  3REL A;  5GT3 C;  3KUY D;  3LJA C;  1S32 A;  3AZN D;  5AV8 B;  1HQ3 D;  5JA4 A;  3WTP A;  3O62 C;  5AV5 D;  5CPI D;  1P3G A;  5DNM D;  3WAA D;  5E5A A;  1P3M C;  1TZY B;  4WU8 B;  4XZQ D;  5AV9 A;  4NE3 A;  4YS3 C;  1M1A B;  3A6N C;  3W98 B;  5CP6 A;  2CV5 C;  4ZUX D;  3AZK A;  2ARO C;  1P3P B;  1KX5 B;  3AV2 A;  3NQU A;  4UUZ A;  1KX4 B;  5BS7 C;  1ZLA D;  3TU4 D;  2NQB A;  5B40 A;  5B0Z A;  3WA9 B;  5AV8 D;  3X1S B;  2NZD A;  3KWQ C;  1TZY D;  4WU8 D;  1P3F A;  4J8X C;  5CHL B;  5BO0 A;  4WU9 A;  3VH5 A;  5DNN B;  1M1A D;  3W98 D;  1AOI B;  3MGR B;  1P3P D;  4H9S A;  1KX5 D;  3MGS B;  3VH6 A;  5B1M C;  1ZLA C;  3TU4 C;  1KX4 D;  3REH B;  3KSY A;  3KXB A;  3WA9 D;  4QLC A;  2HUE C;  5B31 C;  3AZF B;  4LD9 C;  5AVB C;  3X1S D;  2F8N H;  1TZY C;  3A6N A;  5BT1 D;  3C1B C;  5B31 G;  5B32 C;  5BS7 A;  1M1A C;  3AZL A;  5B24 A;  5DNN D;  3KUY A;  1AOI D;  3MGR D;  4J8V B;  3AZN A;  5CPK B;  1HQ3 A;  5AV5 A;  3MGS D;  5CPI A;  5DNM A;  1JFI A;  3WAA A;  2RVQ D;  4XZQ A;  3REH D;  3X1U B;  3AZF D;  3NQJ A;  1TAF A;  4ZUX A;  3AYW C;  3LZ0 B;  1ZLA A;  3TU4 A;  4AWL B;  3VH5 W;  3AZE C;  1ULY A;  3X1T C;  3B0C T;  4J8V D;  5AV8 A;  3REJ C;  5CPK D;  1B67 A;  2RVQ C;  1P3O B;  1TZY A;  3VH6 T;  5AY8 B;  4WU8 A;  3REH C;  2FJ7 B;  5GXQ D;  2JSS A;  3X1U D;  4KGC B;  3B6G B;  1M1A A;  1R4V A;  3W98 A;  3REL C;  1S32 C;  1P3P A;  1KX5 A;  3LZ0 D;  3WTP C;  1A7W A;  5B2J B;  1KX4 A;  3AZI B;  5E5A C;  4XUJ B;  3X1V B;  4J8V C;  3WA9 A;  2F8N K;  5BNX B;  3X1S A;  3WKJ B;  3UT9 B;  1P3O D;  5G49 A;  5AY8 D;  5CP6 C;  3AZK C;  2FJ7 D;  3REK B;  4H9R B;  4KGC D;  3AV2 C;  3B6G D;  5DNN A;  2NQB C;  1ID3 B;  1AOI A;  3MGR A;  3AV1 B;  5B0Z C;  2F8N G;  3UTA B;  3LZ0 C;  1Q9C A;  4KHA B;  3MGS A;  4ZBJ C;  1F66 B;  4J8U B;  3B0B A;  5B2J D;  3MGQ B;  4J8W B;  4H9Q B;  3AZI D;  2NZD C;  3REH A;  4WV4 B;  4XUJ D;  1KX3 B;  3X1V D;  1P3F C;  3AZF A;  1F1E A;  3LEL B;  3LZ1 B;  4WU9 C;  1BH9 B;  3WKJ D;  5AY8 C;  3UT9 D;  3REK D;  4H9S C;  1U35 B;  2CWE A;  2YFV B;  5FUG B;  1ID3 D;  3KXB C;  4J8V A;  3AV1 D;  5CPK A;  3UTA D;  4QLC C;  4G92 B;  1F66 D;  5B2J C;  4J8U D;  4Z2M H;  1P3I D;  3R45 B;  3MGQ D;  4J8W D;  1P34 B;  4XUJ C;  5GXQ A;  3X1V C;  1KX3 D;  3X1U A;  3LEL D;  3LZ1 D;  3UT9 C;  3W99 B;  3AZL C;  5B24 C;  2BYK B;  3KUY C;  3REK C;  4DRB A;  5AV6 B;  3AZN C;  3LZ0 A;  1HQ3 C;  5CPI C;  5AV5 C;  5CPJ B;  1U35 D;  5DNM C;  1P3B B;  3WAA C;  4XZQ C;  5G49 B;  1WWS A;  4NE5 A;  3AV1 C;  3MGP D;  3UTA C;  2YFW B;  3MGQ C;  5B33 B;  1P3O A;  5AY8 A;  1P34 D;  4ZUX C;  3REI B;  2FJ7 A;  4DRA A;  3MVD B;  4KGC A;  3B6G A;  3MNN B;  3W99 D;  2IO5 C;  4NFT A;  5AV6 D;  4CAY B;  5AV8 C;  1U35 C;  3AN2 B;  3AZM B;  5B2J A;  5CPJ D;  3AZI A;  3B0D B;  3AFA A;  1P3B D;  4Z5T B;  4WU8 C;  4XUJ A;  3X1V A;  4G92 C;  5BNX A;  3WKJ A;  2BYM B;  3UT9 A;  5B33 D;  3W98 C;  3REI D;  3REK A;  1P3P C;  1KX5 C;  4R8P D;  2PYO B;  4H9R A;  5B32 G;  3MVD D;  3AZJ B;  1KX4 C;  3MNN D;  1ID3 A;  3AV1 A;  5GXQ B;  1M18 B;  3WA9 C;  3UTA A;  4KHA A;  1F66 A;  4J8U A;  3AN2 D;  5CPJ C;  1P3I A;  3AZM D;  1P3B C;  3X1S C;  3MGQ A;  4X23 B;  4J8W A;  4H9Q A;  5BNV B;  4Z5T D;  5BT1 C;  1KX3 A;  3LEL A;  1N1J B;  3B6F B;  3LZ1 A;  1BH9 A;  4KUD D;  5DNN C;  3W97 B;  3W96 B;  4Z2M G;  1AOI C;  3MGR C;  1HTA A;  3MGS C;  1U35 A;  2PYO D;  2YFV A;  3WTP E;  5C3I B;  1H3O B;  3MNN C;  3AZJ D;  3AZG B;  5FUG A;  3UTB B;  3MGP A;  5F99 B;  3VH6 W;  4JJN B;  1M18 D;  3AZF C;  3AN2 C;  2F8N B;  3R45 A;  4X23 D;  1P34 A;  4EO5 B;  3B6F D;  4Z66 B;  3AZH D;  3W99 A;  3AFA B;  1M19 B;  3W97 D;  5B1L B;  5AV6 A; 
#chains in the Genus database with same CATH topology
 5B0Y B;  5CPK C;  2PYO C;  2HIO B;  3AZJ C;  5CPJ A;  1P3B A;  1KU5 A;  3AZG D;  3V9R B;  1EQZ B;  5GXQ C;  3UTB D;  3FDD A;  5F99 D;  5GT3 B;  3LJA B;  4JJN D;  3X1U C;  2F8N D;  2YFW A;  5KDM B;  3O62 B;  1B6W A;  5B33 A;  3REI A;  1P3M B;  4R8P A;  3MVD A;  1P3I B;  4Z66 D;  4HGA B;  3MNN A;  4YS3 B;  3AFA D;  1M19 D;  5B1L D;  4AWL C;  2CV5 B;  4CAY A;  2ARO B;  5B0Y D;  3AN2 A;  3AZM A;  2HIO D;  3C1C B;  3H0M C;  4Z5T A;  1P3O C;  2FJ7 C;  1EQZ D;  5JRG A;  5GT3 D;  3LJA D;  4G91 B;  3W96 D;  4H9N B;  4KGC C;  4KUD A;  3B6G C;  2BYM A;  3O62 D;  1P3L B;  3KWQ B;  3MGP B;  1P3M D;  2XD1 A;  4EO5 C;  2PYO A;  4J8X B;  3AZJ A;  3AZI C;  3AFA C;  4YS3 D;  4E45 A;  1M18 A;  5B0Y C;  2CV5 D;  2ARO D;  4H9P B;  1BH8 B;  2VQR A;  4CSR A;  4X23 A;  3C1C D;  5B1M B;  5BNV A;  3WKJ C;  2G5I C;  4YM6 B;  1N1J A;  3B6F A;  2HUE B;  5B31 B;  3AZH A;  4LD9 B;  5AVB B;  4H9O B;  3W96 A;  3W97 A;  1P3L D;  1ID3 C;  3KWQ D;  3C1B B;  1BFM A;  4J8X D;  1F66 C;  4J8U C;  1P3I C;  1H3O A;  4HGA C;  5B32 B;  3AZG A;  4J8W C;  2UWX A;  3UTB A;  2LY8 A;  1KX3 C;  5F99 A;  5AVC A;  4JJN A;  2XD5 A;  4R8P B;  2F8N A;  1WWI A;  3LEL C;  3LZ1 C;  2Y2O A;  3C1C C;  5B1M D;  3AL0 C;  2J8P A;  4G91 C;  4YM6 D;  4Z66 A;  5B31 D;  1P3L C;  4LD9 D;  5AVB D;  1M19 A;  5B1L A;  4M6B A;  5GT0 B;  3MGP C;  5B0Y A;  5JRG B;  3AYW B;  3C1B D;  2HIO A;  3P5J B;  1P3A B;  5B32 D;  4KUD B;  4WNN B;  1P34 C;  3V9R A;  1EQZ A;  2Y2M A;  5GT3 A;  3LJA A;  5GSU B;  3AZE B;  3X1T B;  3REJ B;  5KDM A;  3O62 A;  3W99 C;  1P3K B;  2ZY3 A;  1P3M A;  5B2I B;  5AV6 C;  4YM6 C;  2BYK A;  4CSR B;  4YS3 A;  2CV5 A;  5GT0 D;  3REL B;  2ARO A;  2Y2Q A;  5JRG D;  3AYW D;  1S32 B;  5JA4 B;  3C1C A;  3WTP B;  1P3G B;  3AZH B;  5B33 C;  1P3A D;  4WZS B;  3REI C;  5E5A B;  4R8P C;  5GSU D;  3AZE D;  4H9N A;  5AV9 B;  3X1T D;  3MVD C;  3REJ D;  3B0C W;  1P3L A;  2L5A A;  1P3K D;  4WJ3 C;  3KWQ A;  5CP6 B;  5AVC B;  5B2I D;  4J8X A;  3AZK B;  3AZM C;  3B0D C;  3NQU B;  4UUZ B;  4Z5T C;  3AV2 B;  5GT0 C;  2NQB B;  5JRG C;  5B40 B;  3REL D;  5B0Z B;  1S32 D;  4H9P A;  1BH8 A;  4ZBJ B;  1P3A C;  4KUD C;  5B1M A;  3WTP D;  1P3G D;  3VH5 T;  2NZD B;  5E5A D;  5GSU C;  4YM6 A;  1P3F B;  5BO0 B;  5B31 A;  5AV9 D;  4LD9 A;  5AVB A;  4WU9 B;  1P3K C;  4H9O A;  1M18 C;  5B2I C;  2Y2I A;  5CP6 D;  5AVC D;  3C1B A;  3AZK D;  5B32 A;  4X23 C;  3AV2 D;  2NQB D;  3KXB B;  5B40 D;  5B0Z D;  3B6F C;  4QLC B;  4DQY B;  1P3G C;  3AZH C;  3IP4 C;  3W97 C;  3W96 C;  2NZD D;  3A6N B;  5AV9 C;  1P3F D;  5C3I C;  4WU9 D;  3AZG C;  3UTB C;  5GT0 A;  3AZL B;  5B24 B;  5AVC C;  5F99 C;  3KUY B;  4JJN C;  3AYW A;  3AZN B;  1HQ3 B;  5AV5 B;  5CPI B;  1P3A A;  2ZY4 A;  4WNN A;  5DNM B;  1JFI B;  3WAA B;  4NE6 A;  4XZQ B;  5B40 C;  5GSU A;  3AZE A;  4E44 A;  3X1T A;  3KXB D;  3REJ A;  4QLC D;  4Z66 C;  1P3K A;  3NQJ B;  1M19 C;  5B1L C;  1TAF B;  4ZUX B;  5B2I A;  3A6N D;  3F6T A;  2HIO C;  1ZLA B;  3TU4 B;  1EQZ C;  2IO5 B;  3AZL D;  5B24 D;  3REL A;  5GT3 C;  3KUY D;  3LJA C;  1S32 A;  3AZN D;  5AV8 B;  1HQ3 D;  5JA4 A;  3WTP A;  3O62 C;  5AV5 D;  5CPI D;  1P3G A;  5DNM D;  3WAA D;  2Y2K A;  5E5A A;  1P3M C;  1TZY B;  4WU8 B;  4XZQ D;  5AV9 A;  4NE3 A;  4YS3 C;  1M1A B;  3A6N C;  3W98 B;  5CP6 A;  2CV5 C;  4ZUX D;  3AZK A;  2ARO C;  1P3P B;  1KX5 B;  3AV2 A;  3NQU A;  4UUZ A;  1KX4 B;  3KFU G;  5BS7 C;  1ZLA D;  3TU4 D;  2NQB A;  5B40 A;  5B0Z A;  3WA9 B;  5AV8 D;  3X1S B;  2NZD A;  3KWQ C;  1TZY D;  4WU8 D;  1P3F A;  4J8X C;  5CHL B;  5BO0 A;  4WU9 A;  3VH5 A;  5DNN B;  1M1A D;  3W98 D;  1AOI B;  3MGR B;  1P3P D;  4H9S A;  1KX5 D;  3MGS B;  3VH6 A;  5B1M C;  2Y2G A;  1ZLA C;  3TU4 C;  1KX4 D;  3REH B;  3KSY A;  3KXB A;  3WA9 D;  4QLC A;  2HUE C;  5B31 C;  3AZF B;  4LD9 C;  5AVB C;  3X1S D;  2F8N H;  1TZY C;  3A6N A;  5BT1 D;  3C1B C;  5B31 G;  5B32 C;  5BS7 A;  3H0L C;  3AZL A;  1M1A C;  5B24 A;  5DNN D;  3KUY A;  1AOI D;  3MGR D;  4J8V B;  3AZN A;  5CPK B;  1HQ3 A;  5AV5 A;  3MGS D;  5CPI A;  5DNM A;  1JFI A;  3WAA A;  2JCH A;  2RVQ D;  4XZQ A;  3REH D;  2FFF B;  3X1U B;  3AZF D;  3NQJ A;  1TAF A;  4ZUX A;  2DF4 C;  3AYW C;  3LZ0 B;  2DQN C;  1ZLA A;  3TU4 A;  2F2A C;  3EPK A;  3VH5 W;  4AWL B;  3AZE C;  1ULY A;  3X1T C;  3B0C T;  4J8V D;  5AV8 A;  3REJ C;  5CPK D;  1B67 A;  2RVQ C;  2G5H C;  1P3O B;  1TZY A;  3VH6 T;  5AY8 B;  4WU8 A;  3REH C;  2FJ7 B;  5GXQ D;  2JSS A;  3X1U D;  4KGC B;  3B6G B;  1M1A A;  1R4V A;  1Z2C B;  3W98 A;  3A1I A;  3REL C;  1S32 C;  1P3P A;  1KX5 A;  3LZ0 D;  3WTP C;  1A7W A;  2BG1 A;  5B2J B;  1KX4 A;  3AZI B;  5E5A C;  4XUJ B;  3X1V B;  4J8V C;  3WA9 A;  2F8N K;  5BNX B;  3X1S A;  3WKJ B;  3UT9 B;  3H0R C;  1P3O D;  5G49 A;  5AY8 D;  5CP6 C;  3AZK C;  2FJ7 D;  3REK B;  3EPL A;  4H9R B;  4KGC D;  3AV2 C;  3EPH A;  3B6G D;  5DNN A;  2NQB C;  1ID3 B;  1AOI A;  3MGR A;  3AV1 B;  5B0Z C;  2F8N G;  3UTA B;  3LZ0 C;  1Q9C A;  4KHA B;  3MGS A;  4ZBJ C;  1F66 B;  4J8U B;  2Y2N A;  3B0B A;  5B2J D;  3MGQ B;  4J8W B;  4H9Q B;  3AZI D;  2NZD C;  3REH A;  2Y2P A;  4WV4 B;  4XUJ D;  1KX3 B;  3X1V D;  1P3F C;  3AZF A;  1F1E A;  3LEL B;  3EPJ A;  3LZ1 B;  4WU9 C;  1BH9 B;  3WKJ D;  5AY8 C;  3UT9 D;  3REK D;  4H9S C;  1U35 B;  2CWE A;  2YFV B;  2Y2H A;  5FUG B;  1ID3 D;  3KXB C;  4J8V A;  3AV1 D;  5CPK A;  3UTA D;  2Y2L A;  4QLC C;  4G92 B;  1F66 D;  5B2J C;  4J8U D;  4Z2M H;  1P3I D;  3R45 B;  3MGQ D;  4J8W D;  1P34 B;  4XUJ C;  5GXQ A;  3X1V C;  1KX3 D;  3X1U A;  3LEL D;  3LZ1 D;  3UT9 C;  3W99 B;  3AZL C;  5B24 C;  2BYK B;  3KUY C;  3REK C;  4DRB A;  5AV6 B;  3AZN C;  3LZ0 A;  1HQ3 C;  5CPI C;  5AV5 C;  5CPJ B;  1U35 D;  5DNM C;  1P3B B;  3WAA C;  4XZQ C;  5G49 B;  1WWS A;  1W2E A;  4NE5 A;  3MGP D;  3AV1 C;  3UTA C;  2RIQ A;  2YFW B;  2ZM5 A;  3MGQ C;  1PZR A;  5B33 B;  1P3O A;  5AY8 A;  1P34 D;  4ZUX C;  3REI B;  2FJ7 A;  2Y2J A;  3A1K A;  4DRA A;  3MVD B;  4KGC A;  3B6G A;  3MNN B;  3W99 D;  2IO5 C;  4NFT A;  5AV6 D;  4CAY B;  5AV8 C;  1U35 C;  3AN2 B;  3AZM B;  5B2J A;  5CPJ D;  3EG5 B;  3AZI A;  3B0D B;  3AFA A;  1P3B D;  4Z5T B;  4WU8 C;  4XUJ A;  3X1V A;  4G92 C;  5BNX A;  3WKJ A;  2BYM B;  3UT9 A;  5B33 D;  3W98 C;  3REI D;  3REK A;  1P3P C;  1KX5 C;  4R8P D;  2PYO B;  4H9R A;  5B32 G;  3MVD D;  3AZJ B;  1KX4 C;  3MNN D;  4UPK A;  1ID3 A;  3AV1 A;  5GXQ B;  1M18 B;  3WA9 C;  3UTA A;  4KHA A;  1F66 A;  4J8U A;  3AN2 D;  5CPJ C;  1P3I A;  3AZM D;  1P3B C;  3X1S C;  3MGQ A;  4X23 B;  4J8W A;  4H9Q A;  5BNV B;  4Z5T D;  5BT1 C;  1KX3 A;  3LEL A;  1N1J B;  3B6F B;  3LZ1 A;  1BH9 A;  4KUD D;  5DNN C;  3W97 B;  3W96 B;  4Z2M G;  1AOI C;  2W8S A;  3MGR C;  2ZY2 A;  1HTA A;  3MGS C;  1U35 A;  2PYO D;  2YFV A;  3WTP E;  5C3I B;  1H3O B;  3MNN C;  3AZJ D;  3AZG B;  5FUG A;  3UTB B;  3MGP A;  5F99 B;  3VH6 W;  4JJN B;  1M18 D;  3AZF C;  3AN2 C;  2F8N B;  3R45 A;  4X23 D;  2JE5 A;  1P34 A;  2ZY5 A;  4EO5 B;  3B6F D;  4Z66 B;  3AZH D;  3W99 A;  3AFA B;  1M19 B;  3W97 D;  5B1L B;  1T3U A;  5AV6 A; 
#chains in the Genus database with same CATH homology
 5B0Y B;  5CPK C;  2PYO C;  2HIO B;  3AZJ C;  5CPJ A;  1P3B A;  1KU5 A;  3AZG D;  3V9R B;  1EQZ B;  5GXQ C;  3UTB D;  3FDD A;  5F99 D;  5GT3 B;  3LJA B;  4JJN D;  3X1U C;  2F8N D;  2YFW A;  5KDM B;  3O62 B;  1B6W A;  5B33 A;  3REI A;  1P3M B;  4R8P A;  3MVD A;  1P3I B;  4Z66 D;  4HGA B;  3MNN A;  4YS3 B;  3AFA D;  1M19 D;  5B1L D;  4AWL C;  2CV5 B;  4CAY A;  2ARO B;  5B0Y D;  3AN2 A;  3AZM A;  2HIO D;  3C1C B;  3H0M C;  4Z5T A;  1P3O C;  2FJ7 C;  1EQZ D;  5JRG A;  5GT3 D;  3LJA D;  4G91 B;  3W96 D;  4H9N B;  4KGC C;  4KUD A;  3B6G C;  2BYM A;  3O62 D;  1P3L B;  3KWQ B;  3MGP B;  1P3M D;  2XD1 A;  4EO5 C;  2PYO A;  4J8X B;  3AZJ A;  3AZI C;  3AFA C;  4YS3 D;  4E45 A;  1M18 A;  5B0Y C;  2CV5 D;  2ARO D;  4H9P B;  1BH8 B;  2VQR A;  4CSR A;  4X23 A;  3C1C D;  5B1M B;  5BNV A;  3WKJ C;  2G5I C;  4YM6 B;  1N1J A;  3B6F A;  2HUE B;  5B31 B;  3AZH A;  4LD9 B;  5AVB B;  4H9O B;  3W96 A;  3W97 A;  1P3L D;  1ID3 C;  3KWQ D;  3C1B B;  1BFM A;  4J8X D;  1F66 C;  4J8U C;  1P3I C;  1H3O A;  4HGA C;  5B32 B;  3AZG A;  4J8W C;  2UWX A;  3UTB A;  2LY8 A;  1KX3 C;  5F99 A;  5AVC A;  4JJN A;  2XD5 A;  4R8P B;  2F8N A;  1WWI A;  3LEL C;  3LZ1 C;  2Y2O A;  3C1C C;  5B1M D;  3AL0 C;  2J8P A;  4G91 C;  4YM6 D;  4Z66 A;  5B31 D;  1P3L C;  4LD9 D;  5AVB D;  1M19 A;  5B1L A;  4M6B A;  5GT0 B;  3MGP C;  5B0Y A;  5JRG B;  3AYW B;  3C1B D;  2HIO A;  3P5J B;  1P3A B;  5B32 D;  4KUD B;  4WNN B;  1P34 C;  3V9R A;  1EQZ A;  2Y2M A;  5GT3 A;  3LJA A;  5GSU B;  3AZE B;  3X1T B;  3REJ B;  5KDM A;  3O62 A;  3W99 C;  1P3K B;  2ZY3 A;  1P3M A;  5B2I B;  5AV6 C;  4YM6 C;  2BYK A;  4CSR B;  4YS3 A;  2CV5 A;  5GT0 D;  3REL B;  2ARO A;  2Y2Q A;  5JRG D;  3AYW D;  1S32 B;  5JA4 B;  3C1C A;  3WTP B;  1P3G B;  3AZH B;  5B33 C;  1P3A D;  4WZS B;  3REI C;  5E5A B;  4R8P C;  5GSU D;  3AZE D;  4H9N A;  5AV9 B;  3X1T D;  3MVD C;  3REJ D;  3B0C W;  1P3L A;  2L5A A;  1P3K D;  4WJ3 C;  3KWQ A;  5CP6 B;  5AVC B;  5B2I D;  4J8X A;  3AZK B;  3AZM C;  3B0D C;  3NQU B;  4UUZ B;  4Z5T C;  3AV2 B;  5GT0 C;  2NQB B;  5JRG C;  5B40 B;  3REL D;  5B0Z B;  1S32 D;  4H9P A;  1BH8 A;  4ZBJ B;  1P3A C;  4KUD C;  5B1M A;  3WTP D;  1P3G D;  3VH5 T;  2NZD B;  5E5A D;  5GSU C;  4YM6 A;  1P3F B;  5BO0 B;  5B31 A;  5AV9 D;  4LD9 A;  5AVB A;  4WU9 B;  1P3K C;  4H9O A;  1M18 C;  5B2I C;  2Y2I A;  5CP6 D;  5AVC D;  3C1B A;  3AZK D;  5B32 A;  4X23 C;  3AV2 D;  2NQB D;  3KXB B;  5B40 D;  5B0Z D;  3B6F C;  4QLC B;  4DQY B;  1P3G C;  3AZH C;  3IP4 C;  3W97 C;  3W96 C;  2NZD D;  3A6N B;  5AV9 C;  1P3F D;  5C3I C;  4WU9 D;  3AZG C;  3UTB C;  5GT0 A;  3AZL B;  5B24 B;  5AVC C;  5F99 C;  3KUY B;  4JJN C;  3AYW A;  3AZN B;  1HQ3 B;  5AV5 B;  5CPI B;  1P3A A;  2ZY4 A;  4WNN A;  5DNM B;  1JFI B;  3WAA B;  4NE6 A;  4XZQ B;  5B40 C;  5GSU A;  3AZE A;  4E44 A;  3X1T A;  3KXB D;  3REJ A;  4QLC D;  4Z66 C;  1P3K A;  3NQJ B;  1M19 C;  5B1L C;  1TAF B;  4ZUX B;  5B2I A;  3A6N D;  3F6T A;  2HIO C;  1ZLA B;  3TU4 B;  1EQZ C;  2IO5 B;  3AZL D;  5B24 D;  3REL A;  5GT3 C;  3KUY D;  3LJA C;  1S32 A;  3AZN D;  5AV8 B;  1HQ3 D;  5JA4 A;  3WTP A;  3O62 C;  5AV5 D;  5CPI D;  1P3G A;  5DNM D;  3WAA D;  2Y2K A;  5E5A A;  1P3M C;  1TZY B;  4WU8 B;  4XZQ D;  5AV9 A;  4NE3 A;  4YS3 C;  1M1A B;  3A6N C;  3W98 B;  5CP6 A;  2CV5 C;  4ZUX D;  3AZK A;  2ARO C;  1P3P B;  1KX5 B;  3AV2 A;  3NQU A;  4UUZ A;  1KX4 B;  3KFU G;  5BS7 C;  1ZLA D;  3TU4 D;  2NQB A;  5B40 A;  5B0Z A;  3WA9 B;  5AV8 D;  3X1S B;  2NZD A;  3KWQ C;  1TZY D;  4WU8 D;  1P3F A;  4J8X C;  5CHL B;  5BO0 A;  4WU9 A;  3VH5 A;  5DNN B;  1M1A D;  3W98 D;  1AOI B;  3MGR B;  1P3P D;  4H9S A;  1KX5 D;  3MGS B;  3VH6 A;  5B1M C;  2Y2G A;  1ZLA C;  3TU4 C;  1KX4 D;  3REH B;  3KSY A;  3KXB A;  3WA9 D;  4QLC A;  2HUE C;  5B31 C;  3AZF B;  4LD9 C;  5AVB C;  3X1S D;  2F8N H;  1TZY C;  3A6N A;  5BT1 D;  3C1B C;  5B31 G;  5B32 C;  5BS7 A;  3H0L C;  3AZL A;  1M1A C;  5B24 A;  5DNN D;  3KUY A;  1AOI D;  3MGR D;  4J8V B;  3AZN A;  5CPK B;  1HQ3 A;  5AV5 A;  3MGS D;  5CPI A;  5DNM A;  1JFI A;  3WAA A;  2JCH A;  2RVQ D;  4XZQ A;  3REH D;  2FFF B;  3X1U B;  3AZF D;  3NQJ A;  1TAF A;  4ZUX A;  2DF4 C;  3AYW C;  3LZ0 B;  2DQN C;  1ZLA A;  3TU4 A;  2F2A C;  3EPK A;  3VH5 W;  4AWL B;  3AZE C;  1ULY A;  3X1T C;  3B0C T;  4J8V D;  5AV8 A;  3REJ C;  5CPK D;  1B67 A;  2RVQ C;  2G5H C;  1P3O B;  1TZY A;  3VH6 T;  5AY8 B;  4WU8 A;  3REH C;  2FJ7 B;  5GXQ D;  2JSS A;  3X1U D;  4KGC B;  3B6G B;  1M1A A;  1R4V A;  1Z2C B;  3W98 A;  3A1I A;  3REL C;  1S32 C;  1P3P A;  1KX5 A;  3LZ0 D;  3WTP C;  1A7W A;  2BG1 A;  5B2J B;  1KX4 A;  3AZI B;  5E5A C;  4XUJ B;  3X1V B;  4J8V C;  3WA9 A;  2F8N K;  5BNX B;  3X1S A;  3WKJ B;  3UT9 B;  3H0R C;  1P3O D;  5G49 A;  5AY8 D;  5CP6 C;  3AZK C;  2FJ7 D;  3REK B;  3EPL A;  4H9R B;  4KGC D;  3AV2 C;  3EPH A;  3B6G D;  5DNN A;  2NQB C;  1ID3 B;  1AOI A;  3MGR A;  3AV1 B;  5B0Z C;  2F8N G;  3UTA B;  3LZ0 C;  1Q9C A;  4KHA B;  3MGS A;  4ZBJ C;  1F66 B;  4J8U B;  2Y2N A;  3B0B A;  5B2J D;  3MGQ B;  4J8W B;  4H9Q B;  3AZI D;  2NZD C;  3REH A;  2Y2P A;  4WV4 B;  4XUJ D;  1KX3 B;  3X1V D;  1P3F C;  3AZF A;  1F1E A;  3LEL B;  3EPJ A;  3LZ1 B;  4WU9 C;  1BH9 B;  3WKJ D;  5AY8 C;  3UT9 D;  3REK D;  4H9S C;  1U35 B;  2CWE A;  2YFV B;  2Y2H A;  5FUG B;  1ID3 D;  3KXB C;  4J8V A;  3AV1 D;  5CPK A;  3UTA D;  2Y2L A;  4QLC C;  4G92 B;  1F66 D;  5B2J C;  4J8U D;  4Z2M H;  1P3I D;  3R45 B;  3MGQ D;  4J8W D;  1P34 B;  4XUJ C;  5GXQ A;  3X1V C;  1KX3 D;  3X1U A;  3LEL D;  3LZ1 D;  3UT9 C;  3W99 B;  3AZL C;  5B24 C;  2BYK B;  3KUY C;  3REK C;  4DRB A;  5AV6 B;  3AZN C;  3LZ0 A;  1HQ3 C;  5CPI C;  5AV5 C;  5CPJ B;  1U35 D;  5DNM C;  1P3B B;  3WAA C;  4XZQ C;  5G49 B;  1WWS A;  1W2E A;  4NE5 A;  3MGP D;  3AV1 C;  3UTA C;  2RIQ A;  2YFW B;  2ZM5 A;  3MGQ C;  1PZR A;  5B33 B;  1P3O A;  5AY8 A;  1P34 D;  4ZUX C;  3REI B;  2FJ7 A;  2Y2J A;  3A1K A;  4DRA A;  3MVD B;  4KGC A;  3B6G A;  3MNN B;  3W99 D;  2IO5 C;  4NFT A;  5AV6 D;  4CAY B;  5AV8 C;  1U35 C;  3AN2 B;  3AZM B;  5B2J A;  5CPJ D;  3EG5 B;  3AZI A;  3B0D B;  3AFA A;  1P3B D;  4Z5T B;  4WU8 C;  4XUJ A;  3X1V A;  4G92 C;  5BNX A;  3WKJ A;  2BYM B;  3UT9 A;  5B33 D;  3W98 C;  3REI D;  3REK A;  1P3P C;  1KX5 C;  4R8P D;  2PYO B;  4H9R A;  5B32 G;  3MVD D;  3AZJ B;  1KX4 C;  3MNN D;  4UPK A;  1ID3 A;  3AV1 A;  5GXQ B;  1M18 B;  3WA9 C;  3UTA A;  4KHA A;  1F66 A;  4J8U A;  3AN2 D;  5CPJ C;  1P3I A;  3AZM D;  1P3B C;  3X1S C;  3MGQ A;  4X23 B;  4J8W A;  4H9Q A;  5BNV B;  4Z5T D;  5BT1 C;  1KX3 A;  3LEL A;  1N1J B;  3B6F B;  3LZ1 A;  1BH9 A;  4KUD D;  5DNN C;  3W97 B;  3W96 B;  4Z2M G;  1AOI C;  2W8S A;  3MGR C;  2ZY2 A;  1HTA A;  3MGS C;  1U35 A;  2PYO D;  2YFV A;  3WTP E;  5C3I B;  1H3O B;  3MNN C;  3AZJ D;  3AZG B;  5FUG A;  3UTB B;  3MGP A;  5F99 B;  3VH6 W;  4JJN B;  1M18 D;  3AZF C;  3AN2 C;  2F8N B;  3R45 A;  4X23 D;  2JE5 A;  1P34 A;  2ZY5 A;  4EO5 B;  3B6F D;  4Z66 B;  3AZH D;  3W99 A;  3AFA B;  1M19 B;  3W97 D;  5B1L B;  1T3U A;  5AV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...