4WUKL

Crystal structure of apo ch65 fab
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
210
structure length
210
Chain Sequence
SVLTQPPSVSVAPGQTARITCGGNDIGRKSVHWNQQKPGQAPVLVVCYDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHVIFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CH65 heavy chain
publication title Structure of the apo anti-influenza CH65 Fab.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2014-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wukL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wukL01
1WZ1H 3VFNB 5IW3A 4BFGA 1T0NB 4Y4KB 1XZ0B 2J8HA 2WNGA 4HKZA 2FZ3A 3UPCA 3QH3A 3LKSA 1UXSB 2V7HB 1CD8A 5HDBF 4NNXA 3MJ8B 1IZJA 1KOAA 1EMTL 1MCRA 3CVHB 3IETB 1ERNA 3VFWB 1ZGLA 2HJLB 3U9UA 4CRPA 3ULUF 4G6FB 3B2UC 1T4KA 2KQNA 5C9JA 1HYSD 4X6CF 5SWSB 4Q6IB 4JE4B 1YY9C 3BOVA 4XXDA 1QUNA 5IB5A 5LWYL 1ZT7A 4LP5A 3RVVD 4NGHL 5EU4B 3TA3D 3U2SB 1I1AA 4YGVA 4EI5D 1ZLWH 4C56A 4LDOB 1V3KA 1D6EB 1NCCL 4MX7B 2A38A 2R4RH 2W9LA 2VDPL 3FT2A 4ONOA 1KCLA 1KIPA 3MR9B 3FO2B 3QNZB 1R3IH 3QHZH 4KUZH 2IH1A 3OB8A 1CDUA 1PYWA 3PV6B 1FVEA 5HGDA 4WWKD 4PRPD 4WTZA 3R1GH 3WIFB 2FX7H 2KBGA 1UG9A 4N68A 1AO7D 1QA9A 1U6AH 1G7LA 4Y5VC 2P8PB 4HLZH 3RWFA 3G5YB 5EU6D 4KPHL 5JW3H 4PGBA 4KK8D 1FYTD 1I85C 1WWWX 3WJJA 3C8HA 1NSNH 3GMLB 1IQWL 1OTSD 1MPAL 4JDZA 5H94A 1F45A 3IDYB 4UOJA 2WWMD 1T04B 2YPKB 2VDOH 4NJ9H 2WW8A 2VISB 2LABA 3KYOA 4NPYA 3QIUD 1MF2H 5D2LB 4JG0H 4P57A 1HDMB 5ALCH 3QIBB 4ZNCD 2JJSC 1CFSA 2UVFA 4MQ7B 3W0WE 2EYTB 5KSBF 4BKLA 5I1AA 2IQAB 2VERN 5JQ6H 4LFHG 5SX4H 2X4PB 1WLHA 5I9QB 1G6RH 4URTB 4XB8A 4O2CB 1HKLL 5C0CE 1MREH 2HVKB 4YHMH 1NAKH 2VLRA 5HVGB 3DV6B 3EIFA 3V5KB 43C9A 2EKSB 3QQNA 4OBRA 1RK1A 3F8UB 4X6EA 4PREB 2V7NA 4FFVD 4PGDB 2D0GA 4DTGL 4TSBH 1M71B 4MWFB 5DRNB 3V4PH 1EEYA 1JF1A 1BZ9A 4F58H 3G04A 3MLWH 2XXMB 2R2HA 5I17A 2R23A 4OLZH 4WI7A 1IGFL 5I19H 3L3GA 2D2OA 5E5UB 4UV7H 4OLUL 5TH2A 3TT1L 5FA3B 4Z18A 1CGSL 1M4KA 1QRNB 1MFAL 1LO2L 3HZYB 4OIIL 3R4DA 3WE6A 1BZQK 5DJXA 1D3CA 3K7UA 3WD5H 4L4TB 4RFNB 3T0ED 3GMRB 4ORZC 1KNOB 3NA9L 2D7NA 1JUFA 3IXTA 1Q94B 3PWNA 2H32B 4YHIA 5F9JB 4OZFH 5CMAA 1BD2A 1QSFA 1PD6A 2NY3B 2RJMA 4M3KB 3RX8A 4F2MA 3FO0L 4ZXBC 4BQ9A 1MEXL 3QXVA 3ORJA 1MI5E 4LKCB 4N9GA 5E99L 3QAZB 4UILL 5KSVB 4NYLB 1AD0A 2Q87A 1OWRM 2PETA 1RUQL 1PW3A 4E41D 1SYSB 3UAJD 4JQVA 3WKNA 3KLSA 4LARH 4UBDC 4RWHA 1I7UB 4LVOC 3D25A 4PRDB 1VADB 3SE3C 4I0CC 3TO2B 1VFAB 4CNIA 5IJVB 3FFCA 3LEVL 4NHUA 3VGDA 5F7EH 2GKIA 1GJIA 2CD0A 2F53E 3MBEA 3QQ3B 4OD1H 3FL7A 2NY1B 3ARXA 4XNYL 2A6KA 4JFDB 1B9ZA 2EDTA 5EORL 4LVHC 2IQ9L 1A6PA 4ZOAA 5CZXC 4NBYB 4PP1C 4ODHH 3MO1A 1A9EA 2DMKA 2IWGA 5I8EB 3IFLH 1FFPA 1OF2A 1BJ1H 1OAZL 4X83A 5J89A 3EYSL 3UO1L 1OAKH 2OJZH 2OP4L 3A6CH 5DUBB 4LIQE 1TTFA 5T3ZH 3W9EB 3EDFA 3HE7D 4UQ3A 1YQVL 3NCYS 1CDJA 2HRPH 3UEZA 3OR6B 3ZE2E 4CN6A 2EIZA 3QEUA 1RVFH 5HGBA 4ELME 2UZXB 3QUXB 5IBTL 1C08A 5D5MA 3REWA 5C0GA 1DBMH 2E9JA 3ALPA 3TJEL 2R56H 5DQDH 1WT5C 2NNAA 3P73B 4WHYH 1MCCA 3MA7A 5F3BB 2ZSWB 5F1IA 4P2QE 2NR6D 3JTSA 3ARVA 5EOCL 1FVDB 3W2DL 3D0LA 5EDXA 4YO0A 5F88B 2HFGH 3C09B 4Y4HC 4JG1L 2P46B 2Y72A 4KRPB 4ZTPH 4BH8A 3U0PA 2H2SD 1DE4A 1T5WA 3MJ6A 4XHJD 3G6DH 1NC2D 1CG9A 4P2OD 3NH7L 4HSQA 3BD3A 5GGUA 3SY0B 2VWEC 5HGAB 4LAQH 1BVKA 2OLDA 1T0PB 3MCLL 4UB0H 5DHYB 1YEEH 5TE7H 5JA8B 1H15B 3V7AG 1QKZH 5GHWL 1P6FA 1T7YA 2ITCA 1IRAY 3IFNL 5E1AA 1DQDL 1U8NB 3F58H 4FQJL 3QNYA 4WV1C 3JTTB 4RGND 3QXWA 1IGTA 2D0HA 4ZS6C 4JFYB 1A7PH 3AVEA 4N0RA 4XBGA 4ODSL 4RBPK 4CVZA 1IGMH 3GSNA 3UTTE 2YD6A 4I2XB 5T1MB 4XVUD 2JJWA 2ZKHL 5FUOL 1OARH 2WWKO 3QDMD 3OL2A 4Z95L 3MV8D 2B4CH 3TBVA 2WBJB 4OZGE 4PUBL 2MMXA 3OAUH 1JV5A 4X9BA 5GRUL 3W9DB 5DD0L 1GC1L 2CPCA 2HT3D 1IGYB 5JUEL 3FAXA 3EUUA 4JRYE 1AHWC 4KI5D 2PO6D 3PUCA 4MAUH 2I27N 3BD5A 3IKCB 2HA1A 3UMTA 3QI9B 4RFOH 2X1PA 4OFIA 5CIPH 4WTZG 1A3RL 1E4WL 4I0PD 5ADOL 1G7QA 1KCUL 5MENB 1Q8MA 2Q1EA 4TPRH 1INEL 3ELAT 4AIZB 3BUYB 4AIOA 2H2PC 5CKGA 4ERSH 5ENWA 3CDGA 3H0TA 3CAFA 4MDIA 4MAYB 4ZFOA 5SWZD 3EHBC 2NXYD 4JHWL 5MI0C 4NUGH 3BVNB 2CDGA 3TPUB 1LHZA 1MCWW 3BZ4A 4M5YH 4OKVA 3ES6B 5ICZA 4JPIB 5D7IB 5D1ZC 3RNKA 1YYLL 1WIUA 2DMBA 4UAOC 1JPST 3QXTA 4F8TA 3IU3A 5T3ZD 3LQZA 1CGWA 1NLDL 4HULB 1H0DB 3GSNL 3EYVA 3CK0L 3OGCA 4ZMAT 4MLIA 5TDNB 3Q6GH 4ZS7L 4PJAB 5CEYB 1U58B 2P8LB 1KEGH 3I9GL 4NRYA 3B9KA 4TOYH 3GKZA 3HC4L 3VA2C 1FAKT 2APBA 4QCIA 2D4FA 1VGEL 3MROB 3H9YA 3JWDC 3OKMB 2ZUWA 3SN6N 2D3VA 4BQ6A 2BOBA 5HHQA 4QXWA 4OUUA 3VXSA 2FL5B 4WJ5B 3R8BB 2UUDK 4EOWH 2DM7A 1AO7E 3V6OC 3WN5A 2HH0L 5EU6E 3BQUD 1GPOL 1TZHB 4LGRB 4PG2A 3I3BA 3KPMA 2PYEE 3OZ9H 1XH3A 2QHRL 3PDOA 4ZUUB 2X70A 4Z7WA 1K4DA 2XY1A 5EUOA 1NCAL 4R7NB 2DQUH 5L2KE 3T3MF 4NQSA 2JK5A 2XTJB 1GZQA 1WBYA 3DTXB 3TZVA 2F19L 2V2XB 1FH5L 1XGUA 1KN4H 1NCTA 1ZLVK 5F9AC 3U4AA 3MOQA 2UZIL 5C07B 5MEQA 4F8QA 4HAGA 4ZFGH 3B2VH 3EJZD 4U1NB 5DI8B 1J0YA 5J12B 3QPXL 1G7MB 4PY7B 1JGLH 4YFDB 4M6AA 5BZWB 1FL3B 2VC2L 4O2FA 5C0JA 4XP5H 3VRIA 1EEUA 3K8KA 5E00A 1XF5A 3J7HA 2VLKA 4HWNA 1MVFA 3MSPA 3ARDA 4NRXA 3L3JB 3HNTL 5ACZB 1WZLA 3FT3A 2YD5A 1P7QD 2YXFA 4KMTH 5D1XB 4YK4B 1KPRA 1CBVH 5E2TL 4EUPH 1EHXA 2N4IA 5E8PA 5FOJA 4OZHE 3UTSB 5DD6B 3GSUB 2PW1B 2H9GB 1LDPH 3A0OA 4XAWH 4WY7H 1VPOH 1KB5A 1IBGH 1TDQA 3BKJH 3BEVA 1KLFA 3DLQR 4P48A 4NKOA 5DWUL 4EBQH 1FG2A 3OG6B 2V17H 2MPAL 2W60A 5B39G 3S88H 3REVA 3I3DA 5E2JA 1YEFH 1J05A 4IM8A 1CXHA 4LSVL 1T7VA 1KCVL 1SVCP 1FE8L 3HPJB 4N0CD 4JM2D 4P5KB 4X7TB 3VH8A 2XT1B 3BKCH 3PWPB 5GJTH 3GHBH 2G75B 4ONGH 3PHQA 5HDQH 4XVSL 2BP3A 1RULH 2FCBA 4QHUB 2HKHL 4RDQF 2FSEB 5I8KH 3KPNB 4DZBB 4S0SD 1IC7H 1T22B 3SDDB 1PG7H 5B22A 4YHOL 1SM3L 1BQHA 1NANH 1UC6A 1FNGB 3BXNA 5HYIA 2Y06L 2QSCL 5C09A 3UXFA 5I1CH 1S7VB 1I4FB 3QYCA 3TCXA 4GAJH 5FYJE 3CFIC 1OM3L 3TPKA 1YNTB 3NIDE 1KFAL 3BWAA 4IIQA 4P4KB 3CC5B 3LPWA 1OPGH 2BNRB 3UROR 1EJOL 1X5KA 2DQFA 3C6LD 3LD8C 4XP6H 4XWGL 5D9SA 4X7CC 4YC2C 1QLRA 4L9LB 4MQSB 5DD5L 1JGVL 2CLVB 3H3BC 1Q0YL 1TVHB 5JHDD 4LVNC 4XC1H 2O5YH 4P46C 3S35H 1IC5H 4AH2B 3D6GA 4K3DL 4PJFA 5BZDA 5T5FH 4IHOA 5HHVH 2ATKA 5J3HD 1S7XA 1QYGH 4F9LC 1QBML 3W39B 3QWRD 3W81A 5FHBH 3BGMB 4G7YH 4P9MH 2AK4A 5T1LA 1KJVA 5DRXB 2AXFB 5J9PB 4XCEA 4PG9A 3IVKA 1Q9OA 2DQEH 1IFHL 4ZUWB 3ZHLA 1ZS8B 4YDVB 3BRDA 2YD3A 2VLJE 4WI8A 2XQYG 1NLBH 3CSYB 4NKMA 4YBQC 5CILH 3GSVA 4S1RH 5FYLH 4JJHA 3HMXL 3QUYC 3V9FA 3GSOB 4U3XA 1A6VL 3U82B 5BV7L 3K4DA 5GGRB 1IEAB 1EO8L 4MJ4A 1QNZL 1MFNA 1NBVL 4TULL 2BXZA 4Z7UF 1AC0A 2JCCB 1EMTH 2UWEF 4S1DD 3UCRA 3MFFA 3QDJD 4PJDA 3SKMB 3VFRB 1D9KA 4KK6D 1I85A 4XCYB 3OXRB 4ZSOE 4NN6C 4RGNE 3BHBA 4V2CB 4WWKB 1OOAA 1TJGL 1CLCA 4PRPB 4CMMA 1JWMB 3R0NA 3V5DB 3N1FC 32C2A 1B0WA 2VLMD 1JNNH 3KJ6L 5LWYH 3BT2H 2BNQD 4D3CL 1CIUA 3PF2A 1NC4A 4D0BB 2PXYB 3V4UL 3K74B 5F72S 5HHMD 1A6TA 1CFNA 1NCCH 1FYTB 1U8QA 4X7FC 4O02H 3SQBA 3HCVA 5L0QB 2JJSA 4MA3B 4LFHD 1IAMA 2YK1H 2YD2A 3AS2A 1WBXA 2V9TA 5E0QA 3RWCB 2V2TA 4PRIA 3NN8A 4IMKC 3H3PH 1LE9A 3QIUB 4OGAC 1U9KA 4PD4K 3TNNA 5K9OA 4JY5L 1I8MA 2VITB 4KPHH 3WIIL 4LLUA 1F6AB 4L8DA 1JP5A 5IB3A 3ZKXB 3ZE0F 2ZCHH 4M1CD 3P11L 3G9VA 1U3HD 2CK2A 3G5VB 2R0WH 3PWJB 1PKOA 4R97B 1R5IA 2OTWA 3QJHA 4ONFH 1FLRL 4XPTL 4NQDA 2BVPA 1I7RB 2IC2A 4PLNC 5SWZE 3ARWA 3KVQA 2XN9E 1X5YA 1CE1L 3BMWA 4PJ9B 1YMHA 3FONA 3TV3L 3FB5B 5D96C 4M1GL 2LU4A 2RCSL 5GRXG 5JO5B 1OGAA 2Q76B 1HKLH 3NA4A 2ED8A 4HUMB 4I18B 4J6RL 2FJGB 5MEPB 4I77L 3WLWD 2VQ1A 1FRGL 3N85L 3FKUS 4RA3A 2ICEB 4HC1L 4DGVL 1AE6L 2OJEB 1LMKA 1MFCL 1XGQB 5CJQH 4XX1G 1TZIA 4AK1A 2ZZUT 4Q97A 2IAMD 2VNCA 3LHPH 2WQ8A 1N3NA 3SE3A 5ITBL 1A64A 3S96A 1IGFH 2B1HH 3TT1H 4OLUH 2F5AL 1WAAF 2WSKA 3BDXA 4CN1A 5IF0A 3QWOA 1JGEA 3QCUH 3C5ZA 1G7PA 1LDSA 1MFAH 3WYRA 4WIQA 4MS8D 4OIIH 4D9RE 3KXFE 4E41B 5CGYC 3CDYA 3OJDB 4PJHB 1FSKC 1ZT4B 3NA9H 4APQB 1FGVH 1A2YA 5CBAA 2AERT 3F7YA 5FYLD 3FO0H 4GRLC 4OLYH 5I66B 1MEXH 4UILH 2YWZA 4Z77A 4FTVB 1RZJL 4FG6D 1OSPH 5L9DL 4J7RA 2BCKA 3DETD 1Y18B 1HI6B 1U92A 4PY8I 4G5ZL 5CLWA 4OZ4B 2P7TB 3WNPA 3K4AA 4MNQB 2AJ3B 4HK3N 1JTPA 4MJ5A 5DLML 1KIRB 3DBXA 5IOPA 3D5OF 2O93L 2BOCA 1FZKA 5BRZE 2AXGB 4XNYH 1CICD 4BZ1L 5EORH 3ME0A 1AI1L 1ZLSH 4IRJD 3A67L 4R3SA 4CDGC 4X6DF 4Y4HA 3IDJB 3QP3A 4AENB 1JK8A 2BZDA 1SJXA 2EIDA 2HJFB 1BQHG 1OAZH 2C3WA 5EFIB 4A6YB 3EW3B 4GRWB 1MHPH 3QQ4A 3UO1H 2HN7B 3TN0C 1OQXA 3V7MA 1K8IA 2E9BA 2GQHA 2K7PA 5DQ9B 4KTEL 3O2WH 1YQVH 5JW5A 3UDWC 3MLZL 3DSNA 1NFDA 3VFTB 3S97C 2Q6WA 4H5SB 3KPRA 5KJRH 3GSWB 4OCXL 4X0KA 2DRUA 4WV1A 2ZSVA 3QHTC 5AD0A 3MREA 3RGVC 2P5WA 3MBXL 5I1IL 1D5ZB 3LN4B 4OI9A 4MZ2A 3VFSB 4EN3D 3MYJA 1CIDA 1FZJA 4L3EE 4JREC 3TF7C 2FB4H 5FO8A 1J0HA 2M2DA 2P45B 4ZFZB 1RZIA 2V9RA 5HYQB 4XZUA 4PRHB 3OJ2C 4EDWH 5FKAB 4MSWA 5CINL 1YJDL 3WNMA 4U6TA 4PY8J 2YKLH 4KKAD 1HH9A 3MRPA 3ARQA 4JFEA 2EECA 4ZOCA 5TQ0L 2VXTH 2ARJA 3LZFH 2DL2A 1INQA 1I1AD 3TBTA 4C56D 2BSRB 1U8JA 2ATPA 2VL5B 1C12B 1AGBA 4LGPB 1B4RA 4ZQKB 4O5LL 1HSAA 3GMPA 4FFZL 3ZT6A 1ZT1B 4MXWL 3IJHA 1SJEA 1F5WA 1DQDH 4PD4J 3VFMA 2VDML 2FJHB 4DVRH 4FQJH 4M7JL 1I8LC 5IT2H 3UJTL 2W0LA 5I1HH 4Y8AA 2HG5A 2OYPA 3SOBH 3L5WA 3GMMB 4HPOL 1A4KB 4G6KL 3TBSB 3DPBA 1K5NB 2HTKD 4PJIF 1CL7I 3DXAB 3AM8A 5JHDE 4ZAKC 3X13A 2FNBA 4HH9B 4HKXB 1GVIA 1NH6A 2HRLA 3MLTA 5JA9A 1CU4H 2ZKHH 2MKLC 5DJ8B 2NZIA 4Z95H 3DX8A 2E7CA 3MRLB 3HE6C 3LQAL 4LPTA 4PUBH 4NJAH 2YRPA 3UPRA 4WO4B 5GRUH 1WBZB 5A3IC 5D1ZA 2YZ1A 1E4KC 3D39A 4J1UB 1B2WL 5B8CC 4JKPH 4B0MM 4U7MA 5HPMB 3JV5A 5SV3A 3NFSL 3OV6A 1FC1A 3RIAF 3RU8L 5I1EH 2OR9L 1CVRA 5AAWA 4X80H 2QKIA 1F42A 1D5MB 3SJVE 4WVRA 1Z0NA 5DJ2A 4BSWA 1NCWL 4MD5A 3RY6C 4C59B 1A3RH 1QVOA 1E4WH 1I7TB 4PGCB 1KCUH 3ARGC 4FXKA 4QNPF 1WEJH 3F5WB 2VLRD 4LHQB 1B0GA 4KRNA 2EDFA 4HIXL 4L8CB 3BZEA 4X9IA 1NAMB 2X4QA 1BVLA 4KK9D 5F7LB 1FNFA 4WHTB 4WFHD 4ODWA 3PGDB 4X5XA 3RVWD 4JHWH 5IW1B 1KTLA 4GQPH 2Z4QA 4P4RA 4QHMB 1KJ3L 2BY3A 2J4WL 3LKRB 3VI3F 1DBJL 2ADGB 4WW2B 3KLHD 3G08B 2DQTL 3CZFA 4S10A 5IHZB 4XNQA 4BQCA 1CVSC 3ZKMC 2BNQE 1N0LA 1KUMA 3GSNH 4LCYA 3EYQD 3S34L 3CK0H 1IEBA 1YYMH 3I6KB 1F3JA 1LP9F 3ISWA 2DD8L 5D70L 4CADB 1DBKL 5HHME 4EEEA 3JXAA 3GUTA 4DK6A 2OXHA 1EA9C 4Q0XL 1ORQB 1BD2D 1QSFD 1XF2B 3I9GH 4HWEH 2F8VA 1CR9L 5HHXH 5BXFB 3IXAB 2P1YA 5C0DB 1TMCB 3ROOB 2EDBA 3O2VL 1OTTC 2XFXB 1XCTA 3I2CL 3GJFK 3VD9A 5GSRB 4L3CB 3RUGF 5IBUB 1QACA 1QBLH 2NXZC 3MPCA 1FV1A 3P4MA 3PABA 2J3SA 4ZUSB 1JWSB 1NBZA 3MXVH 1GPOH 1T1YA 2MKWA 1HYRC 4R6UA 9CGTA 1MCDA 4QRTB 4EVNA 5A1AA 2QHRH 5KS9B 3AREC 1W0YT 3MRFA 2DIAA 3L7EB 1BECA 3FFCD 4XMLL 4N0UA 3V6ZA 3VGGA 2Y25A 5DMKA 3MBED 4LMQI 3X11A 4OGZA 1OY3B 4WFGD 1UCBL 4JO2L 2IPTL 2IF7A 3AMKA 3BP4A 1CXKA 3MX0A 4XNZC 4UMGA 3V4VL 2XZQL 1ZVSA 2APVA 1BIIA 3P4OB 4V1DA 2XKNB 4XPHH 5F70A 3KWWB 3RVXD 2XNAA 2L7JA 3KAAA 2EDDA 3MLYH 1N7MH 2EDJA 3EOAB 3K0WA 3QA3B 4NC2B 2OXGA 1XEDA 5TGBB 3QPXH 3LKNA 2DDQL 2IH3B 4PTTA 2CRMA 1Q9KB 4P2YA 3X14A 4BH7B 15C8L 1ETZA 1J0ZA 2VC2H 4RBPH 3MRCA 4N8VG 5FUZL 1AGCB 2NY2D 4NRZB 1E27B 1K2DA 3DO7B 3OKYA 4MNGE 3C8KB 4CN4A 3UPAA 4XNUL 3MNZB 4L4VA 4OF7A 25C8H 5DVOA 4MD4B 3NFPB 5D7JA 1U8MB 5E2TH 4WHCA 3GSXB 4FQQB 4U1LB 2GTWB 3GIVB 4YBLC 4JRXB 5DMIL 3DX7B 2OL3L 4PLKD 3GJFA 2ZCKL 3PWVB 4JM4L 1NGXA 4OCNC 4MCYB 1HXMB 4I4WA 3FMGH 1CXFA 3HRZB 4FQHB 1EEZA 3VCLA 1P84K 4OAWA 3N0PB 4M6ML 4JANA 4FN0A 2C26A 2MPAH 1JPFB 3VXUA 5FYLE 1T03L 4CVWA 4Z7OE 2Z31C 5GS1C 3MLVL 4HAFA 3MOBL 1NKOA 3VGEA 1KCVH 3LRHA 4EZMA 4N1EA 1X9QA 4Q9QL 3DI3B 4HWZB 1PDKA 5T1KA 1U8HB 3L6FB 4PJCB 4ZFFA 1YPZB 4P46A 1Z9LA 3AXLB 4PJ8A 4LNVA 4NO0B 2I9TB 2XTLA 3MMEB 4XPAH 5E6ZA 2HKHH 4S0TD 4UUJA 3C6LB 5FK9A 4EI6B 4XPBL 3ARZA 4DKEL 1SM3H 4X7SH 5GJSH 2OBGA 3VI4F 1HHKB 1A1MA 2AJVL 1PKQB 4RMTA 3C60A 4WUKL 5DRZA 2X4OA 4HJ0C 1OL0A 4JY4B 3CFJB 3SBWC 1H5BB 3SKJL 1FBIL 5I71C 1KFAH 5D6CB 4PV8A 3JSSA 3HC0A 2DOCA 5JDJA 3T08A 5GGQL 2EDEA 3F6IA 5DD5H 4EXKA 5F7NC 3FT4B 4HK0A 1QQDB 1SY6A 3C5SB 3QUYA 4Y5YC 2GI7A 1OVZA 2DBLL 2UUDH 3WO4C 5MENE 4R4NC 1NPUA 3ZMRA 4I3RH 3TYFA 5DJ0A 5DMGD 3DURB 2B1AL 5E03A 5E6IC 5ICXA 2XWJA 1QLFB 4KU1A 3UTPD 3WSQL 2GSIB 5LGKA 1QBMH 5D7KE 5BVPL 1A3QA 4DZ8A 5FGBC 3GMQB 1FNSH 1MIML 1QSEB 3OHXA 1EO5A 1HHJB 1JNHA 3M1BB 4DEPB 2FD6L 3IAQA 1C7TA 5DGQA 1SEBB 3L5XH 5CJXC 4KTDH 1ZLVH 4HHAB 3BWUC 5CSZB 1RIUH 4N0FB 1HHIA 1WICA 4ODTH 4PJAE 3FRUA 4Q74A 5E8NB 3WLBA 3NCBB 4HFWA 4LU5L 1X7QA 4QYOB 3VXNA 3LKOB 3NFNA 1S5HA 1T21B 4M7LL 1HH6A 2Y36L 5DT1L 1A6VH 2EKJA 5BV7H 5F6IB 3CFBA 4NP4L 3QUML 3C5JB 3MRNB 5IK3B 1INDH 4IMKA 1EO8H 2AP2A 4OGYH 1QNZH 1NBVH 1FPTL 2XYCA 4KK5C 4D94A 4Y1AB 5EA0L 5DK2B 3U36B 1L6ZA 3TO4A 1IQDA 1AP2A 3EFFB 3P40A 5IQ9B 4YDIH 1CFQA 5TF0A 3LKPA 1C5CL 4YWGH 5FHAL 5HHNA 1A1OA 1TJGH 4NWUL 2EXWD 4OZIA 3VXSD 3GI8L 1AY1L 3TJHD 2E7HA 4PB0L 3IFPA 1SY6L 3WS3A 3WFHA 1D5IL 4D3CH 4NDMB 5J6HB 4NZJA 1EBPA 2FWOA 2DLFH 5TF1H 3V4UH 4UQ2A 5EBWA 3L3KA 2IPKB 2G5RA 5JIPA 4XPGL 3PHSA 1TTGA 2DLEA 4CJ0A 2XTJE 3D2UB 2EDOA 4J4PC 3PJSA 4BFIA 2X4TA 1P6AB 3BYTA 1A7OL 3MRKB 4D0DB 5GZOC 5D71L 3TLRA 3KNBB 5FO9A 3TZVD 2MSPA 5HVWA 1P4LB 5C07E 5FXCH 3MXWL 4HUNB 4DOHB 2VABA 1UZ8A 1IM3A 1UB6A 4M4PA 1MHEB 2WK2A 3QEQA 4JZOA 1ORSA 3G6JB 5C0ND 1U8IB 2BVYA 3LN9A 3VFPB 2R1WA 4HG4K 4O4YL 5HJ3A 3EYFB 4P3DA 1B90A 2CR6A 2BVEA 2X9WA 4BYHA 2FX8H 4AMKL 3V2AR 3S3PA 3FFDA 4ZOEA 4P2RE 4U1IA 4XPTH 2VLKD 3RWJA 1HINL 3ARDD 4ACPA 2IANB 3HPLB 5J11C 3BZFB 2AS5M 4H26B 1CE1H 1DQJA 3D18B 3FQWB 2IAMB 3NCMA 2DIBA 5EUKA 5HHPA 3RVUC 4C4KT 1FO0L 3SE4A 4M1GH 2RCSH 4DUVA 1P84J 4GRLA 2YPLB 4U6VH 1AQKL 1UEYA 4I77H 3VGAB 1A6ZA 2ADJB 3IFOA 3HI6H 1U8KA 4X4XA 2ZPKL 4DGVH 1AE6H 3VXRB 1S7WA 3MJGX 4LCWB 1UB5A 3MGTB 1QSFE 1EXUA 2Q3ZA 5KVFH 4L8SA 4LOUD 5ERWA 5D7IF 5ITBH 3PWPE 4L1HA 2EDLA 3CH1B 2IG2L 5T33H 1ZA3B 5HSFA 4OJFH 3RVVC 2AEPL 1ZK9A 3O3EB 4EI5C 3PQYA 2FRGP 3QQ9C 5LBSL 4YBHA 4Z6AT 3HUJB 3IAGC 2OL3B 4OLVL 5EWIL 2YEZA 2QQNL 4UNTA 3S9DB 1XIWA 2M26A 5EU3A 3MC0A 4WFFD 4K7FB 4LSTL 3WEXA 4P5MA 4XBPA 1UA6H 4G6ML 4JCLA 1MJUL 5C09D 2B5IB 3U4EA 4NN7C 2YD9A 4OF6A 3P2TA 4Z7VB 1CICB 4JJ5B 3V8CA 3FTGB 4N5EC 5ILTL 1OTSC 4PJEF 1H3TA 1BP3B 4LVEA 2X7LB 1MJ8H 3IRZA 4HH8A 4JGJA 2B20A 1N6QL 4R4BB 2XOTA 3ESUF 4WEUD 3BRGC 1PSKL 5ACLA 4J3VA 1HXYB 1EEQA 4LSRL 2X40A 3ARYA 1NKRA 2MQ3A 2AJZA 1RD6A 2YMXH 5JXEA 4FHBD 3RL1A 4GLRI 4KFZC 4ONHA 1EBAA 4YEFA 1RU9H 5HGHB 4Y4FC 5F89A 5DRWB 1YUHB 2CH8A 3WJLA 1EZVY 4KGJA 3MNVB 3VFOA 4BZ2L 3P4NA 4KDTA 4LSQH 2AK4D 5T1LD 3MCG1 4HKZB 3AB0C 1S3KL 4FFVC 5L8KB 4EN3B 4KTEH 1MLBB 3H7BB 5I8OL 5IV2A 3MLZH 1RIVL 1LO3L 4QEGA 3U9UB 3NABL 2D31B 4DN3L 4ELMF 1BEYH 4KJYA 5DA0B 1KG0A 4OT1L 1DQLL 5C9JB 4POZD 4G42A 4JFXA 4XXDB 2JCCE 4F15B 1QFHA 1I8LA 4NKDA 1ZT7B 1LE5B 2Y9RT 1QLEH 1U8OA 1QPXA 1I8KB 4YGVB 3OKDA 4D9LL 2VIRB 7CGTA 3MA9L 4GXVL 1URLA 1JZ4A 3O11B 5ESVA 4ZAKA 4AM0B 3QG7L 1D9KD 3GIZL 2IH1B 1BFVH 1PYWB 1F6FB 2WBWB 5DMYA 2AAVA 2UY7A 4P9HH 5HGDB 4OF8A 3T04D 3IAPA 4XH2A 5EN2B 1NJ9B 3L3OB 2GJ6A 2R0LL 3HE6A 3L1OL 3DVFA 5TQ0H 1NC4D 2AV1A 5DC0A 1QA9B 3JWOC 4KJWC 1G7LB 3ULUL 3RL2B 4X7EC 3HR6A 5B8CA 2JJTC 4PGBB 4G9FE 2ZG2A 1CK0L 5AYUL 5L88L 1YMMB 4O5LH 5DUPL 4DCQA 2E8ZA 1JVKA 1ZEAH 4ELKA 2VDMH 5H94B 2H3NB 1S7SA 3UJTH 2H41A 5IKCA 4PRID 1IT9H 4U3HA 3JZ7A 4NPYB 1YEGL 4G6KH 4HG4J 1M7XA 3MRHA 1RIHH 5IHUL 4QHLA 4PJBF 4GG6A 1WFUA 3LVEA 1EHLL 1RURL 1Y0LA 3MLRL 5I1AB 4OQTA 2DWEA 2UV3A 3UTPE 1CD1B 1TQCB 5KVMC 1D5BB 4OZGF 2M8XA 3KDMB 2O5XH 1PY9A 4P2CG 4A2LA 3PIQA 1AQDB 1VFBA 4IOFD 5FAAA 4R7DB 2GITA 5CHNB 3QFDA 2GFBB 1CL7H 2A6DA 2V2WA 1B2WH 2ENYA 1UJ3A 2HFFA 5FA4A 4NQDD 2HLFD 4IS6B 4LRNL 5GRJL 3CX2A 3GBNH 1AGDB 2OR9H 5B21A 1JF1B 3ZDXF 2X1QA 1NCWH 3RTQB 1KB9J 1I1YB 1OGAD 2IMMA 1GGBL 5F1NA 3STLA 1ND0B 3T1FB 2D7TL 1ZA6B 2YUVA 3RWDB 4HIXH 4F33A 3WE6B 5D6DA 2Y5TB 3V95A 4ZUTA 4UBDD 1CTNA 3O3UN 5H2BA 2E7LA 3RWIA 1LEKB 3WIHA 5IM7B 1OTUD 2IGFH 4F2MB 2J4WH 3IDIA 2VTFA 1U3ZA 3AREA 4P2OC 1BLNA 1OSZA 5I1GL 2P44B 3C5ZD 3MZTA 3KLDA 5SWQB 4OI7A 1KC5L 2VDLH 2W92A 3DGGB 3E6HA 1FO0B 1P53A 2WUBL 5IBLC 4K2UL 4BK4A 3BP5B 1F58H 3QEGL 1DBKH 3TC9A 2ZUVA 4OQTL 5MHSE 4Q0XH 4LCCC 4RGNC 1RFDH 4PJ7B 3IDGB 2AEWA 4K8RC 4UZGA 5KSUA 4JY6A 5ESQA 5J1TC 2HP4A 4H1LA 5EBMB 5C6PB 3PWLB 4OCSL 2I25N 3L3IB 3I2CH 5CGTA 3GSQB 2EH7L 3V0AC 2A6KB 4XVUC 2GTZA 4FXGB 4PRBA 2YXMA 1MWAB 5HI5D 2NY0C 4ETQB 3LSOA 1QFWL 3EOBB 3MQIA 4TSCL 1G7JA 4YHYB 1FFPB 2BSED 2WP3O 3W0WA 3RNQB 4QHNA 1OF2B 1F02I 3LRGA 4XMLH 1XF3A 3OKKA 5CD5D 5B39B 3DX6B 3HNVL 2GIYA 3DRQA 4QRSB 2YSSB 3JWDH 5C0CA 1DUYA 1X5GA 2RGSA 2JJVA 2PO6C 4JO2H 1NCBH 4XCFH 4M61A 3IYLW 3Q48A 2Q8AH 4G6AC 2OCFD 4Y4HD 3GM0A 1W72B 1W2KT 3OPZL 3KYMB 1C08B 1KEMH 2E8YA 1X5AA 4P99A 1FCCA 3BYYA 1FAIH 4MLSA 4ODXA 3B6SB 4PJGB 4QO1A 4O00A 3PL6B 1SQ2N 1G9ML 1WCBA 2DDQH 4Y5XC 2DBJA 1TJHL 4JLRB 4NT6A 3OKLA 3MNWA 3D0LB 1D7FA 2ESVB 2NXYC 4RQQB 4R4FL 4DJMA 3CCHA 3B3IB 4PRAA 1TJIL 3KPRD 1YNLL 4ZPTA 1S7RA 4PJ5A 3T0XA 4JKLA 3RBSA 2DWDA 3G6AB 2ZOKA 4QF1A 1KTKE 1CG9B 1U3YA 4ZS6D 1J12A 2ZG3A 4PRHE 1PEZA 5DMIH 5GGUB 1LWRA 2L4OA 3DV4B 1P7KA 1MCNA 5DZNA 3ZLQC 4HPYL 5D1QC 3RZCC 3D3VB 2ZCKH 5HD8C 5T5NF 4YXHH 4M6NL 5JPNB 3NIFE 3VWKB 5I1DA 3SBWA 3NPSB 3QNYB 3VWJA 3EBAA 1ED3A 5CEXA 4UV4L 4GBXC 2CKBA 4K94C 4JFED 1S8DA 1HIML 5IESH 4KJQD 4NFDA 4XBGB 3MOBH 4CVZB 1HHHA 5E4IA 4XP9L 2W65A 3UYRL 1MCHA 5C09E 1CTOA 1X6NA 4CL7A 2NX5B 5K9QG 5FOBB 1VGKA 2Y7QB 3B8SA 5IEKB 3VG9C 4YHKH 3VD5A 1MLCA 3DXAE 1JV5B 3ECBB 5KVGL 4AG4L 3MRIB 2FECI 5EIIA 4L8BB 1OW0C 2V5MA 3KPLB 2AJVH 4TVSa 1Q1JH 3DSFL 4XPFL 5E4EC 3IDUA 1X5FA 1J5OL 4R8WL 5CP7A 1K6QL 4F80A 5JHLL 2Q86A 4PJFE 1NFIA 1FBIH 5IW6A 2XRAL 4F57L 3RDTB 2X44D 2BVUA 5D1ZD 4QRRE 1WFTA 3VJ6B 5GGQH 1P4IH 2PUQT 1GGYA 3VRJB 2AK4E 4Y2DC 1JNLL 1MVUB 2ORBH 2X1WL 3I50L 5ALBL 1LK3H 1JTOA 5J06A 1JYWA 1H3WM 3GJFH 1FNAA 3CDGB 5HYFA 4NO3B 1U95B 1I9IL 4P2QA 3H0TB 5DD3L 4HUVA 4E0RB 3IDMA 1CDIA 4G43B 3GBML 1F4YL 2B4CC 5I2IA 3QEHB 3BZ4B 5EO0A 5HVFB 1I1RA 5ICZB 4WI3A 4S2SA 3CFCH 1A1NB 4FQ2L 4E5XA 5DZLA 1DL7H 2DM4A 3IDXL 3OAZK 2X4UB 1MIMH 3DHJA 2AJXL 1A14L 3OKEB 2GK2A 2FD6H 3SDXF 5JORB 3DNKA 4TSAL 4Y4KC 3AAZA 3QZWA 4EQ3A 1OT1A 1H3GA 1UH4A 3LV3A 1S9VA 1RAMA 1BZ7B 3SE8L 3S36H 3WL9A 1MQKL 2GHWB 5IVXA 4KQ3L 3VXTB 5DJDB 4J4PA 1Q72L 4LU5H 2F8XC 1NDMA 5EOTB 4OUUB 3BPOB 3VXSB 4JDTL 1QFUL 2GY5A 4N0CC 2Y36H 4JM2C 5DT1H 1R3KA 4NP4H 3QUMH 2PKDA 4Q6IC 3UTTA 3HRPA 3L95B 4W6YB 3G5XB 4O51B 1D5XB 4YFEA 4MMZC 3OXSA 5ADPL 3BKYH 2X70B 3HS0B 4G8EA 4Z7WB 3RHWF 4KDWA 1ZHKA 4JZJC 2QR0B 3NTCH 2JIXB 5AZ2L 4PRIE 1Q9LA 3U0WL 1AY1H 3GJEA 4NQSB 2V9QA 2JK5B 4TVPH 1GZQB 1SY6H 1J11A 5KS9E 1D5IH 3TZVB 4TNWF 3DMMB 3KPSA 1DCLA 3GGWB 2CJUH 3BMVA 4TNVK 3RX7A 4N8CL 1N59A 1G9NL 5GGTL 2CIIB 5DFVD 3L9RA 4XPGH 2MOVA 1JL8A 1KJ2A 1DVFB 4DK3A 5C2BH 4IOIB 5D71H 5AUMA 4K7PX 4QRPE 4YDJB 1L7IL 3VXMB 3KYKL 1JGDA 4GW5B 2PCPB 5E00B 4LPVA 4JFQA 2L0DA 4KI5F 4V1DD 5A2FA 4NRXB 5E5MA 4UTAL 5DFWH 1RJYA 2Z93B 2FO4B 1GL4B 4IRSC 4NQUA 1KENH 1NBQA 4DWHA 5SV4A 2D03L 4P23A 4YPGB 3BSZH 2APXA 1YECH 3MODL 1HWHB 1Z6JT 4TUKH 3FN3A 3WXWL 3KPPB 3UZEA 3BKML 3O6FB 1KB5B 5FYKU 1ZGLP 1HINH 1JMXA 3BEVB 4NKOB 4L4VD 1JI2A 35C8H 1RPQA 2B0SH 1FG2B 5D7JD 1ZANL 5B3JF 4MDJA 4ZD3H 1VDGA 5KAQF 5DUML 2DYPA 1J05B 4NKIH 2HJKA 3CFKA 4HGWB 4JAMB 1OB1B 3F7RA 5EOQH 3P3YA 1YEJL 5L8LB 1AQKH 1UQSA 3BIAX 4FQIL 1BJMA 3FB6B 5ANMA 4S1DC 2VQTA 4DW2H 5E9DA 3ZHKA 3PHQB 4G3YH 4MMXC 2ZPKH 3QO1B 3QFJA 1LNUA 1WWBX 2PYEA 4KK6C 1KJ2L 1I3UA 4G6JL 4HUWB 5A2JH 3VXUD 5DJYB 1MHHB 3VFVA 5FGCE 3DHMA 3BPNC 2AXHA 5FUCC 1CDGA 2AI0H 2GSGA 4M6OL 1BQHB 2R2BA 2IG2H 3BXNB 5L2KA 1IVLA 3DUUB 2AEPH 3JBG7 1P1ZA 3KPQA 3WFEL 1BQUA 5HI3D 2BFVL 3DOSA 5ICYB 5J6GB 4CW1A 3L7FB 5F44A 5T1KD 4J8RB 5E70A 4HJJL 4P46D 5C0FA 5LBSH 4PJ8D 4HIIB 2I07A 3ALXA 3LQMA 5DJAA 4TUJA 3MCKA 1PKQE 3QCVL 4OLVH 5EWIH 5KVEL 2BNUA 2QQNH 2FH6A 3RA7L 5HYJB 4Y4FA 2V5TA 3RAJH 4X5LA 1QLRB 1A3LL 1KJMB 4LSTH 2I24N 3H9HA 3C60D 1JHTA 2XA8L 4G6MH 2NTFA 4LBEB 1XR9A 2RFXA 5T1DH 2XWTA 4XTRD 4LHUA 3VXPA 5JOPE 3DI2B 5BZDB 2OM5A 1SVZA 1S7XB 1AKJA 1TZGH 4JVUA 1RJZB 3FQNA 1S9YB 2I5YL 4NNYB 1VKXB 3OMZA 5I18L 1T20B 1XT5A 4RZCB 3QUKB 2Z35B 4DKDC 4EIGB 4C54A 4TVPD 2ZG1A 3QUYD 5IFJB 5T1LB 4OZHA 1KCSH 3WFDL 1CLOL 5GS0L 4G8IA 1RUKH 2FGWL 4AEIL 1MH5A 1JPTH 4XCEB 2P5EA 1QR1B 3EZ8A 4G80B 4MJ6B 3IVKB 4KHXH 5ITFB 5IQ7L 1QSEE 5GGVY 5DURD 2CLZA 3KPRE 4S1RL 1KPVB 4FP8L 5ISZA 3SDCA 4NKMB 3NZHH 3CX5K 2P5WE 2ERJC 1XGPA 4JZNB 4HQQL 2J8UA 3NACL 2Y4SA 3H42L 4U0RC 4GLRH 1S3KH 2OS7A 4W4NA 5JMOC 1MIEH 4XBEH 2K1MA 5J13C 1XGTA 3MFFB 3O45B 2F15A 4Y5VB 1QP1A 4CU6A 2JJTA 1N5AA 1RIVH 4L5FH 1LO3H 1T0MB 4Y16A 3KHOA 2XIDA 1G7IB 1VFMA 3C09C 4ODVL 4OT1H 2OX5A 4U1SB 1DQLH 3GFUA 5FM5O 4CMMB 4HCRA 4Y1AE 5FCUH 3LRSA 4OCYL 2W9DL 3TFKD 1QO3B 5B38G 1ITCA 2FEEL 1M05B 4JM2F 1GGCL 1N64H 4D9LH 1A6TB 1UM6L 1ZMYA 4GXVH 2PW2B 2A2QT 3TO4D 1GOFA 1LD9B 2C1PB 3M45A 3HCVB 3GIZH 5HY9B 1RHHA 4X8JA 4NQXA 5ECJE 1WBXB 3E6FB 2CUIA 2IPUK 2V2TB 3M07A 5IB1B 1VHPA 5EZJA 3E2HC 4YNYA 4BJLA 2VDKH 3X3FL 5KN5B 4Z7QF 2XQBL 4GKZA 2X4SA 3QZWG 1G7HA 4OF3A 1I8MB 2P24B 2OK0H 4L8DB 1CK0H 5AYUH 4Y19A 4PJCF 2AJUL 4OLWL 4DOHE 4HT1L 2Q7YA 1E28A 3LKQA 5JNYA 2DQCH 3T0BA 4OSUH 3D39E 1R5IB 2A6IB 4F37F 1B4JL 4Y7MA 1DQMH 3PGCA 4D8PA 4X98B 1KCKA 3MRJA 3QEQD 3VGHA 2YC1A 2BVPB 1UXWB 3H9SE 4JHAL 5J8OA 3RI5K 1LEGA 1YEDA 4IRJC 1R24B 1I1FA 4G9DA 5BJTB 4FZEH 4N90E 3MLRH 5KSAA 2WBKA 1YMHB 2VLJA 5DEFB 2WUCL 2IALA 3VGBA 4JHZA 4ZXBB 5JW4M 4H20L 1CZ8L 3SDYL 3QB7C 5FECB 2VQ1B 4O2EB 1J1PL 4LRNH 3NCFB 4OCLC 4U1KA 4PR5A 5DDHB 1BGXL 3CLEH 1TZIB 2YPLE 2FLRT 1N3NB 3S5LA 3MUZ1 2EDYA 4MAYC 4GKNA 4RFEB 4ZSOA 4F7MB 3O6ML 1GGBH 4GRLD 1OCWL 4HLJA 5CZVL 5IF0B 1JGEB 1YEKL 4LCWE 3Q3GA 4RGOL 2D7TH 4I0KA 4YXKL 5GSVA 4L29B 2C3VB 4MA8L 1WCQA 4MQXD 4WUUA 4DAGL 3ULSA 3MLUH 2NY4D 4LVHB 1AXSA 4LGSB 2D7OA 2FHFA 1UVQB 4NCDA 4KKAC 5SX4I 4HMEA 4POUB 4X6FA 4JN2A 3J8F7 4HUUB 3HUJE 5I1GH 4GW1B 1I1AC 2HT4C 1A8JH 3Q6FA 3PQYD 4Z77B 1FL5B 1KTRL 4PV9A 4UDUB 3M17A 4LPXA 4HKJB 4AIXA 2WUBH 4N8VB 5C0BA 4K2UH 1GZPB 3QEGH 4JFHD 5D2NB 3MRBB 4QTIL 1AD9A 4OQTH 1XIWD 3ILPB 2GCYA 4N0UE 2FJFA 5CJ8A 5GGSA 3DBXB 3MGOA 1V7MH 2QQKL 4WI4A 3C87A 1DDHA 1BWMA 4X99A 4R9HA 2WINB 1O5DT 2X10A 4Y5XA 3PHOA 3U30C 2FX9L 4V1DE 4K23L 3O2DA 4R3SB 3OKNA 3RIFF 5KVDH 2XTJC 1XF4A 2HVJB 4Y4HB 5LAXA 2XN9A 3ARFB 4JO4L 1JK8B 5CSGA 1JMZA 4JKKA 4OCRL 3HNVH 4HJGA 4KUCD 3V7AE 4OFVA 5DJZA 5DD1L 3RWHA 1BAFH 5IB4A 5JXED 5DEGB 1K8IB 2VR5A 4QOKD 4KZEL 3HG1B 3CX5J 3QISA 1J8HE 5F96L 3LPGA 5D1QA 3RZCA 3EO0A 4L4VE 3WIHH 3GO1L 2Q6WB 3GEWB 3TVMC 3MRQB 1JPGB 1YEHL 5CEZL 3QG6A 4GBXA 5C86A 1WQVT 1G9MH 3VW3H 5D1XC 4WW1A 4YK4C 5IMOA 4KVNH 5EB9A 4GKSB 1I9JH 1X4YA 5FO8B 3KXFA 4NHCL 4FRWA 3DVNB 1EHNA 1SYVB 5C3TA 1BFTA 3OX8A 2XPGB 4M5ZL 4PJXA 4HFUH 2GUOA 2R9HC 5GIRA 1YNLH 2BVOA 4XCNB 3KJ4C 4GAGH 3V5HB 4H1LH 1R5VA 4JFEB 1RUPL 5CWSB 1TITA 1E6OL 1O7SA 2VN4A 3VFGL 2MCPH 3DUSA 3P9LB 1TCMA 4HPYH 4OD3L 5E08H 2ATPB 4NM4L 4ZAKD 1AHWB 4NZTH 3JWNC 3O2DL 5C08B 3BZDA 2AQ3A 5CFHA 4OF5A 1N0XL 4EDXB 3T2PA 3VDBA 1UKQA 1OWWA 2GJ6D 3HE6D 4UV4H 4S1QH 2NY5H 1J18A 1WWCA 1Q9WA 1YMME 3P0VL 3L5WB 5I15L 3QSKB 5IEHB 4XP9H 3SDDC 3UYRH 3I02A 4HUXB 5BRZA 5K9JL 3MV01 3QNXA 4Y2DA 2W0FA 3X13B 1HSBA 4M62L 3MLTB 4GQ9L 1L9MA 4PGEA 5C7XL 3E0GA 5HDLA 5E8EB 1FJ1B 2VQUA 1MUJB 1MCQA 1SEQL 5HYSB 1NL0H 3AC0A 5KVGH 5HDOA 4AEHH 3MBEC 2J5LC 1TQBC 4P4KC 4UAOB 4X5WB 3ZKND 1VFOA 3UZQA 3L3HA 4GSDH 4RMUA 4XPFH 3HI5L 4JDVB 3LS4H 4Z7UB 2UWEB 4Z7VF 4R8WH 3VFNA 1MCPL 1K6QH 1UWXH 2QKIB 3LCYA 4H88L 3RVXC 2E27H 5JHLH 4Y4KA 1XZ0A 4BSWB 5FB8B 4OV5A 2XRAH 4F57H 3EOYG 2VDNH 1KGCD 4S1SH 4F7PB 2CXKA 4IEFB 1TNNA 2V7HA 3T0VA 5E6YA 3CVHA 1R3HB 1KLUB 3U4BH 3IJSB 1BJ1J 4G8GE 3BZEB 1U0QA 4HLZG 5ALBH 2HJLA 2NY2C 2X4QB 3SO3C 3U1SH 1A7NH 1I9IH 1PZ5B 4L3EA 5DD3H 1BF2A 1F4YH 5SWSA 4Q6IA 1KTLB 4M8QA 2DKUA 5EBLB 1S9XA 2AJSL 4G7VH 4MXVF 4Z7NF 4R2GB 2CKBH 1GC1C 3QRFM 6CGTA 1WSST 4RRPG 5GQBA 1D6EA 3E1F1 3GB7A 4MX7A 5HI4C 4JZJA 4ZYKB 3MR9A 2MWCA 3FO2A 3QNZA 5F3HA 3ZYZA 3PV6A 1F3JB 2NXZD 4QXGL 2EH8L 1MNUL 3V79C 1NGQL 2B39A 3BPCA 4NQCB 3S8WA 1F8TL 1E6JL 4OCWL 4F7EB 3HZVA 3SE8H 3ARED 1T5XB 2P8PA 1T83C 3G5YA 4BSJA 3C2AL 4NZRL 2AJYL 1QFUH 4WU5A 3GMLA 3QHFL 4DQOL 4PJ7E 1F4XL 3D85A 3MV7B 4BSVA 2EC9T 1UKTA 2YPKA 4HWUA 3ILQC 4NM8H 2VISA 1OAUL 3Q2CA 3MRFB 4JO1H 3NAAL 5ADPH 5D2LA 1HDMA 5FF6B 3QIBA 5H35B 5FKPB 2A9MH 2RQ8A 4IRSA 1XMWA 2VDQL 3CVHL 2BY0A 2R8SH 1R3JB 5AZ2H 2XI9A 5L0QC 4TTGA 1AJ7H 2DQGH 1IJ9A 3PXHA 4MQ7A 4HXBL 4KVCL 4FQPA 4GT7A 3CSGA 4LEXL 2IQAA 5TPWL 5I30L 1ZVSB 4XP4H 2X4PA 1G9NH 5GGTH 3W0WD 4OZFG 1QEWA 1FNLA 2VZTA 1XGYL 5DR5L 3SJVA 4J3UA 3DV6A 4W6WB 3V5KA 2EKSA 2VZUA 4HMCA 4PREA 5C0CD 3LKNB 4PGDA 4WDIB 1M71A 3HMWL 2Z92B 4MWFA 5DRNA 2O61B 5DHVB 1M1SA 5EC1B 5DMGC 2FEDD 3CMGA 3GMNA 3CJJA 5I74B 2ESVE 2J6EA 3K1DA 1J0IA 1NGYB 3B9DA 2Z31D 4KROB 1L0XA 3GMRA 1KNOA 3ARUA 3GJFB 1Q94A 2H32A 5DS8B 1ONQB 1NGXB 4TYUA 2NLJB 5CLTA 3QULB 4LKCA 4OAWB 5DC4B 1K85A 5KSVA 1QZ1A 4PJ5D 4JANB 4NYLA 3RVTD 5KAQG 2EZ0D 1ZANH 5ID0B 3VXUB 3D3VE 2ZUXA 4JPKL 1OHQA 1SYSA 4DUXA 2WIMA 4LKXB 1I7UA 4YC2B 3IGAB 4PRDA 1VADA 1YEJH 2D4DA 1DBAL 1H3XA 3U6RB 2HFTA 3BIBX 3TO2A 4WI9A 2CR3A 5T1KB 2Z8VC 3B9KC 4HJ0D 4P46B 1V8HA 1KN2L 4HMDA 5AAMA 4X6DB 4TQEL 3VWJD 1KJ2H 5DA4A 3QQ3A 4GAFB 1ZLUK 5C0RH 3MV9B 2H1PL 2H8PA 4LPCA 3JV4B 2NX5E 4UTBL 4JFDA 1LQSR 4M6OH 4APQC 1AGEA 2F53D 3X3GL 3WN5C 4R0LC 3OAZH 3BAEH 1QHPA 2KQMA 4PG2C 2X4OB 4D0CB 3NIGF 4HJJH 2BDNL 4R4ND 4GMTL 4M00A 3QCVH 5DUBA 3W9EA 5HDBE 3RA7H 2J6EL 1A3LH 2XZCH 3HAEA 3OR6A 4HK0B 1B88A 3ULUE 3QUXA 2A9NH 4X6CE 3TYFB 4JFZH 4MNGA 3P73A 3GNMH 3O4LE 2ZSWA 2Z8RA 2OTUA 5TE4L 1FVDA 1L9NA 5F88A 4NN6B 1XFPA 4M43L 3OHXB 4N0YL 1T1ZB 4R26L 2WLYA 4P2QD 8FABB 1CLOH 5GS0H 2Y6SC 3ARDC 2FGWH 4NWTL 4AEIH 1A4JB 3D48R 3O9WB 2OTPA 4KK5D 1PJ9A 3NZ8B 3QO0A 1S7UB 5D5MF 4FQCL 3SY0A 5HGAA 1P9MA 2YRLA 1PQZB 4RAUA 1H15A 1JZ8A 4H0HB 3F12B 4YUEL 4DN4L 4HQQH 5CJBA 2DQDH 3U7WL 4PJIB 2Q8BL 1U8NA 1KULA 3JTTA 2FH8A 1CXIA 1M6OB 4JQIL 1IQDB 4JFYA 3WFBL 1C7SA 4RMSA 5DF0A 4LOUC 1CFQB 4IOSD 5CJOH 3CZJA 5MEOA 4J4PD 3CXHK 2GJ6E 1S5IH 1A6AA 1A1OB 5FDWB 1YZZA 4MJ2A 3IFPB 5KSBE 1TETH 2W9DH 5GZOD 1FGNL 3UTTD 2QQLL 2FWOB 3HR5B 5AWNL 3QDAA 4LNRB 5EBWB 1FFOA 3D9AL 3W9DA 3BIKB 1CF8L 3O3BB 1IGYA 3PJSB 3S36X 1UM4L 2X4TB 2E7MA 2FLBT 4ZDHB 5F9OH 3BRFA 3FHQA 5BV7C 4NNPH 4LSPH 4M3JA 3O0RL 1T3FB 1A22B 1CXLA 3IKCA 5D96B 1K4CB 1BF8A 3QI9A 3KPSD 3X3FH 1MCOL 5B4MC 2ZNXA 1UZ8B 2FBOJ 4JZOB 3QEQB 1ORSB 1YY8B 4YHLL 5MP6H 4IIQC 5MENA 3DUHA 4FFWC 5DGRA 3BUYA 2AJUH 2R1WB 4YQXL 4P3DB 1KGCE 3X12B 1JN6A 4P5TB 3RVUD 5EBGA 4MAYA 4XNMB 3MRGB 2JB5L 3BVNA 3TPUA 1B4JH 2IBZX 1OP3K 4PB9L 4U1IB 1ULVA 3ES6A 3RWJB 12E8H 1LP9B 3JWOH 1X5LA 4JPIA 4WCYL 3TBWB 1FZOA 2D7MA 3WDIA 4LAJH 2X4NB 5F9WC 5E7FA 4P23D 4GUPB 4X4ZA 4PYGA 4PJAA 4HCRH 4KV5F 5CEYA 3CPLB 1CZ8H 4ODBD 3SDYH 4EJ1C 1U58A 4MJIB 1G84A 2P8LA 3RUGB 5TDPB 1A6ZB 3U7YL 3IFOB 2F5BH 5BQ7B 5I1LB 2DQJL 1U8KB 3BDYH 4X4XB 1OQOA 2SEBB 5FYJH 2QADD 2WAHA 3MROA 3OKMA 4JFPB 3QQ9D 2I60H 4HEPG 1EX0A 2F54B 3T65A 2DTMH 4U0QB 2FL5A 2DYPD 1NMBL 4POZC 1CGTA 4NO5B 4NCC1 3FAWA 4MNHB 1B0RA 2AXJA 2J2ZA 4ISVB 3EFDL 4AJ0A 1CDBA 1TZHA 1YEKH 3WXVL 5E9DD 4ZUUA 4PS4H 2W9EH 4Z8FL 1IC4L 1YDPB 1D9KC 3QFJD 5DQJB 2PYED 4DAGH 4N5ED 1BWWA 5C0IA 1HK6A 4HZAA 4EUPG 2F9BT 4YX2H 2IFGA 4GFTB 3NCEB 2V2XA 4HKBB 5L2KD 3BH9B 4HS3B 3SQOH 3SGDI 2VXVL 3U4EB 3UBXB 3TP4A 5C07A 3TN0B 5D72H 4KMQA 2VH5H 4N1HB 3CFDB 3ZT7A 4U1NA 1WJ3A 1G7MA 4NKQB 4H8WH 5KTEL 1IZKA 5ACMA 4MCZA 4Y4FD 4Z7WF 5EUOF 2EDNA 3TVMA 3WMSA 2XY2A 3BPLB 4FNLL 2ICCA 4DGYL 3S6CA 2R1YA 3L3JA 4M1DL 5ACZA 3RGVB 4M03A 5A2LH 3RFZC 5EU5B 4QOKB 4P2RA 4ONHB 4LHUD 1PLGL 5D1XA 5IHLB 4XVJH 4JREB 2NTSP 1MCKA 5IFHL 1AKJD 4UOW0 5F89B 3RPIB 1RZ8A 3V0WL 4JO4H 4K3EL 4G8FB 3GSUA 2PW1A 5FIEA 2DM3A 4IOFC 4X9HA 3HNSL 4K8RH 5CBEB 1UWEL 4FOMA 4P59L 2HLFC 1RZJC 1CGXA 5IMLA 2P5ED 2AVGA 3MOAH 3S4SA 4RSVA 1JZ6A 1BX2B 4KZEH 5IV2B 5F96H 5HHOB 3VE0B 3IF1B 1OLLA 5FV2A 1ACYH 1OP9A 4PJ5E 1KG0B 5ISZD 4RISL 4U1GC 3HPJA 4P5KA 1MFBH 1CFVL 3HAEG 1YEHH 2W91A 5CEZH 3PWPA 4NKDB 3SHSA 4M7KL 7FABH 4FABL 1ZXQA 1JYNA 3RRQA 4CBPA 5EU7E 2R69H 4KJWD 3CXHJ 4QHUA 2FSEA 3KPNA 4DZBA 3SDDA 4NHCH 3QUZC 4ZAKB 1OTUC 4Y16D 2VMFA 3VXQB 1FNGA 2F58H 4LIQL 4OFKA 3IDNB 2VL4A 1JE6A 3HE6B 1N5YL 1S7VA 1I4FA 3THMH 1YN6B 3A6BH 3C5ZC 1RUPH 1YNTA 4JFOB 5A2IH 2AV1B 3GRWL 3DVGA 3QDGB 3TT3L 4DGIL 5B8CB 2DQHL 4P4KA 1A5FH 3CC5A 3NVQA 5FYJD 1UFUA 2BNRA 1UT9A 5JPMB 3MLSL 4NC1E 4NM4H 4UIKL 3IJYB 3O2DH 1NCDL 3GM8A 1AXIB 1OT2A 3F65A 4U2YA 2E5EA 2CLVA 1IM9B 3C08H 4P3WA 1S7SB 1TVHA 2EE9A 1OAXL 2PTUA 1TIUA 3PDGA 2VXSL 1MCLA 3ARGB 4AH2A 5I15H 3TESA 3MRHB 1W0VB 4FS0A 2R29H 2RHEA 1FIGL 2H26B 2LU3A 3CU7A 4QHLB 4S11A 2CLRB 4M62H 4XAKE 4Y19D 5HI5C 1U91B 4GQ9H 1BQLL 5C7XH 2JF1A 4P9HC 1MCEA 3BGMA 5C0AB 1YJDC 5KZCB 2F74B 1NUDA 5CD5C 2DLGA 5DRXA 2AXFA 3WFCL 3PIQB 1VFBB 4KGLA 5J9PA 4CGTA 4K94H 5EZLB 5FA4B 4ZUWA 4B7LA 3OG4B 4YDVA 1N4XL 4QTHB 3HI5H 2VUYA 3GKWH 3CSYA 2AEQL 2CGRL 3WKML 4KQ4L 1L7TL 2A1WL 5KSAD 1MCPH 4PJFF 3GSOA 5JDSB 2VLJD 1PAMA 2X42A 4NOBA 3ZSTA 4HBCL 5GGRA 4XNXL 2ED7A 1IEAA 5F1NB 5I1JH 1J1XL 2JCCA 4HF5L 4ZO6A 1NGZA 2VYRE 2B2XH 4PRNA 1T83A 3AFLA 4YHNB 3VFRA 1CDCA 1DUZB 3OXRA 2NXZB 2XZAL 1T1WB 5IBLD 1R3LB 2AW2A 2R4SL 1JWMA 3O41B 3V5DA 1CFTA 3LQAC 3ESVF 1MRFL 4DEPC 4XCCL 1DSFL 2AV7A 5IVXE 3RGHA 4D0BA 2PXYA 1JRHI 1BLNB 4K8RD 3ZTNH 1ZSDB 2ZUUA 2CUHA 1S9WB 4ZO9A 4LPUA 4MA3A 1I3RB 3S37H 4QXGH 5I8CB 4OIAA 1MNUH 2VO5A 4JFFB 1NGQH 2EYSB 4PJDF 1I7ZB 1OAYL 4G9FA 4Z76B 2NY0D 1FHGA 3RWCA 1E6JH 5EOCJ 1RZKL 1N6VA 4WI5A 1JRHL 4XC3L 5ETUB 3WV0A 5C0EB 5CEZD 4KJQC 2FBJL 4QT5B 5D2NE 1F6AA 4Z0BH 5CCKL 3C2AH 4QGTA 4NZRH 3KPSE 3QHFH 5C0BD 4HWBL 5E7BA 4GMSL 4Z78A 1MCWM 4HXAH 3LSOB 4G6AD 2QLVB 4U05A 3FQTA 3PWJA 4HK3J 5AEAA 4QHNB 4WGWB 4XB7A 3OKKB 3FOLA 5LXGL 1I7RA 3CVHH 3ZT5A 5C0CB 3AM8C 3V0VB 3BI9X 2OMBA 4RAVB 5KW9L 4HXBH 4YBLB 3GSRB 4LEXH 1QTYT 2KDGA 4PJ9A 1WIPA 1QRKA 3GI9L 3H7LA 3KR3L 5DYOB 1LO4L 3FB5A 5M94B 5JO5A 2Q76A 2XN9D 4I18A 1JZ3A 4WI6A 3FRPA 2FJGA 3N1QC 5MEPA 3HG1E 4P0DA 2QV2A 1NGWA 5GS3A 3DGCR 1MHCB 2ICEA 1JPSL 2OJEA 2Z31B 4U3CA 3HMWH 5GS1B 4YHPB 2XWBB 4HS6B 3MNWB 5D93B 3UJIL 5IIEA 5D1QD 3RZCD 2XA3A 5HD8D 4YJZL 1A6WL 4UNUA 5C6TH 1IAKB 3Q0HA 4CMHC 4XGZB 1YEIL 4MA1C 1C5BH 2ZUSA 2WM0A 4LASH 3LIZL 4GBXD 4UU9A 1WC7B 1MI5B 3OJDA 4PJHA 2YA1A 1P7KB 4YDKH 5D4QA 4APQA 4RIRB 4LLQB 5ANME 2C5DC 1D6VL 4D9RD 5E9DE 4R0LA 1DANU 3KXFD 3TYGL 2ENSA 3BGFC 2NZ9C 4WU7A 2JELL 3T2QA 3QFJE 4PJEB 5I1DB 5I66A 4RGMC 1J9CT 5TFSL 2ZP0T 4F3FB 5DSCA 1ED3B 5I71B 3JV6A 1OAQH 5JMRA 1KIQB 4Q9RL 3EO9L 3HLAB 3VG0L 4FTVA 4JPKH 4LL9A 3WHE0 3S4SG 3ZDYF 2F53B 2HWZH 1Y18A 1Z5LB 1VACB 4QXTA 4N5UA 4X4YA 1Q0XH 4NZUL 4OZ4A 1T89C 1DBAH 2P7TA 5EO1A 3MRMB 3JVGC 3G5ZB 4Y5YB 1VGKB 4MNQA 2AJ3A 3WO4B 1FZMB 4LLWB 2I26N 1KIRA 1KN2H 2EXYD 1MLCB 1RK0B 5E6IB 5BCAA 2H1PH 1ZTXL 2QSQA 5LQBH 2AXGA 2J88L 4WHDA 4ZG1A 1EAPB 5C8JB 4K3JL 3RY5A 2X6MA 2XXCB 3X3GH 5CSBA 5BRZD 1BFOB 1U42A 4Y2DD 3UTQB 5DJ6B 1VEPA 3IDJA 1YN7B 2ILLA 5DFVC 2HJFA 5EFIA 4A6YA 1RUML 2YA2A 4OI8A 5IW6B 3VFUA 4ELMB 1IGCH 2HN7A 1UH2A 4AL8H 2ITDB 1DBBL 4M9OA 3CMOH 2K3TA 1Y6NR 2J6EH 5E95B 2YZ8A 4Z7UE 2UWEE 3S7GA 1B6DA 5CD3B 1MAJA 3UX9B 4KKLD 3NCYP 2QJDA 4HIJB 5IWLC 4HS8H 5E94B 4IRZL 3BW9A 2H32H 3AS1A 5B38B 2P5EE 4JPVL 5L8JB 2I9LB 3GSWA 3K81A 4KKCD 4Z0XA 4Y4KD 5I2IB 1JYVA 3PNWB 3T8XB 1CYGA 3LN4A 5ISZE 5LGJA 3VFSA 1MY7A 1K8DB 2AQ1A 2R1XB 2J8UE 2R4RL 4ZFZA 4M43H 1N8ZB 2EEBA 4N0YH 4PRHA 4KUZL 5JR1H 2ICWB 4LEOA 5FKAA 4L3ED 4JQXA 5SWSD 3AAZB 3R1GL 4FQXB 1S7QB 5FYKL 1S9VB 4Y8DC 2FX7L 5CZKA 1NFDF 2EYRB 5D7JC 4FQCH 3EKCA 3WL9B 3MUGA 1HQRB 4DVBB 2C7UA 2BSRA 1IGJB 3X17A 1IAOB 5I75B 3HMXA 3LOWA 3ZE0E 1CLZH 1C16A 4YH6A 4GXUM 2BC4B 1ZT1A 3U7WH 4NUJB 2Q8BH 43CAB 4C55A 1ADQL 3UTTB 4F15C 4PJBB 4A6YL 5BS0E 3MJ9A 2G2RB 4U6YB 4JQIH 2DQIL 1MF2L 1RZGA 3GMMA 3WFBH 1A4KA 4G8EB 3GMOB 3NOIA 3LEYL 1W8NA 4OZGB 5FM4A 3K1KC 3DXAA 5H37H 4M48H 3MV7E 2QSVA 4HKXA 5L7XL 3HAEH 2ZUYA 5HI3C 1I3VA 1NMCC 5DJ8A 3RWGB 1FGNH 4KJPD 5JQ6L 3D85D 4GS7B 4H25B 4JRYB 5LG1A 1N59B 3P30L 4PJ8C 4Y19E 5LVEA 1J0JA 3D9AH 4P3CH 4WO4A 1WBZA 2WQRA 4YHML 1CF8H 3OF6A 3GHEH 4J1UA 3QIBD 5J11B 4IRSD 1UM4H 2CDFB 4XMPH 3K3QA 1L0QA 2OQJB 5HPMA 1EPFA 2A83B 4QRRA 1DLHB 4TSBL 3C60C 3O0RH 5AUMB 1I9EA 4C83B 1Z9MA 4LLYB 1D5MA 3MLWL 4KZDL 1MRDH 2BXYA 1ZE3C 4OLZL 4XTRC 4PGCA 1I7TA 4XVTH 4YHLH 1F3RB 5E5MB 4UV7L 3EDEA 3TWCH 1WAAE 3F5WA 3SJVD 3VXOB 3U7AA 1ZLUH 4Y89A 1NAMA 3UP1A 2GK0A 3MUY1 4WHTA 3PGDA 5IW1A 1CE6A 5A2KH 1U2CA 3W82A 3LKRA 3TA3B 4M7ZC 1TXKA 2ADGA 4WW2A 3MJ9L 4EI5B 4WCYH 5IHZA 4KWUA 4X9FA 3LH2L 3TCLB 1EGJL 4DKFL 2DYPB 3I6KA 4Y0GA 4HV8A 5FO7B 1UQSB 3LAFA 4NGHH 1AO7B 3VA6A 3U7YH 4WUUE 5BXFA 3IXAA 5EU6B 2EEDA 5C0DA 4HC1A 3FRPG 2VDPH 3ROOA 2PYEB 2XFXA 1A7QL 4X4MA 1KLGA 4L3AA 1NMBH 5D7LE 1QFWM 5CEZE 3EJYD 3HZMB 4ZUSA 2GSGB 1JWSA 4NQVA 3TFKC 3SKOA 1NBYB 3EJJX 5IHBA 3KPQB 2OZ4A 3IFLL 4QRTA 4YIQA 5KS9A 3TO4C 5C0BE 2UVEA 4Z8FH 1IC4H 2I07B 5FGRA 3HN3A 1M7IA 2VOTA 3O81A 1IQWH 1HCFX 4JPWL 5T3ZL 2NY1D 1MPAH 1VB9A 5EIQA 1NAML 4Y4FB 4JFDD 2HRPL 4QGYA 3NBNA 2ARJQ 3H9HB 1W0WB 3PWUB 5HPOA 3P4OA 1JHTB 1FNEA 2XKNA 4U1JA 1LK2B 4QRPA 3KWWA 3HZKB 5INCB 3I85A 3SE9L 2R56L 3LN5B 1K3IA 4I5BB 3EOAA 3VXPB 3ZTJH 5TGBA 3G9AB 2DMCA 1KPUA 1DN0B 2IH3A 1Q9KA 3ZO0A 4BH7A 4L4JA 2HFGL 4KC3B 1E27A 5IB2B 3DO7A 1KIUA 4WEBL 3SGDH 4DGYH 4YHYC 4GRMB 2N56A 4OZHB 3C8KA 2VLLA 4M1DH 1I9RL 5AZEL 3MNZA 5DC9B 4XXCC 4MD4A 3NFPA 3G6DL 1U8MA 4GW4B 1AGFB 1TCRB 4DTGH 4LPWA 3T0EB 4FQQA 4U1LA 2GTWA 3GIVA 1QG3A 1EFXA 4JRXA 1RJLA 3RWEB 3SKNB 4LAQL 3QUZA 3AROA 4K71C 4K3EH 5TE7L 1JI1A 1YEEL 3PWVA 4HIHB 5C9KA 3HNSH 4MCYA 5F6HI 1A21A 1UWEH 2OZ4L 2ADFL 3HKFA 3TNMB 4P59H 4FQHA 1CGSH 3F58L 1F6LL 2YWYA 1LO2H 1JPFA 5F7UA 3PL6C 4PJXE 4F7CA 1JWUB 3RBGA 2VZ3A 3SE4C 4M8VA 5I1KL 2BX5A 4RISH 4JVPA 1DFBL 1DZBA 3UTOA 5D7SL 2BRQA 4HWZA 1OARL 5E99H 1U8HA 3L6FA 4FABH 4ZODA 1YPZA 2B4CL 4NO0A 1RUQH 3MMEA 2I9TA 1OP3H 3CUPB 3OAUL 4FQ1L 4MQXC 1YNKL 5M7QA 1CGUA 1NDGB 2DICA 2NY4C 5C2UB 1A9BB 2HLAA 4NQEE 1HQ4B 1AC6A 2Z91B 4L8SC 2CKNA 1FVCB 1GAFL 1HHKA 2CUMA 1RMFL 2AQ2A 1PKQA 3ARBC 4NQXB 3KYAA 3QJFA 1FN4B 4K7PY 3SGJC 4MAUL 5K59F 1N5YH 3LEVH 4JY4A 3CFJA 5EZJB 4RFOL 4YNYB 1H5BA 3VH8G 5EC2B 1DJSA 1J1OL 3NCJL 2IADA 5D6CA 3TT3H 3HE7B 2DQHH 4XRCB 2ZUQC 2IQ9H 3MLSH 4TPRL 4QNPE 1NCDH 2UZYB 1XIWC 4OM1L 3FT4A 1QQDA 4ERSL 4H0GA 3C5SA 3KPOB 1WFOA 4DKAA 5MERA 3LKQB 3EYSH 1EK3A 3CDFA 5C71A 1P5UA 1H3VA 3QI9D 4NUGL 4CKVX 4U6XA 3DURA 2OP4H 4M5YL 3HB3C 3FQRB 3I6LD 5F6HJ 3MRJB 1VA9A 2YC1B 1QLFA 3O3DB 4ORGB 4MXQD 4EKXA 1YEDB 2GSIA 3F6LA 3SDXB 5MEND 4LRIC 4ZOBA 3GMQA 1BQLH 3RZWA 3BP6B 4RNRB 3DX9A 1QSEA 5IBTH 3FB8B 1SJVA 4PYHA 1HHJA 3D0VB 3FO1A 4LP4A 5D7KD 3Q6GL 1G6RB 5I76B 4R96A 5H8DA 3TJEH 1KT2B 4MAYD 3M1BA 4XMKL 3MLPA 1LEIA 2XACC 2IALB 1SEBA 1NC2B 3RJDA 2D9QB 5JXEC 4P2OB 3ULUC 2XKUA 4HHAA 4FXLA 4TOYL 4N0FA 1MJJB 4U1KB 4LCUB 5EOCH 2KPNA 4MD0A 3W2DH 5SWSE 5E8NA 5JOFB 4NFCA 4JG1H 2AEQH 2CGRH 3LKOA 1IEHA 1H8SA 1T21A 3BO8B 4LDLB 3WJLC 4LLVA 1DQQA 4IDJL 4EOWL 1MELA 3KG5A 4KDTC 4LCCB 4HBCH 2FIKA 2C4FT 3MRNA 4XNXH 4IBLT 4RGNB 5IK3A 3SEPA 1J1XH 3NH7H 3OZ9L 4Y1AA 5DK2A 3U36A 1WIOA 4HF5H 2F54E 2HT4D 3Q5YA 3MCLH 4JKWA 1T6WA 5JXAL 2DQUL 1KXTB 2XZAH 5GHWH 2OI9C 3IFNH 2R4SH 2MHAA 2H6PB 2NY0B 3QDMB 4GG8B 4HD9A 2NW2B 3MV8B 4OZFB 5EZOL 1DSFH 4NDMA 2VAJA 3FO9A 5E2WL 4X6FB 4ENEC 4JN2B 4HEME 4ZNEE 2IPKA 3KLAB 1WTLA 3Q6FB 5DHXB 4ODSH 2VE6B 2COQA 5SX5K 5K9KA 4MHHI 4YR6A 4AY0A 2G60L 1VERA 3D2UA 2PO6B 1CT8A 1GH7A 1U93A 5JW4N 5FM5M 2HMIC 1CI5A 2DN7A 1JGLL 5FUOH 1OAYH 5D2LE 3KNBA 2XTJD 2DS4A 5DK0B 1JRHH 3R8QA 5L2JB 3GK8L 4B53A 1P4LA 2P48B 4IDLA 4JGUA 4I0PB 2FBJH 4OZIF 1MHEA 5DD0H 3EYOB 1GC1H 3B5GA 3G6JA 3JUYA 3UZVB 5JUEH 5FEBA 1RZFL 3QIWC 4X99B 2AKRA 5C07D 1NEZA 1F11B 3RP1A 1G1CA 3EYFA 1CBVL 3H9SA 1HCVA 2NW3B 5LAXB 5SWZB 2NXYB 2XN9B 3MRDA 3KYNA 3TVMD 1HOCA 1LDPL 4U6HA 4XAWL 4WY7L 5ADOH 1NUFA 1VPOL 3BH8B 1AR2A 5DJZB 4J23A 5IB4B 3ZKNC 1INEH 4NOFA 4ESKA 2IANA 3HPLA 1FDLL 5KW9H 3BZFA 2V17L 4P2RD 1NEUA 1ZHLB 4H26A 5D1XD 1MFEL 3D18A 3FQWA 3MZGB 2DTSA 2Z9TA 5EPMA 5D1QB 3RZCB 3F7QA 3GI9H 3EO0B 1LO4H 4NBXB 2ADIA 2ZOLB 1QRNE 2YPLA 2R9HD 3BKCL 1YYLH 4UT9L 5GJTL 5E24E 4L4TE 1UJ3C 4GBXB 4PPTA 5HDQL 3WNNA 1RULL 3VXRA 3QXUA 1NLDH 4LCWA 5F9DC 3MGTA 5I8KL 2BHZA 4H0IA 4UDTA 4ZS7H 4F7TA 1A47A 3KXFB 1H8OA 3BQUB 5CGMA 1T89A 1A6WH 2FGZA 1LO5A 3AMLA 3CH1A 3JVGA 2PTVA 3VI4E 1XCQA 1ZA3A 3HC4H 4BZYA 3PWPD 3VG9B 1ZHNB 1VGEH 5E8OB 4GAJL 4OUOA 1T2XA 4BM7A 5ABDE 1K9TA 3HC3L 3HUJA 5D6DC 3C6SB 5IMMB 2OL3A 2YOCA 2HKFL 3SDDD 2J7LA 2E7LC 2HH0H 3TYGH 1N2RB 1QHOA 3P77A 1DEDA 2VKWA 5E4EB 4OD2A 1XR8B 3O4OC 4K7FA 3QDGE 1JBJA 5JLZB 3L3DB 3GZKA 5F7FA 4XC1L 1TVBB 2O5YL 1Q9WB 3BEWB 1G9MC 3EO9H 4JFDE 4ODUB 1NCAH 3VG0H 4JJ5A 3FTGA 5T5FL 4P4KD 5BRZB 1QYGL 4Y2DB 2X7LA 1U8PB 2W0FB 4NO2B 2KUTA 4NZUH 5IWLA 2F19H 4R4BA 1FH5H 3ALWA 4PGEB 3P9WB 4PLJD 3U83A 3STZB 2UZIH 1HXYA 4U7SA 3WHXA 1P7QB 2PYFB 3FB7A 3O3AB 1ZTXH 3MJ7A 1ZVYA 1A02N 2DQEL 5HGHA 2JLLA 3LY6A 4R90L 5DRWA 1NLBL 1YUHA 5AG8A 5CILL 1J8HA 1FC2D 2CRZA 3MNVA 1RUMH 2C1OB 3HNTH 5CIPB 4OV5B 2NY5C 3T3PF 1DBBH 2J8OA 4LF3A 3U46B 3BN9C 2G9HA 1CGYA 3HI1B 5F7DB 4EN3A 1MLBA 3H7BA 1A7BA 4KUCF 1I8IB 1JJUA 2UYLA 3ROLB 5HI4D 2X4RB 4QRUB 1IKNC 2FDBP 1T2QL 2D31A 4IRZH 4JM2B 2FEDC 1S78D 4JPVH 4L3EB 1ES0A 1RHFA 3MGAA 4M8QB 5DWUH 1JNNL 3BT2L 1LE5A 1G1YA 1S9XB 4M4RA 4BUHA 2GT9B 4FZ8L 2YA0A 1WFNA 1I8KA 2A6JB 2R2EB 2VIRA 5HGGS 3GB7B 4XI5C 3LDBC 4LSVH 2A74B 3O11A 4AM0A 4JZJB 4O02L 5F3HB 4CVXA 1FE8H 1DEEB 1F2XK 3MRRB 2EC9U 2YK1L 2BVTA 5EN2A 1NJ9A 3BPCB 3L3OA 3TGXA 5FYKH 4X8XA 4QRQB 1ZHBA 3ZYJA 4XVSH 3RVTC 1TTUA 4UIMB 3AGVA 3ILQD 2EZ0C 3H3PL 5KG9B 2VUOA 2EICA 3HZVB 3QCTL 2PXYD 3H6JA 1T1XA 3RL2A 4I2XE 5GZND 1SJHB 4JFFE 4YHOH 4MHHG 1X5HA 5TDOA 1YMMA 4WEMB 4WU5B 5EU7C 2ZCHL 2APWA 4YDLC 4JEGB 2Y06H 5I73C 3QUMA 2QSCH 1HN1A 3D85B 5JHDB 4BSVB 1ADQH 4LSUL 2H3NA 4G9FD 3K8LA 4LSSL 1OM3H 4A6YH 2RIKA 4GRWH 3VWJC 2R0WL 2DQIH 1HILB 4YEEA 4ONFL 2BJML 2LV4A 3LEYH 1EJOH 4IRSB 4XWGH 1GGTA 3EDJA 3DECA 4Y2OA 5L7XH 1JGVH 1Q0YH 4OIBA 1VEMA 3I6LE 2BY2A 4NC1C 3S37X 1CD1A 1D5BA 1IILE 2J1KA 4GAYA 3KDMA 3P30H 1AQDA 1QEWB 4R7DA 5EH1A 4ZPVB 5CHNA 1HEZB 3SJVB 4K3DH 3RQ3A 2GFBA 2JB6B 4IS6A 4QKXB 2QHLA 4QY8B 1HZHL 4HDIB 5CJQL 1AGDA 4PJ9D 3LHPL 4G8GA 3TIEB 4KZDH 2WWKT 2CIKB 5D7IE 3RTQA 5IMKB 5J1AB 1VEOA 3DYOA 4GG6F 1I1YA 2B1HL 2MQ0A 3JV0A 3GMNB 1U2HA 2DJSA 3QDJB 1ND0A 1IFHH 2YR3A 4U7KA 3QCUL 4EXPX 4K3HA 3T1FA 3T2OA 2N7AA 1BOGA 1ZA6A 3RWDA 2PR4L 4N8PA 4EUPB 1C5DA 5E2UL 1BREA 2Y5TA 3TIDB 3HMXH 3BPNB 1V3JA 1NEZG 5JOEA 2VZOA 3R0MA 1LEKA 1FGVL 2BNQB 5IM7A 4TTDD 1XAUA 1G9NC 3Q1SL 5DVLA 3AS0A 2YPVL 4TULH 3MJ9H 4OLYL 5HHMB 1DP0A 3NGBC 3B9KD 3EDKA 1KACB 5IVZB 1K3ZA 3LH2H 4E42B 1EGJH 4DKFH 3O6LL 5SWQA 2GAZA 1JGUL 1OSPL 3S3SA 4EQ2A 3DGGA 5A16B 1FO0A 4PJEE 3BP5A 4APQD 3KJ6H 3QXAA 3B43A 3QXDA 2CRIA 1WVZA 4PJ7A 5BVJB 3IDGA 5MHSD 5EBMA 3PWLA 3L3IA 1FFNB 1A7QH 3GSQA 4FTVD 2H8PB 1ROWA 1U3HB 4DFIA 1XGRA 4GKOA 4FXGA 1KTDB 1AGEB 3I6GA 1ZLSL 1TLKA 1MWAA 4I48B 4ETQA 1EO7A 1JYXA 3EOBA 3F7VB 1HKFA 4M93C 2W1NA 3RNQA 4JY5H 1R0AL 3I75B 4MNQD 5FYKD 5IR1B 3WIIH 5B39A 3DX6A 1MHPL 4XXCA 1EIBA 5E1HB 3ZL4L 2E6JA 3RKPA 2FYYA 2YSSA 4QRSA 4JPWH 3P11H 3E8UL 5I6XB 1UEMA 1NAMH 3O2WL 2PTTB 3LEXB 2P47B 5D2NC 1BBJB 3HAEB 2ERJB 1W72A 1U3JA 3KYMA 4U1MB 1FLRH 3VD3A 5KJRL 4U0RB 2XQYK 3SE9H 3NPZB 2Y6SD 2G5BB 4PJGA 3B6SA 4MNGB 5J13B 2BMKB 2R0KL 3PL6A 3UTSE 1T66D 3IKKA 2WIIA 3B5TA 2OTUB 4JLRA 3TV3H 2FB4L 4IJ3C 4YAQA 3C9NB 3FHAA 2ESVA 2AK1L 3T4YA 4RAHA 4JO3L 4RQQA 3ARFC 4J6RH 4WEBH 4EDWL 3B3IA 3K4ZA 1VENA 1I9RH 2WLZA 5AZEH 5KANI 1EFQA 1FRGH 4K9EL 3G6AA 3N85H 2YKLL 5BO1L 4UNVA 4HC1H 3QO0B 1MFCH 2VXTL 5CKAA 3LZFL 2L7UA 4P23C 5DJCB 3DV4A 4RAUB 2CSPA 2EDKA 3M8OL 3TBYA 3D3VA 3ARBA 3QWQB 1F97A 4NN5C 5JPNA 4PRHD 1MWAL 2VAAA 5F21B 3N1MC 3SGJA 2F5AH 2OZ4H 2ADFH 3BX7C 4YFLI 3VWKA 1MJ7L 3K80A 3E2HB 4DVRL 2HYMA 4XWOC 1U8LB 2QADC 3K46A 5IT2L 3RY4A 5I1HL 2EDXA 3SOBL 1WF5A 2BVQB 1OGTA 5MEOB 5I1KH 1A6AB 1VCAA 4PJBE 1DFBH 1FCGA 2NX5A 1CU4L 5D7SH 4NSKB 5FOBA 1UZ6E 5GS0C 1W72L 2Y7QA 3N1GC 5IEKA 2B7DT 2BNRE 5B4MD 4NJAL 4FQ1H 1FFOB 1RZJH 1YNKH 3ECBA 3MRIA 5INDA 4L8BA 5L9DH 1ZKAA 4IRJB 5IUSA 4WNQA 5JIIA 4LRIA 1GAFH 4FFWD 3KPLA 4YXLL 1MAML 4LLMB 4G5ZH 1RMFH 1T6VN 3DXAD 2YUZA 1PG7X 4JKPL 3KS0J 1QOKA 4I9WE 5DLMH 5I1EL 4I13B 4X80L 2J12B 3ZDXE 3OR7A 1J1OH 1IGIL 3NCJH 3RDTA 4WO4D 4BZ1H 4X6CA 1WEJL 1AI1H 3T4AB 3VJ6A 1MFDL 3OF6D 4RMQA 3A67H 3VRJA 1HHGA 4OM1H 1MVUA 3O4LA 1JN6B 3EZJB 4NO3A 1U95A 4PLOB 4QRRD 4DUWA 4E0RA 4G43A 5JIKA 3DJ9A 2FZ3B 5ESAA 3QEHA 3QH3B 3LKSB 3E3QE 3ULVL 4NNXB 1Z9SA 3S35X 1A1NA 2Y23A 4UINL 1FZOB 3ZE2F 2HTLD 1ZGLB 4ZUVA 1EVTC 2X4UA 1V7NL 1UKSA 3EYUL 2CO6B 4MZ3A 1YYML 1T4KB 1M7DA 4OCXH 4XMKH 3OKEA 3P9MA 5JORA 5IB5B 3MBXH 3O6KL 5I1IH 4HWEL 1I1AB 5HHXL 2LTQB 4C56B 1BZ7A 4PRPE 1WZMA 3FT2B 3VXTA 1KIPB 5DJDA 5FGSA 3T65B 5EOTA 3SDCC 1FVEB 3AY4A 4IDJH 4K7PL 5CINH 1QBLL 1JNJA 1YJDH 1H3PL 3QT2A 1B0RB 5DK3A 3MXVL 3L95A 3UC0L 3OJVC 2Q7NA 1UGNA 1FYTE 3G5XA 4O51A 1D5XA 4R2GC 5KSBA 1CD9B 2VSDA 3HS0A 3RWFB 3QIWA 1QSVA 5JXAH 2ED9A 4Y16C 2QR0A 3MFGB 2JIXA 4FFZH