4WUUE

Structure of esk1 in complex with hla-a*0201/wt1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
223
structure length
223
Chain Sequence
QMQLVQSGAEVKEPGESLRISCKGSGYSFTNFWISWVRQMPGKGLEWMGRVDPGYSYSTYSPSFQGHVTISADKSTSTAYLQWNSLKASDTAMYYCARVQYSGYYDWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a TCR-Mimic Antibody with Target Predicts Pharmacogenetics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 34
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2014-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wuuE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wuuE01
2XFXA 4PRNB 5C09D 3PP4L 4Z7UB 4KDTA 4HKJB 5ENWB 3U6RA 4KJYA 3CVIH 5D2LF 3E6FB 2NY4B 5JXEA 1FCCA 5GGSY 3I75A 1PD6A 4XAWH 4DZBA 3V0WL 2E8ZA 3L6FA 3IXAB 2O5YL 2HT4C 4MVBC 3MREB 4QRPB 1BD2E 3FB8B 5DZLA 1MCHA 3AY4C 5F96L 4DK3A 1BFTA 5ESQA 3QRFM 1QLFA 5J6HA 2GKIA 4QNPE 2ICWB 3VXPA 3VXUE 2NY5H 3BE1H 2VZSA 3WYRA 3ESVF 4NM4L 3EYQD 3KWWA 4MNQA 4UT6H 3C87A 5F70A 1D6EB 2ZCKH 1DBJH 3S88L 5F71A 1UVQA 4FMKA 5BQ7A 4RSVA 4Z9KB 1WBYA 3MRHB 5IFAL 1N26A 1KXVC 3LKPB 2IQ9H 2BFVH 4JFEA 5DJ2B 4CU6A 1ZT7A 3HMXL 1FRGL 5IG7A 3GRWH 3CZFA 4GAYA 3DVNB 4NT6B 1U8QB 1BQHG 4NNPH 4KV5F 2R15A 2XWTB 2YZ8A 5HYJA 3UTQA 2J6EL 2DL2A 3K0WA 1BP3B 2BXZA 1XT5A 5IIEA 5C6WH 3UTPD 1RUQH 2YZ1A 3BVNB 4XPBL 4R7DB 5D7KD 1A6UL 3ROOA 3F58L 5D5ME 1MJ7L 4Y4KC 4RIRA 5F96H 4NSKB 4HHAA 4RMVA 1DBAH 4RGNC 4V2BA 5LAXB 4NWTH 2VDLH 2J6EA 3FN3A 4KWUA 4M6MH 1X5YA 2AEWA 4BQCA 4HCRH 1CFSB 1B6UA 3IDYB 5KW9L 1JWSB 5ADOL 4OZHA 3QBTB 3GZKA 3TH3T 3SJVB 4KVNH 3IFPA 3T1FA 2VH5H 3S5LG 3W2DH 3RX8A 3IJSA 2P5ED 1CDJA 3UYRH 2Q6WB 3MREA 4HT1H 3BRDA 1MI5D 3SJVE 4UIMB 1ZXQA 4QXGH 4ZTPL 1HOCB 2R4RL 5AZEL 6CGTA 2VLKB 3N1QC 2IG2H 3S36L 4KKNA 4F7CB 3DXAA 4G8IB 3ZE0F 4Z7QE 3QB7C 4L3EA 5FKPB 1XFPA 3E2HB 1N8ZB 1T0MA 1ADQA 1V05A 5CJ8A 4JFDB 2XPGB 6FABL 3QEHB 4DQOH 3IJYA 1BAFH 4XNXH 5D2NA 4M5ZL 2XACC 2WUBH 3ZDYE 4GAFB 3QNXA 2EC9U 4UV7H 3KYOB 3QIUB 3UC0L 1NSNH 5E2TL 5E2JA 4X83A 1K8IB 2MHAA 5C0DB 5FF6A 3B9KC 2XWBB 4L9LA 4A2LA 4K3HA 4HKBB 3HN3A 3HC0A 4KMLB 3UBXA 2UZXB 5KZCB 43C9B 4LSQL 4RA3A 5DO2C 3W2DL 1II4E 4GXVH 3HKFA 2HTLC 5FYLH 4U1MA 1Q9LB 4EXKA 1AY1L 5A2IH 1GZQB 3IYLW 3OJ2C 1EUUA 3NABL 2XN9B 3OG4B 5JTWA 1J1OL 1IGMH 2HFGL 3SQOL 4HCRL 2BHUA 3ARGD 1AH1A 4R0LA 3X12A 1N0XH 1BIIB 3R8BB 3RWFB 4RAUB 1MHCA 4L4VB 4ODHH 5GZOC 1KEMH 1V7NL 1HHIB 2IFFH 2IH1B 3F6IA 2DQDH 3MV7A 4ZD3L 5HYIA 2DMBA 3D3VB 2ICES 3FHAA 4TN9A 2BERA 5D7IA 2CDGA 1LP9A 1J05A 3T1WA 1QSED 5GSRA 5F89A 4EI6B 2OX5A 3E6HA 4S0SD 1NCCL 2UZYB 3MRLB 1IGCL 1JNLL 5FHAH 3BP7A 3HI1B 1KELL 1INEH 3TM6A 3MGTA 1IQDA 3U2SB 5E4IA 1E4XI 4KQ3H 4JY6A 3SBWA 3MRPB 3B8YA 1FZJB 4JN2A 5HGDB 3WCYA 3BJ91 1QRND 3LD8C 5FKPA 4M9PA 5B38G 2VDKH 3GHBH 4X7EC 1ZMYA 1AGCB 2HT2D 3L3IB 5IUSA 1I8IA 3EYSL 3QCUL 1ODAA 3IB4A 2NX5A 4P4KD 1EJOH 2GTWA 3HNTH 2VDNL 3VI4E 5HYEA 3RWHB 1CGSH 4MD5B 3QDMD 3VMPA 2NTFB 5MEQA 3GJEB 1F3JA 2PXYC 5HYSA 5I74B 5FO8B 1U3HA 4DFHA 3QFJE 1A6WL 5B8CA 1JYNA 3T0AA 4D0DA 3BH8A 3RIAK 1ITBB 4HWEH 3MRCA 3KR3L 3ARFA 3GO1L 5K93A 2M1KA 1XR9B 2VDQH 1CICC 1CICD 1I75A 3SKJL 3VRIB 5F7WC 4DN4H 1JWMB 3O8XD 3STZA 4JZNA 4FZ8L 2B7DT 2EDBA 5IMOA 2HKFH 1FNLA 4RGOH 2MTPA 2OQJB 4OSUL 2BNRA 5HHME 5JPNB 1D9KB 4DKFH 1FVEB 5E5MA 3SKUD 4X6BB 3LQMA 4ZOEA 3QUKA 1F58L 3FQTB 2Q8AL 3HAEA 3MR9A 2FCBA 3BPLB 2VDKL 3GHBL 4XGZB 4YHMH 4ZO9A 3SO3C 4C59B 3RZCA 3DVNA 1VFAB 4NT6A 3QXAB 4RFOH 4XMLL 4K9EH 3K4AA 4ZMAT 3CFBA 1YEDA 2G5BA 4FQHB 1TVHB 5TE4L 1DBAL 3UAJD 4BQBA 1AI1L 4BUHA 4WENB 4HHAB 5JHDB 1PSKL 4JY4A 4YK4B 1K9TA 4KHTL 4KPHL 1FN4B 3B9EA 4PJ8B 4HXAL 5HI3C 1CU4L 1H9VA 5F7KC 4WRLA 1NLBH 4JDZA 4XCNA 4P3DB 4NNXB 4Z76A 4UT7H 4XPBH 4NN5B 5JHDE 2HMIC 1OAZH 2XNAA 3C5JB 2W0PA 1Q94B 3RUGE 4HAGA 1YEKL 2DMCA 1YPZE 1RUPL 1IC7L 3KPRD 4AIOA 1MCOL 4ODXB 4YPJA 1DLFH 5EA0L 4Q74A 5D70H 3RUGB 5D2LE 1VFOA 3DXAB 3JXAA 5CINH 2OBGA 5GGSB 2Q8BL 1JL8A 5EO0A 3REWA 3V2AR 4PB0H 3QEQE 4BZ2H 4FXGB 3OJDB 4XPHH 5DJ6B 1F13A 3WKMH 2F53E 3OR6B 5CIPH 4QXGL 3I50L 2NY4C 4NQCA 5C09E 1MJUH 3FHQA 3TPUB 1P4IL 3WFHA 3P0GB 1D9KA 1UKTA 3G08A 4OZFH 4NHCL 2YRPA 2Y07H 3DUSB 5BV7C 2NY1B 4RWYL 5FYKH 4K9EL 3AAZB 3IF1B 5MI0B 3GSNB 4LLUA 4JPVH 1NEUA 4EOWH 5F9AC 3W0WA 4C55A 1HSBB 2EDWA 1JGDA 4U0QB 1MHEA 1JP5A 2W9DH 4G7VH 3GI9H 3HC0B 4P23B 1OP3K 3UBXB 2JIXA 1VDGA 3EJJX 1F3DJ 3PGCB 4HGWB 5C07D 1FFPB 5JW4R 5DEFB 3IFLH 1GIGH 3GKWL 3G6DL 2ICEB 3P0YL 1JGEA 4ISVA 4P3DA 3N50A 3V8OA 3L5WA 4OKVB 2AV7A 5IGXL 2AEQH 4Z95H 2R9HD 3BD3A 4E5XB 3MV7B 4PJHB 2D7TH 2Z8SA 2QQNH 2V6HA 4M4RA 4PGDB 4ZDHB 5IT2L 3G04A 4MQ7A 5F7LB 4WU5A 5CJBA 3HE7A 2X4TA 1V7ML 4NQED 1HINH 1SJVA 1UCTA 4WY7H 3RGVD 2NY0D 4R96A 4EZMA 5J9PB 3RVVD 4QGYA 4Y2DD 1EJOL 3GJFA 3HNTL 5L7XL 4N9GA 3DYMA 3FONB 1HKFA 2IBZX 5DVOA 3OKMB 4LHJB 1Z5LB 2I27N 3BPLC 4O2EB 3NCJL 1DQLL 4KRLB 2ESVD 2C3VA 4N0YH 3TN0B 1MHPH 4JZJC 5HYQB 1F00I 4WGWB 5DMIH 2BNQD 4PJBB 3V6OC 3LV3B 3F5WA 4Z78A 4WWKD 4YE4H 2ORBH 3MNWB 3BPOC 3GSRA 1YN7A 3CUPA 3D5OF 3QDHA 5CMAA 3VXOB 4JO2H 5FO8A 5EO1B 1DL7H 1EVTC 2I9LB 4K55A 1NFDA 3EOAB 1KG0A 1UZ8A 3MO1B 1LDPL 5KJRL 4GG6B 2NY1C 3RTQA 4PGJA 2CK0H 4F2MB 4DCQB 4Z7OE 1GCFA 2NCMA 4OZFB 4JZNB 2R29H 2Y36H 1NKOA 1NDGB 1K4CB 4X5XB 3PP3K 4KRPC 2WBWB 3U7WH 1PW3A 2Q3ZA 3BD5A 4L4VE 5T3ZD 4M6ML 4Y0GA 3V8CA 2CUIA 3BGAA 1I9RH 1T3FB 4JFDE 4U6TA 4GKZB 4JZOA 4XCYA 2IC2A 4R7NA 1BQSA 4HXBL 1J12A 3HC4L 1QFWH 4HF5H 2PTVA 1SY6L 1H3PH 5FYLD 5IQ7L 2FECL 3HLAB 1SJHB 4UV4L 2AABH 3MBEB 4N0CC 4N1EA 1KLUB 4FQXB 1CD9B 3HR5A 3O6ML 4JLRB 1U8JA 1OB1A 4KI5C 4PS4L 4TVPL 5LCVH 1CFBA 2C3GA 1Q38A 2CXGA 1IKFH 2PNDA 5IW1B 3B2UC 2PYEA 3H7LA 1IBGL 3BIAX 3IETA 1ACZA 4P4KB 5IEKA 1UACH 2YSSA 1QNZL 5DF0A 2X4OA 4K07A 5LQBH 4HIIA 1DVFD 1MCLA 3KJ6H 1QBBA 2CRZA 2FGWH 5JOPD 3ULVH 1G7HB 3AREA 4OZGE 5IMKA 4KKLC 3X12B 5AZEH 3SJVA 4D2NA 1KCVH 4BQ8A 3GMMA 3LV3A 4IIQC 2X1QA 1PSKH 5I16B 5KAQF 4I2XB 4FQLL 4OV5A 5EC1A 4HF5L 3RPIA 1CDGA 4OCSH 1JGUH 1G7IB 1HZHL 3AU1B 3MRLA 1E4XH 2JK5B 1NGQL 5GS2D 3SGKA 1JPGB 1Q9WB 5INCA 3Q5OA 1JTOA 1N64H 5HJ3A 4CKVX 3I50H 1K4CA 3HE7C 1WBXB 1E4WL 5TQ0L 1MH5A 3V5DA 4MS8C 3VD3A 4W4OA 3TBWB 3C6SA 1RQ5A 2W60A 4LSVL 4ZS7L 2LQRA 2QBWA 2KUTA 1ZT7B 5D5MB 3C2SA 1WISA 3OG6B 4PY8J 1P4BL 3BOVA 3TIDB 1EVUA 5SWZE 5DRNA 2F74B 3DUSA 4UUJA 5AD0A 4WWKC 5F8QC 3VXSD 1NGWB 4HUWA 5IM7A 3QJHA 1L7IH 4G6MH 3PWLB 4K7PL 1UEMA 2AJYH 5I9QC 4ODHL 3B2VL 3T77B 5MP6H 1P6AB 2HT4D 2XIDA 4AG4L 3EUUA 9CGTA 1ZHLA 5DK2A 5DEFA 3EYUH 3LDBB 1MIEH 3MGOA 1UWEL 4JHBA 4RAUA 5DUMH 4ODSL 1MCFA 4P23A 3VWKD 3JWOH 3RWCB 1RZKL 4ZUSA 1H3XA 2VWEE 1U58A 3MRIB 3P40A 2IPKA 5KANI 3IAPA 4LU5L 3D3VA 1WWWX 5IVNA 3IDGA 1HHKB 1CVSC 2VDNH 4N0FB 4GOSA 2CLRA 4QXWA 2R2BB 1JWMA 3VXTB 4MA3B 4XPFH 4MCYB 4U1HA 25C8L 5K59E 3C5ZB 1DR9A 5JPMB 4PGDA 4OQTL 4RBPH 1XCTB 5IB4A 3SDAA 3BSZH 3K4ZA 4KK6C 5FK9B 3MMEB 4GT7A 1MUJB 2Q6WA 4MAYA 4K7PY 4HMCA 1HCVA 4WCYL 3NA9H 2H9GB 4IMLA 4JRWA 4PJHA 5EIVA 1TTFA 3LQZB 3ZE1F 5A2KH 4PV8A 5BOPA 1IAIM 1MFBL 2AJXL 2ZUVA 4U3XA 1C12A 1XGRB 3BZ4A 3K3QA 3MA9L 4TSBL 1CFNA 3EFFA 5EOTB 2VAAB 4MJ5A 1HH6B 1M6OB 2Q87A 2VN7A 3ZT5A 1FC1A 3WJJC 2EDYA 4E41A 3MOQA 4LSVH 2IMMA 2YBRB 3HRZB 4R26H 3DURA 4WFEE 3N0PB 2LVEA 3BMVA 5TDOA 3SDAD 3MBEC 5ID0A 2XFXB 3I3EA 5DD6B 3CVHB 1F2XK 1TVDA 4LHQB 1T0PB 5A43C 2J2ZA 1QHPA 4P57B 1KPUA 3HG1D 5EZIL 1QSFA 2YD1A 3W5MA 3DMMA 1UADC 1UXSA 3TESA 4Q97A 3SGJA 4UDTA 5KG9B 1TZIB 4G3YL 1I3RA 4OQTH 4RNRA 4Z7NF 3GDBA 4OQTA 3DBXA 5C8JA 4JO4L 4BFEA 3NCMA 4NQTA 2OMBA 4X4XA 1PYWB 3U0WH 1PQZB 4HMEA 2WM0A 1DSFH 3NGBC 5FHAL 4GG6E 1I8LA 5F7EL 1GZPB 2WBJD 4HWUA 3ZDZF 2A6IA 1XCQA 3E8UL 4Y1AA 4ELKB 4X4YB 5I1DB 2WANA 5D4QA 1GGTA 2DQGL 3BPCA 3QFJA 1V3JA 1A7NH 4MA3A 3RVTC 3A6OA 2IANE 1V7NH 4LCYA 5D7SL 5I9QB 1G9MH 4TPRH 4R2GB 3BESR 3CXDL 3MOBL 5DDHB 3GIZL 3VGFA 3GM8A 3H42L 3E3QC 5ETUA 4EBQH 5HXMA 1AQDB 1QACA 3AXLB 4P4RA 3OQ3B 1ZT1A 2XWTA 1X5LA 2AXFB 3TPKA 1T04B 2DBLH 3ARPA 1OB1B 3VFWA 4JFZH 3QZWA 1NLDH 7CGTA 1P69B 2ZCKL 1SY6H 3CC5A 4PG9A 4TNVF 4DEPC 4XC3H 1XF2A 3QUMA 1CXKA 4LSTL 4U1KB 1WC7A 5D71H 2L7UA 3VXME 4MDIB 5FCSH 3REVA 3VFRB 2XKSA 3MRJB 2Z92A 1C8PA 3IFNL 5HI5D 4JM2B 1FO0B 4G42B 4CU7A 5C0BB 3RHWF 2X4OB 4OD2B 3BP5B 4NKOB 2LV4A 3U4AA 3WN5C 3G6JB 3R0NA 3OKLB 4A2MA 3CFIC 1LP9E 4RA0C 1I3RB 1Q94A 4MHHG 4F58H 1KTRL 3DYOA 1I4FA 4AK1A 3WFEH 3QI9C 4AENB 4MMZC 1DJSA 3FO2B 4GRLA 5E7FA 5TDNA 3U0PB 4UIMA 3SKNA 1Q9WA 5CEZL 5IQ9B 2F53A 4X4MA 1UJTA 4WO4B 2QR0B 4NQCE 2CDEB 2D9QB 3LPGA 3STBA 1NGYB 1PAMA 5GGRY 1MFAL 3N9GL 4UMGA 3WJLA 2FX9H 4X6FB 4YHNB 3MYJA 3BJLA 4HQQH 4YFDB 5ANMB 1T2QH 3BXNA 1VFUA 1FVCB 3DI2B 4BFIB 2P49B 4JR9H 4PJ7B 3HE6D 3HPJB 1WEJH 3LN5A 2X42A 5F9DC 4KZDL 5M7QA 4QCIB 1P4BH 4M6AA 2XG4A 3FONA 1HYSC 2BVPB 2J8UE 3AFLA 1A4JA 2BY1A 5CCKL 2XT1B 3CXHK 1KJMB 1B90A 4HWNA 5T5NF 1Q9KB 2N7AA 4LLVA 1MCRA 2FL5A 2PYFA 1S7UB 3H9HA 4P2OC 3WDJA 2VH5L 4XCFL 3P2TA 3MLRL 3PXJA 1MFNA 4XMKL 4XNUL 2BOCB 2EYRB 4JFDD 3D85A 5D1XC 1LO2H 3BRFA 1SHMA 4U7SA 5JHLH 3CSYA 4OBRA 3RX5A 2NY6B 5I19L 4KJWC 1UQSB 2H32B 2Y5EA 4NC0B 1EO8H 4PJ9D 3KPNA 1QLRA 3SDDA 5ACZB 4JHAH 25C8H 5ICYA 1UA6H 1BM3H 1C5BL 4G6AC 1BJ1J 1FAIH 1DEEA 1JYXA 1A7PH 1SYSB 3ECBA 5GISL 3VFSA 5B39B 3IJHB 3NGBB 2Y06L 1ES0B 2BSSA 4I48B 1QSVA 1LP9F 1SJEA 2F5BL 5L0QB 5K9KA 4UBDC 5DMGD 3MUY1 4CJ1A 4DKEL 2DQDL 1IAIH 3C60A 4OCRH 1T5WB 3MC0A 4HIHA 3P77B 1DLHA 4OV6F 3CJJA 1ZAGA 4TTDD 5TH2B 2EDXA 1ONQA 4Y5XA 3TNMB 3LS4L 4N68A 4N8CL 1J0JA 3PP4H 4IM8A 1CLZH 1AY1H 2ATKA 3ISWA 4UZGA 4YX2L 5HGAA 4LHUB 3MGAA 1Q0XL 2ITDB 1JHTB 3SCMC 1WFUA 1DQDL 4JY5H 1T2XA 4MZ2A 4UINH 3RWDB 2V9RA 2FB4H 2ENSA 5C92A 1W0VA 4JEGB 4NKQB 4CADA 5F1OB 2I26N 4OCYH 3RDTB 3LSOB 2R29L 2IAND 1E4KC 2GJ6D 2ZNXA 4EEEA 2C1PB 4YFEA 5F7HA 1S7RB 4QYOA 4PGBA 1UM6H 2JIXD 4HC1A 4M6NH 3WUZA 4QRRA 2VZ3A 2YD7A 4PFEA 5D9SA 4Y1AB 4PBWD 5JIPA 2G75A 4PJDF 1GIGL 1ZHKB 5FDWB 3O41B 1QLEH 3NCYP 1T1YB 4HZLA 3QIBA 3WXVH 2WINB 5FECB 5JZ7C 4U6HB 1U8IB 5IMOB 3RWGA 4AEHL 3EYFA 2OI9C 3B9KD 1RZGB 1LEGB 4MQTB 1CXFA 1LNUB 3MV11 5BZWA 1BBJB 1AGDA 4DKEH 3WJJA 1HI6B 4BQ9A 3CCHA 1GGCH 4U6VL 4C56A 5DJYA 4HS3B 1BZ9B 3JBG7 2UZIL 5F6IB 3QDJD 2NX5E 2Z8RA 2FATH 3P77A 5FYLL 4H1LB 2IGFL 3BP4A 1FBIH 2NY3D 4JQIH 5FGRA 2ED7A 1VKXB 5C0CA 1FG2A 3B9VA 3I9GH 1QBMH 4LEOB 1V3KA 1GAFH 4LVNC 2IAMD 4PJBF 5CWSB 5C2BH 1NMCB 4PJGA 2PW2A 1FZKB 4JDVA 2W9EH 5I1LB 2V9TA 3RZWA 4WO4D 3MGOB 2G60L 2VISA 4YWGL 1DBMH 3TYGH 3SDCB 1FIGL 1U91B 1QKZL 3F5WB 3WO4B 4Z78B 4GBXC 2I07B 4S1QL 1RHHB 3W81A 5T1LB 3U4EB 1X5JA 3R4DA 1G9NH 3L3JA 2ZNWA 4GBXA 3SCMB 4AEIH 4OLVH 4S0TD 4WNQA 2VDOH 4HIXL 2JLLA 5IV2B 3U46B 1G7QA 4POZC 1MCPH 1IQDB 5IB2B 3MRGA 1QFPA 3NAAH 3MV8E 4R4NC 2H6PB 3S7GA 1NCCH 1NDGA 3F7RA 3TBWA 4PRHB 3C60D 3RDTC 1E6JH 3QUML 1VPOH 4JFFB 1NMBH 1FH5H 1B3JA 4HGMA 4WHDA 3KHOA 5DQJB 4LEXL 1H8NA 1P5VA 3O4LB 5MEOA 4K7PH 3QWRD 4XT1C 1RU9H 4XAWL 5A40E 5HHQB 3ILPB 2GY7B 1I8IB 5EULV 4Y2DC 1OP5K 5ID0B 1JGVL 1HNFA 3ZTJH 1AJ7H 4PJ9B 4JFYA 2R39A 2D0FA 3LVEA 4Z7QF 3BP4B 2MKWA 2YS4A 3WIHA 5FYJU 3WIHH 2UYLA 4WDIB 3D39D 4IRZH 4PGCB 5CZVH 5EU4B 4PJAF 3BGMA 4YGAB 3NFPB 5KS9A 3TJHC 4Y5YB 5AAMA 4F9PC 1I9IH 2GT9B 2DD8H 2ITCB 3FQUA 3ZKMC 2EXYC 4LQFH 1CBVL 5ICYB 5L8JB 2QSCL 1RUKL 2EDHA 4H8WL 3JUYA 3NVQA 2QQLH 4FP8L 5AG8A 3CFDB 5DZNA 4OF0A 3IDXL 4ZOCA 1W2KT 4GG8A 4Z5RB 1T7XA 5CGYD 1IL1A 1TNNA 4RISH 5ALBL 4UT9L 1D9KC 3B5HA 4GW4A 3VFGH 5K9OB 1ZWIA 4I9WD 2NX5D 5GSVB 1RZJC 1MWAA 1AR1C 4R4BB 4I48A 5F1SA 2VDMH 3QHFH 1FNAA 3GSOA 4M1CD 3SGEH 3GHEL 1JNHA 1OSPH 4R4FL 5MEND 3VFOB 1JZ6A 4GH7B 4DKAA 3D25A 2YBRA 4HIJB 3C09C 1PG7W 4GRMA 1NH6A 1ZVHA 1B6DA 4QXUL 2AJZA 5D6CA 4EQ3A 1WZLA 3TNMA 1I9IL 2FB4L 2R4SL 4Y19A 5E1AB 3RL2B 1WT5A 3ZKXB 5CHNB 4OLZH 1AD0A 3BIKB 4MD0A 5E94B 4HSQA 2J5LC 2R2HA 3DX8B 3ARDA 3O2VH 1S8DA 5DWUH 2B0SL 3FN9A 3KPPA 3LY6A 3MNWA 5IFHH 1XGYH 4LPCA 1F5WA 4D3CL 4Y89A 2GFBA 1AHWA 4P9HL 2BY3A 1CFQA 2QKIB 3GIVA 1A1OB 4BZ1L 4MHHI 5TGBA 3BKCH 2MKLC 2P5EE 4S2SB 5JIIA 3HMWH 1SY6A 3KYMB 3BKYL 5ISZE 2NQCA 1CWVA 3T4YA 3NIDF 1S3KH 2CUMA 3RP1A 4HUNB 2PCPB 2CUHA 4H0GA 4HFWA 4X5WB 3VXRD 3NBNA 1KGCE 2YPLA 4KTEL 1RUMH 1HHJA 5A16B 4X98A 1FJ1A 4EXPX 1I1AC 2D31B 4WHTA 3MRKB 4C56B 2O5XH 5JOFB 1ZEAH 3IXTB 1E4JA 3FQTA 5JW3H 1GC1C 4KZEH 1EMTH 3X3FL 4PRIA 5E0QA 4M93B 4TULL 5C0BD 5C7XH 4NYLA 3BDBA 3S3JA 5KVDH 5I19H 2G9HA 1I7TB 2EDOA 4YBQD 2NZ9D 5A2JH 4HIEA 1FFOB 2SEBA 1HKLH 3OAZH 1OL0A 5I1KL 1B9ZA 4XPAL 3QRGH 4LEOA 5JOPE 3BQUD 4P3CH 4G6FB 3HFMH 4R3SB 3STLA 1UM5L 2JIXB 1IGCH 4TRPH 1T2JA 1GAFL 4ZUUA 3OKYA 2A77L 4YBLC 1EFXD 4PJXF 5DC4B 5INDA 3FOLA 5CEXA 1R5VA 3B9KA 5DO2D 1CFSA 4FQ2H 4D9LH 1SMAA 3VXMA 1RHHA 1T1XA 4M3JA 5EU5B 4HLJA 2EE9A 5E03A 4Y5YC 4DGVH 3OL2A 2FEDC 5HYSG 4YUEH 1EXUA 4LCUB 1A7QL 3UMTA 2BOBA 4ZFGH 4KI5F 3VXSB 2H26A 1CQKA 3UJJL 3L3HA 3TWCH 3MRGB 5HJ3B 4WW2A 1EZVX 2P44B 3O6MH 3PJSB 1YQVL 3QCTH 5DMJB 2A0LC 3U82B 4LSPH 2EEBA 1RZKC 1A7NL 5C3LD 1UJ3C 4NBYB 5F1KC 1MFCL 4JHAL 4LCYB 4ESKA 3FZUC 2BJML 2PXYB 2YPLB 3CDYA 1T66D 3O4LD 2NY2D 1NBQA 1RZFL 4PB0L 2W07A 4YAQB 3C9NA 4ODTL 3NFNB 4NPYB 4PJDE 4P2QA 3B6SB 1IQWH 1HXYB 4ZQKA 1QLFB 3OKKA 4YFLI 1FPTL 4LSRH 3L3OB 1SEQL 4JRYD 1KN2L 3O8XA 4KKAC 2P45B 2NY6D 3KWWB 3QIWB 4S1SH 3QG7H 5ILTL 5HYSB 3U30C 2APVA 4DGIL 3PL6D 1R3HA 4X6CF 2DJUA 4I3SH 4YUEL 1QP1A 1YEHL 4MQSB 4KJPC 2DTSA 4DGVL 2XQBL 1UFUA 5HGBB 4HWBL 4HUVB 2J8UA 3MROB 4RQQB 2RJMA 4XVJL 1OPGL 4GQ9L 2A77H 2GK0A 5J6GA 2XTJD 2D9CA 2FYYA 4KDWA 5L88L 2BNUA 3O2DA 5T1KD 4FOMA 4WWID 4RMTA 5C0BA 3IU4L 1EIBA 4LLYB 2Z93B 3UTTA 1P84J 4NHUA 4EI5D 2O5YH 1TNMA 4IOIB 4NFBA 2DKUA 3LKRB 1IAIL 2W0LA 1KIUA 5D7LB 1I1AD 3DPBA 4QHMB 3JWDL 2EH8H 1FPTH 3E6HB 4PJCA 1Z2KA 4XWOD 3S4SA 3UJIH 4GKZA 1EHXA 4YBQC 5ISZA 5I73C 2P8PA 4NQDE 4PV8B 2F53B 2DLIA 1YYLH 4ENEC 4J8RA 3I2CH 5I18H 3BAEH 1J1PL 5K9QI 4JREB 3LEXA 4XP6L 1FV1B 1ZHNB 2BVOA 5F88B 2HRPL 2ZUTA 1VEPA 1NLBL 5LG1A 4F7EA 1P53A 1DQDH 4JY5L 5BO1H 1MI5B 3DRQB 5CP3H 1BJ8A 4NZUL 4LOUC 3CIQA 3EYOB 4F7PA 2Y23A 2OJEB 2AERT 2NY0B 2AEPL 2EC8A 5ESVB 3OMZA 1UJ3B 3WD5L 2DWEB 4G9DB 2E27H 1UH4A 1YECL 2NR6D 4PB9L 3ELAT 5DA4A 2K7PA 4PJEF 4YGVA 4WV1C 5DVKA 2DM2A 3GSNH 4U1NA 3F7YB 4O51B 3HE6A 4OLUL 5DI8A 1DBJL 3Q5YA 3U9PL 3MRMA 5FO9A 4XNMA 4JB9L 1WV7T 1HHGB 1IGFL 1OCWH 2B2XL 1WAAA 5FM8A 4GAJH 3IDUA 5F72S 4B7IA 1JUFA 3DVGB 3GMLB 4X6DB 3DECA 1TJGL 1FC2D 4PJDB 1KG0B 3WFBH 3KPLB 3MCLH 3FJTA 2GK0B 1T1YA 3QIWC 5TF0A 1UA6L 1N7ML 1AFVH 3A6BH 1MCCA 1EEZA 1I7RB 1J10A 1J0YA 3QFJB 4IRJC 3QIBC 1SVCP 1S7QB 1C1EL 3PWPE 5DJCA 4OZ4A 3RKPA 1GZQA 1V5JA 2O61A 2BSTB 1OAUL 1YEGL 3O6FC 4X5WA 1NC4A 5DEGA 2C26A 2VQ1A 3GUTB 4GXUN 1BD2D 4G80A 1AGFA 4KTEH 4NGHH 3C8DA 5JA8B 3HR5B 3FQNB 4FQXA 5FDYA 4MDJB 2PN5A 4FQQB 2FIRT 1VKXA 2HVJB 1J0ZA 3K80A 1MREH 5C86A 1IEAB 1LILA 2FO1A 5AWNH 1ONQB 2VLKD 1Y6KR 4APQB 3K2MC 3MRJA 3ULVL 3IVKA 2QQLL 2FJGA 4C56E 5KVGH 1MCDA 2IANB 4QWWC 5FA3B 4ONGH 2P48B 3DV6A 4UILH 4JN2B 3NH7L 5FKAA 4QT5B 3SDCA 4N8VB 2VKXA 1UWGL 4GLRI 4NNXA 5BXFA 3V4VL 4MQXD 3U9UB 3JUZA 4E5XA 4J23A 1EK3A 1HHGA 2E7LA 2BRQA 2X4QB 3T2OA 2YD3A 5SX5H 3TO4D 2VLJE 2WV3A 4S11A 4XZUA 1UM5H 4P5TD 1J7VR 1S5IH 4H0IA 5E2TH 4XWGL 3FFCB 4PRPE 4NO3A 4LVHC 1XCTA 3SDAB 5IB4B 2XN9E 1OHQA 3FRUA 4JQXA 3VFPA 3N1FC 3ARUA 2KDGA 1IEHA 4POZD 4XTRC 4YHYB 3TC9A 4JN1L 5DHYA 5HDOA 2Y25A 1G6RH 4I0PA 4YEEA 3CU7A 1HE7A 2PTUA 1EFQA 1QSFD 1IGYA 2C1OB 1TQBC 1XEDA 2OR9H 3IDMB 3ILPA 3VWJA 3RNQB 1AC6A 2Z4QB 1YNTA 2YEZA 2GITB 1S7SA 5J13C 1KCRL 1VENA 3ARBB 2IH3A 1IC4H 1YMMA 4JO4H 3IU3A 5DD6A 4P2RD 2FATL 4CAGA 5BV7L 5BCAA 5E6IC 2UZIH 2ZCHH 3TT3H 1KNOA 3ARDB 2EDKA 3TGXA 3NFPA 1BGXL 3RVVC 4R2GD 3QXTA 3GSWA 4NKMA 5JDJA 1JGDB 1YA5A 2Y7QB 3ULSA 4JVWA 5E4EC 4OZFG 3NZ8A 5J3HD 1Y18B 3CLFH 2ZWLT 4Q6YA 4MXQD 5GGVY 5J6GB 32C2A 2Z35B 1EHLH 3S4SG 1U58B 3KLDA 3WUWA 1X4XA 1TLKA 1VACB 1JGEB 4JO1L 5LXGL 1H0DA 5IB3A 2E3VA 3ILQD 1PLGH 5DUPL 3M1BA 3KXFE 5T5FH 5F9OH 2ADIB 4OM1L 2QJDA 3H7BA 1MVFA 4JHWL 5CJXC 2JCCF 4LASL 2E7MA 2E8YA 5C1MB 1HDMA 5GRZA 2VJXA 1SJHA 4M7KL 1JGUL 4M7JH 3EHBD 5LKNA 2O93L 2FBJL 1J8HA 3MX0A 1U93A 1F3RB 3NIGF 1MY7A 5D5MF 1KELH 5D1QA 2GAZB 4IIQB 1CK0H 2QTEA 2VXUL 2AJSL 3DX9B 5IF0B 3VXPB 3CK0H 4JFZL 5EORH 2H2PD 4NO0A 2YUZA 4DW2L 3QIUD 4KRMB 3MLZL 1KFAH 4O51A 1GGBH 1ROWA 4TNVK 2VB5A 3RGHA 5TQ2L 3V4PL 1MIML 2V17L 4YGVB 4PJFE 1KIRA 1A6WH 4Q6IC 2B1HL 3NCYS 2DTMH 5DRWB 3GSWB 3GSRB 2R0KH 4UTAL 5JHDD 1EA9C 2B4CC 3NZ8B 4CN4A 3UO1H 4MD4A 3PWUA 1WWAX 4L5FL 2KKQA 1T20A 1WLHA 3MJGX 3ARFB 1K5NB 4JKLA 3SKNB 5EU6D 5DFVD 4QF1A 5D72L 1PLGL 4HH9B 2YR3A 1NFIA 2HJFA 4HFWB 5E2WH 5D1QC 3OX8A 1NSNL 1JPSL 1A7OH 5DT1L 5C0RH 2QV2A 1C7SA 3W39A 1QBLL 5DS8A 5J1SC 5L6YL 4FFYH 3VMOA 4X8JA 2AJYL 1G0XA 3MRQA 3FAXA 4K94L 5B8CC 1YMMD 1PG7L 3ARVA 3HB3C 5IROC 4NUJB 3MXWL 2E9WA 1T22B 2HFFB 2VDML 4OF3A 4G7YH 1YY9C 4OSUH 2GYSA 1ZT4A 1N59A 3QUMB 3UPRB 1CICA 3TA3C 1OLZA 1CDYA 3O8XC 4P23C 5JLZB 2FIKB 2YD9A 2VZVA 3O3AA 4CVXB 2R4SH 1DEDA 5D6CB 4KH2A 4M5YH 3B8SA 3DIFA 4Z7OF 3PWPB 3GKZA 5BW7C 1ZGLA 1UGNA 3U9UA 4WCYH 1WZKA 4Y4HA 1JPSH 4Q2ZA 5EU5A 1KN2H 4HEPG 4QT5A 4MJID 5D7IB 2QHLA 3G5VB 1MJUL 4HK0B 1PGRB 1BD2A 3RWJA 5T33L 2W9LA 3FFCA 5L0QC 3BZEB 1F4YL 1S7TB 1A4KB 4WHCA 4Y2DA 3UTSE 3D69B 5CLTA 4O2CA 1A6AA 1FLRL 2OL3H 4OB5L 4LCCA 1SM3L 2Q8BH 3P9LB 4QTIL 1BECA 3ZSTA 4XCCH 4U7MA 4P0DA 4LSSL 3HMWL 3QQ9D 1RUPH 5F88A 4NNPL 5E8DL 3LN4A 5CBEB 4Z8FH 4H5SA 1UCBL 4EN3B 1AQKL 2X9YA 1FNSL 1UENA 1WTLA 2ZJSL 5C0FB 2JCCB 4APQD 3IFLL 2R0ZH 2XZQH 4PJXA 4XP5L 4JDTL 3QEQD 5C08E 5IB1B 2XZCH 5EO9B 3CNKA 3QQ4B 3BW9B 4RZCB 5C9JA 2DM7A 3PWJB 3WEXA 4J6RH 3FO1A 2C4FU 2AABL 4NBZB 1OW0C 3WKML 1CDCA 3MV7D 2DDQH 4JZOB 3HTLX 5EZLA 4RDQF 2VN4A 4NKMB 4YHIA 4GFTB 1BREA 1T0NA 1W0VB 3MGTB 3I84A 4R0LC 1EO8L 4EIZC 3ORJA 2X10A 5I8CA 1NMAL 4RFEB 5GGVH 2HKHL 2BHZA 2GK2A 1G7PA 1MF2H 1EBAA 1MNUH 1ZA6A 2P24B 4M7ZB 1AO7D 5HYJB 3CX2A 1DP0A 2ICEA 3PHQA 5HBBA 3L3IA 3V0VB 4KKCD 3HMXA 2L7JA 3QUMH 3FQRB 4O58H 3K81A 4N90E 4KGJA 1JPFB 1NANH 5E95B 2EC9T 4NQSA 1K3IA 3PNWB 1JNJA 3TH2T 1BF2A 4Y4HC 5CBAA 2GJZB 2IAMB 2VXQH 1RK0A 1MFEL 5K9KB 2F54D 4YQXH 1RZIA 3LEXB 1AI1H 5DQ9A 4ZFGL 5DD5L 3H6JA 4YR6B 5EC2A 2RB8A 3VFMA 1WSST 2BVQA 3H2WA 4X6DE 4XBPA 5E2VH 3P9WB 3FT4A 1JV5B 1T1WB 3R06B 1NMCC 5F6HI 4C83A 4D0BA 3FOMB 4IDJL 3KNBA 1WZMA 3KXFD 3ULUC 2VDRL 4LDLB 3BT2L 4A6YH 3TLRA 4JO3L 1CD8A 1XH3A 4KRPB 4CN6A 4GQ9H 2G2RB 2L0DA 3KGRA 5E94A 4PJ8D 1UWEH 2XA8L 2VOTA 4Z7VB 5E8EA 5IW6A 4KDTC 1NGPL 5LJYH 4CRPA 2GSGA 2AJ3A 5MERB 3T4AB 4M4PA 1IAOA 4OZIB 3TT1L 4DGYH 1BBDL 1U8HA 1P7QD 2J8UB 1A6ZB 5H35A 4QRRD 1CR9H 2RCSH 4ZAKD 4F15B 5L2JA 4GMTH 2OTUA 5HYJE 2K1MA 2I60H 3BFOA 5DRNB 5TJWK 2NTSP 2Z31D 2B4CH 3CSPA 4NQDB 4P2RE 4Y4KD 3OJDA 4F2MA 1JBJA 4NN7C 4U6HA 3LKSA 1RIHL 4LAJH 4ERSH 3RU8L 3UX9B 5HPMB 1AO7B 3B3IB 4AIZA 5HYJD 5DHYB 3T2NH 2HT2C 1KN4L 1RUQL 3OKDB 5IR1B 4LHUG 3KYKL 1UVQB 5BQ7B 3MRKA 1FCGA 3RI5F 3MQIA 5DLML 3K1KC 1OAXH 4DOHE 3QQNA 3W39B 2E5EA 4M7LT 4O9HL 3A0OA 5DJYB 1EZVY 5EIQA 5GHWH 5L6YH 2PYEE 4U33A 5KSUB 4OLYH 5IESH 3L3GB 3SEPA 4ORZC 1YEJL 2V9QA 5CSZB 1C16B 2VR5A 2X4UA 4KAQL 3G6JE 2HFTA 2X4PB 1FGNL 5KVFL 3DTXA 2XG5A 2MPAL 2Y4SA 4Q9BA 1IZJA 1VGKA 2VLJD 4AJ0A 4UV4H 1FFPA 5T3XH 3V52L 3IRPX 1FBIL 5HDBF 1XH3B 5ABDE 1BMGA 4KJWD 1NUNB 4K3DL 5LAXA 5GS0D 3QCVL 5IWLA 4J4PC 5IB5A 5TQ0H 1CG9B 1MRDL 3GNMH 5HHVH 4PRPA 3ZT6A 4HG4J 3L3DB 5GRVL 5F8RC 5F7UA 1OAKH 1ND0B 3QDJB 3B2VH 4X0KB 1HH9A 5CD3A 1QD0A 1FYTD 5C08B 2BRRL 1WITA 2E6PA 3SDCD 1OVZA 4RBPK 2NY3C 4TUKL 5E8OA 4ACPA 4PR5A 2N1KA 1OSPL 5E9DD 1FRGH 3RWHA 1EGJA 4LCIL 4HC1L 4PREA 1JWSA 3VXRA 3PIQB 1U95A 1JFQL 35C8L 4JANB 4Z6AT 5FUOL 3O6LH 1TZIA 3BPNC 3QUYC 3NACH 4U6XA 2WMPA 4R96B 4N5EC 1P4LB 2JB5H 1DVFC 2ERJC 4OF6A 4AEIL 4JVUA 4Z0BL 5ICZA 1YNLH 1BLNB 1DANT 4FQXD 1WQVT 1R3IH 1NL0H 3EDFA 4HW6A 3BDYH 1YMME 1YEGH 2X09A 4L8DA 3BUYB 5FYKE 4PP2B 4GKOA 1ZGLP 1FE8L 2V2WA 4QTHB 2ATPA 4F80A 4F7CA 1NC4D 3T08A 5C0FA 1N64L 1RK1B 3P11L 4L3EB 3SCMD 4WFFE 4LASH 3QXDA 4XPFL 1DL7L 4HX1A 4JJ5B 4XRCA 4P2YA 2ZG3A 2YD6A 3E6FA 1YJDH 5GGUB 4R4ND 3DHMA 1DE4A 1JNLH 1FVDB 1Y18A 4HKXA 3TZVA 4F3FA 5JNYB 1WTGT 2OP4L 2YOCA 3IVKB 4RFNB 3MV9A 4LCWB 1OP3H 4NO5B 1CFVL 5D93C 4HEME 4LQ1A 1RZ7H 2GUOA 5GGQL 4BFBD 4DVBB 2HVKA 5TE7H 2OTPA 4G9FE 2EZ0C 4FFYL 4NFCA 1RAMA 3CVHH 3OGCA 1T3FA 4WUUA 4JM2D 3C5ZD 3QXUA 2X4QA 1A1NB 3GI8H 2FX8L 3MOAL 5D2LA 2FEEL 4PS4H 4PJAE 4PR5B 1ES0A 1ITCA 5F89B 1C5DB 3V5HA 4EI6A 1HXMB 2NY5L 3VMNA 3NACL 4PJCF 2F19L 4KRPD 1T1ZB 1GL4B 4DUVA 3TFKC 4Z76B 3VXNB 3VFOA 4YDJB 5CCKH 1OSZA 2YRLA 3IDJA 4FABL 4HIHB 3TBVA 5ICZB 4ELMF 3UTZA 4JN1H 5JXAH 2J88H 3HRZA 3MLXH 4F7MA 5FM5O 3EYSH 2BVEA 3IDIA 3GRWL 5KAQG 2CDEA 1QRKA 1FFOA 2V5MA 1MCQA 1XGPA 4I77H 3LEVL 1VFBA 4LEXH 4OTXH 2A83A 5TE7L 4LIQH 2Y07L 1U91A 4YO0A 3V6OE 2Z31B 3RL1B 3HE6B 2LTQB 4QHLB 3SHSA 3MRRB 4ELMA 3HI6H 1Q9OA 2MCPH 3K2UH 1I8MA 2AV1B 3GJEA 4WTZA 4JAMA 1ADQH 3OWEA 3V6FB 1TPXC 1IFHL 3LKOB 4NDMB 2BVPA 3TWCL 3QWRA 3AU1A 3PDOA 3MBEA 3M17A 4JKPL 1HQRB 2J1KA 4LPXA 5FYKD 1IGJA 3GM0A 1QVOA 1AQKH 1B4RA 2X1XR 2CLVB 5FO7A 1W72A 1XR9A 5CP7A 3B5TA 4LGRB 4YLQT 3ROOB 5DHXB 5I8OL 3JWDC 4P5MB 5E00B 3ARWA 3V5DB 4JFXB 2CKNA 4OCNC 1ZOXA 4NQDA 3VGGA 2OYPA 3PE9A 3F6LA 4K2UH 1QHOA 4M8QA 4OQ1A 1D5ZB 2YPKA 4NRYA 3ET9F 1YN6A 2MCG1 5H94A 1KTLB 2E9JA 1MCNA 4FMFA 4HGWA 1OP5H 4ERSL 4JJHA 4XVSH 5BRZE 1EBPA 2RHEA 3P4NB 3VFGL 1ZT1B 1JZ8A 5KTEL 1FYTE 1D6VL 4U1LA 2C3HA 2DS4A 3P4MA 1CICB 3HA0A 4NWUH 5EH1A 2V17H 3DROB 2R8SL 1ED3A 4BZYA 5E8PA 1BOGA 4GSDH 4LSUH 5IK3B 1TJHH 2FO4A 3QQ3A 5T3ZL 3P3YA 3RAJH 2VRAA 1JF1B 2YN3A 4R3SA 4PJIF 5EDXA 4PTUB 5SWZD 3JV6B 1MAMH 3UEZA 4PGEB 1NAMA 1N2RA 3UJTH 3BYYA 4GMSL 5M95B 4KQ4H 1L6ZA 4HJJL 5GGTH 4CGTA 1FNGA 3BZFB 4L1DA 4BZ2L 3H0TB 1QLEL 2BHYA 5JHDA 4QRTB 1OPGH 1HNGA 1JNNL 3SDDC 4PJ8A 2MQ0A 1B88A 4K8RH 3S37L 1OLLA 4GRWE 4CDHA 5KOVC 1D9KD 1HH9B 1YPZA 2ZSVB 1W72H 4YDVA 1LEIA 3VD7A 5D7IF 4U6VH 3H9SD 4WW2F 4WO4A 3GSXA 4G6FD 2FX9L 2KQNA 1HEZB 3H3KA 1NCAL 1YYML 1V8HA 2GHWB 2APBA 1A6TA 4XAKE 5C6PB 5GZNC 5B22A 1I3VA 5TFSL 3EJYC 2C1PA 2X89D 3QNZA 4XBPB 4XNZC 4XP1H 4Q6IB 4JFFA 3IAQA 4XP9L 1DQTA 2AK4B 4I8DA 4PP1C 4DZBB 1ZANH 5CZKA 2VIRB 4NZTL 1WZ1H 1EUTA 1RK1A 4KHTH 1BZ7B 3SKOA 1VB9A 3NOIA 3QDJE 1NEZA 4RRPG 2GTWB 2V5YA 4XHQA 4UOW0 4M48H 2F5AL 2R0LH 2CH8A 4CVZA 4BK5A 4JFEB 1TQCC 4U1NB 1PBYA 5FV1L 3VD5A 1N59B 1YEFL 2DICA 2YRZA 2DI9A 5T1DH 1CLCA 5DJ0A 3MBXH 2EIBA 3QUZA 2GY5A 2Y1VA 1KCRH 3RU8H 4U1SA 3FT3A 1F4AA 1UB5B 1GOFA 1XF4B 4QY8B 3SDXE 3MUZ1 1T6WA 3RA7H 1H3UA 2VZ1A 1BFSA 2FGWL 1OAUH 3MFFA 4O2FA 2YC1B 1DUYA 1SYSA 3ECBB 3W9DA 4PBVC 4MS8D 2HYMA 4WHTB 5IHUH 5ICXB 3MCKA 4ZNEA 4K7FA 3FO9B 2Y5TA 1RZ7L 4Y19D 1AFVL 3A6BL 3V7AE 3S36X 5DQ9B 5IOPA 1H5BA 1GGUA 4OCLC 1SEBB 4NQEE 4OLWL 2IPTL 2ADJB 4OCSL 4GRWF 1B4JH 4J2XA 5DJDB 3C60B 3G5ZB 4Y16D 1JYWA 4F15C 1QEWB 4M1DH 3WSQL 3WNKA 5DYOA 5T1LA 2EXYD 1PQZA 3G5YA 4RGOL 5J11B 4WI4A 1LK2A 4NQDD 3KNBB 5BRZA 1JPTL 3Q3GB 3ZE2E 4PV9A 3RIFK 2IEPA 2XZCL 1L0YA 2W65B 4MNGE 4HJGA 3FTGA 4OCWL 2I9TB 5ANME 3S5LA 4XCNB 4RMUA 4LRIC 4TVPD 4MNHA 4NQEB 1FDLH 3OBAA 3GMQB 3LS5L 1P2CA 3QP3A 1RVFL 4Z7WF 3TO4A 5C71A 1XF3B 2WWKO 4UB0H 3LRSB 3PUCA 3C8HA 1P7KA 5GZND 3A6CH 1GYAA 5MHSE 2IQAA 4XXCA 1LO0L 1TCRB 1YEIL 3L5XL 2DBJA 4PRDA 2YPVH 4DEPB 1INDL 4WI9A 1ADQL 2B2XH 2YA0A 3JSSA 3SDXB 4AH2B 4S2SA 1B4JL 4IOSD 2DM3A 1CYGA 1IRAY 3O2DL 1NC2B 2WUBL 2ZPKL 4DCQA 1Q0YH 2QQKL 3QEGL 5T5NG 4NC1C 2HLFD 3LN5B 4P4KC 4DGIH 3EOAA 3BP5A 4NKOA 1CDBA 1FJ1B 4KVCH 1FNFA 4XB8A 4YHZL 5TDPA 5BS0B 3G6JA 4PP2A 5D7LE 3P4OA 4IHOB 3JV4B 1CXIA 2P7TB 4PRBA 5JOFA 3ZDZE 3CFDA 2VXSL 1BOYA 2HTKC 4J1UA 1HSAB 3H9HB 1S7UA 2VL5B 2WAHA 3P4NA 5IW3A 3GBNL 3JV0A 2A6KB 2D7MA 1J18A 2BVQB 1JFQH 1RVFH 3LZFH 4AMKL 1A3RH 4KJQC 5EU7C 4XXCC 2AK4E 1RSFA 3C5SB 4KHXL 3KS0H 4K94H 2HJKA 1TZHA 1YC7A 2ARWA 2IFFL 1WFNA 3EOTH 5LWYH 2JJUA 4Y4FC 3GSOB 3MCG1 1KPRB 3GSUB 5DQDH 1AIFA 2A73A 4QXTB 4JDVB 5I1LA 1WF5A 3KLHD 1CE1L 2BK8A 4G6AD 4P46D 5CGYC 3D0VB 4PJIB 1QLRB 2JJTA 1IKNC 3UTTB 4M61A 4PJ7A 2BVTA 3HS0A 1A3QA 3TJEL 4NQUA 3I6GA 5IEHB 1LWRA 4L3CA 1P2CB 3DHJA 2E7HA 2CMRL 2NLJB 4XCEB 2NXZC 1X5IA 3VXMB 1MCBA 1AGCA 1RIHH 5C0CE 3ZDYF 1JWUB 4W6XB 1FAIL 4QRUA 5F1NA 3MXVH 3BIKA 5B38A 5IVZB 5L2JB 3L3HB 3QHZH 5CS7A 1JPGA 3Q6GH 5TPWH 5I6XC 4LLWB 2CR3A 4UV7L 5B3JF 5C0CD 3FRPA 4L3ED 4XBGB 3LN4B 2IJ0C 2LTQC 4MNGB 3H9ZA 1N7MH 2X1WL 1H3TA 1XR8A 2VMFA 4H25B 1WFOA 4MXVE 4HAFA 3FN0L 4ZPVA 5EOCH 2DQGH 5GJTL 3OAYH 4XPGH 2ZKHH 3W9EB 4C56D 5HGAB 2I24N 3NZHH 2GAZA 5L2KD 1J0IA 3TYFB 3JWOL 3ZE0E 1KGCD 1CLZL 3BEWA 1NCUA 3IU3B 1MH5B 4NQCD 2YMXL 5BVJB 1DQQA 5GS1B 3HG1A 1ZHBB 3RDTA 1AKJA 3V5KB 4ZXBD 2P47B 4Y5VC 5F3BA 2NY0C 1D5BA 3CLEH 2B20A 1CE1H 1U9KA 4Q0XL 4PJ5D 3QHZL 4OCYL 4KU1A 4POYA 1MJJA 2P8MA 4OM1H 5FB8B 5DVLA 5J9PA 2FWOB 1QO3B 4D9QE 1F6AB 3N1GC 12E8L 5CZVL 5T5FL 4TQEH 1D7FA 1BIHA 2VLRD 1W72B 1YUHA 4P5KA 3QCTL 4R26L 3DYPA 1OTTD 4FXLA 4WV1B 4CBPA 4XBEL 2Z31C 1MJ8H 2GJZA 4R7NB 4EJ1C 4WI6A 4MNQE 2PTTB 2YC1A 1FO0H 2AP2A 4ZUSB 4KMQA 3N85H 1FQ9C 2LAGB 3LDBC 2P4AB 2WLZA 4JFEE 3T3MF 1Q72H 3DSFL 1YEKH 1ZS8A 2VABB 2BVOB 4DW2H 5IJVB 2P5EB 3G5XB 3Q3GA 5DD1L 2EKSB 4E41E 1EEYB 5D9SB 5HD8D 4HDIB 1YNLL 4LLAA 1MFEH 4E42B 1HWGB 1KJVA 3ZHDA 4YH6A 1VFBB 3BI9X 2CDFA 5DUML 4JY6B 4ZODA 1J1XL 1KIPA 3GSVA 5C0IA 2UVEA 5JXED 3SE3C 4Z7VA 1G9NL 1NCBH 5CSGA 3UO1L 1RZGA 2R0KL 1M4KA 2PXYA 4UTAH 1LNUA 3BWUC 3S5LB 2PUQT 2I07A 4XPTH 4NDMA 1R3KB 5HHOE 3JVGC 5F1IB 3QPXL 5HGGS 4NWUL 1KTDA 2LU7A 3VW3L 3AY4A 5GS0C 3RKDD 2R9HC 5BJTB 2VLKE 2OP4H 4OUOA 1J9CT 5JW3L 1LE5A 1BEYH 4I18C 1CL7L 1KJMA 5E2WL 5HHXH 1S9WA 5IROA 1F11B 2JJVA 2F19H 2H6PA 4XWOC 3LCYA 3CPLB 5T33H 1EHLL 1EEZB 1I7RA 5CJXA 1NANI 4MB3A 1BJMA 1KCSL 2RAMA 3LKNA 1F45A 3M8OH 2FECI 4FFZH 4K3JH 3ULUF 1T83A 5DRZB 3VFUA 1MWAH 1SMOA 2AXGB 3HZKA 1EAPA 4XVUD 2VDRH 2WWKT 3QDMA 3K1DA 4BZ1H 1HYRC 2R1YA 3IFNH 4BSVA 1Z3GL 3AC0A 1XCQB 2AEQL 4OKVA 5GQBA 1IM3A 2DQCL 3VGAB 2H41A 4XC3L 4G8FA 4OGXH 2DJSA 3QZWB 4RX4A 3UPRA 4QHMA 1S7XA 2YPLD 4HFUL 2NY2B 3AXLA 2P8LB 3FQXA 2KL6A 1PZUB 5FGCB 1OCWL 2Z35A 1FORL 3TBSB 1WUNT 5TE4H 1V3MA 2FJGB 3Q1SH 1UKQA 3LEVH 4OTXL 3PHOB 3QCUH 4YXKL 4GRLD 3HE7B 5J1AB 3GSNL 1ZLVH 1KUMA 3MRIA 1TQBB 4I3SL 3S9DB 4LIQL 3GSUA 3JWNC 1OD9A 1SQ2N 3PXHA 4KKAD 2A9ML 3MRRA 1OD7A 4ELMB 3VXUB 1VHPA 3O81A 3SKMB 3AMLA 4M1GH 5HI4D 4HUKB 2ICWI 4WHYG 3V52H 5JW4M 3MACH 3WS3A 1VADA 4QRSB 4MJIB 3OKMA 5E6YA 3WFBL 4JFFE 4GAGH 4X5LA 3CFJA 5E8NB 4DZ8A 1EERB 3PV7A 3PWPD 1U93B 3VJ6B 5B38B 2IPUG 5FYKU 4IDLA 4K94C 1BFVL 1UC6A 1G1YA 1NGYA 1T4KB 3D2UA 5DRXA 2EDQA 3WE6A 4BKLA 3Q5TA 3QH3B 3DWTA 1NAMH 5I8OH 3R1GL 5IQ9A 4FXKA 5E99H 3NPSB 5ESQB 2FD6H 3TYFA 2Q7NA 2EYSB 4QRPE 2IPKB 5CHNA 3EZJB 2CKBH 2X7LA 2WQRA 4HPOH 4EDXA 1IM3B 1B0GB 3C08H 1BVKA 2P5WD 5IFHL 3KPSE 3T0EE 2HP4A 3KDMB 3S35L 4YIQB 1RFDL 2ESVA 3OKEA 4OGZA 1C5CL 1QFWM 5IW6B 1MUJA 5DJXA 1A7PL 2Q20A 5C8JB 4PJ9C 4JG0L 2I60L 5J8OA 1EO7A 4JRXD 4AM0B 1O5DT 1CFQB 4L4TE 3VG0H 3T0ED 4B53A 2AJ3B 3BUTA 1WK0A 4PJBE 3H9SE 4X7DC 1BQLH 5EZOL 1K5NA 3VA2C 3OR7B 1P9MC 4LCWA 3C09B 3DI3B 4D0CB 1A2YA 4S1SL 1F6AA 5J1AA 4KY1L 4WW1B 5IBUG 4MXVF 1F4XL 4RMWA 2EYTB 5CLWA 2J5LB 2DQHL 3ZKQD 3D39A 1P1ZB 3HE7D 2E9BA 2IMNA 3AS3A 2PYEB 2WIMA 1LO5B 4EDWH 1NCDH 3F7PC 1I3GL 1QUNA 2HJLB 5JMOC 3WS3B 4TNWK 5L8LB 1KCVL 4JG1L 4PJGB 2VL4A 1I8LC 1ZANL 5C0EB 4WFED 1WWBX 2PXYD 3GBNH 4GAGL 2DQIH 4CJ0A 4YJZL 3MV8A 2Q7YB 3ULUE 1MLBA 4RRPA 2YD4A 4OLVL 1NLDL 3PP3H 2DQFB 3MRFA 2R0WH 3IKCA 2C3WA 5D8JL 1DN2A 2IBBA 4J1UB 4DFIA 1MLCA 5F6HJ 1S5HB 4OCWH 4N0YL 3HMXH 4FG6D 5IMLB 4MB5A 4F7MB 2DYPA 3TCLA 4LHUD 4N5ED 5IJVA 3RNKB 3D6GA 3T4YB 3LKQB 2F8OA 2J8HA 4CN1A 3SGEI 3FTGB 5EU6A 4HDIA 2X7LB 4ZNCD 3ARTA 3OZ9H 1K8DB 5D7JB 5F7NC 4O4YL 3VRLF 5FV2A 4I18A 2V7HB 3CSBA 3BT2H 3ARYA 3MRMB 5KS9E 2HTLD 2PETA 1NPUA 2IADA 3UYRL 3IXTA 3KYOA 5SX5K 1F97A 3UJJH 2EEDA 4P23D 3VWKA 5D2NB 2DYPD 3OR7A 2JE8A 3QUZB 4HK3N 4MWFA 2PO6B 3ROLA 3T2QA 2IBZY 2AK4D 5HPOA 1U3HC 3WDHA 3RHWK 1A02N 4POUB 3PIQA 4MDIA 3REVB 1CF8H 5C0ND 2XQYK 5C09B 4JZJB 4ODTH 2R4RH 1A6VH 1U6AL 2JCCA 3DMMC 3VGBA 4U1GC 3S6CA 3S96A 2Z91B 2P1YA 4ZXBA 3T3PF 3OAYK 5E7BA 3WNNA 3NH7H 1ORQA 3CDGB 4P2QE 3VXMD 3VD9A 4DKDC 5ALBH 3BIBX 4WU7B 1ORSA 1QFUH 3V7AG 3QIWA 5GS0H 4OLWH 2X1OA 4ODWB 4KZDH 1EXUB 4PIRF 5DR5L 4OZHE 1U3ZA 1NGXA 1KPVA 3TYGL 3Q6GL 3QIWD 3NABH 5TPWL 4LPUA 5IMLA 1DBBL 2D7OA 4H1LA 4LLDA 1MCWM 3U2SA 4XVSL 4A6YB 4LPTA 1WJ3A 2KH2B 4G8EB 1ZA3B 3MRPA 4FQIL 4U49A 4WI3A 3GMPB 3PHQB 4YDKL 3TZVB 3PGDB 7FABH 4QEGA 3BO8A 4IDJH 2C7UB 4MAUH 3WHE1 1BF8A 4P2RB 1A47A 4W4OC 3RZCD 1I8KA 2P5WA 2QQQA 1S9VA 4IIQA 4MJ4A 2M26A 2XRAL 5D1XA 1AC0A 2GJ6A 1JWUA 1MCKA 4FTVB 2NXZD 4O02H 3H9SA 3TO4B 2PW2B 2NXYB 1LD9A 4MJ6A 1C7TA 5EZIH 2X4NA 5D2NE 5E2VL 3WN5B 3WLBB 1YC8A 1CLYH 1IILE 2K7QA 4PJCE 5E1AA 3RL2A 4JO2L 3LEYL 3THML 1C08B 4QHKI 5C2UB 3CVHA 4P5TC 4URTB 4G5ZL 4NUGL 2DOCA 3S3SA 5ERWA 4HS6B 1LO3H 3D2UB 5FOBB 1XIWD 4XI5D 3JTSB 2A9NL 3FT4B 1TFHA 3BYTA 4K8RD 1E27A 2ZUXA 3KYNA 5H37G 4EN3A 3ARFD 1CGSL 1U3HB 5CP3A 1ETZA 1G9EA 4PJ7F 1AGEA 2BC4B 4LHUA 1I1RA 3OAUL 4GQPH 1RULH 1U36A 3O2WH 4ISVB 4PJHF 5DMYA 3RKDC 2ITDA 3NTCH 3ZO0A 3QDGD 1U3HD 4HH9A 4TUJB 5JO5B 3LMJL 1G6RL 1K6QH 3CLEL 3WL9A 4LQFL 1IJ9A 1JRHI 5DDHA 3UCRA 4WJ5B 4ZFOA 1CBVH 2ZCHL 3O45A 3IGAB 5DMGC 2VL5A 3SE9H 5I15L 3D0LB 5A1AA 3C8KA 3LOWA 4R90H 2XKNB 2AQ1A 5I8KH 2JJWA 4JPIA 1M7DB 3QA3B 5E2UL 4ZXBC 3MNZB 4XTRD 2ZSWB 1X9QA 4X6BA 4ZDHA 3TA3A 3S35H 4XHJD 5JORB 1KPRA 4YXHH 1JGVH 4G5ZH 4PD4K 2BMKB 4AQOA 3MOAH 4WEMB 3V6ZA 4EBQL 5EPMB 4BH8B 3DVIA 1G84A 3FQWB 5I0DA 1VGEL 4Q7DA 4WWKB 1QR1A 1CFVH 3S8WA 2O61B 5I17A 2ZJSH 4P5MA 5E00A 5SWSA 3INUL 4KXZH 5JZ7D 2R2EA 3RTQC 2PO6C 1DTUA 5I1IL 1Z6JT 1R24B 1T80A 2R0WL 4GRWH 4NCC2 1DDHA 4L4JA 5K9OA 2C3VB 4P2OD 1KC5L 4RMRA 3BN3B 3GHEH 4PLKC 4MDJA 1MFDH 3EDEA 4UQ2B 1G1CA 4MJIE 4M6OL 3BGFC 5CILH 4MYWB 4XBGA 4PJDA 4KKLD 1LK2B 1WIPA 5GSRB 4RISL 4LCUA 1S7XB 3IXAA 2FJHB 3QWQB 4UILL 4ETYA 1XZ0B 5EU6B 3NTCL 5T1LD 3HAEG 1A9EB 2DYPB 1QSEB 4AT6A 3GSVB 2A83B 5C0IB 4JFQA 3D25B 4HIJA 2QSCH 2R8SH 4UDUA 2DRUA 1BJ1H 3B4NA 4LGPB 1KB5L 3MRDA 3S3PA 5E8EB 4G8GE 1S5IL 35C8H 5L88H 4D3CH 1WBYB 3MRHA 3UTSB 4G43A 4NJ9L 1T6VN 4ENED 1I9JH 4S1RL 4X9IA 5E5UB 4YHLH 5HTSA 3PDOB 5CKGA 3U4EA 1DLFL 1U41A 2GTZB 3E2HC 1AXSA 1CT8B 3AAZA 4QRSA 3ARXA 4L9LB 3TCXA 5FYJD 1F11A 8CGTA 4JPKL 3GIVB 3X13B 4BSWB 3G08B 1FDLL 3RQ3A 1A7RH 4CW1B 3ALWA 5F97E 5C07B 4S1QH 1CI5A 5IVXA 3QDME 1NC2A 3ZKMD 5IIEB 4UQ3A 1W8OA 4L8DB 5D7SH 4BKLB 5K59F 1MEXL 4MX7A 4P9HH 3VDCA 5JR1L 4UOW1 2B1AH 3ALPA 1D5MB 3RY5A 5J1TC 1MCSA 3ULVD 1A1MA 2H32H 1N6QH 3MRQB 3K7UA 1QA9B 1MCEA 5D72H 1IEBB 4N1HB 1HQ4B 3VG9C 3GMMB 1NEZB 2K3TA 1IC5L 4JFYB 3VXQB 1KT2A 2BSSB 1BX2B 2WLYA 4YHYC 4CVZB 3SDYL 1LO4H 5D6DC 2F54B 2R56H 1N3NA 5GS0L 5EBWB 4Y16C 1QFUL 3CMGA 2EDDA 2CGRH 4LPWA 3TT1H 4K9EC 4X7TB 2F54E 2AXFA 3MLXL 1DLHB 2AQ3A 5A2FA 1NCWL 4OUUB 3G04B 4Y5XB 5ID1B 4U1SB 1L7TL 3IDNB 4ALAH 4UNTA 2J3SA 3PQYA 2IWGA 4MXWH 1MI5A 3DRQA 4ZAKC 2QADB 3FFCE 4PRPB 3IDGB 1R5VB 3CFBB 1LD9B 3ZDXF 3FOMA 2B1AL 3DGGB 1I8KB 2P5WB 1BD2B 3RWJB 4Q9QL 1ZGLM 2CD0A 1JHKH 1CIDA 5E6IB 4LFHG 2H2SC 2BCKB 2H9GA 1XIWB 4IMLB 4ODBD 3F7YA 3MV8B 5C0DA 5KS9F 5DUBA 3UDWC 3BRGC 2AI0H 2H26B 4FFVD 4PLNC 4JM2F 1CGXA 3SDAC 3W0WE 3LRGA 1KLGA 1W0WA 2CQVA 5IFJA 3OKOA 2HT3C 3PWNA 4NN5C 1ZHKA 5FDWA 3L3KB 3CFKA 5HDBE 2LU3A 4WFGD 1YMHB 4WI7A 5TDOB 1HWHB 1ZSDB 2APXA 4UAOC 2WQ8A 1F6LL 5TF1H 4MD0B 1I8MB 1MSPA 1ZKAA 1IKNA 3LH2L 3BWAB 5EFIB 4L8BA 3RUGF 4LKXB 2BXYA 4P9HC 3OTTA 3ZYIA 4DJMA 5IHZA 4JCLA 5F7YC 3T3ME 1HCFX 5DURD 3BP7B 3LQZA 1IQWL 2UWEF 3ZTNL 2NYYC 3QULA 3P30H 43CAA 4NO5A 2DQJL 2GIYA 2VWEC 4PY8I 3VI4F 5JUEH 2DAVA 3RRQA 3IDNA 3NCBB 3O2VL 4O58L 4LLUB 3NIGE 5E2UH 1U8KA 2BNUB 2AS5M 5FUOH 1AHWC 3WIIL 3FN0H 4L4TA 5DK0B 5GJTH 5FXCH 1BQUA 4OD1L 1XGUB 2XQBH 4B5EA 4HCRA 4GMTL 1ZVYA 4X98B 2FSEA 4HJ0C 4P4KA 1VGEH 1P7QA 2ENYA 3EO1B 2NTFA 5DUBB 5DXWA 3RDTD 1JPTH 3LPFA 2OM5A 4ZUWA 5C7XL 3HB3D 4TVPH 1R3JB 5LCVL 5DYOB 3VFMB 1F3DH 3WFDL 2JJTC 3IJSB 2DI8A 1ZLSH 2X9XA 3MLRH 3S4SB 2EIZB 2HRLA 2KZWA 1ZEAL 4O4YH 3KYAA 2Z8VC 4MAUL 1HINL 2A6KA 2HH0H 3GBMH 4OAWA 3I85A 1AGBA 2H2SD 4OF5A 4JFQB 1YMHA 4Y88A 4MNQB 4X99B 2J8UF 4MQ7B 4UDUB 1ZSDA 3O3UN 1EHAA 4FFVC 5EIIB 2F15A 3ZE1E 2PR4H 2D7TL 1QSEA 1EX0A 5I8EA 5KVDL 3EYOA 4F7PB 5ADPH 1U2HA 4KHXH 4PRHA 5HHQA 3VH8B 5C70A 4X7SH 5JQ6L 3ZSSA 5I75C 2WZPD 3QISA 5GIRA 3N1MC 3RVUC 3JZ7A 5DQJA 5LGJB 2V2WB 4QTHA 1M71B 1R0AL 4QTIH 1JZ3A 4WFHD 3UTSA 4LBEA 4D9LL 1TCMA 2R23B 5JUEL 1KF9B 1QTYT 4JFHE 1U8LA 3QQ9C 4AH2A 1HHHB 1MVUB 3QNYB 1TZGL 5IM7B 2GTZA 1VCAA 3BAEL 3QXAA 1E4WH 5DGQA 3O0RH 1IT9L 2ZKHL 4ONFH 5EZJB 4X6FA 1DE4B 1FVDA 4CVWA 3TZVC 1AO7A 3B3IA 4AIZB 3ULSB 4EKXA 2FH6A 3PWPA 4XNXL 3DX7B 2QHRL 5KVEH 2JJSC 3CVIL 2FR4B 2Z0BA 4KI5D 5EBGA 3UZEA 3EO1A 2VYRE 3GUTA 4XX1G 5C2BL 3AM8A 3CK0L 1D3CA 5IB3B 5FYJE 4NUGH 3QEUA 2EIEA 5AYUL 3K2UL 5I2IB 1K4DB 4MCYA 4XXDB 1BX2A 1X6NA 1GSMA 3VCLB 2ARJB 3CCHB 4NC2B 4PJEB 2GJ6E 5ID1A 1Y0LA 2DJ4A 4I77L 3CH8A 4O02L 1CGTA 5SV4A 5EA0H 3EJZC 4M61B 2HLAB 4G6ML 1QSZA 3MYJB 1QSFE 1A14H 1M7XA 4BA8A 4N9GB 3W9DB 3BZ4B 4MLIA 5E9DA 4FTVE 3M45A 3BGFB 1OAZL 3QHFL 4OCXL 1IGIH 5GRVK 1G0YR 3GSQA 1KSRA 2NW2A 1XGPB 4MXWL 1TMCB 2V2XB 3MLYH 4UNVA 2BNRE 5F1NB 2AQ2A 4NQXA 4RMQA 4Y8DC 4NRXB 4JFFD 1I7ZB 3QG6B 4UDTB 3FCTA 4Y1AD 3U6RB 3G5ZA 4HUUA 3F7QA 2DMKA 4U05A 3MLUL 4KROB 4U1MB 2A1WH 4ZTOH 4GKSB 1U8OA 1JV5A 3R06A 3QT2A 4F7TA 3WXWH 1BLNA 1UXWB 4CMMB 3KYMA 3MLVH 1FFNA 1Q0YL 3U7AA 4I5BA 5DURB 4TUJA 4G8GD 4X4XB 2JB5L 2YWYA 3EO0A 2CDGB 5INCB 2EE3A 1OF2A 4JFED 1MRFL 4TSAL 1YNTB 5HHMB 5FYJH 4JO1H 4HPYL 4JFHD 4GW5B 4U2ZA 2EEAA 1HILB 4KK6D 1AKJB 3V5KA 2YKLL 4ZTPH 1N4XL 1RZJH 1KPVB 2ZSWA 1Z9LA 2JELL 4PJFF 3FB7B 4RAVA 4XNYH 4G43B 4TUOB 4TTGA 3VCLA 5D1ZC 2CKBL 1QBAA 1H15B 5BV7B 2EO1A 3GB7B 2DF3A 2JKXA 3P11H 3W11D 3GO1H 5J11C 3MV9B 4XC1L 2A1WL 1MWAL 4U1KA 4LVEA 2IALB 2M8XA 4P2RA 3RBSA 3F12A 2HWZH 3PWVA 2O5XL 4M7ZC 1CZ8L 3B5GA 3U0WL 2HKFL 3D3VE 3B9DA 2EE6A 3NN8A 4OGAC 2P46B 1P7QB 4U0RC 3JV6A 4OD2A 2AXGA 5CUSH 4WGVB 2YD8A 2VQ1B 3S34H 3RFZC 3LIZH 3AREC 1SEBA 4LPYA 2O5ZL 3U4BH 2ADJA 5I16A 2IAMC 2XWJB 3MA7A 1BIIA 1P5UA 3OHXB 2V2TB 1BZ9A 2BZDA 4NN7B 1J8HE 1C1EH 1FAKT 2NY2C 4GG8B 4Z5RA 1FIEA 4GKSA 1GRWA 5CD5D 4H26A 2NY7H 2VQTA 5SWQA 4GW4B 4Z0XB 1PX3A 3NIDE 4QHNA 1IAKB 1N3NB 1XGYL 1R5IB 2B39A 4JM4H 1JPST 1AGEB 2CRYA 5CWSA 3MJ9H 4MA8H 3FFDB 5KZCD 4ELME 4GG6A 1ZLVK 3JVGA 5I8EB 3TV3L 4X7FC 3QIBB 3TBTA 2HWZL 3NMEA 4N8VA 4PJGE 4J12A 3MUGA 3OR6A 3BX7C 3T3PE 3B6SA 4ORGB 1DFBH 3DX9A 4LARL 2DQEL 2F58H 2YUWA 3C8KB 1NBZB 1AP2B 2PR4L 3PG2A 5HDQH 3QG7L 1UWXK 3QNXB 1OGAA 1Z0NA 4YAQA 4JHWH 3TIDA 4KK9C 3O3EA 4KQ3L 4NNYB 4MD4B 1M05A 2GI7A 5SX4I 2R1XA 1IGJB 4P9MH 3D85B 4F37F 4L8CB 4J4PD 3QIUC 4EUPB 1L6XA 3Q48A 4EI5C 4ZXBB 2H8PA 1Z9MA 4LP5A 1MCOH 2ATPB 5HGHA 4G3YH 3VFVB 4FXKB 1X5GA 1MHCB 1O7VA 1V3LA 2D4DA 4KROC 4IOIA 1D6EA 5F21B 5J4MA 1KT2B 3V79C 5IHLB 3SE8H 2J4WH 5IJKA 3KPQA 5CSBA 2PCPA 3QUYB 1T5XB 2Z8WC 3LKPA 1E6OL 4HLZG 3EOYG 15C8H 5KN5A 4NZTH 4WTXA 3U36A 3D87B 5E1HB 5L9DH 4S10A 3L5HA 5FGBC 3KVQA 1QFHA 2FJHA 5GPRA 5FGCE 2HJKB 1A3LH 3TVMC 4NKIL 3DO7A 4P3CL 3PGDA 4GLRH 1AJ7L 5HHPA 3H42H 2IBGA 4DK6A 3CGTA 3KAAA 4NM8L 4JPVL 1IGYB 2C1OA 1S9XA 4C4KT 5MHSD 4G9DA 2N7BA 4M93C 3V4UL 4MJ6B 3D9AL 5J3HC 5BZDA 2OJEA 2XA3A 4DN3L 1W0YT 3WN5A 2Z9TA 3O11A 4BH7B 5KSBA 4J3XA 1B2WH 3HUJB 5AEAA 5J12B 2WUCH 3FCTB 4PJAA 4U1JB 4YDVB 1A4KA 4M5YL 4Y2DB 5DTFB 4KJQD 3RA7L 4IRJD 4DZ8B 5EG6C 5DA0B 1CQYA 2V2XA 4YDJA 3G5VA 4L1HA 1QFWI 5K9JH 1X5XA 4QHUB 2ZUQB 4X9FA 3G5XA 3RWDA 3OB8A 3KJ4C 4YX2H 3RWEB 1AE6H 4JRYB 1TVBA 1IAOB 3MBXL 4XB7A 1FFNB 4OLYL 5IESL 3KPMB 2XTJC 3QFDB 1GC1H 3FO2A 1CE6A 3LEYH 5HVWA 4Q9CA 4JRYE 1L7IL 3CX5K 5CZXD 5DJ8B 3MLUH 2J4WL 1OAXL 1A1MB 4BQ6A 2EDNA 3TNNA 4EI5A 3SO5A 4H8WH 5DJCB 3BD4A 3D2UD 3OXRA 2G75B 5GRUL 4M7LL 4JKPH 4NJAL 3PWJA 4ZS6C 3WEXB 5HPMA 1JCKA 5C6TL 4OIIH 4GW5A 8FABB 3CH1A 2NNAB 3LKOA 1HI6A 2QADD 3HI6L 1LEGA 4FQQA 1E28B 1KXTB 4Y4KB 2CGRL 1PG7X 2XZAL 2DM4A 1MJJB 5DVMA 4ZSOB 3ZHLA 5FHBH 1C12B 2UWEE 5KANG 3F12B 2XZZA 4YHIB 3HAEH 3ULUD 3IDIB 2XY2A 4JFXA 5DRZA 1MQ8A 1EAPB 3FMGL 1G9NC 3UYPA 5FKAB 1D5IH 1JN6A 4R0LB 3T09A 2OTWB 1G7HA 4NOFA 1U8MB 4JVPA 4Z7UE 3FO9A 5DHVB 3MXVL 4DTGH 2AVGA 5IMKB 3BDYL 3F58H 3I6KB 3U79A 4K2UL 4W68A 2AV1A 2VC2H 3GEWB 4HD9A 2RBLA 2OSLB 1I1AA 5JA9A 3AUVA 2DQTH 2VLJB 5E5RB 4JRXE 3DGCR 3KPMA 4M43L 5E24E 2AJUH 1FNEB 3SBWC 1H8OA 4ONFL 2BSRA 1RZIB 2G60H 4YWGH 3VFNA 5I30H 1G7QB 2XZAH 2AEPH 5T1KA 5T3XE 2VUOA 4PRHE 2DLHA 4YQXL 3T0VA 1Z9OA 3KPRA 1KXQE 2CDFB 4YHNA 4PGEA 2OL3A 3QAZB 4LLQB 4D8PB 1B0RB 1DBKH 3SPVA 2ZPKH 1X5AA 3PQYE 2YMXH 4ELKA 5I1DA 12E8H 4MNHB 3LZFL 4AMKH 4F8QA 3MLYL 4QLRA 1NUGA 2XPGA 1O7SA 2IADB 4HK0A 5LGJA 1DN0B 2XYCA 2ICWJ 1S7SB 3HR6A 1NCAH 1YYMH 2IH3B 3AS2A 2Q76A 4U1LB 3CFJB 5E8NA 2Z4QA 4Z7WE 3MZTA 2X41A 4MXQC 5HDQL 1WIOA 2F58L 3QJHB 4RGNE 2C4FT 1PKQA 1NMBL 4LF3B 1CXLA 5IVXF 5SX4H 3MRCB 4FNLH 4KK5D 4WFGE 1KN4H 2E7BA 5ESAB 3WIIH 4TSAH 5C0NC 4F7TB 2OTWA 3OKDA 2FX8H 5ITBH 3NFNA 4UIKL 1M7IA 3NIFE 4AIXA 2H45A 1F4WL 5F9JB 3LPWA 2BSED 1FNSH 3MLTA 1YEJH 3ZL4L 1UM6L 3HPLB 1I1AB 4U31A 2W0FB 3RWGB 2DLEA 3WDIA 2B8OT 1T0NB 4XMLH 5AWNL 3RY4A 2R0LL 2I25N 4I1NB 1MREL 3OKNB 2OR8A 1A0QH 4G8GA 4PJEE 5DJAB 1K85A 1AGBB 3LHPL 3WFEL 2PKDA 3O6FB 4E9LA 1B0RA 1PX4A 4BJLA 4XNZB 1FZJA 2HG5B 1TVHA 3WS6A 4Y1AE 1UYWH 1IEAA 1TENA 5GRJH 5D70L 5I1GH 1AD9B 2Z93A 3ULUL 1VGKB 2E7CA 2AJVH 1FGNH 2VZUA 4FNLL 4P5TA 5DQDL 3RVWD 3MCKB 5KVFH 3ZYZA 4OIAA 1MOEA 1S9XB 3FL7A 4Q58C 4HV8A 1CFTB 1T2QL 1M71A 2AK1H 3GBLA 1CS6A 5IEKB 5E6IA 5AG9A 4QKXB 5E8OB 1LHZA 5DFTA 4ODVH 4XNYL 1QSFB 3AB0C 5ERWB 2XXCB 1R3HB 3QEQB 4PJ7E 1JVKA 5CIPA 3VXRE 1P4IH 5CD3B 4HUXA 1AHWB 3UTOA 2LAAA 5IBUB 1RZ8A 5MENE 3OHXA 3EDDA 3WHXB 2VO5A 3T65A 4C57C 2WUCL 4PGBB 4A6YL 3LHPH 4OKDA 2VLME 4V1DE 2AI0L 3RX7A 3P73B 4MVBD 3LS5H 4UU9B 4P99A 4RGMC 4X4YA 5JHLL 3DLQR 2G5RA 4L4VD 5T3ZE 1NFIB 2OMNA 4EUPH 3ZKSD 3QDGA 3X14A 4NHCH 1BBDH 3NIFF 3ZLQC 3O4OC 2YPKB 4NRYB 3O6KH 1MHHB 2HFEB 5FCUH 5BV7H 4NWTL 3VWJB 5FIEA 1E4XL 4P4RB 3NAAL 3KPRE 3T0BA 3EOBB 5I73B 3MZGB 8FABA 3VWKC 3MNVA 5J7CC 5IMMB 3FT2A 2FJFB 4OIIL 1KB9K 1N5YH 2X40A 1TITA 4JM2C 4OFYD 1UH2A 3A6CL 1T5WA 3B83A 4KQ4L 3MLPA 3UXFA 3AGVA 3LKSB 3WNMA 1CR9L 3BHBA 4X80H 4BK4A 3VFRA 4R7DA 1AXTL 1PG7H 4LVOB 4X9HA 2X44D 5I1IH 4HJGB 2YSSB 3EHBC 3WS6C 3EYQC 2R69H 3R1GH 3MLSL 4LARH 4OD3L 2IPUK 1F3JB 1QZ1A 2ITCA 3FQUB 3WUWB 1CN4A 3TN0D 3WIHL 4IRSD 5B4MD 3S36H 3SDXF 1F8TH 2DI7A 3VXSE 2HN7A 2GSGB 4MA8L 4OV5B 1JIBA 3CMOL 4IRSB 2EXWD 2EXWC 4LCCB 5TFSH 3L3JB 5AZ2H 3T65B 3BH9B 5C0AE 1LQSR 4P59H 4TSCH 4CDGC 5FCUL 2ZCLL 4NN6B 1EEYA 1UH3A 4KK8C 4ODXA 1OP9A 1NGZB 4JREC 4APQA 1T1ZA 3FO0H 2W91A 3SPVB 3TJEH 3ME0A 2V5TA 4N0RA 5GHWL 3TP4A 4AEFA 1EGJH 2DKMA 4CVUA 1KYOK 1TJIL 1WBXA 2MJWA 2DQTL 1F58H 2V5SA 2OQJA 4KJPD 1G6RA 2YKLH 1A64A 3VH8A 1XAUA 4MJ5B 1INQB 5B39G 1L9NA 1Z5LA 1BVLB 3EO9H 1FORH 1ULVA 2XQYG 2VIRA 4WI5A 3OB0K 2XWBA 5E6ID 2J8OA 4HC1H 1I3GH 1B0GA 3L5JA 5L9DL 5FM4A 5E70A 5SV3A 4HS6A 1YDPA 4ZQKB 2DQCH 3CLFL 5IB1A 4NOBA 1GPOL 1YEDB 2G5BB 4Q9RH 1WC7B 4RZCA 5C9JB 5EUKA 1F4XH 3R0MA 3OPZL 4UTBL 4PRIE 3W0WB 4M1GL 4J3SA 2FBJH 1P4LA 2XTJB 2XN9A 4UQ3B 5CKAA 3ARBC 1QRNB 3LKNB 4PUBH 5D8JH 2ZUUA 2P24A 3DARA 4ZO6A 3UZQA 4GG6F 4PJIA 2ZCLH 5EWIH 3QFDA 5D1ZB 1U42A 5HVHB 1CE6B 3SGDH 3CDGA 3RGVB 2W9EL 3I6LD 5CJOL 3V95A 3TIEA 1MFCH 2HJFB 5AAWA 3FB5A 1KIQA 1DQQB 5GS1A 5D93B 3ARFC 1FYTA 2X5PA 5CFHA 4QOKD 5JPMA 1A0QL 4NHUB 4EVNB 1NUFA 3X11B 1KNOB 5I1JL 3CH1B 4QHKJ 5HGDA 5IK3A 3ZE2F 4MCZA 1MLBB 2WNGA 1U95B 4IRSC 1A22B 3HCVA 1EH9A 3V6ZB 3P4MB 4JKWA 1OQOA 3QDGE 1T04A 5D7IE 5DJAA 2AJVL 1SM3H 4C83B 4D0BB 5TQ2H 1KJ2L 3WFHB 4Q9QH 4XMKH 2RFXA 4PY7B 2UWEB 3QI9A 1A6VL 3VXUA 1UKSA 4HWBA 3S37X 5BRZB 3E0GA 4UAOB 4OGAD 2OXHA 5DK0A 3P30L 1P9MA 2X4SA 1J1PH 2X9WA 4M03A 4GXUM 2APWA 4P3WA 2VDQL 3O9WD 5GGRA 5CEZE 2R2HB 3DX8A 4FG6C 1EFXA 3HI5H 1M05B 4YDLB 1HKLL 1OW0A 3BKCL 4Y5VB 4LVOC 5DR5H 5EC1B 4RFOL 4XP4L 3QYCA 2F5AH 2R2CA 1G7LB 2UUDH 2QSVA 4HBCH 1R3JA 4OGYH 2XV6B 5EOQH 5F9OL 2FGZA 2F5BH 4RMSA 4D0DB 1E27B 1NCBL 3KYNB 4E42A 4NO0D 3QIBD 1BZQK 1RY7B 3KPOA 1A6ZA 1FGVH 1NFDB 1T03H 3EO0B 5CJOH 3SDXA 3VXSA 2FZ3B 4FQIH 2KQMA 3RL1A 4AG4H 4RCAA 5C09A 1R3LA 2AK4A 4R97B 4F58L 1MIEL 1QFOA 1TIUA 4LK4A 2WW8A 5H8DA 2LE9A 5KSAD 3BXNB 1RUAL 1I85C 2FD6L 1NCTA 4Y7MA 1HDMB 3I3BA 1HXYA 5DC0A 4OI9A 3QUXB 1CLOH 5LWYL 1JMXA 1NJ9B 4K3JL 3HNSL 3MR9B 3HAEB 4GS7B 1KCSH 4X6DF 3WNOA 3RZCB 1XGQB 3EFDH 3GJFB 2FHCA 3T0EA 1L9MA 3PDGA 3QO0B 4FFWC 4IBLT 4GRMB 3LQAH 4PY7A 1NCDL 2AGJH 3QAZC 1L7TH 1OGTA 2BNQB 3L95B 4LFHD 4RFEA 4JG1H 1PZ5B 2RIKA 4JY4B 2R1YB 2CR6A 2FSEB 1XGTA 3SY0B 1QA9A 3O3BA 4X6CB 3QR2A 5BXFB 3L3DA 1N5AA 2IANA 1K3ZA 1AD0B 3LMJH 3VXTA 1PY4A 4QXUH 1H5BB 5DVNA 2FYYB 3KPSD 1GVIA 1U92B 1CG9A 4PG2A 2CXKA 1AE6L 5EBMA 5FUZH 1REIA 4YXKH 3L5IA 2RQ8A 4XP6H 1QOKA 1F8TL 2VLRE 4R8WH 3V4VH 1QYGH 3QPQC 3EYFB 4D9QD 4PREB 2H1PL 1Y0LB 3MV01 3CAFA 5ANMA 4IJ3C 4JGJA 1D5ZA 4LNVA 3MLWL 1TJHL 4ZFOL 2H3NA 4ONGL 2W60B 3MV7E 1YEEL 4YNYB 4L4VA 4HKZB 1RIVL 2ICCA 3MUJA 3LIZL 1YMMB 4OJFH 3SGJC 2QSQA 4XBEH 1LEIB 2CSPA 5FOJA 2P42B 4YXHL