4WUVA

Crystal structure of a putative d-mannonate oxidoreductase from haemophilus influenza (avi_5165, target efi-513796) with bound nad
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
280
structure length
280
Chain Sequence
NIAANHNLENKLIIITGAGGVLCSFLAKQLAYTKANIALLDLNFEAADKVAKEINQSGGKAKAYKTNVLELENIKEVRNQIETDFGTCDILINGAGGNNPKATTDNEFHQFDLNETTRTFFDLDKSGIEFVFNLNYLGSLLPTQVFAKDMLGKQGANIINISSMNAFTPLTKIPAYSGAKAAISNFTQWLAVYFSKVGIRCNAIAPGFLVSNQNLALLFDTEGKPTDRANKILTNTPMGRFGESEELLGALLFLIDENYSAFVNGVVLPVDGGFSAYSGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative D-Mannonate oxidoreductase from Haemophilus influenza (Avi_5165, TARGET EFI-513796) with bound NAD
rcsb
source organism Haemophilus influenzae rdaw
molecule tags Oxidoreductase
molecule keywords 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase
total genus 90
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wuvA00
3HN7A 3LQFA 1VL8A 4E31A 4E13A 1XYGA 1P9LA 1DRVA 5CEJA 4OSOA 3QVOA 4Z0PA 4S3MA 1NQAO 1LRKA 2YQ5A 2GSDA 2O7SA 4U5QA 4OHUA 5EPOA 1UXHA 3VC7A 4YJHA 2Z1NA 4DBVO 3JQAA 4Z9YA 1UZLA 2ZYAA 4IY1A 4JROA 3ANNA 3Q0EA 4CQMB 5JW6A 1ADGA 3H3FA 1ONNA 1JWBB 3PDJA 1QORA 3COSA 2DAPA 4BNXA 2IZ0A 4IDGA 2EIHA 4E12A 3N58A 1AXGA 2YJZA 2FP4A 4PLVA 4IMRA 3RFTA 5KJ6A 1U4OA 3LT0A 4CV3A 3GZNB 4FC6A 3N74A 4URFA 5JC8A 3JQ8B 5CFZA 3G1TA 4FJ0A 2IXBA 3WJ7A 4R41A 5JXWA 2X9VA 3WTBA 4CM3A 2BKAA 3GA0A 4DMMA 5T64A 1KVSA 2BGMA 3ASUA 4D44A 1HDGO 1PX0A 5AXAA 3H5NA 4YJFA 3AOEA 3BMOA 3RUHA 1DC5A 1E3IA 1I32A 2UVDA 4KMSA 3VVBA 3GEDA 1NM5A 2CSUA 3DO5A 1H6DA 4AJIA 5GY7A 2O3UA 4YAIA 4TROA 2UYYA 3NKLA 1TVEA 3Q1LA 3DONA 3ZV3A 1VL6A 3E5RA 1YB4A 5KJCA 4BQPA 2DU8A 1U1IA 3AJRA 1WDLA 3D4NA 2V6GA 1MXHA 1EUZA 3OM9A 4AJJA 4EZBA 4OKNA 2NNLD 4K1LA 4KQXA 3Q3CA 2Q2QA 2X0IA 4WASA 1M6HA 1NR7A 1YL7A 3I6QA 3I9OA 4J43A 5ICSA 4QO7A 5LDGA 5T6BA 3H6KA 1DFIA 4F46A 4AJKA 3PI7A 3PLNA 2WD8A 5FFFA 1A7AA 2Y93A 3BZUA 2PKRA 3I23A 5F1OA 5A9SB 1ZK2A 2WWRA 3ZWWA 4H3VA 1RYDA 4NJMA 4YAJA 4EUFA 1T2DA 5IZCA 1KEVA 3QJ5A 4FJ2A 1KOLA 2NACA 4NMHA 1M66A 5L53A 1ZK3A 4QUKA 2Q1SA 4DUPA 2DM6A 2FPIA 3ZZNA 4GX2A 2Q49A 1NXQA 3ZHYA 4WGGA 2VYVD 1GL3A 3B70A 3DMYA 3Q6IA 2YHUA 1HETA 1KVUA 2O3JA 3ABIA 3L4BA 3KO8A 4N7RA 3TL2A 3GH3A 4GKBA 3WOHA 3O9ZA 1ADBA 3CE6A 1E3JA 3GEMA 3PJEA 3ZNQA 2CF5A 4K9DA 1BSVA 2XF8A 1V35A 1LQUA 4CLEA 1IZ9A 3RIHA 2H1SA 3AU9A 4R1NA 3FTNA 3B6ZA 4DIFA 1IHXA 3RUFA 1QYDA 3QQPA 4J9VA 4KDFA 4OQZA 3GF4A 3X2FA 5F1KA 3ZV6A 2WMDA 1LRLA 4XIJA 3W8FA 3HJAA 1XKQA 4D45A 1IL0A 2CDCA 3DAFA 4L73A 4ZVVA 3DZGA 3E5MA 3NDJA 3V1YA 2C7VA 1CQIA 1DC3A 1EK6A 5IN5A 2BGLA 3WG9A 3JQ9A 1Y5MA 2WYWA 4JXKA 2J5QA 1LUAA 3VTFA 3LT1A 1XEAA 4JLWA 1QMGA 2WSBA 3NX4A 3DZHA 4B3JA 5JMPA 2E37A 2P5YA 1PJ4A 2UUOA 3DHYA 4TKMA 1EFKA 5FF9A 1IUKA 4PRKA 2J3IA 2EJVA 1SAYA 4NU5A 3TF5A 4RPGA 2EKQA 3WXBA 3E48A 1H0KA 4AVYA 1JU9A 1TXGA 3K6JA 3QIVA 3A14A 3OBBA 6ADHA 2ZKLA 1IHYA 4CQMD 4PG7A 1AUPA 1I5RA 5ITWA 1ML3A 1D1TA 4IMPA 1T2CA 3U49A 4DL9A 1R15A 1T2FA 5JYEA 1P1HA 1UP7A 3H4VA 5A5FA 2YUTA 1SNYA 1QSGA 2I67A 7MDHA 4IZHA 3GEGA 4UVGA 1R37A 3ZWYA 3W6UA 3WQQA 1B8PA 3WYBA 4HXYA 4FGSA 3I52A 1Y8QA 2OOSA 3DBLA 2Q50A 3EC7A 4RDHA 5CDYA 1GDHA 3KB6A 5ILGA 1V9LA 4JN6B 1XCBA 3D1LA 4WNIA 3MJ4A 4IS3A 3MJTA 4LMPA 4Z3KA 1MLDA 1DBVO 3BXXA 2VTDA 1BXGB 1ZVMA 3B1FA 4JBGA 4HFNA 4GSLA 1SPXA 2IEDA 5BSEA 5KNLA 4J2OA 4WCFC 3DMTA 3L6EA 3ROQA 4DTIA 3ONEA 1BWSA 1GUZA 2BFAA 4EUEA 3P2YA 3QWHA 1PS9A 5G2OA 1GR0A 1VI2A 2YDXA 5F5NA 5ENDA 4DGSA 4Y98A 5TT0A 3P2OA 1E5QA 2Q2WA 1XU7A 2EXXA 5TS3A 4M49A 4QX6A 4W6ZA 1A7KA 4ALIA 3GLQA 1ENYA 1C0IA 3L4BC 5AQ1A 3P19A 4BGEA 2G0TA 1M2WA 1NPDA 1WAMA 2R00C 3U4CA 3W4KA 3AFNA 5K0ZA 2X6TA 5JLAA 1FDUA 4GKVA 1I01A 1U2GA 3NGXA 2HUNA 3JD1A 2HJRA 3SLGA 4CPDA 4ZGWA 1N92A 4M87A 4MKRA 1B16A 3PXXA 2EGGA 2JAHA 1GFSA 2VZ0A 1X7DA 4TWRA 5K6AC 1J49A 4BNHA 1NNUA 4LISA 1E0DA 4B7CA 4GX1A 1T1RA 2OL4A 1KC1A 2B4QA 4J90A 4K6CA 2R00A 3UAGA 1SB8A 1HE2A 5AXCA 5DOZA 5I9MA 1SCUA 4XJSA 5F5LA 1Q1NA 3BMNB 3WMXA 3IKVA 2C54A 3JD3A 3PHHA 4R1TA 3HDYA 1DEHA 1NFQA 1E3SA 4J91A 3QP9A 1C0LA 2GLXA 5KVQA 3T7CA 3WYEA 1EDZA 1YQGA 3U4DA 2P2SA 4AL4A 2VN8A 1DPGA 1UXGA 3AM5A 4FW8A 1EVZA 4O6VA 4Z9XA 2ZB4A 1ZKMA 4GX0A 1U8XX 1T2AA 1X1TA 1M76A 2OP0A 2VRCD 4NQZA 4GX5A 3PWSA 4R5HA 4KTTE 3GVCA 3GQVA 3ZWXA 4CM8B 4GSKA 3DBRA 3ZWAA 2TMDA 4P38A 2JCVA 4LVCA 3KYDB 3PQFA 4J1QA 4BO4A 1P1IA 2RHCA 3DFZA 1N2SA 2EERA 1AHIA 4XYBA 4GMGA 1E6WA 4MIOA 1L7EA 4N54A 1YRLA 3DOOA 3QVTA 3QY9A 4GAEA 4OGWA 3ZN2A 3L6DA 3R1IA 3VPXA 5IZ4A 2O3SA 4MKXA 3WQSB 4TMFA 5ADHA 4DWVA 1JWAB 1ENOA 4E3ZA 3FWZA 4Y8VA 1E7QA 4OAQA 9LDTA 1JQBA 1VJ0A 4E0BA 1DC6A 1K89A 4XR4A 4B79A 1X0VA 1CEQA 1JAXA 2FY8A 2YW9A 3AW9A 3JQ7A 3O4RA 3TZQA 1YB5A 4BKUA 3IP3A 4CL8A 4U0KA 1P1FA 5AXBA 2EKPA 3OJ0A 1Z73A 4MOWA 3K9QO 1EDOA 4TQGA 2PGDA 1HLPA 1E3WA 4B4WA 4RF2A 1KVRA 3X2EA 3VOSA 3VPGA 1O89A 2EGHA 3JQAD 1V0JA 4XGNA 4UVDA 1NAIA 2EKLA 3K30A 1PJSA 1K0UA 2PV7A 4NBVA 1GCUA 3HG7A 2VCYA 3ITDA 4RPKA 1HDRA 5TLSA 3ROMA 5K6AA 5CG1A 1HRDA 4IIUA 1DFGA 2BD0A 3QVSA 4BMVA 2IZ1A 5A03A 3NUGA 1T4DA 3AY3A 2DBQA 1P74A 4BS9A 5G0UA 2V6FA 5FEUA 4OYRA 4XCVA 5EESA 5HS6A 1IE3A 3WICA 1B8UA 2P9GA 4EITA 4AJPA 3FNFA 4JX8A 5IZCC 1LLCA 3BTUA 4J7CA 5TSDA 1Q2XA 3F4LA 1PJLA 3DBRB 2NU6A 1WW8A 4QECA 4QSMA 4ESOA 1W0CA 2YQ4A 3R3SA 1L7DA 4GVLA 2OGUA 1JKFA 1N7GA 4R3NA 3QRWA 1NQOA 3WWYA 3EK2A 3GPDG 2CDAA 3JYQA 2PTGA 3HUDA 4AJ4A 2QHXA 5ER6A 2Q3EA 4CQMA 5IG2A 3BTVA 1A4IA 5CP8A 2FN7A 5JY6A 2FZWA 2WD7A 5A04A 1SZJG 4ZQHA 3NDIA 5A3VA 1H9AA 2Q1UA 4NIMA 5B1YA 2HRZA 3GNSA 2P68A 3GY0A 3K96A 3ZWVA 3UKOA 1F14A 1OBFO 3LF2A 3M2TA 3KYDA 1Q7GA 1G1AA 4HKTA 3WLEA 4ZRNA 1KC3A 1XLTA 1DB3A 3IP1A 3VDQA 5T57A 3ONFA 3V1UA 3L07A 4YRAA 2D1YA 3IUSA 4JBIA 2HU2A 2I3AA 4RO0A 4CM4A 1GYPA 1QYVA 2BMAA 4BMNA 4HADA 2IXAA 1SEVA 3S2EA 4HNHA 3DHEA 4FD3A 1V6AA 1LX6A 2DQ4A 3HZZA 3M6IA 1ZK1A 4D0RA 4CODB 2DTDA 2Y0CA 3G0OA 3IQDB 5JS6A 1U5AA 4BNJA 2VHZA 3GN2A 2PGLA 3GK3A 1WXDA 5A06A 3RKUA 2AMFA 4Z9FA 1IPFA 4W7IA 2VWHA 1P0FA 4E32A 2UUPA 4LRSB 3WBBA 3WGIA 2ZTVA 2AG5A 1Y8QB 3DBLB 3KSUA 4LN1A 4RVFA 1SC6A 4ONEA 2NTJA 1UH5A 2A94A 3V2HA 1PGQA 1Z7EA 4XGIA 1ADFA 1GPDG 1ZK0A 4YR9A 4NJMB 3B1KA 2BRUA 2X8LA 4DIOA 3LT2A 4H7PA 5G4LA 3DTTA 2B5VA 3GN1A 2WTBA 2NVUB 1WMBA 2VOEA 1F0YA 3RJ5A 5F3RA 2FSSA 3GAFA 1ZK4A 4JJGA 4WUVA 4BB6A 4RPLA 4II2A 3WLFA 1JA9A 5DT9A 4P4GA 2Y67A 5ES3A 2ET6A 2VHVA 1HT0A 2V7PA 3D64A 4FFLA 1M75A 4GGOA 2W2LD 4L74A 1JVBA 2H63A 2I5PO 3OJLA 4RPHA 4U6QA 1DHTA 4BNKA 4EBFA 3ICCA 4DIBA 5TNXA 3V8BA 4L76A 2D3TA 2VT2A 4CM4B 1BHSA 4XGKA 3SC6A 2Y66A 2QZ9A 3KM0A 4IJKA 4ZRMA 5C3MA 5JAQA 1EVJA 3GRPA 4BMSA 4I08A 3G3EA 4YJDA 5ICMA 4NI5A 2B5WA 2D0IA 4N18A 1ISFA 3FI9A 4K6FA 3DZKA 3WSVA 2X7HA 4HFJA 4CJXA 5L4SA 4CMKA 2PNFA 3BHMA 1LSSA 2G76A 2PR2A 1DAPA 3ZU2A 3TSCA 2VZ8A 5JY1A 1QKIA 4DLLA 1LTHR 1PS0A 2X0JA 2DKNA 1E1LA 3PRJA 4Q3EA 4Z0HO 3UCEA 3GNQA 4XQ9A 3FCOA 1U28A 3BMCA 5IAAA 1U8FO 1DFHA 2EWMA 4U6SA 1E7RA 3BTSA 2FZEA 2YZ7A 2TMGA 4ID9A 3LK7A 2E4AA 1HL3A 2XAAA 2SCUA 3G17A 5HM8A 1QLHA 1H6BA 4W82A 2JCYA 1FDTA 3OSUA 1QP8A 4P4LA 4CLDA 1PTJA 4O5OA 3KYCA 3R6DA 3H9GA 3QV1A 4J49A 2GRAA 3FPLA 3U62A 1ZZEA 3ANMA 3MEQA 4EJ6A 2W98A 2JHGA 3L9WA 3TN7A 1NP3A 3PHIA 2ZYGA 5JO9A 1I0ZA 2EW2A 5JYDA 3HFGA 2I99A 4E5MA 3W6ZA 1VLLA 4B4VA 3QW2A 4KTVE 2EEZA 3RUAA 4JIGA 1HYGA 3OECA 1R0KA 5CPFA 3WS7A 4WLOA 4RV9A 4XD2A 5T8KC 1AN9A 5IDQA 1U9JA 1P1RA 4ND3A 5EMHA 2NTNA 4QXMA 2PK3A 1O6ZA 4B8ZA 1AXEA 4D43A 1SBYA 2QYSA 4AJNA 5IXSA 5DBGA 4NBUA 3M2PA 3ORFA 3JQ8A 1HE4A 5EJ2A 4XDZA 3DR3A 3I4FA 1HSOA 1JW9B 4ZQBA 4A03A 4NFYA 2B0JA 1XQ1A 4BNVA 2X9GA 4CM9D 2JAPA 1QLJA 3VKUA 1NQ5A 1Y6JA 3OETA 4YJFB 4LW8A 1PGNA 3AI1A 4BL5A 1E3WB 4Q3BA 5BSHA 4YJGA 1YQXA 2R6JA 1K6IA 1DIHA 4RVUA 3C1TA 3E9NA 4EGFA 2BFMA 1PZEA 3RFVA 2V6BA 1KBZA 4J4BA 4ND5A 5DBFA 3CZMA 4XKJA 1K3TA 2G5CA 1SMKA 1Q7BA 2VHXA 2D2IA 2VUTA 4B3IA 3AOGA 1X7HA 4YAGA 1KIFA 3QWBA 1LDGA 4FSHA 4WLEA 4Q3DA 4MVJE 4OO3A 5F21A 5BSGA 1BMDA 3AM4A 3TDKA 1T4BA 1OC4A 3AUUA 4DRYA 2DBVO 4M89A 1EQ2A 5EQDA 2C0CA 3ITKA 5U9CA 2NSDA 3BIOA 2Y1EA 3H2ZA 3SEFA 4AFNA 3KEOA 2OUIA 2Y99A 3FF4A 3AWDA 1XU9A 5DF1A 3HE3A 4XQGA 3T4XA 4YBZA 2ZK7A 1LRJA 1B14A 3FTPA 3UHAA 3HN2A 1HYEA 4MP6A 3DHNA 1BXGA 5KKCA 3F5SA 4BO0A 2C29D 3EMKA 1E1MA 1NBOA 4PLHA 3VH4A 2HDHA 1NWCA 3CPSA 3D5QA 3HDQA 1RWBA 4GLLA 9LDBA 3IC5A 4NDNE 4UVHA 3RC7A 2O23A 5FYDA 3SBOA 1HE3A 4DPLA 2BELA 4R4JA 1N7HA 1GEGA 4FGWA 2FR1A 3PJDA 4UVEA 4BGUA 3WYCA 3C24A 1DIBA 4LVUA 4Q3NA 3HB4X 5CDSA 1E6EA 1C1XA 1HLDA 2AA3A 3TWOA 1FF9A 3PWZA 4RLSA 3K92A 5JDCA 3MZ0A 1G0OA 1BXZA 5CG2A 1VM6A 2OZPA 4RVDA 4BO7A 3U4IA 5CDUA 2P5UA 1SB9A 1P1KA 1T2EA 3AI3A 4MPDA 3QVWA 2AQHA 4ITUA 3RU7A 2DFVA 1LDEA 1ZSYA 2RH4A 5BNIA 1HF3A 1HKUA 3ENKA 3VZPA 3OJEA 3PGJA 1X7GA 3WB9A 5T67A 4UEKA 1U3VA 1JLLA 4UVIA 4WNCA 1DLJA 4FFOA 5IDXA 3GR6A 3OICA 4BO1A 2X5OA 5DCYA 1ARZA 3D4OA 3INTA 1GZ6A 2PKQP 1YWGO 2O7QA 5JDIC 4ALLA 2OHXA 1YO6A 1PJBA 4RPJA 4QFCA 4U8GA 3G49A 2W2KB 3WGHA 1OZAA 4CMEA 4L8VA 3ON5A 4UEJA 2QRKA 1I2BA 4R01A 5I9LA 4M86A 4IDDA 3ADPA 3JQBA 4OXYA 1VJTA 3ZWCA 1X1EA 3GVPA 3PYXA 3DQPA 4H16A 5BR7A 3O03A 4R1SA 4D0SA 1P45A 3Q11A 2XOXA 4B7UA 2YV3A 2AQKA 3IJRA 4Z6KA 4NH4A 3WIDA 1B7GO 4RL6A 1ENPA 5H81A 2GPTA 1RPNA 4WLNA 4DPMA 2DPGA 3ZW9A 4JP2A 5A05A 1HYHA 4WOKA 3VTZA 4EUHA 3PPIA 1TEHA 1LC3A 1ZO8A 2O4CA 1VC2A 4QT0A 1YBMA 2DUWA 4OSPA 1C1XB 1LI4A 3D3WB 4CLOB 4BO8A 1SEPA 2GERA 3DC2A 3F1KA 1V3VA 4L4XA 5BSFA 4E4YA 3GMSA 4YDRA 1TA4A 2IYPA 1ULSA 1CQJA 1UP6A 2B69A 3RBZA 3STHA 5JAIA 1ZXLA 1CDOA 1KETA 3PWKA 4WECA 2X1HA 5AOVA 4Y6RA 1PJQA 3JQEA 3D5TA 1ZFNA 3GGOA 1XDWA 2XXJA 4WOJA 2CD9A 4YCAA 1U4SA 3OHSX 3WGOA 1NFFA 1LBEA 1T26A 2WD7B 2FR0A 3UFXA 4AG3A 3JD4A 3LZ6A 2POQX 1QV6A 3OIGA 4HNGA 2IE0A 3KZVA 6LDHA 4MVJA 4XWYA 3OJOA 1MV8A 1NHGA 4KUEA 4OIMA 4PLCA 3LC1O 2HK8A 2ZJ1A 1Y9AA 2P91A 2NQTA 3NTRA 2ZB8A 4JNKA 2CFCA 2AQIA 3LSYA 4B7XA 3Q2KA 2B36A 4FDAA 4J4HA 4XX0A 1VPDA 4TRJA 1KERA 5KJFA 2AEJA 2EP7A 3OA2A 4KUHA 2VHWA 1R16A 3QHAA 4PN3A 1BVRA 1S6YA 1HWYA 3TJRA 3NDRA 4B4OA 3W8EA 4B8WA 2GCGA 2VOJA 4RZHA 3G1UA 1QV7A 1U3WA 3UF0A 2A92A 3MCVA 4YEDA 1RKXA 3WMWA 1LC0A 4UUNA 1GEEA 5CHEA 3FSRA 2AW5A 3INRA 4RVSA 2J5RA 4RVHA 3H9QA 4YT8A 1ISJA 5I8WA 3NTOA 4A26A 5LCXA 1BG6A 4XYMA 1N9GA 5L7YA 4CLRB 4WJZA 4Y67A 2PFGA 1F8FA 4A10A 3RC2A 4DVJA 3RU9A 5IN4A 2H6EA 3LVFO 4IDFA 4DBZA 5CAEA 3L6OO 3PYMA 2VWPA 3PJFA 3UVEA 4UULA 4HX5A 4C4OA 2VQ3A 1T25A 1J0XO 3DOCA 1HZJA 3L0DA 2B4RO 2O2YA 1KEWA 3IAHA 4JGBA 1O0SA 1ZIDA 3ETDA 3U09A 4PLTA 5TJ9A 1LU9A 5JFOA 4J2HA 4NBTA 4CMCA 3MWDB 3E18A 4YQYA 1N1GA 1T1SA 4OOEA 5G0WA 4A5OA 4HWKA 3WGYA 1YH3A 1YGYA 1QR6A 4FR5A 1NQTA 3OF2A 4IQGA 1LSJA 4RGBA 1UDBA 4HFMA 1FMCA 5F1PA 2Q1TA 2J8ZA 1GUYA 5LC1A 5L9AA 1DJNA 4FFRA 3ONDA 2C7GA 3CMMA 3IJPA 4XEHA 2NVBA 1I3KA 2BFOA 2QIOA 4D3SA 3JYNA 2RH8A 3CEAA 4Q9NA 4ZQFA 5JNLA 3JYPA 4FC7A 4FQ8A 4CL3A 1YJ8A 1PZFA 4ZA2A 4MIEA 3WTCA 3OH8A 1PGPA 4G81A 4R9RA 1P0CA 3CINA 5TT1A 3S2IA 1NVGA 1W4ZA 1D4FA 4XR9A 4PG4A 3H9UA 4MKZA 2Y1DA 5KWEA 1H5QA 3CKYA 4RLHA 1U7HA 2Y1OA 4FN4A 1LLQA 4MINA 1XELA 3AUTA 3IDSA 1LDBA 3EDMA 2JFHA 4PLFA 1TT5A 4Z3DA 4HY3A 2H9IA 2GN6A 4FJ1A 4M55A 3E6AA 1LDMA 4J1TA 3DBVO 2RAFA 4NR0A 5CDTA 1GYQA 4WKGA 1NHWA 4JJFA 5ER9A 5JC1A 3RBXA 2AE2A 1MX3A 5DN9A 5ENVA 5AVOA 4BKQA 5KOIA 1Z6ZA 4D42A 3SLKA 3JD2A 1E1NA 4I9UA 4WLFA 3GDOA 1PL8A 3VAZA 1XGKA 1EE2A 3UXYA 4Y6SA 1DO8A 1S7CA 3ZU5A 1GUFA 1Y8RB 3ZNNA 2Y1FA 4OL9A 2VNSA 3D0OA 2YFQA 4MDHA 3FBTA 3RROA 3BMQB 1DRUA 3P5SA 4KZPA 4MVJH 4BO6A 4IS2A 4AJ2A 4K28A 3TRIA 2V6MA 2Q46A 1A72A 3GC6A 4IGFA 4YPOA 3MJVA 3HQ4O 3C7AA 3UGKA 5L51A 1L1FA 4CV0A 3KSZO 3O38A 2EF1A 2QYTA 3DTYA 5TC4A 1MC5A 5KTKA 4RJTA 1PGOA 4PLGA 2G82A 2AQ8A 1EE9A 3V2UA 3WJAA 2GGSA 2GN4A 4INAA 3C1AA 3ZWBA 4P4NA 4P22A 2AG8A 2NVWA 3H3JA 4NNJA 4R51A 4I9NA 1H94A 2NU9A 4E2ZA 3AUSA 4EDFA 4L0QA 5FI3A 3AY6A 1ISIA 4LGVA 2GR9A 4CR8A 2C59A 3EYWA 4QFDA 2EJWA 4GBJA 4LSMA 5KVSA 1PQPA 2I66A 1EUDA 1ISHA 3GVIA 5JAZA 3EHEA 2GZ1A 3ROKA 1PL6A 1YXMA 3C85A 3SC4A 5TRTA 1KVQA 3OMLA 3VH2A 2HMVA 1ZMTA 4G5HA 3UW3A 3WQRA 2CVQA 5DULA 1DIAA 3GFGA 1I3NA 2VZ9A 2D4AA 4J4TA 3ZH2A 2DUUA 3GG9A 1ZUD1 5BQFA 5JCJD 1YE3A 4RCVA 3KETA 2ZJ0A 2P4QA 4DQVA 2YY7A 4XYLA 3GPIA 2Z95A 5MDHA 2C5AA 4PG5A 2X86A 5ILOA 3VHRA 2FSVA 3EUWA 3KEQA 3NEPX 4WPGA 1DJQA 1RJWA 5MGBA 3MJCA 1X15A 1PJTA 1A4UA 1DLIA 1GD1O 3DZBA 4BKRA 1E3LA 4XYGA 3JQGA 2PD3A 4IDAA 1D8AA 3E1KA 4O0LA 1Q0HA 1WDKA 2O3TA 1CWUA 1MC4A 3O26A 4ALNA 4D46A 4DC0A 2Z5LA 3K2BA 3WSWA 4N5MA 4TZKA 4DQUA 5LDHA 1GU7A 3TZKA 4ND1A 2PZLA 1WZEA 1F8GA 5A02A 4J0EA 5KIAA 2WE7A 4GLOA 4GPD1 1PQUA 2FRDA 3BMOB 1N8KA 4MJLA 1PJCA 3H7AA 4DPKA 4BGIA 2WYUA 2ZTLA 1FDVA 1I8TA 3ZU4A 1UAYA 8LDHA 1NAHA 2IZZA 5TIIA 1ZMOA 1J4AA 4TRRA 3DL2A 5DP1A 1NYTA 3LC7O 3ZHXA 4WCDA 4NK5A 5L7WA 4BUCA 1ORRA 1U3UA 1WDMA 3I3OA 5KCZA 2B4TO 3NJ4A 4E5PA 1H2HA 4A0SA 3KUXA 3S2FA 1KY4A 4U0JA 1R4NB 4PZDA 4D79A 3AM3A 3BHJA 3FHLA 1LSOA 5K9ZA 1DXYA 1XIVA 4IBOA 4JCOA 2NUAA 4LCEA 1HSZA 2C2XA 3A06A 4XRRA 4MVJM 1YVEI 2JCXA 3NGLA 3JQ9C 3CTMA 3O8QB 3BMCB 2VWGA 3NTQA 3OIDA 3JD0A 4N5NA 3WGZA 4BKPA 2CMDA 2BF7A 4IJUA 4PRLA 4RDIA 4LRTB 4WLUA 4CM1A 4F45A 4L4RA 5GZ1A 4TRMA 2AHRA 3FNHA 1P33A 3TL3A 4TKLA 2PGJA 3GG2A 4ZICA 3WWZA 4L75A 1XHLA 1O94A 2Y1GA 4CMEC 2CF6A 4OJNA 5EIOA 2E82A 3GDGA 3I9MA 1DIRA 1E5LA 3TFQA 4CMIB 1QRRA 1B15A 1P44A 1I30A 3F46A 4YA6A 1V3TA 4ZN6A 4I1IA 3KV3O 2A9FA 3ZU3A 3TZHA 1J6UA 4MP8A 3I9KA 1WLYA 4XA8A 2GZ3A 3VVCA 2HO5A 3GGGA 2NLOA 3OA0A 4I8XA 2GDZA 3PP8A 1X14A 5KVVA 2O3QA 3CSDA 3GAZA 4S1VA 1ZJZA 1FJHA 3RUEA 3HWRA 2VUUA 2I3GA 4PLZA 1TLTA 3ST7A 3LU1A 3SX2A 3S1LA 5B4VA 1N5DA 4XDYA 4BIIA 3WFJA 3ZHBA 3VPSA 2O48X 1EFLA 4ALJA 1PZHA 4OM8A 4W9NA 1ONOA 3QSGA 3DAPA 5IXYA 3I9NA 1P77A 3WDSA 1XG5A 2W2KA 1ISGA 2ZATA 3Q9NA 1RM4A 1ZNQO 5BNFA 3RUIA 3UOGA 3JQFC 3V1TC 3DZIA 1I3MA 2Y1CA 5H82A 3DDNA 3E82A 5B4TA 2QZZA 2DTEA 4AJLA 4GGPA 5JSFA 3HHPA 4A2CA 2LDXA 2ZTMA 2CVZA 2P9CA 3DMTC 4H15A 5EL0A 1AGNA 1HXHA 3EY4A 2RCYA 4TVOA 5DCUA 3RCBA 4YRDA 5HA5A 1TT5B 4BO2A 5IF3A 4BNMA 4FBGA 1Y81A 3MJEA 3HSKA 3OFSA 1R0SA 3HDHA 3E9QA 4ND4A 1FDWA 4GVXA 5TF4A 1IB6A 4YRBA 2F1KA 5T5QA 1YONA 5DCWA 4CLOA 3D4PA 3TNLA 1P3DA 2HLPA 3L9XA 3RJ9A 4CQLB 1LQTA 4HBGA 4CMGA 5DZSA 2QQ5A 3C7CB 4CMBA 1PR9A 4M1QA 1QYXA 1JTVA 3H9EO 1EUCA 3IIEA 1I3LA 2Q1WA 1Y7TA 4Z0TA 3AK4A 2PZMA 4CMIA 4NBWA 5TJHA 4RZIA 3DEYX 3Q9UA 2W90A 4X54A 2JFFA 3GUCA 5HWSA 2ILTA 4IPTA 2RBEA 4FOOA 5GMOA 3VH1A 4BV8A 4BO3A 3PVZA 3QE3A 3K73O 4L4SA 1GV1A 2OXIA 3DBHA 4UUOA 1XQ6A 4GH5A 3ADOA 5I7SA 1NX6A 2FPPA 4ZHSA 2YYYA 1C0KA 3ZI0A 3IS3A 4KWHA 4IXWA 2NV6A 1F12A 4BNWA 2GASA 3FPCA 1BDMA 3WIEA 3ZCXA 1JKJA 3GZ4A 1R6DA 2PY6A 3NT5A 3ZNOA 1QYWA 1RM0A 4O1MA 1UXKA 4YTEA 1HTBA 4PLWA 1VKNA 2VWQA 1EQUA 4CLXA 1K6XA 3EGOA 4J6FA 4AJ1A 1OFGA 2PH3A 1WWKA 3NYWA 3C3XA 3ETEA 1ZEMA 4GWKA 3ZWMA 4YYZA 4R5MA 1OMOA 2VTEA 2YFHA 3PQEA 3U4HA 1XSEA 1H6CA 4IJVA 2VYNA 3P7MA 3GMDA 1LJ8A 1NWHA 1JN0A 4MO2A 2PZKA 2Y05A 3ASVA 1IULA 3VDRA 2ZCVA 3VKVA 4KDEA 1TI7A 3H65A 1EMDA 1I2CA 3FN4A 3D7LA 3PHGA 4OMUA 3D3EA 1ZEJA 1GPJA 2QW8A 4WCFB 3ANLA 3K8ZA 5I9NA 2DC1A 3BTOA 1FK8A 5JPIA 5EQFA 1ZJYA 3DXFA 3KRTA 4WLVA 4YXFA 3JQFA 1CETA 5A1TA 4DMLA 1TB4A 1R0LA 2BI7A 3PJGA 3AU8A 3NV9A 3KYCB 1UZMA 3KLMX 1UAGA 4IINA 1ZSNA 3LLSA 1UR5A 1U3TA 4E5YA 3DWFA 2UDPA 5EINA 4CQLA 1VSVA 4IDEA 4TSKA 5EN4A 4GL4A 1CERA 2CDBA 3OQ6A 3T7EA 3FNGA 2WDZA 1QXSA 2PZJA 1PU2A 4R16A 3E9MA 4JQCA 1JKIA 1SOWA 3A9WA 3UN1A 3CXRA 3GFBA 2W8ZA 1BVUA 2IEBA 4PZCA 5JDCC 4EI2A 2PH5A 4IIVA 4J3FA 4E2WA 4BO9A 5J23A 4OXNA 4DXHA 1GZ4A 3F9IA 4NPCA 1BTOA 4CM5A 4CM7A 5G0SA 2EV9A 3ICPA 3JSAA 3PIIA 4PLPA 2E6UX 4AJOA 2W2LA 4Q3CA 1K6JA 2FWMX 4NJOA 3RASA 3SXPA 4CMAA 2WYVA 4IDBA 4EW6A 1I2ZA 2LDBA 2ZQZA 3AI2A 3DAGA 3W1VA 2Y0DA 2PWZA 4BNFA 2OBYA 3JQDA 4CV1A 4RORA 1A9YA 3OP4A 4LCJA 2J3JA 1YOVA 4NBRA 3ZV4A 1B2LA 2BH9A 2YHIA 4II3A 2I9PA 3EVTA 4MIYA 3HNPA 3IUPA 3O8QA 5G0VA 3M1LA 5I7VA 1I36A 2F00A 1MUUA 4CUKA 4CM6A 2D5AA 1PS8A 4P8RA 1B0AA 5IDWA 1QG6A 1OI7A 4BNNA 2ZB7A 4PGFA 5TGDA 1LLDA 4J7XA 3EW7A 1OC2A 4ZD6A 2J3HA 2IRWA 1NVMB 2X58A 3SJUA 4YJHB 1VSUA 1DAOA 4FS3A 4KQWA 1MFZA 1HDCA 4D41A 1F06A 4BHTA 3A28A 4MVJG 4MVJP 4R68A 4WCFA 1Y1PA 5G4KB 1YBAA 4I5GA 1EBUA 1IY8A 1H6AA 4IGEA 3S2GA 4CLRA 3OQBA 3H5AA 3I83A 3BMQA 5GZ6A 5JAMA 1FXSA 1TT7A 3GVXA 3MTGA 3PEFA 4JJIA 1Y5RA 2OO5A 4LK3A 4O59O 5B4UA 1EBFA 2OP1A 4D7AA 2WE8A 4PCVA 4RQUA 2DLDA 3BA1A 4YT2A 3OEYA 1PWXA 3QWIA 5BNTA 2ZYDA 1PR3A 1RYEA 1EK5A 2OFPA 4MVJF 3MWEB 3ZW8A 1WP4A 5A9RA 2B35A 3CUKA 5JCJA 5IFLA 3W8DA 4A73A 4FPXA 1FDSA 4FCCA 5T8KA 3EZLA 5KJEA 3KBOA 2BHLA 1YOVB 3ZNPA 5A5EA 4A7PA 2AXQA 4KWIA 2XXBA 2EG9A 4XYEA 3PHLA 2C2YA 1MXFA 3FR8A 2P9EA 4UEOA 1GCOA 1W6UA 2IODA 2BLLA 1XA0A 3NAQA 4G65A 3UCXA 3WGGA 5ITVA 5JBIA 4E2XA 2NU7A 4GMFA 1D1SA 4CM9A 3KSDO 1MG0A 2Q45A 1ENZA 3A4VA 4YB8A 3SJ7A 4QO8A 2X5JO 4W4TA 4LSWA 4CUZA 3JQ6A 2JD2A 1HDYA 1PSDA 5DNAA 4BNYA 5COAA 3F3SA 4WEQA 1DSSG 1XWFA 3QWFA 3I1JA 1YDEA 3GNTA 3PIDA 3OJFA 5A9SA 5C37A 2J5KA 3OQ1A 4I5EA 1R4MB 3F4BA 2GN9A 4UUPA 4YT4A 4C7KA 3RQSA 1LXCA 4BNZA 3B1JA 1UDCA 3I9JA 4YQZA 4CV2A 3ZHZA 4BOYA 4HP8A 4EJMA 3JQGB 2BI8A 1K2WA 4R54A 3VZQA 4WE3A 3G79A 1YL6A 3BAZA 1ZSVA 5B37A 1KS9A 4I9HA 4J7UA 1HEUA 2FHSA 4R3WA 4ROSA 1D3AA 2D5CA 3I9LA 5GZ3A 3R0IA 3H9JA 4IDCA 1KEPA 3A1NA 1D7OA 1M67A 1QYCA 2VNAA 4J16A 4OOFA 4O63O 4CM8A 3CIFA 4UREA 2OBNA 3Q2IA 2C82A 3WBFA 2OORA 1DRWA 1K5HA 5G0TA 3V5NA 5HS4A 1P1JA 1ZW1A 3TZCA 1O8CA 1UZNA 4J9UE 5DP2A 4CLHA 2EW8A 1UDAA 1GY8A 2O50A 1U5CA 3JYOA 4ILKA 2HAEA 4K26A 1Y8RA 3RD5A 4R69A 4YAEA 4YT5A 2XPCA 1JAYA 1DOHA 2X4GA 2NADA 4BNGA 5C5IA 4ZQGA 2P4HX 1O5IA 1BXKA 3CH6A 4E2YA 2X0NA 4M54A 8ADHA 3TPCA 1IYZA 1A27A 5L4NA 3JCZA 2X0RA 3HB5X 1YS4A 3JQ7B 3L77A 1NPTO 4YJGB 4DC1A 5DBIA 1E3EA 2Q2VA 3VPHA 1CJCA 2FOIA 1PQWA 3NT4A 1H9BA 3BHIA 3DOJA 5JE8A 1XR3A 1JDJA 4QQRA 3WGQA 5BT9A 1R4MA 5KVCA 4AJHA 1MG5A 3PFFA 2VYVA 3OEWA 4NHEA 2FR8A 1YB1A 1ID1A 4ZQEA 3IL2A 3I4CA 1BW9A 1IZ0A 2Q99A 2EP5A 1IPEA 1E7MA 3N7UA 4ALKA 5FI5A 3GUYA 2C5EA 2BFPA 3E03A 4E6PA 2E48A 2PD4A 4Q39A 1M6WA 5C7IO 3RVDA 3QLJA 4IXTA 2GN8A 2Q4BA 3H2SA 4OQYA 1I10A 4ZJUA 3KYBA 2IYOA 3EAGA 5HBRA 5KKAA 3IOYA 2Y68A 2NM0A 1N9GB 2EHDA 2HJSA 2D59A 2GZ2A 1C3VA 3PK0A 5H83A 3V2GA 2DFDA 1WPQA 2QRLA 1Y9EA 1VE9A 2O3RA 4YVFA 5C7LO 2HMWA 2DBRA 3GZNA 2NU8A 2PD6A 4HUJA 1E1KA 1CYDA 4N5LA 1U2DA 3EVNA 5CEEA 1F17A 5I8ZA 2VRBA 1LDYA 2FPGA 2X23A 3TZ6A 1G6KA 5A4DA 2DTXA 3I6IA 3PFWO 3PQDA 4HV4A 1YJQA 3HADA 4WEOA 2G1UA 3U3XA 1E7SA 3HFSA 1B26A 2ZB3A 3C7DB 3ZDFA 3OIFA 4DLAA 1LDNA 3RFXA 2NWQA 1GZ3A 3W4IA 4XQCA 4KUGA 3KHUA 4PVCA 2JL1A 2YHIB 3VH3A 2E49A 4FFMA 2JD1A 2I65A 4CR7A 3JV7A 1GQYA 3EZYA 1N1EA 2A4KA 1GTMA 2ZIZA 5L3ZA 5C7OO 3PYLA 4GQAA 1GQQA 4EYEA 4F3YA 1X0XA 5JO0A 2JJYA 2WM3A 2CZCA 1E6UA 1Z45A 1ONPA 1NFRA 2Q4EA 1KY5A 4E5KA 3ULKA 3WFIA 1UUFA 1W8DA 3JQCA 3VPFA 3ETGA 2GO1A 5IJZA 2QRJA 2H5LA 1I24A 5L7TA 5I7FA 3AFMA 4I5FA 4PFJA 2ZQYA 5THKA 4YWJA 3WNQA 4PZEA 5G4KA 3E8XA 4Y6PA 3GGPA 4IQ8A 1I33A 2GYYA 4UAGA 3QWAA 1OAAA 3AUAA 4GWGA 4NU6A 2AEFA 1GQ2A 1HDZA 1PEDA 2GD1O 4XIYA 3U9LA 3QA9A 3FNEA 3ZWPA 3HDJA 4J1NA 4IJWA 1UXJA 4DYDA 4E30A 1RM3A 1GADO 1SO8A 2NVUA 1MB4A 3DFUA 3TFOA 3F47A 4CMHA 3F6YA 4TRNA 4IM7A 1DDOA 1Z7BA 3IMFA 3DBHB 1J5PA 3LF1A 1EZ4A 3I5MA 2CNBA 2VYND 5DDIP 3S8MA 4JP3A 4ND2A 4FB5A 3B20A 3RSHA 2HMTA 2QX7A 3D3WA 5U1PA 5DOVA 3JQAB 4EEXA 4DYVA 3UH1A 2YV1A 5COQA 4XB1A 5IDYA 3H5RA 1AHHA 3K2EA 3NT2A 1MGOA 3RKRA 1ZH8A 2R2GA 1E77A 1O95A 2UAGA 4J1SA 4W9NC 1RM5A 3K5PA 5TX7A 2X5KO 2JFGA 4F6CA 3C1OA 2C07A 2RHRA 5JCXA 2YV2A 1LNQA 1X13A 4B3HA 4CUJA 1WVGA 1E7YA 1Z75A 4JBHA 4OXKA 4D3DA 1WNTA 3WR5A 3WNVA 1HZZA 3CMCO 4BQRA 4E33A 1KEUA 4PIVA 1C1DB 3T4EA 1Z82A 1HE5A 3ZWOA 1H93A 2NTVA 2CY0A 3MOGA 1ADCA 4FFPA 3LYLA 4B4UA 1KVTA 5THQA 4MVJI 3F5QA 3ROPA 2WEKA 3CZRA 2J3KA 1U7TA 3ZWNA 1P31A 4I5DA 1OOEA 4FIZA 4TZTA 3U5TA 3W4JA 1JVSA 5JMWA 5TQVA 1B8VA 4IQ0A 3INGA 4L9RA 4W7HA 4NFSA 3U0BA 2C20A 3RC9A 1PIWA 5COBA 3LDHA 4E5NA 1V8BA 1LSUA 1H2BA 7ADHA 3TOZA 3FWNA 3KOUA 2B37A 3AY7A 3RUDA 3DB2A 3PDUA 4BV9A 1IOLA 1LLUA 3FD8A 3RC1A 3PZBA 1HDOA 3LC2O 4RF4A 4DLBA 1NR1A 2AEMA 3KTDA 5CPBA 1PJ3A 1NTOA 3KXDA 5U4QA 4IZIA 2HKIA 3TQHA 3C8MA 5A3JA 4BKOA 4XZ3A 2W4QA 3JYLA 1KYQA 2Y0EA 1VJ1A 2VUSA 1Z74A 4UUMA 1DHRA 3PLRA 1MFPA 3BMNA 3FR7A 4KP7A 4M8SA 1NPYA 4RQTA 3DZJA 2JKVA 3MTJA 4MVJD 2UV8A 2WJPA 4J0FA 2I6TA 2ZTUA 3LT4A 4AJEA 3L4SO 3S55A 1NASA 4C7JA 5FWNA 2HK7A 1EVYA 2ZCUA 2X22A 2HQ1A 3RAJA 1C1DA 3M1AA 4FOSA 1VL0A 2DVMA 2A35A 2HMUA 4PVDA 4BNTA 4RF3A 1B3RA 3WGTA 1V3UA 3ZV5A 1PWZA 4BO5A 5HTOA 3VZRA 2RIRA 1CIVA 3RUCA 2DPHA 1LEHA 1WMAA 2D8AA 3KLPX 1EEHA 5L40A 2CVOA 1BW9B 1CRWG 3DZFA 4CR6A 4EJ0A 5L4LA 2G17A 2QG4A 3GT0A 3K31A 1G0NA 3ENNA 3RI3A 1MA0A 4LMRA 4CMJA 3GDFA 1GV0A 1MP0A 1EVIA 3GHYA 5EERA 1R66A 3TOXA 3H8VA 1GYRA 1WZIA 1ZBQA 5I7EA 1YDWA 3GRKA 1O9BA 4Q3AA 1A5ZA 4BNLA 4DA9A 4F6LA 1R4NA 1PZGA 4KOAA 4U7WA 1C14A 2OMEA 1Q0QA 1YBVA 3FBGA 2O4UX 4XJTA 4A27A 4ALMA 3R3JA 1SOVA 1BGVA 2GNAA 2O2SA 1PJ2A 3KVOA 5AXDA 4YACA 1BRMA 4BNIA 3UICA 2X9NA 1AE1A 1T24A 2NQ8A 4BVAA 4PG8A 4OH1A 1YL5A 4XQEA 3UUWA 4DREA 4BB5A 5B12A 5JDIA 4NZ9A 3PTZA 2HCTA 4RVGA 2V65A 1ZXBA 2IDZA 4NG5A 4ZU3A 1UXIA 3AOEC 1NVTA 2JD0A 2PKQO 2FMUA 3UCFA 5CEFA 3LLVA 4DQXA 5KJ1A 4PLYA 5AYVA 3WX0A 2B83A 4EEZA 2DBZA 4JK3A 4NFHA 4BNUA 4E21A 4Y9DA 2VRCA 4XRGA 3QVXA 4D3FA 1BDBA 2HMSA 2PA3A 4WK6A 2BGKA 3IKTA 1W73A 1C0PA 3GVHA 3BYZA 1B3BA 3MOIA 4AICA 4OKIA 1CF2O 1DIGA 3ZGYA 5HRUA 3F1LA 1E92A 2J6IA 2AE1A 1E7WA 2YDYA 2VT3A 3RWBA 2HRBA 3RBVA 3SVTA 3GOHA 1HDXA 4QTZA 3FRJA 4PG6A 1Q0LA 4QEDA 3JQBC 2JHFA 3NJ8A 1R12A 1Q7CA 5L95A 4TVBA 1YKFA 4YAKA 2CUKA 3MJSA 4W99A 4R9SA 1UJMA 1VKOA 3VZSA 1DC4A 2PLAA 4R1UA 1ISMA 4G2NA 3NRCA 1UP4A 5CDGA 1YQDA 5L45A 4GI2A 3PGXA 2Z1MA 3JTMA 4XB2A 3GHHA 2DT5A 1A71A 1GAEO 1PL7A 3PHJA 5A9TA 4RF5A 1ZCJA 2GF2A 1LA2A 4FFNA 2HSDA 2GUGA 4MP3A 2I76A 1ULUA 1A9ZA 1PGJA 1VRWA 4IUYA 4HFRA 4NK4A 4BGVA 3PZRA 2VHYA 2HK9A
chains in the Genus database with same CATH superfamily
1VMDA 2VDUE 4RXTA 3HN7A 4NYJQ 3LQFA 4KDRA 1XP8A 1LVGA 3RSLA 3J81k 1DRVA 1U7DA 3CKMA 1F4PA 4S3MA 2DX7A 4DT1B 1BYIA 2YQ5A 2IWRA 1A76A 4ZKEA 5P21A 3GJ4A 4OHUA 2I3DA 5EPOA 2JW5A 1UPTA 5JRJA 1CE8B 3HN6A 3VC7A 4YJHA 2Z1NA 4HGOA 4DBVO 4L22A 1F9EA 1N0VC 3QTTA 3WLSA 3ZBTA 3PUWA 5M5BA 2BCJQ 3LECA 1OLUA 2WIFA 2C1ZA 4UU0A 2E55A 2ZBDA 4BNDA 1ADGA 3LKBA 3O84A 5EIBC 3DPIA 3FDIA 2XDAA 2CL0X 4DQ0A 4R2LA 2IZ0A 1WQ3A 3M6LA 4IDGA 3T4PA 1HZZC 1QFJA 2EIHA 2PT7A 2RGBA 3FMOB 3BB4A 1FUIA 1AXGA 4H3KB 4KREA 4IMRA 4MCAA 4MJ7A 3S1AB 3LT0A 4CV3A 4DNOA 3CKLA 5GIOE 2KE5A 3DL7A 4I55A 3EFOB 2B8EA 3H8WA 5DU2A 3AC0A 1C7ZA 4CM3A 3MRXA 1OWNA 3BXHA 1LNSA 3T61A 5KYKA 1K8ZB 4HNAA 4OUKX 2IUSA 4MROA 3V8EA 4YAUA 3C3MA 3ASUA 4ADSG 2UZ1B 4D44A 3ZU6A 1LZKA 2WNHA 1O77A 3A4YA 2WJAA 4DNFA 3GLIE 3DCNA 4R1OA 3AP2A 1I32A 1UOQA 4MQEB 3K0HA 4KMSA 2FMHA 1Y9ZA 2LRHA 2PMWB 2JAWA 4G4IA 2JI6A 3DO5A 3ZJUA 1ZMXA 3G9TA 2I7DA 4QUBA 1JKJB 4H60A 2C2ZA 3NKLA 3PNSA 1ECBA 3V4OA 2QY6A 4KQEA 3OX2A 1JJFA 1JSXA 1VL6A 2YJ3A 3KVVA 4O29A 1YB4A 4J0DA 5KJCA 1U2PA 3WAGA 4BQPA 3PR1A 4RD0A 1CEXA 1GUAA 2R1ZA 3V3TA 4EGSA 2X13A 3D4NA 2R7MA 3OM9A 1M8JA 1MXHA 2GXQA 4JDPA 3TD2A 4AJJA 1E6CA 4UTVA 1JDVA 4K1LA 4KQXA 1PX2A 4F8EA 3DS8A 3ZDCA 3J81A 4FSXA 4J43A 4WBSA 3TW0A 1BJRE 4MUEA 4QO7A 5LDGA 1JAZA 1WB5A 3L7CA 3OX3A 2BGJA 2QN1A 4FHGA 5EWLA 2OM2A 4JWTA 1TKAA 1T4GA 2HDWA 2GJ4A 2R8XA 4WXMA 2AKEA 4CETA 3PLNA 4WI1A 1SBHA 3OCXA 4G63A 1A7AA 4FX2A 4X1YB 3K0EA 4ZO9A 3I23A 5A9SB 3BDIA 1ZK2A 2X8AA 4ZC8A 2VDPB 3ZWWA 3HU5A 1RYDA 4JQSA 3ZI7A 4GBGA 5E1DA 2BM8A 2GK7A 5IZCA 4N3AA 1KEVA 1J22A 3CB2A 1I6WA 3DT6A 4Z9BA 5I9SA 4NMHA 4EBBA 4B6OA 1M66A 1UFRA 3MSXA 1E4EA 2C31A 4CQNA 2Q1SA 2JRCA 4PU0A 1U11A 1MENA 2G70A 2FPIA 4Z0NA 5CT8A 5F4BA 3ZG6A 4CCYA 1B76A 3OM0A 4MI6A 2COUA 2WV7A 5HM6A 1I2MA 3BERA 4LPKA 1M2OB 5KNBA 1GL3A 3B70A 5EEHA 2G83A 3Q6IA 1J7KA 3P2MA 5FBWB 3L4BA 3ABIA 2O3JA 5BWNA 1R5NA 2DHQA 2HLHA 4N7RA 4YJ3A 5BW4A 4IMIB 1JJVA 1PDVA 3G2LA 2NXNA 4DJDC 1ADBA 1KO5A 3B3GA 1V95A 3HCCA 2CF5A 3KXLA 1YS6A 2C04A 4BZWA 5LQDA 2XUKA 4Q47A 5HJ2A 1IZ9A 2H1SA 3ZHTA 2FETA 3T1HB 2PU5A 2VJNA 3K9GA 3FTNA 1IWPB 4L27A 3B6ZA 1V5IA 1V3QE 3PQ7A 1EFRD 1CLEA 1IHXA 1T0PA 2I62A 2Z58A 5EI5A 5I47A 5LWHA 2ZR7A 4B7AA 4OQZA 3GF4A 3X2FA 5F1KA 2CV2A 2FG5A 1LRLA 2WMDA 4XIJA 1ZGCA 3E81A 1XD8A 1HQCA 2I2DA 3QPDA 3IR5A 1IL0A 1BFUA 1PO7A 1RRFA 3DAFA 3REQB 5TGZA 5CIWA 4L73A 4WIAA 1RDFA 4OHVA 1WB9A 1DC3A 3GEEA 1NDQA 1OQAA 3LYAA 5IN5A 3QEMB 2ZI6A 1A2BA 1D5WA 1LUAA 1C3OA 3JVVA 3LT1A 4RIFA 4YP5A 3LHFA 1CY8A 2HBQA 3IV7A 1TQ2A 4ZK2A 5JMPA 1KI1A 2E37A 2NTYC 2Q0QA 4UKDA 2ATVA 1EAMA 2XZDA 4Y2RA 4UZSA 3ADCA 4TXLA 1TYAE 1P9OA 1M7GA 3FLMA 4NABA 3VNVA 4TT3A 1K1EA 3RRMA 2P2YA 4L8WB 4LOIA 4JLAA 3KKKA 2IH4A 1Z83A 3HKEB 1UMCB 4M0KA 1C4XA 1OAKA 1RWNA 1VGQA 3E48A 5ARCA 3TAUA 3ZS9A 3E8MA 3K6JA 5HZKA 2AD1A 3PL5A 2HSJA 1NXPA 3N0TA 3IR7A 5HFJA 5LJIA 4MDEA 2KS6A 2CE7A 3E23A 5CNJA 3PUJA 2YN4A 3R2JA 3L8GA 1T2CA 1GIAA 4QOJA 2WT4A 5JYEA 2QPLA 4HLUA 1UP7A 1VCOA 2NSHA 1U7WA 1B8OA 3ESAA 2VSXA 3TL6A 4UHDA 1QSGA 2HRQA 3LE8A 4X20A 1N2EA 2IDKA 4FNGA 1QG4A 2DYKA 2I67A 4FDMA 4IZHA 1R37A 3I5XA 1RHRA 2WBLC 1JDTA 1H8HA 3AHGA 1NP6A 1XZ8A 5GJWC 4ABYA 2KW5A 1XZCA 1OVGA 3AFIA 3OQPA 2VDRB 4N8SA 2OOSA 3LUGA 3TQCA 2Q50A 2YWXA 3U7EB 4O3FA 5IABA 4UHFA 1SBCA 4D02A 1AS2A 1JHVA 3E05A 4JN6B 4WNIA 5SZJA 3WE7A 4IS3A 1ITZA 3PUXA 5IAEA 2HA2A 2IU0A 1MLDA 3RF7A 1DBVO 3BXXA 4WXPA 3ZJ5A 3UJNA 1BXGB 1R9GA 3PB3A 4Q02A 5ELXA 3QUAA 3AG5A 2OY0A 4HWPA 2IEDA 3IE1A 3TLYA 5BSEA 3B53X 3GH1A 5KNLA 1G4UR 3BEDA 3OBIA 1KMHB 1QO7A 4JGIA 3RGGA 4X84A 2BFAA 2R1UA 3P26A 1R18A 5CGZA 4BTEA 1QC5A 4LVOA 4MS3A 2GA9A 3BG5A 5G2OA 4DSZA 1GR0A 1VMIA 1PR4A 3F2VA 4RK4A 4O2BB 3ZQKA 1FCJA 1OIWA 5ENDA 3VR0A 2ZUEA 1B1AA 5CM8B 5IJXA 5DASA 3RS0A 4I8DA 1KF0A 5J2UA 2V0CA 2PVPA 1N1DA 3P2OA 5TT0A 1E5QA 4FXPA 2FW7A 1RW4A 2Q2WA 2EXXA 3I76A 2ZDQA 4V3BA 2PBRA 4W6ZA 3LNTA 4TVKA 4A6PA 1ULZA 4UM5A 2ODQA 3ZIAA 1ORDA 3G5UA 4B6FA 4MAAA 1MJFA 1T5SA 1KIAA 4G1CA 4I0WB 4XCQA 3G0BA 5E0OA 4RZXA 5KYUA 1KYXA 2XX3A 5K0ZA 2J4DA 5JCOC 1DG9A 4XXHA 1FDUA 2FN8A 2H9YA 5DV9A 1WMEA 4MRVA 4MITA 1I01A 4JLMA 1I6KA 1U2GA 1WOMA 3NALA 3HO1A 1D2AA 1L4MA 4UHCA 5B6IA 3CH5A 1NXSA 1VI5A 1B16A 2PLWA 2ATXA 2GKGA 2QX9A 3HBMA 4KFUA 2D3WA 2V7XA 4TLEA 4UE3S 1N5IA 1XROA 3ZTYA 2D1TA 2IF0A 5K6AC 4OU5A 4KKVA 1NNUA 2ZR9A 3UK1A 1SGWA 3F5MA 4TV8F 4D5EA 1QVVA 4GX1A 1T1RA 1XTRA 2FEPA 1SXJC 4AECA 4BUJA 1KC1A 4J90A 2R00A 4MUHA 4NARA 5HF6A 2UYOA 5I9MA 1E1CA 2DH5A 4OQ4A 1SCUA 1W49A 4OX9B 2C8VA 2PKWA 4DIKA 3Q8MA 4BFZA 3CR3C 1Z29A 4QUGA 3PFCA 4DUYB 3KJGA 3AERA 3WV4A 2QXYA 2JAXA 1M72A 1NFQA 1ZMRA 1MX1A 4J91A 1C0LA 2WIAA 3FGOA 4W5WA 1XXHB 1EDZA 1ESNA 1YQGA 1K92A 3HJTA 1C29B 1SUFA 2P2SA 3AM5A 3EBOA 3QKUA 3N2IA 1EVZA 4QAJA 5ALKA 3K8QA 3R3WA 4GP6A 3QQ5A 5GAJA 4COOA 1HKHA 3VVMA 4I1OA 2FV8A 4RHUA 1Z2DA 1R88A 1M76A 1R6VA 1NSFA 1X1TA 1P2VA 2VRCD 3Q8WA 4QNRA 2Z2KA 3JALA 5LQSA 2GJSA 3HO6A 3TLGB 2WICA 3T94A 4V1CB 3CCCA 4CM8B 5HZMA 2K2WA 2XUZA 2A1UB 4BVBA 3FLAA 3DLIA 3KV1A 1IB0A 3VYTB 4IFTA 3MCWA 1U9CA 2IBMA 4QBIA 3K4HA 1D4ZA 3IMEA 4LOKA 4RD4A 4ZYXA 3F78A 3X1YA 2XWQA 2FUG6 4JUBA 4E2FA 4NESA 5DN6D 3MMXA 5JYCA 3A36A 4XYBA 3ISTA 3EXHA 1E6WA 1X7ZA 2G06A 3ZE8A 1L7EA 4PNPA 3KZCA 3MMPA 3D54D 4JZYA 4OGWA 3L6DA 1E6MA 4CF6A 3VPXA 4S0XA 4DMUB 4TMFA 4EG0A 2EQ5A 4JSRA 1JEEA 2EZTA 4E3ZA 2XIQA 3PE6A 3LQRA 4ZU6X 1QHEA 4RSGA 3B1VA 3S1SA 4E0BA 1DC6A 1EP3B 1YZVA 4GR4A 1QK3A 3DTNA 4B79A 1X0VA 1U4NA 4DJAA 5HXAA 1XDZA 3OO0A 4NAVA 2VDNB 4TLBA 4C2AA 4POAA 3WMRA 3KLBA 1TFUA 1J21A 1TCBA 1WETA 3R09A 2EKPA 4RKFA 3OJ0A 1TW2A 3K9QO 1SRRA 5EP4A 4TQGA 1HLPA 2C42A 1U1FA 5GONF 3DEFA 3GRUA 2OHIA 3HUUA 3VOSA 1O89A 4MLPA 2Q7XA 3CVVA 4XGNA 1N75A 4EJSA 1HT3A 2VBIA 5CW1A 1ESZA 3H18A 4QWMA 4XI9A 1BAPA 4ZMRA 1GCUA 2W4MA 4JENA 1HDRA 2RC5A 3C41J 5TLSA 1JTFA 4HDNB 2VVTA 2Y2VA 3ESDA 2OXTA 2VPPA 1HRDA 2PCJA 3L6BA 2BD0A 2FUCA 3MCTA 2O57A 5BSFA 3LL4A 2DBQA 4RTSA 1P74A 1TUBA 5H16A 4INPA 5G0UA 2VKQA 3CRVA 1MKYA 2XD9A 3ICOA 3R3HA 4G0UA 2EYUA 1I6MA 5EESA 3O4JA 9ABPA 3F0TA 3U16A 2IGBA 3OZ7A 1C2TA 3D7KA 2ECOA 4B85A 2F90A 3ZUGA 3TLGA 1P91A 2B2NA 4KPYA 4GKKB 4WAUA 4LTDA 3BTUA 3KOXA 4J7CA 3X1JA 2AF3C 4QECA 2YQ4A 4OK3A 1KNXA 2ZU6A 3OUUA 4GVLA 2OGUA 4TS9A 3QRWA 3WWYA 3GPDG 4E15A 2VJLA 3HP7A 3SZUA 2CDAA 4EJ2A 5JXHA 5A0TA 2PTGA 2XECA 4CQMA 1PBTA 5IG2A 1PZNA 3FFTA 1YS2X 4JASB 3V1LA 2J67A 1WU7A 2WD7A 1QM5A 3CW8X 3QE2A 1ABFA 2CN1A 2ZBFA 5GWXA 5B1YA 1QH1A 1J9EA 4D56A 3O9MA 1M8GA 3AR2A 3MWEA 5K0FA 3CRQA 4A8JC 5BVHA 1ONSA 1P1BA 5FPPA 2PGXA 3ACBA 3K96A 1CY2A 3NJRA 3UKOA 3ZWVA 4LYEA 4OHCA 3OQJA 1C4WA 1N3BA 2C5FA 3E22A 5ALDA 1EGHA 2YOGA 4NZMA 1SWVA 5DHQA 4FNAA 1R9JA 1G1AA 2DQYA 3AWIA 2PQ0A 1TK2A 1C7EA 1OVMA 2YNMC 1UM8A 1XQVA 2AL7A 2XTAA 4O2BF 5HSGA 1SXGA 1SG0A 1D4AA 3VDQA 4YRAA 4ZDJA 2ZZMA 3JAMA 4G1UC 1DGQA 3SQDA 4CM4A 3LRXA 5FP0A 1QYVA 3PUYA 4BMNA 4BQEA 5I7WA 3G2MA 4GKAA 2WVAA 3RANA 1QJ4A 2IXAA 2Z30A 4YJKA 3FA2A 3M6WA 1XT6A 5C8XA 5JCPA 1E64A 1NW7A 4WA7A 1QGUA 1J7JA 4M22A 4QDXA 3DYVA 1ODKA 4QTUB 1E2BA 4LYAA 4CODB 2JFYA 2GPNA 1L4GA 3KJXA 1VBFA 4CG2A 1LPPA 5CCEA 4WN9B 2Y0CA 1ZUHA 5ALHA 1U5AA 3F67A 1WO8A 3DE0X 5AIBA 2PGLA 2FK8A 3DCYA 3GK3A 1C50A 1NUPA 4V0NA 5HMLA 3KAKA 5HKBA 1WXDA 3KQKA 2GHIA 2K87A 1EGMB 2AMFA 4MWSA 2BMWA 2OC9A 2PUJA 4AT1A 4OQLA 4MQFA 10MHA 1AOXA 2P5TB 3B78A 3HA3A 2H2AA 2P9FA 1M6VA 4XIFA 1QLWA 3HCNA 4LN1A 4AF7A 4PSUA 1LVHA 1SC6A 4M88A 4ONEA 2A94A 3ADKA 1ADFA 1GNVA 2N42A 2Z8ZA 3VNUA 4DB4A 5CLLA 1RE0A 4YR9A 4I3FA 4NJMB 3EF0A 2C9MA 3LT2A 1X94A 1FPQA 4ILEA 4Z1MA 4KLZA 4PAQA 2Z6AA 1YZYA 3M83A 2VJBA 2PRSA 3GQBB 4M9SA 5CB4B 4I1RA 1ZR2A 2QMZA 3WYDA 2ZYVX 1W0KA 2VOEA 4HK4A 1XZMA 4WXHA 2D2FA 2WTXA 2JI8A 3TTWA 4DIDA 3RJ5A 4NYIQ 1J00A 4FDVA 1ZK4A 4AO8A 1JXQA 4MI3A 4BLSA 1H69A 4WRRA 4RPLA 1J8FA 4HUQA 1FVHA 3HBFA 1MPTA 1XEFA 1N36B 1P5JA 1KOFA 4ZAFA 4BZPA 6Q21A 5KTNA 3CR7A 5ES3A 3A9CA 2VHVA 4KXQA 4LHEA 2V7PA 4DR6B 3LSTA 4L2IB 4L74A 4WFKA 4A0RA 4RPHA 2GPSA 4U6QA 4WY8A 3GFSA 5DWVA 1GPMA 3ICCA 5ESRA 4X61A 2OCIA 2Y6UA 1K2VN 3EBLA 2FSUA 3WZMA 4BQRA 4CM4B 4KI7A 1UT8A 4ZRMA 2XUAA 4ZREA 3EEFA 3MCAA 5C3MA 3D6HA 4LZZA 1NVXQ 3NASA 2WVGA 1CY7A 1GTVA 2BLNA 2H48A 1BN6A 5GADl 1RZUA 2E4XA 2PVSA 4ZEWA 4EPXA 5ICMA 4NI5A 2B5WA 2EX1A 3AL0C 4C43A 4HFJA 3CBQA 2MSDB 2C9OA 4JC4A 3GRYA 3DEHA 2ID4A 2PNFA 2G76A 4MEBA 4FKZA 3CUUA 3JASB 1H2FA 3TSCA 3ZD9A 3ZU2A 2VZ8A 4AXXA 1DXHA 3B82A 4XE5A 1LTHR 1T5BA 3S7TA 3U5ZB 1PS0A 4Y9TA 3TW4A 3A2LA 4LG1A 3PRJA 4Q3EA 5F2KA 1GRRA 2FSVC 1MO4A 3EW9A 1HOTA 3NVMB 3W5SA 2CNWD 1QF9A 4J75A 1T36B 5DM2A 1U28A 3BMCA 4IFBA 1Z4OA 4LECA 5BYKA 1DFHA 2WIJA 3H5VA 5K99A 5MN4A 4MYHA 1YAHA 4DNXA 1E7RA 5BO5A 2WA1A 4NS4A 2HDNB 2YZ7A 3U4AA 4YCNA 3LK7A 3PC4A 3WMGA 3MUOA 5FA5A 4E46A 3A27A 5HX7A 4EI8A 1VBNA 1UBEA 2C5SA 3FYTA 2JCYA 2VK1A 2W0MA 3OSUA 3QUBA 4P4LA 3TK1A 4YRLA 3VKFA 1UDWA 1L5YA 1PTJA 3H8JA 3KYCA 4JD5A 2ZI3A 3P2EA 1OXXK 2L19A 1RRKA 2H92A 3ANYB 1M6VB 3U62A 3ANMA 3MEQA 2CNKA 1SQFA 3L9WA 4BB9A 4Y6QA 2FWNA 5ETJA 3PHIA 1EK0A 2BEWB 2YUIA 1Z8FA 1S2MA 5K0JA 1RE1A 1N6HA 1THZA 2ZRBA 2NUPB 3AR8A 3BH7A 1T0JB 3B6JA 3UOGA 3QW2A 3MTDA 4F06A 4O2AF 1HYGA 1Y6QA 2R65A 5EMJA 3DDOA 1RWKA 3I1FA 5EZYB 2ST1A 4BE9A 1U65A 5F5XA 3RRFA 1N4DA 1T2NA 4ND3A 2CZGA 5EMHA 5BMVA 3OLWA 2PL9A 1Y48E 2PK3A 2CLMB 1K7XB 5BN5B 3KQLA 4PZYA 4AJNA 4AZ3B 5IXSA 3ORFA 1N5LA 2DY0A 3NIWA 5F52A 5K0GA 1GSOA 1QPGA 2YXEA 2AV6A 3CEHA 3P9IA 4BRZA 5HPYB 2P2NA 4ZQBA 1JW9B 1X7WB 5TPWB 2D1QA 2HU5A 1YZGA 4BNVA 2X9GA 4CM9D 4D9MA 4QAQA 4NDAA 3VKUA 1KWGA 1WJGA 3OX1A 3PDCA 5HCIA 1Y6JA 4FKMA 4NYMR 4YV2A 5FNVF 3N59A 1PGNA 1E3WB 1FQKA 1P0PA 4Q3BA 4NH0A 5AVVA 1NBEA 1E9RA 4NJEA 5BSHA 5KOHA 4FSDA 2MR6A 3C4QA 4LHYA 5KTYA 1T91A 4HLNA 4W5JA 3PPVA 3E9NA 1SIWA 1JHRA 1YBHA 2BFMA 3PG5A 3KC2A 4YXWA 1ATZA 1Z34A 3EVFA 2IL1A 4L08A 1K3TA 1Q0RA 3FYDA 2D2IA 5B2ZA 2MSEB 5L6MB 4Q6WA 2IF2A 2PZBA 3EXEA 1KIFA 3T5BA 3SY8A 5E2BA 4Q3DA 2IX9A 4MVJE 2ZPTX 4E1VA 3AM4A 3O2SB 1RLIA 2HXGA 3TDKA 4X1IA 2O2DA 1MEJA 3CLKA 2FK7A 3QOXA 1RLMA 2CLSA 1XVVA 4M89A 5FL3A 3SZRA 1I13A 3ITKA 1RLOA 3LZDA 1HTTA 3DD1A 2NSDA 2YYAA 1AMNA 4C7OB 4PC7A 2Y1EA 3RIEA 3SEFA 4ZV4A 1QVWA 4UXIA 4AD8A 3PJRA 4KBGA 4MHTA 1X9GA 1GLNA 4S04A 3AWDA 1XU9A 2OILA 3FYUB 3HE3A 4GM0A 2ZK7A 3KQSA 4ERNA 3PT9A 2V97A 1V1JA 3O3NB 5LYJB 4MP6A 2YRFA 3MINA 5JNVA 1AKRA 1IVNA 2MMCA 3F5SA 4YRPA 5K45A 2WJGA 1XTZA 3QJYA 5AICA 3VI3B 3AFGA 1CK4A 4MVXA 5CBPA 3VH4A 3PQ4A 4X71A 3JVIA 2GN2A 2VP9A 1YS7A 4GLLA 9LDBA 1KSFX 3E70C 5IU6A 8GPBA 3KVYA 3DF9A 3TRJA 1Y4UA 3RVJA 3SBOA 4DPLA 5DISB 2D2VA 5C2JB 2FDRA 2M98A 4DBLE 2YJ4A 1GEGA 1GAQA 4QELA 3GPCA 5HKOA 4LFCB 2FEAA 1KJWA 5LBIA 3RV3A 3WYCA 3C24A 1MVNA 3OJCA 3HB7A 4IGAA 4JL6A 3T3HA 4YUYA 1J8MF 1G60A 5CDSA 4LX0A 3PWZA 4MV9A 3RK1A 1G0OA 1KY2A 1E99A 2OZPA 1IN5A 3AHEA 1YZFA 2FNAA 1Y4SA 1T9AA 4RNCA 4FMCB 1SB9A 3E5HA 2V7GA 3I2YX 3OX4A 1T2EA 4L72A 1YCHA 2FWBA 3QVWA 1B0PA 1FNNA 1QOZA 2FQQA 2RHDA 4W5HA 5BNIA 1HF3A 3ENKA 1ZUWA 1S2GA 2H5JA 4HEA6 1FX0A 1S89A 4BU1A 3A3KA 4EA6A 1U3VA 1XK6A 1AQ6A 1JLLA 2QDXA 3EHDA 4IZ6A 5ALLA 2H0RA 4RZSA 3AT1A 4HRYA 5DSXA 1JQ5A 2AVDA 3JRXA 2EP8A 1ONBA 1X7YA 1XRMA 3PXAA 4Q82A 2M6KA 1OZGA 2DT8A 5F2NA 1DOZA 4MIKA 4RU1A 1GZ6A 2PKQP 1YWGO 2O9JA 2FPMA 3B1WA 1GRCA 1NNEA 1YO6A 1GZHB 2QLBA 2GXSA 3OLCX 4RPJA 4QFCA 2Y27A 1KE2A 4AG5A 4MR7B 1AGRA 3LV8A 4JHXA 1MTZA 3FNRA 4YCBA 5LU8A 2IVFA 1KKLA 2B5OA 4FKBA 2C5LA 4M86A 4DW8A 1YIDA 4IDDA 1UC4B 5EC8A 2QX6A 1RYYA 4BBJA 1I9CA 1ULAA 1VJTA 3K9FC 2WUVA 4E03A 4H4EA 2O0LA 3PUKA 2O8FB 2R6AA 4BTVA 1Y0BA 1L5RA 1FXWF 2RI6A 1SC4A 2YV3A 4B7UA 1BHO1 4N03A 1NATA 1PFGA 3I0MA 2JA2A 1CUEA 4Z6KA 1UIRA 3FBWA 2OC4A 4W8GA 1MF7A 1NMQA 1ENPA 2WMNB 4HOYA 4LXQA 2QRQA 4RIHA 3ROXA 1PJRA 2RK6A 5ERYA 2DPGA 1SZDA 2C3YA 1X2BA 2ZYWX 3HKDB 3Q0TA 3OQVA 4I66A 4LSZA 4Q3OA 1CZHA 2P2CA 1GR1A 3PPIA 5B3JA 3USES 1U2RA 3GRVA 3TSZA 1LC3A 3DAYA 3IP5A 2XVMA 2O4CA 1OLUB 4QT0A 1YBMA 1OCEA 3EZXA 3IUNA 2OCAA 2ZYHA 5FYQA 1C1XB 4EECA 1G59A 3D3WB 2M32A 4CLOB 2JLZA 1SEPA 3F1KA 4MRMA 3KOZA 4G84A 1XMVA 4E4YA 2DWPA 5I5GA 2JC3A 2ATEA 3E3NA 1H05A 4YALA 3TOCA 1ULSA 1UP6A 2B69A 3WL4A 4D98A 3STHA 5JAIA 4F11A 2BP7B 3MRSA 4UBMA 5ILQA 4ZI2A 2FZCA 4WECA 4UAVA 3KT0A 3Q3HA 4UASA 4Y6RA 2WV9A 3JQEA 2XKBA 2J41A 2Z98A 2D0PB 2CD9A 4MMXB 2O7VA 3WGOA 4HVCA 5L3RA 1QP7A 2A0KA 5JAPA 3JD4A 4F3KA 4N5HX 1ZICA 4GEKA 1QV6A 2JVIA 3HJBA 2IE0A 3OIGA 5ELMA 5JD6A 6LDHA 4MVJA 4PPYA 4XWYA 4Y7DA 1NHGA 2OV8A 5J1TB 3U44B 4L02A 2AUTA 2HREA 2I3BA 2FR8C 3ABSB 3Q3GE 1ACJA 4FFBA 2PIDA 1QWSA 3HCAA 3NTRA 2G25A 1GSAA 2I6SA 3X3HA 3WGNA 1SCAA 1MO3A 4M0MA 1E1QA 1F2UA 2O1SA 1ESDA 2ORED 3LSYA 4Q9KA 3Q2KA 3ILYA 3JVDA 3G5AA 1GTG1 1XA3A 2H1LA 3L5KA 3OZBA 4F2WA 1FXUA 4ZTZB 3FYCA 3LBHA 3R40A 1VPDA 2GB4A 2RJNA 1SCIA 2EP7A 4KUHA 2XI4A 5IAGA 4G9BA 4LGCA 3TJRA 2IS4A 1AO3A 2A67A 3EASA 2A2ZA 3I73A 2LCQA 3NIFB 3MTQA 3HB1A 5ALWA 2GCGA 4FQ7A 3G1UA 1RAIA 2BJVA 1GGJA 4E6EA 4EQ6B 1TK9A 1YJXA 3WMWA 4IIJB 1LC0A 3VU8A 1P4AA 3G7SA 4RABA 4AKSA 4GD3Q 4KMOA 3INRA 2CGEA 2AXEA 1DC8A 2Q1XA 3H9QA 5I8WA 1T0IA 4GRIA 4QA9A 3UV6A 2ZS7A 2R1TB 5LCXA 2EF0A 4C7XA 1Z4MA 1G7CA 2J6HA 3BL8A 4CLRB 4Y67A 3UJ3X 2PFGA 2VSYA 3DGEC 1O3YA 1XVIA 1OF1A 3SMVA 2P0EA 4UAJA 1IVSA 3LK6A 4JSYA 3BF7A 1AT1A 2QN8A 2GCOB 5KNDH 4YHHB 1UK9A 3LVFO 4UE6A 4YMHA 4P7JA 3PYMA 3KCNA 2JLWA 3VYSB 3GLRA 4F1JA 4PQGA 3N2LA 3FYHA 1QK5A 2XQVA 3SYMA 1HNXB 1J0XO 3NATA 3K0CA 3B3FA 4R6WA 1OKKA 1Y7IA 1VPEA 1LKZA 4JGBA 4CNBA 2B3DA 2I71A 4C6TA 1NG9A 1KNQA 1DKLA 3WLRA 1ZIDA 1UMBA 4PLTA 4CIXA 2X2OA 4W63A 2CXOA 3R6WA 4FYHA 4NBTA 3R9IA 1D09A 1WHTB 1C1YA 3E18A 1N1GA 1NVFA 2ZB2A 3PENA 1LVUA 2GESA 4IXDA 5G0WA 4B09A 3VA7A 4HWKA 1NQTA 2ZUFA 2W7TA 3R20A 4IQGA 2CHFA 3H0KA 1QQAA 4G09A 2CBZA 4RTRA 2IY9A 1UDBA 3N2NA 1FMCA 4HFMA 3W2HA 2Q1TA 2OTCA 2YVLA 3X1ZA 3R4CA 5BN3B 3TMKA 2C7PA 5BPHA 5L9AA 2P6PA 4KO2S 4OGLA 3CMMA 2IOYA 3GT4A 1NC3A 3IJPA 4XEHA 4RY0A 2NVBA 3T7JA 4XDGA 2O2GA 4CIVA 4UNQA 4DA7A 2QIOA 3COYA 3DHVA 2ZSBA 1MVOA 3HZRA 5DTEA 4I4TF 4C3OB 1FMLA 1W44A 4MGEA 4LWZA 1NDUA 2Q3JA 5EIAA 3T7DA 4ZQIA 1RRGA 3TZBA 5AR1A 1T0HB 4N0PA 3EF3A 1I7SB 1YJ8A 2F1JA 2QP3A 1PZFA 3K70C 5JNWA 1W36C 5KPJA 3WGLA 2O2HA 2XGJA 1U0HC 3NKVA 1PGPA 3OH8A 1DQSA 3FTQA 4DR1B 2Z2IA 1GSHA 4WMLA 4S24A 4P54A 3M4XA 5DI3B 1NVGA 2A84A 2UVQA 1OPXA 1SD5A 4RJLA 1DWQA 4MUGA 1XL0A 1W4ZA 2BF4A 3R3ZA 2WINI 4MV3A 1NJSA 4HAOA 3V8PA 4PG4A 3X1DA 2RKOA 1JR6A 2P6OA 3RK0A 3EGCA 4JI4B 4ZGGA 1Q0SA 4W5NA 2Y1OA 3URKA 5IWAB 2X0FA 2RONA 3AUTA 5CFQA 2QD4A 1CUAA 1LDBA 4NEGA 1RFGE 5A1JA 3EDMA 3EYAA 4PLFA 2GBLA 4Z3DA 1ZINA 3GV0A 4FJ1A 1A98A 4EF4A 3B6IA 3W2GA 4IHAA 3Q5EA 3O8OA 4BWGA 4LC9A 3QPUA 5TPZA 4RULA 2V5VA 3G7NA 3OOHA 1W9MA 1GYQA 5TMBA 1ZZGA 2PGOA 3TTSA 1NHWA 4A1FA 3QPBA 3WRWA 3K9NA 1NL3A 3NTUA 5INTA 5CURA 1CVRA 4Q3LA 1MX3A 3RBXA 1TM4E 4MPPA 4BKQA 1FLNA 1Z6ZA 3SWWA 4Q1FA 2N1MA 3JD2A 1XFDA 1E1NA 4GOOD 2QM0A 4E5SA 3W5BA 2HYDA 3GDOA 3SQWA 1N34B 1QQBA 1EE2A 1DV1A 1YUBA 4EHDA 3UHOA 4EHFA 4DKJA 3ZU5A 4LE0A 4OL9A 2VNSA 3Q8KA 3EXIB 5A3QA 2ZVQX 4BJ3A 4R0VA 1W48A 5JQGA 5GVRA 2FG6C 3BGDA 4MDHA 5KTTA 1NVEA 3ANTA 3FVTA 1NR5A 3LVBA 1TCUA 3H11A 1B4DA 4J2TA 4PYOA 1GNTA 4KZPA 4Y1RB 4ZDKA 4EHJA 5JBQA 2F9FA 5KREA 2FWAA 4IS2A 4HQLA 4AJ2A 3VO1A 5FR1A 4NC9A 3VYWA 4TL6A 1SHUX 2GZAA 2Q46A 5G41A 5BYBA 4AZSA 2A86A 4F38A 4YCMA 3UGKA 3EXFA 1PHPA 3AVPA 4CV0A 3O38A 1N8NA 2EF1A 3LXUX 4C22A 4KL8S 5KTKA 2J9RA 1JLKA 4JBXA 2D13A 5AFSA 3DLHA 2G82A 5ALOA 2ICAA 3V2UA 3SDZA 3LCJA 1FDIA 1Z3CA 1WM1A 2AG8A 2NVWA 3H3JA 4R51A 5HDBB 5A7GA 1AX9A 1VLVA 3IVMA 3HKCA 3PFKA 4I9NA 2F7SA 4JP8A 1T5LA 3WQHA 4UBOA 3AUSA 4E2ZA 2QSJA 4LXUA 1TMYA 1SZCA 4L8LA 2GR9A 4MWBA 4GBJA 5KVSA 5KNDA 1MRZA 1EUDA 2QE6A 4JLPA 3NQ41 3VR4H 1GKIA 5JAZA 2BH2A 3EHEA 2GZ1A 3CS3A 2Q6IA 2BCGY 1PNRA 3GRCA 4YLGA 2QLTA 2X41A 1XXHE 4EZIA 2WZCA 1YJBA 5IC6A 3CZ5A 1KYIA 4G5HA 4R2WA 1AZTA 4D2IA 5IJ9B 4HZGA 5A5GA 5C8YF 3GRRA 3PKZA 1N32B 2FMIA 3AZOA 1DIAA 4Y9SA 1JZSA 4IOJA 3SBDA 4JC8A 3ZQ4A 1UWKA 2QJRA 2V1UA 1JI3A 1NKVA 4UCXA 3AX6A 2ZRNA 1ZUD1 5CITA 6REQA 4AW9A 4BXOA 3H42B 3TLKA 2P4QA 4HDKB 3ITEA 3H1FA 4DR3B 2LTAA 2ZRGA 2C2WA 4IOMA 4DQVA 1V6SA 1AK9A 4S35A 5DMXA 3BBLA 4HR7A 1N3IA 3L46A 3O31A 3QLUA 4BECA 2Z95A 1NU8A 2FSVA 2UUBB 3NEPX 2KQUA 1DJQA 3PQ5A 3GGDA 1PW5A 4HD8A 2FPGB 2QVGA 2FEWB 2X14A 4KR3A 4LV8B 3P32A 3K9HA 2H29A 1X15A 2IP4A 1PJTA 1A4UA 1DLIA 1USWA 3DZBA 4D6PA 1QU2A 4JYAB 2IEZA 3JQGA 4Q15A 4B83A 2PD3A 2HADA 4D6XA 2XMQA 3E1KA 4KGDA 4YWHA 2BFCB 1Q0HA 1WDKA 2O3TA 4DC0A 2AOVA 2Z5LA 4PO9A 2PXXA 3IVGA 4XCXA 3C3AA 1QPZA 5CA1A 3L2OB 1JQ3A 4IHKA 1NRIA 3HCOA 3AFOA 1IY1A 3L7IA 2VJMB 4ND1A 4OVKA 3LUBA 5FD8A 2WKRA 4UQOA 1ILEA 3T5MA 4P3YA 5KIAA 4LTMA 4GLOA 4QLAA 4GPD1 2XUJA 4ISCA 1G6Q1 4HI0E 4N3CA 1N8KA 1XP5A 2FUG1 3D3JA 3G9XA 2WYUA 2ZTLA 4BGIA 4GZLA 4FHDA 3WKCA 5C46F 5I7RA 1JE1A 3COVA 3O2JA 1Z2AA 4FWIB 1JR3A 4BMXA 5TIIA 1J4AA 1IIBA 2YWJA 3DL2A 4YLEA 3SBXA 5EYPB 3P9QA 5KDLA 1SU8A 4ER7A 5HR5A 3LC7O 4N0DA 1ND5A 3CLUD 3L8HA 1QTQA 2AJ8A 4WCDA 2AHOA 1SQ5A 4BUCA 1ORRA 3W3ZB 4LDNA 3CY6A 4RL4A 1RS0A 1XL1A 2B4TO 1GZUA 3FRIA 3SICE 4DV3B 3RC8A 1W30A 4WKOA 2AK2A 1T43A 4MWOA 2IHNA 3LDFA 4HAIA 1M6EX 3N2YA 1K8RA 4QEKA 1G20B 1KY4A 4U7TB 3S2FA 2FP3A 4PZDA 2WUFA 4P86A 3RYTC 5LA6F 4U2DA 1TTHA 3NOOA 2NQ2C 1V7CA 1XIVA 4IBOA 1NVAA 1ZJ4A 4XVCA 1EJ0A 3TS1A 2DLNA 2ZJ6A 2FEOA 3A06A 4M8LA 1L7OA 2HY7A 3W90A 5L6LB 3FG9A 3LX6A 3SF0A 4O02B 4WKBA 5H80A 1JUDA 1QH8A 3JQ9C 2VHCA 3GCWA 1H8EA 2VQ6A 2VWGA 3AESB 4O8ZA 1KSGA 4BKPA 1IC6A 2W2OA 3JD0A 4F9EA 4FDTA 4NMWA 2CMDA 5FORA 4IJUA 2Q62A 3KSAC 3THOA 3OZTA 3DDZX 4F45A 3EQ8A 1R00A 5FH9A 2Q7OE 1OFUA 4H6PA 5GZ1A 2AHRA 4OX9Y 2EL9A 4EI7A 3HGQA 3TLMA 1XMXA 4TLCA 4XWKA 5AVJA 1YC5A 1I3CA 1IBCA 4L75A 1XHLA 1O94A 5JCZA 3DM5A 3G23A 3M5PA 1NY6A 2Q4TA 1K63A 5EIOA 2E82A 2VQDA 1J0DA 1DIRA 1KDZA 3Q9SA 4CMIB 1FSSA 4I3GA 1LWNA 4FMCF 1QRRA 2IHVA 4GUAA 1C8LA 1P44A 3DULA 3F46A 3Q12A 5E95A 3CNBA 1P5FA 4P32A 1TFRA 5EAIA 2XQIA 1J6UA 1SK9A 1O4VA 1XKTA 2DERA 2XTJA 2IS1A 3HCWA 2BAGA 3H1TA 4XA8A 3CZAA 1ZVJA 3SHVA 2CFRA 3VVCA 3RARA 1KKMA 1OTXA 1ZI9A 2HO5A 2F4VB 4KYVA 2E18A 1P61B 4FHCA 1AGPA 3PP8A 1X14A 5KVVA 1T6BY 1LBIA 3SIWA 3CSDA 3GAZA 4MICA 4O2AA 3M9XA 4NZNA 5DJ5A 2OGTA 2NZXA 3B48A 3M5CA 4N4AA 4PLZA 1R0XA 2GK4A 5BSTA 1T1JA 1B73A 5BMVF 3ICQB 1WNFA 2AG6A 4M6WB 4QGBA 1GNLA 1N5DA 3IDOA 4Q3KA 5CVJA 3S1LA 4EL0A 1F6BA 4I50A 2FFRA 4QRDA 2CXXA 4MYCA 5C1PA 1U63A 2HV9A 3EXG2 3M3DA 1PZHA 1K7EB 1ONOA 5GJCA 5IXYA 1QFXA 1P77A 2VBFA 2WAYA 1XG5A 2YIVX 3MS2A 2ZATA 3P0EA 1RM4A 5BNFA 2VK8A 1ABEA 4GVPA 4X94A 2GWHA 2ZFUA 2PSDA 3EVAA 4LY6A 3DZIA 4KIWA 5DGDA 4HDQB 2JGJA 5FBQB 3V1TC 4D4LA 4GKJB 4FWTA 2VUIB 3IH5A 2XMSA 1TUEA 1AH2A 2V98A 3G0DA 2VXCA 3K1AA 2DR3A 4QPPA 1KIMA 1GZ7A 3SAJA 3HRKA 4B3BA 4ZCIA 3VC1A 2ZTMA 4KX5A 4DB2A 1XZPA 2ONCA 1MAHA 2HJVA 2P9CA 4QFBA 4AZ0B 2PANA 3DCJA 4AK9A 2FW9A 3OZEA 3V6LA 4GOXA 2ZT6A 2EBWA 1PR6A 1BEZA 2VQEB 1AGNA 3HL4A 3KQOA 5GM1A 2RGEA 5F7XA 3D8NA 4YRDA 4Z2YA 4BO2A 2IY7A 3VBCA 1AF4A 2ZWAA 3BWEA 1QZUA 2Q8NA 4GYYA 4RANA 4XWAA 3VKWA 2H1WA 3E9QA 3HDHA 2QN9A 2Z2XA 4KIUA 4ND4A 4DCUA 2PR7A 4MSUA 4YFYA 4FLEA 2P8JA 5FWYB 2ZUTA 3UT0A 3IODA 1IB6A 1U3FA 2J07A 4RA6A 3FOZA 5SYNA 5T5QA 1NVBA 1YONA 3Q98A 2FB9A 3WIUA 1P3DA 4TTPA 4X6XA 3GJ0A 1XCGB 2HLPA 3L9XA 1FMJA 3X1MA 3QXGA 1IY9A 3E0QA 4YHBA 5TDHA 1KI7A 4DMKA 4F21A 3VPCA 2QK4A 2NU8B 4CQLB 4R2KA 1FYXA 5AI6A 4CMGA 3A9RA 3C7CB 4ARZA 5JH7F 1MB2A 1ODSA 1Y1QA 4IHJF 5E7JA 5LMNB 2IYYA 1YZKA 2OZVA 4KQMA 1JTVA 1O96