4WUVA

Crystal structure of a putative d-mannonate oxidoreductase from haemophilus influenza (avi_5165, target efi-513796) with bound nad
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
280
structure length
280
Chain Sequence
NIAANHNLENKLIIITGAGGVLCSFLAKQLAYTKANIALLDLNFEAADKVAKEINQSGGKAKAYKTNVLELENIKEVRNQIETDFGTCDILINGAGGNNPKATTDNEFHQFDLNETTRTFFDLDKSGIEFVFNLNYLGSLLPTQVFAKDMLGKQGANIINISSMNAFTPLTKIPAYSGAKAAISNFTQWLAVYFSKVGIRCNAIAPGFLVSNQNLALLFDTEGKPTDRANKILTNTPMGRFGESEELLGALLFLIDENYSAFVNGVVLPVDGGFSAYSGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase
publication title Crystal structure of a putative D-Mannonate oxidoreductase from Haemophilus influenza (Avi_5165, TARGET EFI-513796) with bound NAD
rcsb
source organism Haemophilus influenzae rdaw
molecule tags Oxidoreductase
total genus 90
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wuvA00
3RUHA 1ULUA 3AUSA 3E03A 4CUKA 4CM6A 1PS8A 1TT7A 2X0NA 3GVPA 3ZWNA 4A7PA 4J90A 1O8CA 3ICPA 3GPDG 5JLAA 5A3VA 5CEEA 2P9EA 1E6UA 1FDUA 4HFJA 2GR9A 3KRTA 1QSGA 2X86A 3DEYX 2OFPA 1WW8A 2PKQP 4RZHA 3ZWBA 3EVNA 1N8KA 2DM6A 1R4NA 2VTDA 1S6YA 1MC5A 1Z7BA 4NQZA 3WG9A 3OJOA 3A1NA 3KETA 3GFGA 3KUXA 3AW9A 4IDEA 3DHEA 3LT2A 4LN1A 3D4NA 4IM7A 2QQ5A 4YACA 3Q2KA 1BXGB 3IAHA 1AGNA 4O59O 5ITVA 3H65A 4BMVA 1BVRA 3PIIA 4XQCA 4OXYA 4TVOA 1DLIA 3H9UA 5DN9A 3WGTA 3E6AA 4EW6A 5JDIA 2OO5A 2VHVA 3EZLA 2RH4A 3PHGA 4B8WA 5C3MA 3OSUA 1BRMA 3JQAD 4U7WA 3VDRA 4KUGA 5EIOA 4ZQFA 4E2YA 2C29D 4Y6SA 1NFFA 3FR7A 4IDBA 3PZRA 4YTEA 5F1OA 1XKQA 1YKFA 2PGLA 4L75A 2ZYGA 4GLOA 1TXGA 2V65A 1N1GA 1VM6A 2FR8A 2NU9A 3IP3A 3WYCA 4KDFA 1D4FA 5A9TA 2DBVO 1QYWA 4DMLA 4I1IA 4RPLA 1PGJA 2BGLA 5LCXA 1DIBA 4ZQGA 3CINA 1LJ8A 3EAGA 3WS7A 4R1TA 3PIDA 1XGKA 3WTBA 4ND1A 4L8VA 3LQFA 5IN5A 2ZTVA 5THQA 4RVHA 3L4BA 3RWBA 3AI1A 5JYEA 1C1DA 1SC6A 1ISIA 4JP2A 3H3JA 4K6CA 1O0SA 1C14A 3QVWA 5KNLA 3DOOA 1EE2A 3K30A 3ZWCA 4EEZA 2GLXA 3NJ8A 3W4JA 5LC1A 5I9MA 4YJHA 4YJFB 4IY1A 2NVUB 3UAGA 4XJTA 3GVIA 4IQ8A 4OM8A 2OXIA 4IMRA 2CVQA 4PFJA 3WXBA 2Q45A 2PZMA 5K0ZA 4RPKA 1GY8A 2B69A 3E9QA 1SEPA 1EDZA 4DIFA 3IQDB 4Z0HO 3DC2A 1N9GA 4EJ0A 3TZHA 1VKOA 4FW8A 4YVFA 3IP1A 3UKOA 1EK5A 4IQ0A 3ZU3A 5DULA 1J0XO 1VRWA 4GMGA 3PEFA 3WGOA 3WLFA 1LSOA 2H9IA 3JQBA 4XYLA 4DQUA 4D3DA 3DBRA 1J49A 2C20A 5CPFA 2EHDA 4FJ2A 2ZB3A 3C3XA 4RDHA 4CV1A 1NBOA 4FCCA 4BO7A 3GRPA 3GLQA 1PL7A 4IZIA 1U1IA 1LSUA 4NDNE 2X9NA 3LSYA 2W4QA 2YDYA 4RL6A 3OBBA 1E3WB 1RM0A 2AEJA 4OSPA 3JQ9C 4MO2A 2EIHA 1JWBB 4GKVA 3D7LA 1DLJA 5TT0A 1ML3A 2AMFA 1GPJA 1H6AA 1I3LA 2GNAA 5GY7A 1MUUA 1EBUA 1LBEA 3OICA 1DDOA 1S7CA 3AM3A 3G79A 2ZIZA 1YL7A 2O7QA 2I9PA 3N74A 1LRLA 4NG5A 5A5EA 2BI7A 1DB3A 1XHLA 4WCDA 1ZK2A 4MVJE 5B4TA 2VUTA 2Y99A 2EEZA 2JHGA 2G82A 1HE3A 2O50A 3ZWAA 4J9UE 1LLCA 1EVIA 4D79A 3ZW9A 2FOIA 1VL0A 1HDXA 1PQPA 1QMGA 2V6GA 3RFXA 3I9NA 2BKAA 2X9GA 4ZA2A 3PLNA 5JPIA 1R4MA 2E82A 4PZCA 3INTA 1O94A 3DL2A 3WIEA 4BVAA 4TRMA 1X15A 4FFOA 2O4UX 5DBGA 1W4ZA 2Z95A 1X13A 3RASA 3OA0A 5A3JA 3G1UA 4DA9A 4UULA 1NFRA 2CFCA 1ENZA 2VTEA 2JFFA 2I76A 3OIFA 4JXKA 4W7IA 2UDPA 5G0UA 1E77A 4CLHA 1GFSA 3EYWA 4HFNA 3JQGB 3E48A 1XEAA 4TSKA 1WWKA 4F6LA 2D5CA 2YFHA 2EW8A 2AE1A 3ZNPA 1M6WA 4E12A 3BTSA 3LT1A 4HV4A 3GVXA 3KO8A 2VRCD 5CPBA 3QE3A 3WNVA 4MVJA 1H9AA 3QY9A 1ZMTA 1GPDG 4PGFA 4J1TA 4CJXA 1ZIDA 2BGKA 1O5IA 4R1SA 5TJHA 1XQ1A 3ABIA 3EZYA 4K6FA 1BTOA 5GMOA 3WDSA 3H5RA 3E8XA 5ILOA 1MLDA 3GZNB 1GZ3A 4I9NA 3MTJA 4PG4A 1JKIA 2PH3A 3Q6IA 3D3WB 3ANNA 4BL5A 1HDOA 4ZVVA 2DQ4A 4RQUA 3DZHA 5KVQA 4B3JA 4FR5A 1ENYA 1VE9A 2PR2A 5FWNA 4ZGWA 2YW9A 3TRIA 3KB6A 1Q2XA 3ICCA 5JCXA 1T2FA 4E30A 3S2GA 2NNLD 1P77A 1LEHA 3PGJA 3PWKA 2E37A 5BSFA 3U09A 5FYDA 1H5QA 3V1TC 1SBYA 1XELA 5GZ6A 4EI2A 1T2CA 4ILKA 4U8GA 3CPSA 3H6KA 3IC5A 3P19A 1IZ9A 1OBFO 1E7WA 1U9JA 3HFSA 3HQ4O 2W2KA 3OA2A 4BGUA 1NPYA 4Q3AA 2A35A 4QO8A 1NVGA 2EP5A 2ZK7A 1LQUA 1I8TA 3MTGA 3FHLA 1YQXA 3JQFA 4CMBA 5BR7A 1N7HA 3VKUA 3MEQA 4J2OA 2XXBA 4BNGA 1GCUA 3DZJA 4RVFA 1KYQA 4RVUA 5FF9A 1ADBA 1D1TA 4W9NA 2W90A 2EERA 4QXMA 4YRDA 3T7CA 4FJ1A 3PRJA 2PTGA 2FPGA 3BA1A 3H9QA 4BGVA 2CDBA 1FJHA 1DIRA 2SCUA 4BGEA 2HSDA 2UAGA 2D8AA 4OMUA 4CMGA 1I3MA 1B26A 1B8PA 2IRWA 1PZFA 1IOLA 1GADO 4BV9A 1RYEA 4OOFA 4PCVA 3VHRA 3WSWA 4EJ6A 4XB2A 3S55A 4CM8B 3RCBA 3AOEC 4IBOA 3BMNB 3GNTA 2W2LD 3NGLA 3C85A 1Y6JA 1YONA 3HUDA 1OOEA 4GWGA 5L53A 5ENVA 3CE6A 5H82A 2B5VA 4RORA 1I32A 4PLGA 2VN8A 3PHJA 2FZWA 1PU2A 3JQEA 4BNXA 1JAXA 1PGPA 1TT5B 2P5UA 1E7YA 4WLVA 4D0SA 1T2EA 3JQ7B 4QO7A 3MJEA 1XCBA 1EUDA 3WFIA 2NVBA 5C7OO 1DFIA 1NAHA 1PX0A 3GUCA 4II3A 4BKUA 1UDCA 2E6UX 4A03A 3U49A 1IULA 3GN2A 1PZEA 2RHRA 4N5LA 2WM3A 5CDYA 1KEVA 4CQMA 2BRUA 3FWNA 3K8ZA 3NAQA 3S2FA 1YB1A 2E49A 1ID1A 5A05A 5ADHA 3WJAA 2PD4A 5KVCA 1HE4A 3G3EA 5F1PA 1DHRA 3GFBA 3KYDA 4WUVA 1F06A 3V5NA 3AUAA 1U3UA 4J2HA 2XOXA 1MGOA 1XG5A 2DBRA 3GT0A 3DFUA 4R69A 4IS3A 5KIAA 3ANMA 4LSMA 3WNQA 4XCVA 1OMOA 3H5NA 5KVSA 1EDOA 1RYDA 2BFOA 4UUNA 3F9IA 4XYBA 1YB5A 4PIVA 3RQSA 3WB9A 3DOJA 3VC7A 1YJ8A 3BMOB 5TS3A 3AY7A 8LDHA 4RO0A 1YBAA 1HZJA 2HKIA 4NPCA 2IODA 3DBHB 2DPGA 3MOIA 2E4AA 3AUTA 1ZSVA 4A10A 2IZ0A 3F3SA 1ISGA 3CH6A 1GUFA 1V35A 3GN1A 3W8EA 4INAA 1I3NA 2Y0DA 4WEQA 2HLPA 1LNQA 1HSOA 3ZU4A 4J7UA 1SO8A 4FS3A 3GHHA 4XA8A 1Y8RB 1EMDA 4Y98A 4TRNA 2QYTA 2WD7B 1UZNA 3GK3A 4E3ZA 1HDYA 2VOEA 4A2CA 5B12A 2PKRA 2I65A 3Q9UA 4ALNA 3QLJA 4LW8A 5EMHA 3HJAA 3KBOA 1ZVMA 3AY3A 1JW9B 1EE9A 2YV1A 3TWOA 2YJZA 3S2IA 2GRAA 1QV6A 2J3IA 2QW8A 4MIEA 4U6QA 8ADHA 2JCYA 3VZSA 1N1EA 2B4RO 4M87A 4A26A 1YDWA 2NADA 1YRLA 4DQVA 3MWDB 1DHTA 1E1NA 1E7SA 1EEHA 1PGOA 3DHYA 5DOZA 3A28A 3OIGA 3WGQA 1R4NB 4Y9DA 3EHEA 1IZ0A 2X22A 3D3WA 3WGGA 1KBZA 3DBVO 3UF0A 1H2BA 4DPLA 1E7RA 3LK7A 4NJOA 3QV1A 1ZUD1 3ROQA 2D59A 3BMQA 3OHSX 2C54A 2NM0A 3F1LA 3DHNA 3VZRA 2YFQA 2GZ3A 3IJRA 1JKFA 3K9QO 4B4OA 4J9VA 1XR3A 3GEGA 3GAFA 3WBFA 4CM4A 3OJ0A 4GBJA 3QRWA 1WLYA 2X5JO 5KWEA 3PYLA 4J1SA 3ZWYA 4B8ZA 4I8XA 3AK4A 4Q3NA 2IZZA 5JY6A 5TQVA 1C0IA 2RCYA 3H9JA 2PH5A 3SLGA 2YDXA 1Z6ZA 4M49A 1GZ6A 2P4QA 4EDFA 4ND3A 1AUPA 3VPFA 3TFOA 3U4CA 4XQ9A 1LLQA 1V3TA 3WSVA 4Z0PA 3ZU5A 1F0YA 4BIIA 2ET6A 1PJ3A 2Y68A 4OSOA 5JAQA 3JQAA 1GDHA 2PZKA 3M2TA 3I4CA 4YB8A 3NJ4A 3RBZA 4EEXA 4W4TA 3PJFA 4EZBA 1K5HA 3IOYA 3NTQA 5G0SA 2AXQA 3RFTA 3JD3A 2CDAA 4I9HA 5CDGA 1WDMA 2Q2QA 2QRLA 2ILTA 2DFDA 4XDZA 4FDAA 3INGA 1F12A 1YOVA 5COBA 3ZWMA 3KYCA 5BNFA 3F5QA 4M8SA 1L1FA 1HYGA 4E0BA 4E33A 2RBEA 3FF4A 4Z0TA 3CSDA 3GUYA 4Y6PA 3C7DB 3UXYA 2HQ1A 3KXDA 4ONEA 3ULKA 2IXBA 4DBVO 3GNQA 4GX2A 4DMMA 1UXGA 3SJUA 1DIAA 3RFVA 4AG3A 1T1SA 2BH9A 3STHA 2R6JA 3GVHA 3JQ9A 9LDTA 4N54A 2PFGA 4JX8A 4YJHB 3A14A 4BGIA 4L74A 4XD2A 4DIOA 2X5OA 3TOXA 3SVTA 5FFFA 5KCZA 4O63O 3ZU2A 3HFGA 2HAEA 3OH8A 4CMEC 1ZEMA 3QA9A 5I7SA 1ULSA 2B36A 5I7FA 3HN2A 1DFGA 1FDTA 2DU8A 1GYPA 1GR0A 4YJGA 1N9GB 3FWZA 4JNKA 1CIVA 3ADOA 1ONPA 1R0LA 1M76A 3DAFA 4XKJA 4Z9FA 3FSRA 7MDHA 4FFMA 3DWFA 3UCEA 2Y1EA 3CIFA 1GYQA 2FPPA 4KOAA 4RF2A 3K31A 2ZKLA 3LT0A 2JL1A 4GGPA 3VTZA 3PDJA 1QP8A 1QV7A 3DBRB 4XQGA 4ZRNA 3UOGA 4E2XA 2OHXA 1EVJA 2WSBA 3DXFA 5BSEA 1IB6A 2CVOA 3L77A 2BI8A 1CDOA 3L9WA 4OKIA 4QX6A 2HUNA 2Z5LA 2PGDA 1UP7A 3PQFA 4XIYA 4J3FA 1YB4A 1E3IA 1MG5A 4UEKA 3COSA 1HT0A 1GL3A 4YYZA 2FWMX 2P5YA 4LCJA 3N7UA 4B7UA 3AM5A 1Q7GA 4JN6B 3Q1LA 4WEOA 3RIHA 3EGOA 2VWGA 3QJ5A 4XRRA 5JDCC 2C82A 2Q2WA 4RPHA 3INRA 4QT0A 2HU2A 3AI2A 3C1OA 1MV8A 2J8ZA 3C1TA 1HDZA 5KJ6A 2AHRA 2O3UA 4CPDA 1NHGA 2EGGA 1MC4A 3M2PA 2DUWA 3DOCA 5LDHA 3CZMA 3Q2IA 3TZ6A 4B4UA 1NAIA 4D3FA 1KVTA 4J0FA 5LDGA 2PA3A 4QUKA 4D43A 1GCOA 5TT1A 2C59A 3PJGA 3QWFA 3O9ZA 5I8ZA 3W8DA 4BO9A 1NFQA 1EUZA 1CF2O 2GCGA 4WLEA 5IZ4A 1VSVA 5COQA 4B4WA 1LDNA 4KMSA 5FEUA 2QYSA 1Q1NA 1R4MB 1T4BA 1VL6A 4P22A 1ZXBA 4BNMA 5ER9A 3C7CB 1KIFA 3GY0A 1BW9A 1DRVA 3JSAA 4RF4A 1XSEA 3GA0A 1RKXA 1EVYA 1UR5A 3NYWA 4MVJM 1FDWA 4FN4A 1YQDA 1PEDA 2Z1NA 5JCJA 1LSJA 4AJNA 2O3SA 3VPSA 4CL3A 3S1LA 1KC3A 1E3EA 1A4UA 2CNBA 3RUAA 2VUUA 1GV1A 1Y81A 3IMFA 3RC9A 5A9RA 2CDCA 4RF5A 4YAIA 4YT8A 2ZYDA 1BSVA 3TZKA 1XQ6A 2O3QA 4AVYA 1KVRA 3KOUA 3GNSA 1GAEO 3PI7A 1NX6A 2VHWA 4MKXA 3VKVA 2VRCA 2B4QA 3ROMA 3K5PA 5C37A 1C0LA 4X54A 3I9KA 4OAQA 3TN7A 4R1UA 2XPCA 2YYYA 4QSMA 1PJCA 1QG6A 2Q46A 5JC1A 4LVUA 2ZJ1A 4JBGA 4TZKA 3NDJA 5H83A 3UW3A 4CM3A 4FB5A 1J5PA 1P1HA 5BNTA 1YWGO 3ADPA 1R16A 1V8BA 3H2SA 1LLUA 1X7DA 1I3KA 2W98A 4LISA 3HDHA 3R3JA 3B1FA 3PWZA 3HE3A 3I9OA 3QWIA 4PG7A 2OP1A 2ZYAA 1AE1A 4KTTE 4CUJA 5BT9A 4GX5A 2IYOA 3E82A 4XQEA 5T67A 4DLLA 4MVJI 1B0AA 4AJ1A 2JJYA 1P33A 1FMCA 3ETEA 1E7QA 2PK3A 3AOEA 3DZGA 3EVTA 2W2KB 3PWSA 3PZBA 4WCFC 5A06A 5ITWA 1WXDA 3GQVA 4D42A 1HE5A 2WEKA 4XR9A 1GUZA 3I9MA 3O8QA 4YCAA 3H3FA 2BHLA 4MVJF 4WKGA 2JD0A 2QZZA 4J4HA 3W6ZA 5AXBA 2VZ8A 3ZHZA 3WX0A 1ENOA 4F6CA 3P5SA 1UUFA 2AQHA 3H4VA 1T26A 3PQEA 1IE3A 3ITDA 2WTBA 1EVZA 4JBIA 5JO0A 1DFHA 1UJMA 1UP4A 4YQZA 2B37A 2YHUA 3ORFA 4EITA 4NU5A 2CD9A 2LDXA 3FPLA 3I9LA 5IDWA 3LYLA 3P2YA 4ZU3A 5JY1A 3JD1A 3JYOA 4IDFA 4J7CA 3NGXA 3QIVA 2ZTUA 1U3WA 3HG7A 1WNTA 4MJLA 1P31A 3JCZA 1HSZA 1CETA 3IL2A 5AXCA 1UXIA 2Y66A 1TI7A 4YAJA 1ZK1A 3KSZO 3FNEA 4W82A 3DFZA 4PRKA 2QX7A 1BDMA 1EZ4A 5HRUA 1MB4A 2ZQZA 2NU6A 4DPKA 3GMSA 1DJNA 4UREA 4RV9A 3UICA 4GH5A 2FR1A 1PJQA 4YA6A 5AYVA 4AFNA 1J4AA 4D46A 1WZIA 3MJ4A 1M66A 3JQDA 4UVDA 4RCVA 1P45A 3B20A 1UAYA 3PJDA 2VYND 2HMUA 3TL3A 3DMYA 1Y7TA 1Z45A 4ND4A 2X58A 3DTTA 4KQWA 3ASVA 2EGHA 1YVEI 2VWQA 5C5IA 3GEDA 4PLVA 4RPJA 1SPXA 4B3HA 1HKUA 3NKLA 1H93A 2FP4A 3DZIA 2Y0EA 1U4OA 1JQBA 3L0DA 5BQFA 5CAEA 2NV6A 3D3EA 3PDUA 4PLZA 2C5EA 3WQRA 1LU9A 1PJTA 4CQMB 4DQXA 1Y9EA 5U9CA 4IJKA 2PGJA 4ALIA 1JLLA 4YPOA 1ZJYA 2PKQO 1NTOA 1TLTA 3HADA 3TSCA 3VH4A 4E5YA 4CMHA 1OAAA 3NT2A 1B15A 4Q9NA 2R2GA 4IZHA 4M86A 3KYDB 1TA4A 5HS6A 3B6ZA 4BNUA 1AN9A 1P44A 4E13A 3D4OA 1GEEA 3FR8A 4NIMA 5ILGA 2Q1WA 3O26A 3OMLA 3RKUA 4RGBA 1V6AA 4A0SA 4BO3A 4TZTA 3GZ4A 1ZH8A 1RM5A 4L4SA 1X7HA 1V0JA 3PLRA 2X7HA 3HDQA 1MXHA 2Q50A 3MWEB 5DT9A 4IS2A 2Y1GA 4PZDA 1E5LA 1YE3A 2XXJA 1PWZA 1WMBA 4WPGA 4NBVA 2DTXA 4XJSA 3ZN2A 4GQAA 1H6DA 2J5QA 1N7GA 1W73A 4H7PA 5KKCA 2VUSA 5ES3A 4GKBA 1DJQA 3L07A 1A5ZA 3ZV4A 1ZK4A 1U3VA 4BKRA 5TX7A 4TQGA 1D8AA 1T24A 2BMAA 3A4VA 1HETA 2V6MA 1Q0HA 2VZ0A 1ISMA 1Z7EA 1P9LA 2C0CA 5IF3A 5JAMA 1LDGA 2P2SA 2LDBA 4ALMA 4BV8A 4R68A 4IDDA 1C1XA 4P4GA 4NBRA 4LSWA 1PWXA 1PJBA 1P1KA 4MP8A 4BO5A 5FI3A 2X6TA 3OFSA 3RC1A 2JCVA 4XWYA 4QQRA 3DB2A 5U1PA 4NFHA 1SB8A 3PPIA 2GGSA 2DTEA 3U0BA 1QYVA 3QWAA 4GLLA 4K9DA 3DMTC 4OH1A 1A7KA 4WE3A 3LF2A 3DQPA 3GHYA 4GSLA 1U5AA 2TMGA 4IMPA 4MP3A 3ETGA 3ROPA 3U4IA 3SLKA 2R00C 1O6ZA 4JGBA 2Q2VA 5DP1A 3UHAA 2B35A 3BMQB 1T25A 2X0JA 4N5NA 2FZEA 4TRRA 3AI3A 3VH2A 1B8UA 4CM4B 4WOKA 1WP4A 2OMEA 3PYXA 1YH3A 3O38A 4CM1A 1SOVA 1MP0A 2C07A 3V8BA 3H7AA 4FFNA 4OGWA 5C7IO 2BFAA 1HEUA 5F3RA 4YAKA 2OBNA 1HLDA 4PG5A 3H9GA 3QWHA 1LXCA 1G1AA 3M6IA 1NWHA 1A71A 1PZGA 4HKTA 3ZDFA 4CMEA 2OBYA 4U0JA 4UVGA 1K89A 4H15A 1UXHA 2GN4A 4OHUA 4E2WA 1DSSG 1UZLA 3HSKA 2IEBA 4NK4A 3JQAB 5F5LA 1QKIA 4YAGA 3HWRA 1E7MA 4E5NA 4Y8VA 3PK0A 2DC1A 5HWSA 4EUEA 1QORA 2OZPA 1LRJA 5L4NA 4J4BA 1YOVB 2BELA 5JAZA 1D7OA 3KYCB 3RSHA 4CMIA 3R1IA 3ZHXA 1T4DA 3OEWA 3MJSA 3ST7A 5IXYA 4OKNA 3KTDA 4HP8A 1AHIA 4DIBA 1P0CA 3WMWA 4KDEA 4GWKA 4J7XA 1PGQA 4DC0A 1D3AA 2JFHA 2DKNA 2I99A 4ALJA 3FNHA 3RUDA 1FK8A 1U8XX 4U6SA 1ZO8A 1LQTA 4PRLA 1I0ZA 1BVUA 1U4SA 3ON5A 4BB6A 1H6CA 4D3SA 2O48X 1E0DA 2J3HA 3NX4A 2V6FA 3JQ6A 4F45A 1HE2A 1A9YA 1U2GA 4G5HA 4IDCA 1U7HA 3EDMA 1H2HA 4CMAA 1GV0A 1K6JA 2UVDA 1DPGA 5JDCA 1JKJA 4J16A 5T5QA 2YY7A 5DZSA 4Z9XA 1K3TA 3OM9A 3ZWWA 4CM9D 4EBFA 3WGIA 1E6WA 4FIZA 4RVSA 2GN6A 2O2SA 2O3TA 4IXWA 4YJGB 1DAPA 2DFVA 5F1KA 2P9GA 4UAGA 3TL2A 4MVJH 4ROSA 4TKLA 3ONDA 2A92A 3PP8A 1JU9A 6ADHA 4PZEA 5H81A 1UXJA 2QHXA 1YBMA 3KYBA 4GAEA 3D64A 3Q11A 5DOVA 3OEYA 4PG6A 4AJ4A 1YBVA 2DUUA 3AY6A 4RLSA 3PFFA 4R3NA 3ZV6A 3FNGA 1HDCA 1H0KA 2PV7A 5JYDA 4OOEA 3DTYA 3F1KA 4W6ZA 4ZHSA 1L7DA 2PLAA 2YZ7A 1G6KA 3IDSA 5G0WA 3K6JA 2NU8A 5DBFA 3RUEA 4WLUA 5AXAA 3GGGA 2PY6A 7ADHA 1B7GO 3A9WA 3DZFA 4ALLA 4DRYA 1ONNA 4EUHA 2O3JA 3ZH2A 2POQX 2FRDA 4LRSB 3RROA 4DGSA 3AOGA 2WE7A 1NQOA 1H94A 1JWAB 4BNTA 1ZK0A 4IGFA 1ZK3A 3V2GA 2Y1OA 1E92A 1Y9AA 4AJKA 2I67A 1GZ4A 4OQYA 3NTOA 3F47A 1I2BA 2AQKA 3P7MA 2O7SA 2Y93A 3BMCA 4ZICA 4CR8A 3U9LA 2AEMA 4RLHA 1RM4A 1ISHA 1IPFA 1Z82A 2WYWA 4GL4A 2CUKA 5KJCA 3L6DA 1OFGA 1LDEA 2Y0CA 1HTBA 1QYDA 5JW6A 4QFCA 1OC2A 2H5LA 1GYRA 3R3SA 4KWIA 1MFZA 1PJ4A 4CL8A 1RPNA 3W4IA 1U28A 4FFLA 4P8RA 4DXHA 2GASA 3CXRA 2JHFA 3OJFA 5ER6A 1BW9B 2IE0A 4BO4A 2X1HA 4NMHA 2GN9A 5JFOA 4PN3A 3CUKA 5L3ZA 2GZ1A 1H9BA 3D4PA 4MKRA 4FGSA 5CDUA 3GAZA 5L7WA 1N92A 1YQGA 2FSVA 2NQTA 2RIRA 3K73O 3VPHA 3JYLA 1DIHA 4BO1A 5BNIA 1VPDA 1YJQA 4UVIA 5ENDA 3SC6A 4WASA 4PLYA 1N2SA 4Y6RA 3OP4A 4B3IA 2O4CA 4BO8A 3OIDA 4WCFA 3U4HA 5A02A 1R6DA 2B5WA 3IS3A 2NACA 4PVCA 3G1TA 3KZVA 4DC1A 4R3WA 4R4JA 4TROA 5CHEA 1RWBA 2EV9A 3C1AA 2GUGA 1Z73A 5JAIA 3VDQA 2B4TO 4DLBA 1DO8A 5CG2A 3Q0EA 3JYNA 4XB1A 4HFMA 4OXNA 1F14A 4UUOA 2EJWA 5IXSA 4DLAA 1U3TA 3SJ7A 1PGNA 2EWMA 3ANLA 4OO3A 5JNLA 1CWUA 4IINA 4E2ZA 5T64A 4KP7A 1NWCA 4R54A 3H2ZA 4UVHA 3PYMA 3ZNQA 2P91A 1P1IA 2EKQA 4RPGA 4YAEA 3K92A 1CJCA 2VNSA 3UUWA 2G1UA 5L51A 3SEFA 2VRBA 3V2UA 4EYEA 1HZZA 3ETDA 1U8FO 2FR0A 1E1KA 5EERA 4O6VA 1B16A 3NDIA 4BO2A 3ZNNA 4DL9A 1JN0A 1E3LA 5A04A 3TDKA 1ZJZA 4PVDA 2JAPA 3A06A 3JQ8A 3LU1A 1KEWA 3QP9A 4JCOA 4M55A 3TJRA 1PR3A 4UEOA 3WFJA 3LVFO 3WGYA 4HFRA 4A73A 3V2HA 3I52A 4ID9A 3K2EA 2PZJA 4R41A 1T2DA 4XDYA 1GQ2A 3I3OA 3KLMX 2Q99A 5IJZA 3S2EA 1ZSYA 4ZJUA 1HYHA 3LLSA 3O8QB 3FRJA 5EL0A 1A72A 1KC1A 3GH3A 1E1LA 2ZB7A 1AHHA 4FQ8A 5DCUA 3BHIA 1X1TA 3R6DA 4ZN6A 2UYYA 3TQHA 1ZZEA 4Q3EA 3RJ9A 2DLDA 1I36A 4CUZA 4MIYA 4BKQA 5CEFA 3VOSA 4ZD6A 2AEFA 3X2FA 1U7TA 3BXXA 4YR9A 4J0EA 1A9ZA 1OZAA 1B3RA 4QFDA 1JTVA 3RI3A 4NI5A 3FPCA 4BNLA 1O95A 4JP3A 5G4KA 1E1MA 1CQJA 3NUGA 3HNPA 1ZW1A 4BNZA 2IXAA 2X9VA 1UH5A 3RC2A 2HMVA 3I1JA 5L40A 3WOHA 1IL0A 2Q1SA 1OC4A 1X0XA 4YQYA 3I6IA 1NHWA 2EP7A 3CEAA 2VHXA 4FPXA 2AQIA 4CM7A 4FJ0A 1AXGA 2VYVD 1LDBA 3DDNA 2BF7A 2C7GA 4LK3A 1I2CA 4Q3CA 1MA0A 4OL9A 2WYUA 4AJIA 4E21A 1M2WA 4WNIA 5TRTA 4E6PA 3RJ5A 3AM4A 3E5RA 4RVGA 1QRRA 3E5MA 4E5MA 2D1YA 2GO1A 2I3GA 4XRGA 4R01A 5I8WA 2CVZA 1KS9A 2HJRA 3FI9A 1IUKA 3E18A 5EQDA 1UXKA 3KLPX 4XR4A 5TLSA 3LF1A 3RU9A 3VZPA 1LC0A 5IZCC 2VOJA 4IIVA 1YGYA 3TOZA 3PJEA 1ADCA 2D5AA 2G17A 4I5EA 4LCEA 1FDSA 5EN4A 2X0RA 2G0TA 2WD8A 3F4LA 4NFSA 1T1RA 4TMFA 3LT4A 3QVTA 3RBVA 2C7VA 3UFXA 1EUCA 4D41A 2HJSA 4Z6KA 4DUPA 5ICMA 2JCXA 1ISFA 3OJLA 3WWZA 1QLJA 2F00A 4XGIA 5EQFA 4D45A 3Q9NA 1LUAA 1Q7BA 5HM8A 4AJJA 2NQ8A 3RC7A 2A4KA 1PQUA 4QEDA 4UUPA 4MIOA 3GGPA 2WWRA 3B70A 1XU7A 3U62A 1K2WA 5TSDA 3VVBA 2Z1MA 5EPOA 5KVVA 3DMTA 4DWVA 4GMFA 3UCXA 3GPIA 3KM0A 4WNCA 4PLCA 2VWPA 1LI4A 1VKNA 1T2AA 3L9XA 1LDMA 4RQTA 2HDHA 1LRKA 4HBGA 4RVDA 1K0UA 4YEDA 4TKMA 2R00A 3MOGA 5L7YA 3HZZA 5THKA 3U5TA 1KVUA 2HO5A 3KVOA 2PNFA 4J4TA 4WECA 1I24A 2OP0A 1I5RA 3H5AA 2EW2A 2XF8A 2C2YA 3GDFA 2JD1A 3EK2A 1QYCA 1IHXA 4PLWA 2QZ9A 3ZZNA 9LDBA 5IG2A 3BZUA 5AVOA 4BKOA 3U4DA 4CMKA 3VH1A 4BNHA 2VNAA 1XWFA 1HXHA 2VHYA 3DONA 1QXSA 1I30A 1UP6A 2OORA 3AU9A 3IIEA 5K6AC 1DC6A 2RAFA 5CDSA 4LMPA 1PL6A 1UDBA 3CKYA 3FCOA 5G0TA 1C1XB 3ZW8A 1A4IA 3FTPA 2D0IA 3UN1A 5A9SA 3I83A 3BTOA 4HX5A 5EESA 5L4LA 4UVEA 4CLRA 2ZB8A 2AG8A 4NH4A 1MXFA 4II2A 3MJCA 5B4VA 3SXPA 4JJGA 1VC2A 4AJ2A 1M6HA 4IQGA 4BO0A 3SBOA 2D4AA 2EF1A 2NTNA 1I10A 5TGDA 2OL4A 4OQZA 2NTVA 3HDYA 3QVOA 4K1LA 1X0VA 2WJPA 4G81A 4PLTA 1BDBA 2E48A 5TNXA 1GTMA 1GD1O 2ZATA 5CP8A 5JC8A 3NT4A 1WPQA 1NM5A 4YDRA 3RBXA 3V1UA 2EG9A 3P2OA 4CLDA 1PR9A 4MPDA 1BG6A 3DBLA 4GGOA 2Y1DA 4R9RA 1PZHA 4BNIA 3M1LA 1D1SA 2CSUA 2VQ3A 4HWKA 5HS4A 1MG0A 5TIIA 4KQXA 3TFQA 2HRZA 3PXXA 4LVCA 1IYZA 2YHIB 3WYEA 2OGUA 1YS4A 2GN8A 3HB5X 4IJVA 2HRBA 3RUCA 3W8FA 1A7AA 4H16A 2X23A 3O4RA 4L4XA 1ISJA 2GYYA 2WYVA 4J1QA 1BMDA 1V3UA 4L73A 3EW7A 4AJEA 3GEMA 2FHSA 4OIMA 1HDRA 5DDIP 2WDZA 1EK6A 4NBWA 2NWQA 4AJOA 3BTVA 4CMIB 4CR7A 4OXKA 1M67A 5T57A 1PSDA 5G2OA 4A5OA 2IDZA 2BLLA 1PQWA 3SX2A 1N5DA 1KVSA 5EJ2A 5MGBA 5J23A 2ZQYA 4FC7A 2GERA 4XYGA 2WMDA 3EUWA 2A94A 4XGKA 5B1YA 1WVGA 4I5FA 3FNFA 1G0NA 4BNJA 1QLHA 3BAZA 4MOWA 1XU9A 4BNFA 4CR6A 1R0SA 2P9CA 4CQLA 4B7XA 4XEHA 3F46A 3DZBA 3ZWOA 3I9JA 3T4EA 4CLEA 1BXKA 4KUHA 3DAPA 3MZ0A 5CFZA 1CEQA 4KZPA 1C3VA 4ND5A 4NU6A 5TC4A 1JA9A 1NYTA 1FDVA 3D1LA 2H6EA 5A5FA 5G0VA 4YT2A 3GDGA 4YRAA 3PFWO 3Q3CA 2W2LA 1E3SA 4WK6A 1Y8QA 2VWHA 2PD6A 4K28A 1E6EA 3S8MA 4CM5A 4CM9A 4LRTB 1F17A 4EUFA 4XYEA 2Q1TA 2ZTMA 3WQQA 5L95A 4NK5A 3RVDA 3GG9A 1P3DA 1P1JA 4BNNA 2Y1FA 3M1AA 1KETA 5CDTA 1TB4A 3OJEA 5DBIA 1HLPA 3CMCO 3BIOA 2CY0A 3G0OA 1F8FA 3ITKA 4CLOA 1VSUA 4W99A 1RM3A 5JXWA 4P4NA 3ENKA 2O23A 4LMRA 2IYPA 3WYBA 2QIOA 1UAGA 1HF3A 4M1QA 2ZTLA 3OECA 1V9LA 4S1VA 3WWYA 2J3KA 4NZ9A 3GRKA 4JJFA 3DR3A 3OQBA 1ADGA 1WAMA 2HK8A 2V7PA 4BNWA 5GZ3A 1J6UA 1EQ2A 1B2LA 3R0IA 4DVJA 4O1MA 3F5SA 4AJLA 1YDEA 4PLHA 3NT5A 4NBUA 1TEHA 1DXYA 5C7LO 4H3VA 1LA2A 2JKVA 3C7AA 3LDHA 4J49A 4D44A 5I7EA 1BWSA 4PLPA 2DTDA 3WTCA 5ICSA 3BMCB 2G5CA 1W0CA 4L0QA 4CV0A 1LSSA 1PS0A 1DBVO 2OUIA 1YL6A 1E5QA 2GD1O 1ONOA 3ASUA 3DO5A 3JYQA 4ZQEA 4WLOA 3IJPA 5IDXA 1I2ZA 3RUIA 4DYDA 1CYDA 3GVCA 3RU7A 5F21A 4Z3DA 3T7EA 3W1VA 3KV3O 4NNJA 4MVJG 3LC1O 3OETA 3VAZA 3ZHBA 1NQ5A 4BOYA 1XYGA 4J6FA 5JCJD 3N58A 3L6OO 3VPGA 2ZCUA 4L76A 4G65A 5L7TA 3U3XA 2GF2A 3NRCA 1JDJA 4JROA 3TNLA 3PQDA 2EXXA 1DOHA 1KVQA 4R5MA 3HB4X 4CMJA 3I5MA 3JD4A 1NQTA 3JD0A 4GVLA 4JQCA 2QRJA 1VI2A 1VJ1A 1NVMB 1PIWA 4ND2A 5DCWA 4N18A 5JS6A 5L4SA 2DBQA 1K6XA 3EC7A 4PLFA 5KJEA 4O0LA 1Z75A 4I9UA 4XIJA 4MDHA 3UVEA 3F6YA 4WCFB 4C7JA 3PTZA 2HMWA 3UH1A 4Z9YA 3GC6A 2RHCA 4HY3A 1BXGA 5T8KC 1R66A 4MP6A 2D2IA 3KEQA 3QWBA 2RH8A 4BS9A 4D7AA 1ZMOA 1LTHR 5MDHA 4NFYA 5GZ1A 2GDZA 3B1KA 3ZI0A 1NQAO 1OI7A 4MINA 4M89A 4DPMA 1EFKA 4JLWA 2AW5A 1I33A 2FSSA 1WDKA 5BSHA 5IDQA 4HUJA 4YBZA 3FN4A 2O2YA 5EINA 4IJUA 4R9SA 2GZ2A 3V1YA 4RJTA 1GEGA 3FTNA 2DVMA 1SCUA 2X8LA 2YHIA 1BHSA 4OYRA 1P1FA 1SAYA 2X0IA 1PJ2A 5DP2A 2Q4EA 4AJPA 2AE2A 1Z74A 5I9LA 4I08A 1DIGA 2NTJA 1QR6A 2J5RA 3LLVA 2CF6A 3JQ8B 1C0KA 4WJZA 1QYXA 3JYPA 4AICA 2J3JA 4I5DA 2W8ZA 3NTRA 2DPHA 5K9ZA 1UZMA 3RD5A 4E31A 3GG2A 5KKAA 1ZXLA 3D0OA 4U0KA 4UUMA 3JTMA 5KTKA 1ORRA 1VJ0A 4WOJA 1Y1PA 1P0FA 4NR0A 3ROKA 2UV8A 3CMMA 1NNUA 3AUUA 2CMDA 4XZ3A 1NXQA 1U5CA 1BGVA 5JDIC 4HXYA 3HN7A 3K96A 4D0RA 1DEHA 3O03A 4YJFA 1ADFA 1B3BA 2NVUA 4DBZA 4HNGA 6LDHA 4UEJA 5IZCA 5L45A 3X2EA 4ITUA 1NR7A 4YRBA 4E32A 3PHLA 3AWDA 1KEPA 4Q3BA 3ZV5A 2C5AA 4IDGA 4N5MA 3QVXA 5G4KB 3VTFA 2VZ9A 1CRWG 3ZGYA 3D5QA 5AOVA 1DC3A 1GQQA 5U4QA 3KHUA 1XDWA 3QHAA 4GPD1 1KEUA 1ARZA 4DYVA 4B79A 1MFPA 1GUYA 1R15A 1YL5A 3KEOA 4EGFA 4BNYA 5DF1A 1A27A 1X7GA 4FGWA 1P74A 4RF3A 2H63A 1IY8A 5TJ9A 3QSGA 3WJ7A 1CERA 3F4BA 3FBTA 2VYVA 3L4BC 3MCVA 3WGZA 1G0OA 1NPDA 1NR1A 5F5NA 3NV9A 2DAPA 3TF5A 1FXSA 1E3WA 2YV3A 3QQPA 4ZQBA 3VZQA 2AG5A 4GSKA 1WZEA 2GPTA 2HMSA 3PHIA 2V6BA 4O5OA 4FC6A 1AXEA 4CV2A 3IKTA 1VJTA 4RDIA 5TF4A 1DRUA 3VH3A 5A03A 3ZV3A 1NASA 4NJMB 4CMCA 4BQRA 3AFNA 3AU8A 4GVXA 4AL4A 1IHYA 5CEJA 2VCYA 3TZCA 1HDGO 2I6TA 1LDYA 1XIVA 2NVWA 3LC2O 3L6EA 3I6QA 1EFLA 1JAYA 2EJVA 1W6UA 5G4LA 4C7KA 5K6AA 4JBHA 3CZRA 4ZQHA 5HA5A 3IUSA 1U2DA 2BGMA 5COAA 1KY4A 5B4UA 1K6IA 5JE8A 2WE8A 4BO6A 2Q4BA 4WGGA 2D3TA 2HK9A 5HBRA 1ZEJA 2Y67A 4TWRA 4TRJA 5JMWA 4IJWA 1JVSA 3JQBC 2CF5A 4G2NA 4ESOA 4F46A 4R1NA 2I66A 3ZWXA 3E1KA 1WDLA 4N7RA 4E5KA 4PG8A 2AQ8A 4EJMA 2B0JA 4FFRA 4AJHA 1VLLA 2NLOA 3HDJA 4R16A 3TZQA 3QVSA 4CV3A 1DC5A 4U5QA 1C0PA 2X4GA 1O89A 4Q3DA 4FBGA 3AJRA 3VPXA 1EQUA 3LC7O 4P38A 3SC4A 5KJFA 1Q7CA 5DNAA 1NVTA 1X14A 3DAGA 3BHMA 4W7HA 5B37A 2JD2A 3EY4A 1MX3A 3KSDO 2NU7A 4Z3KA 4MVJD 3GF4A 3JQGA 3I4FA 5IN4A 4DREA 1DAOA 1GU7A 3BHJA 4MVJP 3WGHA 4BKPA 1ZFNA 1E3JA 1DC4A 1R12A 2Y05A 2Q3EA 3W6UA 2J5KA 3H9EO 4XYMA 1PJSA 4BUCA 2YV2A 4BNKA 3WICA 4Y67A 4WLNA 4B7CA 3C24A 2CZCA 3GMDA 3OQ6A 5KOIA 1WMAA 5JSFA 2OOSA 5FI5A 5A9SB 1R37A 1ZSNA 3E9NA 1PL8A 3WLEA 3PHHA 4CLRB 4Q39A 2BD0A 2X5KO 3GZNA 3WQSB 2YQ4A 2NUAA 4URFA 4BMSA 4IXTA 3JQCA 3UCFA 3IUPA 2P4HX 3RAJA 2O3RA 5I9NA 4OJNA 1X1EA 3ZCXA 3TPCA 3BYZA 2Q1UA 1NPTO 4R5HA 4J1NA 1KOLA 4R51A 2TMDA 4QTZA 1M75A 3WMXA 1BXZA 2XAAA 1PS9A 4MKZA 3ONFA 5BSGA 4KWHA 2J6IA 1KY5A 2QG4A 4QECA 4L4RA 2QRKA 5DCYA 4DTIA 1B14A 1RJWA 4FOOA 4RZIA 2UUPA 2BFPA 5IFLA 5A4DA 2PD3A 3DBLB 3DZKA 1YXMA 4BQPA 2HK7A 2C2XA 3ONEA 4CLXA 5JMPA 1SMKA 1B8VA 1UDAA 1ENPA 3GDOA 2VT3A 1PTJA 4YWJA 1XA0A 3K2BA 1GQYA 2Y1CA 5IDYA 3E9MA 5JBIA 4K26A 4E5PA 1HRDA 4FSHA 3OQ1A 3G49A 1KERA 1P1RA 4WLFA 2EKLA 3FD8A 4BMNA 4HADA 4XX0A 4GX1A 1CQIA 1YO6A 1HWYA 3MJVA 1IPEA 2NSDA 3C8MA 4IGEA 4BHTA 1C1DB 2Q49A 2IEDA 1NP3A 2PZLA 2ZCVA 1W8DA 3CTMA 3JD2A 4YJDA 4FD3A 4ZRMA 1SOWA 4J43A 3UGKA 3WIDA 2A9FA 3OF2A 5L9AA 2EKPA 3IKVA 4S3MA 2F1KA 2VT2A 3EMKA 2G76A 1LLDA 1ZNQO 4KUEA 2P68A 2VHZA 4CM8A 2YUTA 3GR6A 2FMUA 3BMNA 4GI2A 4CQLB 5JO9A 4F3YA 4KTVE 5I7VA 2DBZA 2UUOA 3QW2A 4IPTA 4TVBA 2ZB4A 1H6BA 2JAHA 3W4KA 4YT4A 2YQ5A 4YXFA 5IAAA 4I5GA 3JQFC 3ZWVA 4GX0A 3KSUA 1FF9A 1TT5A 3WR5A 3NDRA 1LC3A 4J91A 5A1TA 1DRWA 1R0KA 1Y8QB 4A27A 1XLTA 3JQ7A 4YT5A 4JIGA 1SZJG 4JK3A 4NJMA 4CQMD 5AXDA 4W9NC 1JVBA 2JFGA 2BFMA 1Y5MA 4IIUA 4CODB 2VYNA 5HTOA 4BB5A 3PVZA 1Q0LA 2HMTA 2FN7A 2ZJ0A 4FFPA 4CLOB 3NEPX 1EBFA 1HL3A 2HCTA 3BTUA 3I23A 3T4XA 1I01A 3FBGA 3L4SO 4ALKA 1ZCJA 4JJIA 4NHEA 2H1SA 3GOHA 4IUYA 3ZWPA 3ENNA 2DT5A 2B83A 3HHPA 1V3VA 1Y5RA 1L7EA 3RKRA 1ZKMA 3B1JA 2I3AA 3RUFA 4L9RA 4LGVA 3BMOA 3JV7A 3ZNOA 3AFMA 3GGOA 3LZ6A 3WBBA 3G17A 1TVEA 1ZBQA 5CG1A 3VVCA 3DBHA 4HNHA 3H8VA 2AA3A 2FPIA 5T8KA 4C4OA 2PWZA 2I5PO 5KJ1A 4B4VA 1SEVA 1VL8A 4FOSA 3ZHYA 1PJLA 4IDAA 4M54A 3D5TA 5AQ1A 4BNVA 4NBTA 1SNYA 1SB9A 1LX6A 2IZ1A 2FY8A 1Y8RA 3MJTA 4P4LA 4XGNA 1F8GA 1Q0QA 1O9BA 2GSDA 5T6BA 1HYEA 2WD7A 3PGXA 4E4YA
chains in the Genus database with same CATH superfamily
3OT4A 3JRWA 5EWMB 3BDIA 5F76A 3ZCSA 3L7BA 3TR0A 2WSIA 2INGX 2C5HA 4R9UC 2NXWA 5EFZA 3E05A 1N0UA 4WKBA 3DW1X 3VNBA 3W2TA 4CUKA 1F51E 2F48A 1GKUB 3L0ZA 3ICPA 4J90A 3AR6A 4KNYA 2PR7A 1ULZA 5C5DA 2H2IA 1KFKB 4R83A 1BA3A 3KUCA 5BW8A 1OA1A 2ZT5A 4GZ3A 4B6EA 2XGSA 3R77A 1SUWA 3HYSA 1QSGA 2X86A 3R0XA 3IHWA 3OFVA 2J4CA 2CNDA 2J9YB 2XJ4A 2H4ZA 4KQKA 3SQMA 2JIDA 2ZBDA 4A8JA 1XV5A 2PKQP 1S01A 3EIOA 1B8NA 1MAVA 2FDXA 3AHCA 5KOJA 1E8NA 2B92A 3EVNA 3QM1A 4TTSA 1GPBA 2WOJA 1IUPA 2VTDA 4YP1A 1IWPB 1IN5A 3OLYA 3NC1C 6AT1A 4V3BA 4NQZA 3WG9A 2HF2A 4G1BA 3OJOA 5D5PA 4MUBA 4W5OA 2MSKA 4DXAA 2PZ8A 3AW9A 2SKCA 2HH9A 3DHEA 5UKDA 1NNI1 3PE3A 1U1CA 4FLMA 4MLPA 4K9PA 3Q2KA 1BXGB 2C3UA 4TXMA 1AGNA 3H83A 5DPMA 2P8SA 4B6PA 3TPZA 3L8ZA 5FJJA 5ITVA 4P53A 4BMVA 4EL0A 2WHEA 5IYZF 2AFRA 3WKBA 1ECBA 1ULAA 4XQCA 4ZZ0A 1QRTA 4TVOA 1RIIA 2QN3A 3H9UA 4QEZA 3QXHA 1O08A 2HBQA 5BV8A 2R86A 1G6Q1 1BQ4A 1IHPA 2AOXA 3G7NA 2VHVA 4PHFA 4RA9A 5LQSA 4DCPA 3I61A 4KXFB 1GNQA 2QTFA 1QRSA 3EZLA 2CGEA 3PHGA 5C3MA 2H3EA 2VDPB 3IVXA 1TIPA 3JQAD 4BWYA 1C3OB 4HQOA 1Z6YA 4U7WA 4YHBA 4EG5A 5TF0A 1BNCA 2QRVB 1FSFA 3CBQA 4M1OA 4Y6SA 1NFFA 4JC8A 2LXNA 3C3AA 3FR7A 4L8WB 3OQNA 1XKQA 2PGLA 2QK4A 2ZYGA 5DHAA 2B9EA 5DGXA 3LXRA 2NXCA 3NG1A 2FR8A 3GA5A 1J06A 2I91A 2HSJA 4UHJA 4KDFA 1D4FA 2R62A 2CKMA 4JVOA 1K66A 1K8RA 5H59A 1ZS9A 3L1UA 5LCXA 1OBCA 4CWAA 3U37A 2RGNA 2JGDB 4LJ7A 1EP2B 4R1TA 3WTBA 1XGKA 1FPQA 2CVFA 3VTFA 1QGDA 4UPEA 5CFLA 3R2JA 3ILYA 3ME5A 4L9SA 1V1RB 1JQ3A 2ZTVA 2RGWA 4PAQA 2ACKA 5J5VA 3QFRA 3TTVA 3KL2A 1JNXX 3L4BA 3AI1A 4ZCSA 4EUSA 4HDNB 4TKUB 4OFBA 1ZNXA 3ORHA 4MMYB 5AICA 5EKUA 5LNK1 4U7DA 4OLBA 4NTZA 1G2QA 3OLVA 1TLLA 1DXHA 2XUHA 3K0EA 3H3JA 3L4EA 3W3ZB 3ZY6A 6REQB 4GDMA 4P35A 3QVWA 3K30A 3M9XA 1ABFA 2GLXA 2IPXA 4HS4A 4PAOA 4KAJA 1PEYA 1O9GA 1SXIA 3U3ZA 3ZE7A 2PH7A 4YUZA 4KIGA 3EEIA 5DLEA 1IJKA 1XJ0A 3AR4A 1Y4DE 1B6RA 4IXDA 1W85B 2OXIA 4NXMB 1J7KA 1NF9A 2IELA 4WKPA 4C03A 521PA 1FS5A 2XZOA 2O5RA 1GY8A 4IKPA 3DE2X 2Q6IA 1VLJA 4UNIA 2O0MA 1L6IA 3M82A 5DLDA 2OYSA 2R6DA 3AEKB 4RK5A 3T5MA 2ONKA 1N6KA 3DC2A 1TM1E 4KI7A 2Q5EA 4N12A 1VKOA 4BC0A 4FW8A 1UMCB 3IP1A 5CFQA 1Z83A 1XZNA 2E87A 2R60A 5DULA 1TE2A 1GPLA 1TZBA 5EMKA 3G89A 2HA7A 1YS2X 1E3QA 4G5XA 2BH2A 1RRGA 1H2WA 1ICIA 5KAMA 3JQBA 1VPVA 4XYLA 4D3DA 4Y0AA 2BEUA 5BVHB 2QSUA 2PAFA 1WMFA 2WP8J 5CPFA 2VXOA 4RDHA 4F1WA 2FUNB 1NBOA 2EQ5A 3DS8A 4KEAA 4P9NA 1MIOA 5GIPE 5HQ3A 4IZIA 2QJRA 4F5YA 4ZK2A 3ZXSA 4GE3A 2W4QA 2H5IA 2PKWA 3UJHA 3OBBA 1SQSA 4BJ5A 1R50A 1IMOA 4UNQA 2WWGA 2WNIA 1TF7A 2ZT6A 3NRBA 5ESWA 3N8IA 4OSPA 3ESZA 4JP8A 2EIHA 1JWBB 3D7LA 1ML3A 2AMFA 2YN4A 4KX3A 5BSWA 3B3QA 3K9HA 2UUCB 2GNAA 1MUUA 4G36A 1JQKA 4C88A 1LBEA 1ZGAA 2IYSA 3H6GA 1RLMA 5JJ5A 1I0LA 2ZM5A 3LCVB 4MUGA 3HM9A 4XIIA 5EEHA 1TA0A 1U0FA 3HKDB 2ZUEA 4EDHA 1TJYA 4A2PA 5EE9A 1PEKE 1IBMB 4DMRA 2O7QA 5FFMA 3N74A 4H77A 1LRLA 1KYIA 1N0VC 1QH8B 1TJ5A 3HEMA 1M2FA 1XHLA 1GUAA 4CCYB 3LYAA 1YOBA 3G7UA 2Q6VA 1O96A 2GCOB 1E2GA 1ZK2A 2JJMA 2Q3FA 2W43A 2WF5A 3LFTA 5BOSA 1MJ5A 3KTFA 5B4TA 1NMXA 1PHPA 5DBOA 1UWLA 4ER5A 2GK4A 2PSFA 3JAWA 4DSZA 1J2UA 1H42A 2G82A 4FLFA 1YA8A 3A9TA 1C1YA 4ZU6X 5E6RB 1P80A 3Q7TA 1PRYA 3NHJA 4D79A 1HUQA 4N8EA 1SH7A 4IDHA 3RFXA 4R6XA 3FTEA 2ORED 3PLNA 3MHTA 1R4MA 2G08A 2E82A 1KMHA 3HUTA 1G3RA 3INTA 3CH4B 4TRMA 2O4UX 1KMNA 2G5PA 3HB9A 2CJPA 1OB5A 3PGLA 3RASA 1JDVA 1G8GA 4N47A 2C2KA 3NQ41 4UE2A 1RZRA 1KI8A 3B12A 4IIBA 2I76A 1DMSA 2ODPA 3SZUA 2MT9A 3EWSA 4I8DA 4JLJA 4FTWA 4JXKA 1AQIA 1X94A 3CPHA 4QREA 4TTQA 1CUVA 2QRNA 2GLTA 1IY9A 2B8TA 2DKOA 1THZA 1RKBA 2VHCA 2X77A 1XEAA 5SICE 5DSTA 4H31A 4F9GA 5DKFA 1MEOA 2D5CA 3KWMA 4YIHA 1Y1TA 1H05A 2EEPA 2EW8A 3KOXA 3OWOA 5LQDA 3LT1A 3U6KA 1M6YA 4ZKEA 2Y3IA 3KO8A 2YIVX 3HH8A 1B73A 5AJVB 1NJGA 3ZY5A 2WFMA 4MVJA 4LYHA 5LM3A 1ZMTA 3QUAA 5JSHA 1FJGB 1UK6A 4J1TA 2FQWA 1OXKB 1ZIDA 1O5IA 1JYFA 5H9VA 5TJHA 4RACA 2QPLA 4BRWA 5FAKA 4BNDB 1UOPA 2C2HA 2W93A 2G63A 3SHFA 1QO9A 4XFJA 3E8XA 2H48A 3BE4A 2XMQA 3SHQA 3PR2B 3Q41A 3RVOA 4FZRA 3K35A 2YBDA 2PZGA 1XROA 4ZVKA 1KOGA 3Q6IA 3GNLA 1U8UA 4PSKA 1UM8A 2YHBA 1HDOA 6PFKA 3HL4A 3ELDA 4KR9A 5LD2C 4Z4QA 5EY5B 3OIUA 3LKBA 1HFWA 1OA0A 3PA6A 3M3PA 3W5SA 3CR8A 4JL5A 4WNYA 2XLCA 2AXEA 3WHLA 3IQXA 3DFIA 1T8YA 3TRIA 3WNBA 5M7EA 3HO1A 1EK2A 2P4EA 3ICCA 3UIEA 2F59A 2JAWA 2MSLA 2FSUA 5CIQA 2NNLD 1OVMA 1LEHA 3PGJA 1WBJB 2E37A 5FYDA 1G8JA 2FMKA 2HHAA 2Y92A 1QZXA 1CE8A 4MS1A 3V1TC 2IFTA 3WK7A 1T5TA 1T2CA 3R75A 2GN2A 4U8GA 1JG7A 3CPSA 3CLUD 4F71A 3L84A 1S8NA 5ALNA 3OA2A 3IUMA 1OZHA 2IT1A 4QDZA 4BGUA 1NPYA 1GL9B 4OBXA 4QO8A 4X20B 5EUCA 4DR5B 1RVV1 4K05A 4AKHA 5JEDA 1NVGA 2ZK7A 2QAIA 2EL7A 2Z57A 4JASB 4EAAA 2WSMA 5CH8A 3W1WA 3ZE6A 2VNJA 1YQXA 2QP9X 4GO1A 3MGKA 4EB6B 2V7EA 5C8YF 2YJGA 5BYJA 1Q95A 1CUBA 3O3NB 4C3UA 3BREA 1U0SY 3QUSA 4TWIA 3FVQA 5F78A 5JAUA 5FTWA 3V42A 3V4VB 4JB2A 1D1TA 2W90A 4QXMA 1BCRA 2Q6KA 1UBOS 1AGRA 2GWRA 1ZN2A 2FUG6 1EBBA 1NOIA 2FPGA 2PTGA 3BA1A 3FYDA 1CD5A 1VTKA 4LBVA 4OQMA 2P3OA 1DIRA 4HAVA 1BOFA 4YC7A 2SCUA 2VDNB 3MHPA 3DMGA 3OZUA 5D01A 4XVCA 5CCEA 1ZVKA 1LPOA 4FYIA 1CW2B 4K9QA 3A6LA 2WVHA 3M4YA 2OD2A 2WTAA 2HMYB 4QULA 4CMGA 1O87A 2ZVPX 4BQOA 4UFOA 2EX0A 4LYGA 3D1JA 1T4CA 1RC0A 3A1UA 3IEXA 3NC4A 4OOFA 3IT0A 4PCVA 4WA8A 4XB2A 3VHRA 4AUMA 1KRWA 2VZEA 3PUVA 4I99A 2O59A 1H2YA 1SFRA 1U7OA 3AILA 5IT4A 2ZTHA 3KZNA 2Z2JA 3F2VA 3R3ZA 4HWTA 4UXIA 3BMNB 2MMGA 1L4BA 2OCKA 4CDRA 3HLYA 3QELB 3T35A 3DKRA 4O1HA 1SVOA 1ABBA 2JVIA 4CKCB 3HUDA 1OOEA 4FZ3A 1FS6A 5L53A 1V7CA 3CLUC 2VDJA 4LWPA 4G86A 4BX9A 2VN8A 1IPHA 2CHUA 3BJEA 4H7EA 2HN9A 5JWRA 1TT5B 1I3OA 1TZ2A 4IR7A 3F78A 1GP2A 2VYQA 1E7YA 4WZ6A 3UK7A 2WNHA 3DKIA 3VR0A 1AMUA 3VNAA 4IG4A 3ZX5A 1V26A 4WJKB 4BP9A 1PVOA 2AOTB 1FU8A 1DFIA 1T10A 4II3A 2NP6A 4RZ3A 2O8CA 1RQ2A 1M6EX 1MX1A 4WL0A 2HU7A 3SZRA 1PZEA 1QDEA 1UBEA 2VF2A 1V5GA 3A1DA 1LBIA 2BRUA 1TKRA 3DD1A 3ROGA 4MI9A 3EDQA 1YB1A 1OLSA 2E49A 1ID1A 5DGTA 1EM6A 1KOFA 5IBRA 3DZDA 3KD3A 5B3KA 1GSIA 2AX4A 2FWBA 2XKAA 2D0PB 4POAA 4WX2B 3UAYA 5KVCA 4E09A 4L2IB 4U8HA 3V5NA 2FJPA 5AJYA 4A2QA 1DEXA 1U3UA 4J2HA 4UHDA 2VP2A 2XOXA 3WQHA 2DBRA 4KR7A 4IS3A 2MR5A 4LIPD 1KA9H 1U1GA 3A7EA 3I1IA 1OMOA 2CFIA 4L51A 1EWTA 3WY9A 1Q0RA 1RYDA 4IFEA 5FH9A 4UUNA 4EYKA 5JISA 2AZXA 3CUUA 4HEA6 4EECA 2EFHB 1YJ8A 3BMOB 2YTZA 3UAZA 2MWMA 1A50B 1E0JA 2PSDA 2OGTA 2XMPA 4NV3A 4GPTA 1YBAA 3QYFA 5DXAA 2Q3HA 2QL6A 3HWWA 3MOIA 4G97A 1J56A 4GZMA 3GT7A 3X1JA 1CB0A 3RT1A 3RRNA 3CH6A 3GN1A 3W8EA 3EZXA 1I3NA 2Y0DA 2IEYA 1MAAA 3HCOA 2HLPA 1P2DA 1A8PA 3A10A 4PYIA 5HF8A 4K9NA 1SO8A 4OQQA 3GHHA 3HCBA 4RZSA 1EMDA 3HU2A 1EIWA 1WDWB 5JSUA 5D5QA 2ZE5A 3MTEA 3QU7A 2H7VA 1NUUA 2I2FA 2VOEA 3TTXA 3HVHA 5H4HA 5F9HA 1N33B 2A5YB 3O4GA 3EXEB 2PKRA 1E2EA 2ZSKA 4W8HA 3W06A 3R6LA 3VV2A 1ZVMA 1X9GA 1NE7A 5BQXA 1SCIA 3PNPA 3TWOA 2YJZA 1J07A 4O2AB 3S2IA 2AMLA 4NYJQ 2GRAA 1RJDA 2J0UA 4PZYA 3NYQA 1QQ6A 1SY7A 4KAFA 4IG9A 4CIDA 2GFQA 1I5OA 1GFIA 1PX2A 5F5XA 4EL5A 2NADA 1YRLA 3V4RA 4DQVA 1E7SA 3DHYA 3GLHA 1PSWA 3CNEA 3HJUA 1RE1A 2X8BA 1E58A 1E9SA 3OIGA 1TC1A 3I2HA 3QKRA 2CL0X 2FXVA 2JAOA 2PFKA 1R4NB 1NN5A 3FF1A 3EHEA 2PRJA 2X22A 4F7WA 4GMKA 5DW0A 5FAXA 1QTIA 4BFSA 1H2BA 2P67A 3BD8A 3MERA 4KVZA 4EVSA 4L50A 3SI7A 4R8RA 1VIYA 2JIOA 1ODJA 4FIDA 5JS2A 1BHJA 1ZUD1 3ROQA 3TTUA 3CGGA 1SOUA 3F1LA 3DHNA 2ON6A 1L5MA 4YAWA 1B76A 1JKFA 3GARA 3GD7A 4ES6A 3C3YA 2ONYA 1XVTA 1GKKA 2C61A 3OFNA 2QGNA 5KSOA 3ZWYA 1I1QB 2CBZA 3JAKA 1NRJB 2Q5LA 3GIDA 1VYUA 4CIXA 1HPLA 5DVZA 2FWRA 2RCYA 1F60A 4PS1A 2RG1A 3WLLA 2VDWB 4H3SA 3OCUA 3K70C 4M49A 2FTKE 2P4QA 4EDFA 3E7WA 4ND3A 3TFOA 3P9RA 5FOVA 1LLQA 2CXNA 3UA4A 4QC2A 1GPKA 2ZRIA 3VDXA 1CHNA 5J59A 4JUCA 4B43A 1JJBA 3FYTA 4D96A 4E3WA 3UENA 4F8YA 1ZONA 2GNOA 2DPYA 3KOOA 1XUOA 5FLKA 4C4RA 3G9QA 2OB1A 3M2TA 4W4TA 2YRWA 3PJFA 3NTQA 4U3JB 2AXQA 2CDAA 5CDGA 3CEMA 2PSEA 1K86A 4RKQA 1SZPA 5CVCA 2JHCA 1U2SA 4B3GA 4RD3A 5T4HA 2HIGA 3KYCA 2JFWA 5BNFA 3V7UA 3T15A 1XLWA 4X7PA 3V34A 1L5ZA 3GLGB 2XMRA 2RBEA 2W2TA 3AGPA 3CUWA 4P32A 1CVRA 4UMFA 1BQEA 4LNAA 4Z0TA 2R8EA 2G67A 3A8TA 3H8SA 3UXYA 4FYWA 1IATA 4ONEA 4YGXB 5MN5A 2HUPA 2IXBA 4RK1A 5AKHA 4AUNA 4GX2A 1FYWA 4OXIA 2QMHA 2NAFA 1C7RA 3RFVA 1W19A 5AJUA 1AK1A 3NIBA 4OI4A 4YMHA 1KJNA 1PKEA 3JQ9A 5DFAA 9LDTA 4YV2A 4AMGA 5HJ7A 3TW4A 1SUCA 3KP1A 3EXHA 5HCNA 1UWCA 4DR2B 3N7AA 3SVTA 1ZOLA 1RWWA 2ZJOA 1N57A 1K7XB 1L7QA 1GU0A 4CXMA 1CJSA 4NC9A 2RJNA 4UZSA 4O63O 3RABA 2VR1A 5KCZA 4OLHA 1BKDR 3HFGA 3ORYA 4YRZA 1ZKDA 4M6WB 5BN3B 3A9SA 1ZEMA 2PA0A 3QA9A 4GEKA 4K87A 3T1NA 1ULSA 2VRNA 3VTZA 3RAGA 1VE1A 4D8VA 1V39A 5BQPA 3ZCVA 1SBTA 4F5WA 1DQPA 4S0ZA 3BIJA 1GR0A 1PT9A 4FT4A 4LG1A 4YJGA 1N9GB 1QHHA 3FWZA 2OENG 4P31A 4BVEA 5C80A 1CIVA 3QPWA 1M76A 1RFGE 3NU1A 4KNVA 1YFZA 2Y27A 4M98A 4H7KA 4CIYA 4QU9A 3X1YA 3DWFA 2YKGA 2Y1EA 3CIFA 2FPPA 4EHIA 3LT0A 4ESVA 1IDOA 3LA6A 4YP0A 3UOGA 4ZRNA 4OX9Y 1T91A 4CFSA 3IA7A 3QPBA 3U0VA 2WSBA 3ODGA 4ZT3A 2YOHA 5JXIA 1IB6A 4LJSA 2LRHA 2BI8A 3EGXB 3L77A 1VZ2A 3IR7A 4QX6A 5CHYA 2HUNA 1N6LA 4MA5A 3UUGA 3DTVA 1XMIA 2IZ5A 3PQFA 4H1WA 1EQAA 4JDUA 3O7MA 1L6RA 1YKGA 4J3FA 4TMVA 3G0IA 1E3IA 4UEKA 1Z62A 2QTWB 3KQOA 4RM3A 2JLVA 3O0DA 2C94A 1E2NA 2AG0A 2C95A 3B6MA 3C39A 4PCLA 3V1NA 3X43A 1XHFA 1I7SB 3N7UA 4B7UA 4OPMA 2ZM6B 1F3OA 3EIUA 1UOEA 4KHZA 1CU1A 2YJ5A 5KNCA 2PWYA 2YVLA 1Z0AA 2II6A 3A4YA 2KSQA 3Q1LA 2X0FA 4DILA 3QY0A 3HCNA 4K3VA 4WIAA 2C82A 5JDCC 1ZM3A 4XX1A 1VG1A 1ZAKA 3B1XA 4KQHA 4XW2A 3EA0A 3MTAA 3T38A 2Q2WA 2OLJA 4RPHA 1UKEA 3INRA 4QT0A 2HU2A 3AI2A 4YH1A 1MV8A 2J8ZA 1IRXA 5BURA 4DQ0A 1YUMA 5KJ6A 2O3UA 2NGRA 5AR1A 4KQ6A 5BN1A 1MC4A 4XM0A 1DXQA 1V45E 3DOCA 1CSEE 3TZ6A 4D3FA 1KVTA 4J0FA 5LDGA 1H65A 2PA3A 2W5UA 3FYUC 5IVDA 3SMQA 4D43A 1NN1A 5TT1A 3U7JA 4ECAA 1HL7A 3E8SA 1XMOB 3K71B 2N47A 2R1VB 2C3OA 2WIAA 3O9ZA 4P1ZA 2C4UA 3C98A 1EUZA 1KO1A 1JMYA 4G09A 1Z35A 2AZ4A 4YN3A 5IZ4A 1RPTA 5COQA 3OE1A 2BEJA 2AGVA 3MG9A 5AVXA 3Q9SA 1W5AA 5CD9A 3IAS6 2JJ1D 1Y3HA 1JJIA 4WK2B 3EC2A 1KJYA 1TM5E 1C9KA 1VL6A 4BNMA 5ER9A 1WXXA 4PNHA 4GDFA 3P27A 1P5RA 1BW9A 1EFVA 4I1OA 3THWB 1QONA 1IFXA 2R8PA 4IGAA 1Y6FA 4ETIA 3CT4A 3T5CA 3GO4A 4IIYA 1I80A 4Q3OA 2I2BA 1UR5A 1QIKA 2R5WA 3ORSA 4P7KA 1FDWA 4ENVA 1YQDA 4JVLA 4U2EA 3VRHA 1PEDA 5JCJA 2JLQA 2WVAA 3CT6A 2D74A 2YIMA 3M5WA 4ZU1X 4AO7A 3MWLA 4YV7A 2AI2A 3VPSA 2YIJA 2HWKA 1P2VA 3DV0A 3LUJA 1IRIA 2QUBA 3PC6A 2VQ6A 1KAEA 3CURA 3A1CA 5EE3A 3UT6A 4E51A 1HRKA 5CM8B 5A9RA 5DN6A 1E2MA 4YAIA 1JIQA 2ZYDA 4N0QA 1BSVA 4GOKA 4G8DA 4IOJA 3TZKA 5SV2A 4AVYA 4D5GA 5HIMA 5A4AA 3RPEA 3IBCA 1Y4SA 4ME6A 1UJNA 2BEWB 4I6EA 2CV2A 4MKXA 1QWSA 3K5PA 3UJDA 4JUFA 3I9KA 3UB2A 3MTQA 1RPZA 4W9MC 4DRXB 2FYTA 3IXLA 5IEBA 4RIGA 1VECA 2DFPA 1Y37A 2Q46A 3N5CA 2DF8A 4LVUA 2JLSA 5AVRA 5H83A 4Y2JA 3NDJA 2R8BA 4LX8A 2YOFA 4N3CA 1JF8A 2G71A 2H1LA 2P2NA 1CDEA 1J5PA 3WGNA 1P1HA 5BNTA 1E79D 3V2IA 4PO8A 2DZDA 4LISA 5CYFA 3SGLA 3ND8A 2FFRA 2HQSA 2R1ZA 3HDHA 3R3JA 1Z9BA 4RZUA 4BQNA 3SYMA 3BCRA 3R5KA 1JHYA 3CN9A 1OU4A 3IODA 4M4SA 1AE1A 1G38A 1DV2A 2DECA 4KTTE 3RJTA 2XWQA 3QNWA 1G3IA 3DVSX 4I46A 4WVLA 1C2TA 1MH1A 4YLGA 5AK5A 3U19A 3QMPA 4XQEA 1JAZA 4KRYA 4MVJI 1DCKA 1U65A 3P2KA 2IKQA 4DVGA 2JJYA 4IX9A 1P33A 1FMCA 2CD7A 1H8HA 2FPXA 2QROA 4XWTA 4TL8A 1T4GA 3DZGA 2HEIA 3PZBA 2W2KB 4GOLD 3VU1A 1F3LA 2AK3A 2V03A 1CQXA 4HGNA 1YVPA 2XGMA 2XZTA 5AKEA 1UAAA 2FB9A 4QLOA 4DY4A 4RFSB 3ZDRA 1GCAA 1SK9A 1C8LA 1VA4A 3OEED 5JI2E 3GLFE 1TPZA 3KPJA 4QGHA 1GUZA 1V1MB 2YINC 2A86A 3PDWA 4Z7NB 2QXUA 1E9EA 3TG8A 2AYZA 3WRXA 2H65A 3NUZA 1C3XA 1QZTA 2GZSA 2ID4A 2ZT7A 4J0CA 2NO7A 4L5BA 2VZ8A 5KYVA 2D0OB 1VP9A 4C0KA 1FFEA 2AQHA 3H4VA 1XCPA 3ITDA 3LDFA 2HSGA 2CK3A 3QBTA 1IHUA 3IDZA 1AXRA 3ORFA 5EJ9A 2R66A 4EITA 2YVKA 2H2GA 4WBNA 3CNLA 4Z9BA 1DG3A 2ACEA 1C2YA 3R24A 4UAUA 3DLTA 3AC0A 1T0BA 1Y3CE 2IU6A 2QMZA 2IX9A 3JYOA 1X7YB 3TNYA 2IGTA 3NGXA 3QIVA 2ZTUA 4M60A 4Q1BA 3BPSA 1U3WA 2V7UA 2Q9UA 3HG7A 4ZAWA 5AVJA 1P31A 5I7UA 5K0GA 1N4AA 2ZUFA 5BN4A 1JT2A 2X8AA 4RHUA 3TD2A 4LV8B 4MV7A 1M2VB 3CIOA 4HI0E 2HQBA 3COZA 2Y66A 3CWCA 4LWZA 4BMYA 1ID8A 1BDMA 3N8HA 1KFJB 1L4MA 1A5TA 1NBEA 1HORA 5FLYA 5HRUA 3TMYA 3HBJA 4KSYA 4DV4B 3M81A 4M21A 1BMQA 1D2HA 2VK2A 4GH5A 2FR1A 4UREA 1JNYA 1PJQA 3DBIA 4I6GA 3KB1A 4ZT5A 5AYVA 4AFNA 4D46A 2OQIA 1GQOA 2H1IA 4ACAA 3VNRA 2H0AA 2BGIA 2V7VA 5IJ0A 1TZKA 3JQDA 4UVDA 1EX6A 3O4VA 4OIFA 4HN2A 3NTVA 1UAYA 2A1TR 2VYND 4JJAA 2C98A 2IXFA 3S99A 4EGJA 4XFDA 1L8OA 3G9XA 2V7GA 3DGFC 3G6WA 3UUEA 3FVRA 2I6UA 3UK1A 4IH9A 4KQWA 3OPQA 3ASVA 5DTJA 5BWLA 5AVSA 3T1YB 3BRSA 5C5IA 1A9QA 1EAMA 1HI9A 1VI5A 3NKLA 4UCFA 5AI0A 1HYBA 2Y0EA 1UPCA 2ID7A 3LX4A 4HQ0A 2CLLB 4H7FA 4PLZA 2FQXA 1N7IA 2C5EA 3MGGA 3QX7A 4E08A 2XY4A 4UC0A 3BEOA 3L7OA 2GJAA 1ZUHA 1L4NA 3FOBA 4JKIA 3C6QA 1ZJYA 2JFXA 5CXSA 1TLTA 2VSQA 3OZIA 2IPOA 4KXUA 3WK9A 2FWIA 2I4RA 3MC1A 3U44B 2R2GA 3QXXA 2K4MA 4ND7A 3FOCA 4FUTA 4ZFNA 1C7FA 3DGEC 2H11A 5EE0A 5DX8A 1TA4A 3LPAA 1SZCA 4QICA 5JAPA 2X76A 2HR1A 4GQBA 4OLJA 1DI0A 1WDTA 4BNUA 1J7JA 3GGSA 5BO5A 1ZZGA 1GEEA 3ZTYA 2G9VA 4EJSB 4Z53A 1L5RA 2YWDA 4WUVA 1GRRA 3O26A 3OMLA 4BZZA 5A4JA 3GLIE 2GPWA 1E0AA 1V6AA 1Z56C 1ZIXA 1ZH8A 2QRMA 1KYTA 3GZ4A 1ZGZA 4L4SA 2HLDA 4ACBA 1X7HA 4TWBA 4TPKA 1E2PA 5THXA 2X7HA 1NVWQ 2Q50A 4HPXB 3V7WA 1E5LA 4LDPA 3CRNA 1WMBA 5BQ5A 2PUWA 3ZN2A 1VIMA 3FW1A 5ITZA 3SYNA 5F3WB 2J5QA 3RSLA 2GJKA 4H7PA 3N6VA 3KB2A 2WB4A 4WACA 2G9NA 1DJQA 3V4FA 1LPBB 3WDLA 3CNNA 5JR3A 4IZOA 4DR3B 1QIJA 1E9BA 2XHZA 3ZV4A 1SIUA 1T24A 2BMAA 3K5HA 3ESXA 2GZAA 4J07A 5IAGA 4C14A 1HETA 1QGOA 1MU0A 4Q1CA 1G8HA 1KI4A 1Q0HA 2V6MA 3P32A 3NVDA 5CJ2A 3SS9X 2AJTA 2EDCA 4KBYA 3T99A 5IF3A 1G64A 2V96A 2P2SA 4I8IA 4NNOA 3FUWA 9ATCA 3OJWA 3A2NA 4NBRA 1K68A 2BHTA 3U61B 2HW8A 2OHFA 3LWBA 2G5TA 1OYYA 3QMVA 5JNVA 1USVA 3HJCA 4MUJA 4HLUC 3CSSA 4OB6A 2JCVA 3HXQA 4QQRA 3EAQA 5U1PA 4CU2A 4PFQA 5TE9A 5FBHA 1QYVA 4GLLA 4OH1A 3ZBUA 2VI5A 1CY4A 2VL7A 1QV9A 3SF8A 2Q5FA 1U04A 5E1DA 1JR2A 3GHYA 4IMPA 4G26A 5FA5A 5IABA 1TYEB 3ETGA 3EPLA 2ZT8A 4LECA 3AWIA 3W79A 1SBHA 1O6ZA 2BFEB 1GN9A 5DP1A 3FUVA 2B35A 4PCUA 4ZAYA 5B3AA 3V6LA 4N5NA 4MKGA 2QN8A 2FLWA 2FZEA 5SZJA 4TTRA 2MSEB 4L5YA 3QEMA 3VH2A 2VXBA 1PV2A 3RSOA 1GAXA 5AW5A 3OQOA 1JIKA 4UCQA 2YXEA 2GEBA 2FW8A 3PYXA 4EYQA 2C07A 2J1LA 3O84A 1L1EA 2NV0A 3ZTWA 5C1BA 5CTAA 5FBWB 1AZLA 4OHZA 1N5JA 3ISTA 4OGWA 5C7IO 1HEUA 4F3TA 2VDOB 4G4IA 4D8XA 1W75A 4ZO6A 2RKOA 3U1TA 3EJWA 3H9GA 3QWHA 4C21A 5JARA 4Z4EA 3C3EA 3R8FA 1WTAA 1M34A 3M6IA 1NWHA 3NM4A 3G0HA 3UJ3X 2I87A 4HKTA 1LW6E 2OFOA 1JSZA 1K1EA 3NBKA 2N46A 3DOUA 4U0JA 1K89A 4MQFB 5ENZA 5FX2A 1FEZA 1GTL1 2GN4A 3ODPA 4OHUA 1BRTA 1UZLA 2IEBA 3AX6A 3IHLA 4JP1A 4NK4A 5LZ9A 1S02A 3H97A 1JE0A 4P2GA 1QKIA 4YAGA 4MV0A 1Y1QA 4RSMA 3PK0A 3REOA 2AOUA 3U3JA 5HWSA 1QORA 3I1FA 3QVGB 4OA5A 1F2UB 2R4QA 1LRJA 2DB3A 4J4BA 4MYUA 2IZ6A 2BELA 1SKYB 3I0ZA 1POWA 4MW0A 4RTKA 2GYUA 5LYJF 4UUBA 4HTFB 1QE0A 2ZOSA 4TYWA 4HP8A 3G02A 3W2IA 1HURA 3BE5A 3IEIA 4BRSA 2DWCA 4J7XA 1NZFA 1DUSA 4DC0A 3SR0A 1PR2A 2DKNA 3JQ8B 4Q21A 4ZVOA 2PV0A 4I55F 1RAAA 3R7WB 4BCBA 4Q4LA 4DHEA 3R9XA 3CF6R 3RS2A 1E89A 1BVUA 1I0ZA 1U4SA 1ZVQA 3L7MA 2PXAA 1A96A 2C7BA 3FH0A 4MIKA 4BB6A 3AF6A 1Q21A 4PFSA 1E0DA 5DHPA 2XUGA 3B3GA 4ZC8A 1HGXA 2HD4A 2IITA 2IEAA 1A9YA 1U2GA 3P0RA 2PLWA 4CBVA 4CCYA 4PHGA 2RK4A 5EZ6B 4BZXA 2QN9A 1K6JA 2FQYA 2UVDA 1FYEA 5LP6C 1DPGA 2M6LA 3SHTA 3ZVNA 1KY2A 1JALA 1XQVA 4J16A 2XB8A 4XLTA 4DCSA 3PJRA 1K3TA 3OM9A 3ZWWA 2BR3A 1CQJB 4CM9D 3DFMA 1S3FA 2SNIE 5ELMA 2JASA 1W48A 3FM9A 5F1KA 1DAPA 2XWPA 1YZNA 4UAGA 2XE8A 3O8OA 2QU7A 5K0CA 2ZI4A 2A92A 5KDLA 3ZR4B 1BN6A 1JU9A 1C4OA 3BXOA 1FFGA 6ADHA 1I7DA 3O31A 2G3YA 3GLTA 4GPBA 3G2NA 3DEIA 5FQNA 4BUZA 4HDRA 4HWPA 4ZJZA 2OR3A 2VH5R 1TRHA 1YBVA 5F2NA 1N3BA 2VBFA 4LJ4A 1XN4A 2WUVA 3D2CA 5AH0A 5JH7A 3IVRA 2Y4NA 1A98A 1QOZA 3HRKA 2Z0MA 1E6KA 5CA1A 5JROA 2A59A 1Q3HA 3G8BA 2GWHA 3FNGA 2I8CA 1H0KA 5EXTA 1AH2A 2VXYA 1WXGA 4Q5IA 3D5EA 3DTYA 2ODNA 1NJFA 2Q5IA 1KORA 1NJ1A 2C2ZA 3NBYC 4LFCB 3BB1A 2FFJA 1DTEA 2DULA 4G1UC 3HA7A 1JBEA 4OM7A 1IWOA 1YCFA 2CXTA 3IDSA 5G0WA 1NW9B 4QEKA 5DBFA 3A3NA 4JCCA 1ESZA 4F86A 4D97A 3BFXA 3GXOA 1PZMA 3GGGA 2PEZA 4X8HA 2PY6A 2GH1A 2VDLB 1DCMA 3DZFA 4M9XA 4LHYA 4CG1A 4DFDA 2VJYA 4P58A 1SU4A 4GECA 2PX0A 2ZR8A 5H8WA 4LRSB 3WLJA 2YWFA 4DGSA 1N36B 1V5IA 3EULA 3DVLA 4D4JA 4NZZA 4IEEA 1GZ7A 4IJ6A 1H94A 1XAJA 4NYIQ 1J90A 3L18A 3E1GA 4K7JA 2P2GA 3V2GA 1VXOA 4M7PA 4OQYA 3TSAA 5EJ7A 1G17A 1EZZA 4AG5A 4G1EB 2P2YA 2H1RA 3O8DA 2JIZD 3AIKA 1XCGB 1Y1RA 2BFWA 2WUFA 2LR0A 4C78A 1WY5A 4C7MA 2HBYA 4LQLA 3UANA 1YCDA 4GL4A 4JQOA 4IEFB 1ZQ1A 5A6SA 3F5MA 1YTLA 2I03A 2JZCA 5IJ9B 2YIDA 2P9YA 1JVNA 5JW6A 5ESRA 1OQAA 3G0DA 3FKJA 2Q6TA 4C0LA 3L04A 2H5LA 2ATXA 1SG0A 2J45A 4G89A 1MFZA 4CL8A 3WYAA 1RPNA 3W4IA 4JL6A 1M8FA 2J31A 3CXRA 4RPCA 5F73A 4DXHA 1OXVA 2XNHA 1WR8A 2X1HA 2ZJ6A 1KZ6A 4NMHA 4X91A 4WZAB 4H35A 1JHXA 2PS1A 2K87A 2IVZA 1RRFA 1H9BA 3MIIA 2HTFA 4IIGA 3KHKA 1L4EA 3H04A 5AJWA 7ABPA 5FOQA 1JG3A 1RLTA 1P5ZB 5HUQA 1CXZA 2FSVA 1CJMA 2NQTA 3NB0A 3Q5GA 1XTBA 3QPDA 5KX5B 4KR3A 5FPPA 1PFGA 1U90A 1PNTA 3JVUA 1DIHA 1RBMA 3BA6A 1Q91A 3JQQA 1Z5PA 2YN2A 4HEJA 4UVIA 3SC6A 2HGZA 2PRIA 3GRYA 1AQJA 1CRPA 1A8SA 4PLYA 4TTAA 3OP4A 2NP7A 4B3IA 3BXPA 3OIDA 2FFQA 4WCFA 5B1EA 5FTJA 1R6DA 1B93A 1SKYE 1NW4A 1N5KA 1U2TA 2B7CA 2CFTA 3DLBA 1BS2A 4JYAB 1OBHA 2ZJ3A 3T6KA 4URZR 4BO9A 5CHEA 3GBVA 1OYWA 1UPBA 3SP1A 2Z8ZA 3IR5A 4RXTA 1LWOA 2O8VA 3TQRA 4NOKA 1KJZA 4IOLA 4HZGA 1ICEA 1ZC4A 2W6IA 4DLBA 1DO8A 2QI9F 3DAYA 5CG2A 1RRVA 4L5IA 4XB1A 1EESA 1G7TA 1CZLA 2VKTA 1X2EA 2PLRA 4KFSA 4DLAA 1LCIA 3SJ7A 4L7QA 5IS2A 1XRLA 3KFLA 5IT5A 4E2ZA 5ARDA 5K0LA 3H2ZA 3GJ7A 4UVHA 3PYMA 3QGMA 5CLHA 1UC9A 5FNZA 3ZDCA 4DUGA 2VNSA 3VYRB 1MAHA 2G1UA 2X4LA 4Z4IA 2HU8A 2DQKA 3K8QA 2DY0A 3V2UA 2AFVA 1HZZA 4EYEA 1G1MA 3SVLA 3OO0A 2G6TA 3DE5X 2VATA 3JATB 3R4CA 5EERA 2AXPA 3VDNB 4W5NA 1GR1A 4EY8A 3HO6A 1H5NA 3ZNNA 4DQLA 1JN0A 1PR4A 2P6UA 3KZXA 5CVDA 1ZJZA 1DX4A 3VOTA 5A04A 5KMGA 2JAPA 3A06A 4GXRA 4JCOA 1JFFA 4M7WA 4YFVA 5D85A 3V00A 4V1CA 5AW4A 1W87A 1UJBA 1REQA 2FQ1A 4KR2A 3KAKA 4UEOA 4HFRA 5ALMA 4A73A 5I4KA 1N7JA 1TU0A 2ZI5A 1P5HA 3GAMA 1VCNA 3I52A 1M74A 3PFNA 4PO1A 4ID9A 4R41A 3KLMX 3ZE1B 1GGFA 4E07A 3I0MA 3N28A 2PO7A 1X1CA 2AG1A 4ZQIA 3NM6B 1ZSYA 2J9FA 4TMXA 3ZKWB 1J2TA 4ZJUA 5CLQA 4B81A 2VP4A 3WP1B 3NONA 2GBPA 1QQ7A 1COWD 1WEKA 3KYJB 5I01A 2RK3A 1A9XB 1U94A 3QVJA 4KAAA 3UFBA 3R6DA 3ZZUA 2FK8A 4ZN6A 2UYYA 1VG8A 4Q3EA 2IF2A 3FG9A 2H7XA 5CEFA 1SQ5A 2WZBA 1CR2A 2NSHA 3PUXA 3VOSA 3FIUA 3RG2A 2WG2A 3S1AB 4ZD6A 1DQNA 3TOCA 1U7TA 1MF7A 1OJ7A 1OZAA 4YV1A 4QFDA 2OCGA 2B99A 4LDAA 3QYAA 2Q9CA 3FPCA 2DWPA 4TT3D 1O95A 4BNLA 4BWFB 4BZQA 4G9BA 1J9GA 3HA5A 3RF7A 4OG2A 1IY1A 2GTHA 4AD8A 2JF0A 1IEXA 4BFUA 1CY2A 1Q22A 3L6RA 3WOHA 2OT3B 2BHRA 3QU5A 4NU8X 2NTYC 3W04A 1WPRA 2XNDA 3I6IA 3CZ9A 1NHWA 1TKAA 2EP7A 2H5JA 3AF3A 3GUUA 4HLDA 2KJQA 3K0AB 3I5XA 1XWIA 3D43A 3LECA 1G20A 4FSDA 1H5UA 1AXGA 3O6VA 1XRSB 4CM7A 5K0JA 3HBNA 5JNRA 2PUCA 4B0OA 3M3DA 3Q8LA 4D6YA 4LK3A 1I2CA 1UT8A 1VFNA 2IC5A 2C03A 4D8UA 1MA0A 2YWRA 4OL9A 5KQPA 1M2WA 5TRTA 1H2AS 3RJ5A 4C3ZA 3AM4A 2PGAA 2SKEA 4RVGA 1QRRA 4EKDA 5A4DA 4EG7A 4MAMA 5K1ZA 1TJPB 4Q7JB 3A04A 2XTJA 4XRGA 1BGXT 1EAYA 2WUWE 1JECA 4R01A 1XPJA 2CC2A 2ZB2A 3DF7A 1BKYA 3FCEA 2ZVJA 4W8OA 5AK6A 3BICA 3FI9A 3B1ZA 5GONB 1IUKA 3LL7A 4YAFA 1EHYA 1FQKA 1UXKA 1QS0A 5DM2A 5CK4A 4ZYVA 1W4CA 4GP6A 5ELXA 3HVJA 4EHDA 3V55A 2P1RA 3MJHA 1H2XA 2P6RA 1CCWA 1DBIA 2FP4B 3EEOA 1XPOA 3NOOA