4WUVA

Crystal structure of a putative d-mannonate oxidoreductase from haemophilus influenza (avi_5165, target efi-513796) with bound nad
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
280
structure length
280
Chain Sequence
NIAANHNLENKLIIITGAGGVLCSFLAKQLAYTKANIALLDLNFEAADKVAKEINQSGGKAKAYKTNVLELENIKEVRNQIETDFGTCDILINGAGGNNPKATTDNEFHQFDLNETTRTFFDLDKSGIEFVFNLNYLGSLLPTQVFAKDMLGKQGANIINISSMNAFTPLTKIPAYSGAKAAISNFTQWLAVYFSKVGIRCNAIAPGFLVSNQNLALLFDTEGKPTDRANKILTNTPMGRFGESEELLGALLFLIDENYSAFVNGVVLPVDGGFSAYSGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative D-Mannonate oxidoreductase from Haemophilus influenza (Avi_5165, TARGET EFI-513796) with bound NAD
rcsb
source organism Haemophilus influenzae rdaw
molecule tags Oxidoreductase
molecule keywords 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase
total genus 90
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wuvA00
1Z45A 4Z9XA 1ADFA 2PR2A 3GH3A 3MEQA 3WQQA 2Q3EA 4BB6A 5CEJA 1SAYA 3DHEA 1SBYA 2DM6A 2BHLA 1XCBA 1JU9A 1Z73A 5I7EA 1T2DA 3ENNA 4JK3A 2X22A 3BAZA 5KIAA 1VJ0A 3DZGA 1VPDA 4XQCA 1JKJA 1MX3A 3KOUA 1NWHA 1YOVA 2ZTLA 1U3TA 2NTVA 4J91A 4ZQEA 3RJ5A 3NKLA 3AJRA 4MKZA 5ITWA 4J1QA 1SB8A 1P1FA 1DBVO 4FGSA 3WGOA 2I99A 3S8MA 3FTPA 2YQ4A 2EGHA 1V6AA 4NU5A 5TF4A 5IJZA 1Y9EA 4EEXA 1YB1A 3MTJA 3TZQA 2VYND 4BS9A 2NM0A 4II3A 5A9SB 5THKA 5L9AA 3DTYA 3QSGA 3PIDA 3P5SA 4IM7A 3I4FA 2CVQA 3AM3A 5A02A 4L76A 3VH4A 4CV3A 2P2SA 3MJCA 4HX5A 5TQVA 3V1UA 4KTVE 2VRBA 4FQ8A 4XYMA 5DP2A 2VZ0A 1HXHA 5TJ9A 4J1SA 5KJCA 2BLLA 1M66A 4JN6B 3LQFA 2OFPA 4CLRB 3SJ7A 4CR6A 3I83A 4RJTA 3UCXA 5ITVA 4RLHA 1RYEA 4FFOA 4BO7A 5KJEA 4GPD1 4CM8B 3OQ6A 2C82A 1R4MA 2YFHA 2BF7A 3RU7A 2OGUA 1BG6A 4HXYA 4CMEA 3RUFA 4FDAA 2FPGA 3U0BA 1JDJA 4RDHA 3UH1A 4U6QA 3HDHA 4WLNA 3UGKA 2PK3A 3GN1A 1GCOA 3NTQA 3L9XA 4D79A 4PG8A 1EUCA 3BTOA 4W4TA 4DYDA 1FK8A 3DOCA 5COBA 4UUOA 1I10A 1PTJA 5AXAA 2CFCA 4HNHA 1E0DA 4OKIA 3GUCA 5ILGA 2X0NA 1I3NA 1NPTO 4WNCA 1YL7A 3P7MA 4HUJA 4FBGA 4LN1A 2X9GA 4JROA 3MWEB 2FZEA 2Z1NA 4D42A 4RPHA 3BTSA 4R9RA 3W8FA 2PGDA 3WWZA 5L7TA 3GRKA 3FHLA 3BXXA 1U1IA 4PLGA 2QZZA 3QWFA 1U3WA 4F6LA 1H94A 3KTDA 1ORRA 4NFSA 3VZPA 4QO8A 4EJ0A 5CPBA 3VDQA 1OI7A 4WOJA 4PG4A 1T1SA 4BNWA 2BGLA 1I32A 2FWMX 5IAAA 3D4PA 3EGOA 1MUUA 4J2OA 1A7KA 4GL4A 1YDWA 3WJAA 2O3RA 1P0FA 3AWDA 2FR8A 2VUUA 3KBOA 1PQPA 3PWZA 4E5MA 4WLOA 4E2ZA 2HJSA 5EESA 2YV3A 2ZJ0A 3E5MA 1NFFA 4I1IA 1E77A 1WMAA 4AVYA 5GZ1A 4F3YA 2J3KA 1F12A 1O0SA 4XDYA 5AQ1A 1GR0A 4IIVA 4WGGA 3E03A 4TZKA 3WS7A 3IUSA 5A9SA 3GEGA 3AOEA 3DZFA 3EAGA 4IDGA 4E2XA 4L9RA 3T4XA 5H81A 3CZRA 3D5QA 3KO8A 1ZBQA 4KUHA 4HNGA 1T2CA 3NX4A 1PR3A 4CM4B 4CQMD 2OOSA 1LSUA 4I5FA 1LSJA 3OJEA 9LDBA 1YS4A 3C8MA 1GQQA 1H2HA 4DPMA 3NDRA 3IKTA 4PG6A 3WYCA 4OM8A 2JCYA 2VQ3A 4IINA 3F1KA 1C0LA 3RUCA 4KQXA 4Z0PA 1N1GA 3EYWA 1A9ZA 3W4JA 1JQBA 5T57A 4NMHA 1K2WA 3AI1A 2IZZA 3K92A 5ICMA 2JFGA 3HDJA 2G76A 1P9LA 4UEJA 2JJYA 3LZ6A 2Y68A 4YXFA 3L07A 1ML3A 3GA0A 1E1KA 4RPKA 1YB4A 2I66A 1H5QA 3O26A 3DONA 3KZVA 5DOZA 2H9IA 5L51A 2VHZA 3IJPA 5CDUA 5JMWA 3LT1A 3U5TA 5A06A 1FDTA 3MOGA 3P2OA 5C7OO 1HYEA 3EW7A 3ZWVA 1Q0LA 1LRLA 4KOAA 3Q9NA 3EMKA 1TT5A 1DFGA 3C3XA 3GOHA 1ONOA 1A72A 2C29D 5JAZA 1YDEA 3H4VA 5JY6A 4AJNA 4AJ1A 4PG5A 3TZ6A 2BFMA 3TFOA 1DIAA 1PJ3A 3F47A 1G1AA 3KRTA 1IL0A 1DJQA 2E49A 2DBRA 3E1KA 1ENYA 5HA5A 2DU8A 4IDAA 1P31A 3VKUA 3ZW8A 3AFNA 4DPKA 1Q7CA 5AYVA 1Q7GA 1U3VA 3D4NA 3EZYA 1DRUA 3D0OA 3PYLA 4FIZA 3ZNQA 1EE9A 2OORA 4Q3DA 1XDWA 1SC6A 4YVFA 5JCJA 1XWFA 2ZTUA 4P8RA 3K30A 4ZQBA 1E5LA 1YBAA 3U4DA 4RQTA 2GN6A 1B0AA 4MKRA 3DFZA 4IDEA 1BSVA 3NUGA 3DOOA 4MVJP 4ESOA 1H6DA 2PZKA 3KYCA 5G4KB 5TNXA 1AHHA 1GL3A 2Q2WA 1RKXA 3DWFA 3CUKA 4JCOA 5IXYA 2EKLA 2W98A 2VT3A 4ZJUA 1MA0A 1JWAB 1MXFA 2O3SA 4KDFA 4CQLB 5JCJD 2W2KA 1ZFNA 4IZHA 1T1RA 2AQHA 4BGUA 4IBOA 4EW6A 3C1TA 5DF1A 4DYVA 2OP1A 4QFDA 2ET6A 4L74A 4FR5A 4WCFC 4PLHA 1EMDA 3DBHB 4WOKA 2UAGA 4QECA 1YGYA 3JYQA 3DBLA 3QP9A 4KMSA 3RSHA 4D3DA 3U4IA 2AEJA 1DHTA 3VH2A 4EUFA 2JD0A 5EMHA 4CV0A 2PKRA 1LA2A 3KYBA 2CNBA 3GAZA 4G81A 3I4CA 1O95A 3RBXA 5CEEA 1MG0A 1P33A 2IYOA 5JYDA 1SNYA 5KKAA 2PZMA 2X0JA 3MZ0A 4B7UA 1QYXA 4J6FA 1GCUA 1CIVA 3BMQA 1HDGO 1HDZA 2OXIA 3PDUA 1JKFA 3QQPA 4PLYA 4XX0A 4BNTA 3JYPA 4EJMA 2VYVA 3QY9A 4ND1A 5LDGA 3ICCA 4JIGA 4PRKA 3SXPA 3RUHA 2WSBA 3B1FA 2EWMA 1AGNA 2EJWA 2C2YA 1GZ3A 1P1IA 2ZYAA 2OZPA 4BV8A 1R0SA 4B8ZA 3FTNA 2QZ9A 3LC2O 3ZW9A 4CMIA 4MVJG 4XIJA 2D0IA 2UVDA 4R16A 4ALMA 5JDIC 2V65A 2CDCA 2BH9A 4AJLA 3I1JA 4K28A 5DZSA 4Q3AA 2UV8A 5TT1A 3WIDA 4BMSA 2IDZA 2V6MA 3S55A 1I2CA 3FD8A 3WTBA 4ILKA 1EUDA 3FNFA 1H9AA 3F5SA 2O2SA 3UVEA 2CDAA 5KCZA 4R1TA 3Q9UA 1LQUA 4R54A 3JV7A 1YBVA 3PLRA 1W4ZA 1ZMTA 3OIGA 4MOWA 4HKTA 1SOVA 1HT0A 1U7HA 2X7HA 5T64A 4EI2A 3JQAD 3E9QA 3GUYA 2PTGA 1VKNA 2HU2A 1CJCA 3I3OA 1IY8A 3K6JA 4XRRA 4BHTA 2HAEA 3PGXA 5A5FA 1EK6A 4BQPA 3GG9A 2GPTA 1Y8RA 5FI3A 3AM4A 1J49A 3M2TA 4FCCA 3O8QA 5HWSA 2ZCUA 2HCTA 1K0UA 1BXGB 1WLYA 4GVLA 5IG2A 2Q1TA 3BYZA 3GQVA 1QLJA 4KZPA 2YHUA 2VWQA 5JO9A 5JXWA 4AJ2A 1HE3A 1GDHA 4QTZA 5DCYA 5ENVA 5THQA 4MO2A 1V0JA 4IDFA 3KUXA 4ND4A 1IHYA 4WEQA 1VJ1A 4NH4A 1PJQA 5BSHA 4IGEA 1TVEA 1E7QA 3NAQA 3K9QO 1ENZA 1YJQA 3K96A 1WAMA 3VH1A 4BNFA 1NWCA 3S2IA 3LF2A 4CODB 4D46A 1E7SA 5C7LO 4EYEA 5I7VA 4ND3A 3E8XA 3GK3A 3QVOA 5A5EA 3PTZA 3ZWXA 1ZUD1 3F1LA 5F5NA 5C3MA 2ZB8A 2RCYA 3H7AA 4OGWA 3PJFA 5KNLA 4IJWA 4S3MA 2Y67A 2Z5LA 3INGA 4LSWA 4QUKA 1ADGA 1TA4A 1LJ8A 5B37A 5EQFA 1LU9A 3OJ0A 2O48X 3NT4A 3AOEC 2I6TA 3FR7A 3GNSA 2EXXA 3G1TA 3PQDA 5JLAA 4BO1A 2O2YA 3HN7A 4G65A 2Z1MA 3F46A 4IPTA 1C3VA 1R0KA 1BTOA 4ZQGA 1OOEA 1SMKA 3L4BA 1K6XA 3GMSA 4OSPA 5ADHA 5GMOA 1I0ZA 3B1JA 4Z3DA 2YW9A 4F45A 1H9BA 1NHWA 5I9NA 2HMSA 4NBWA 1JLLA 3OMLA 3BTUA 4OXNA 3QIVA 5L53A 5CDYA 4QX6A 4TROA 2NVWA 1WWKA 3JQAB 1JN0A 1FDSA 4P4NA 3KLMX 1DDOA 4DIBA 1AN9A 4L0QA 3K8ZA 4PCVA 1UXKA 2AQKA 5T8KA 4GQAA 1LLCA 4XD2A 4W9NA 1N2SA 1SB9A 2O3TA 4EDFA 3W8DA 2P4HX 3IL2A 3LLSA 3PHJA 1N7GA 1NPYA 1WVGA 2GZ3A 2X4GA 1E7RA 2Q2VA 1EBUA 1FDWA 1DC4A 4O1MA 3UUWA 3OJFA 1DAOA 4PVDA 1XQ1A 2VUTA 1IHXA 3SX2A 2GASA 4FB5A 3WXBA 4C4OA 4K1LA 3RC2A 1SCUA 4PLWA 3TZKA 4E21A 1ZH8A 3IAHA 3JQ7A 2CD9A 4FOOA 4D3FA 1A5ZA 4N5NA 1LI4A 3PIIA 3CKYA 3GZNA 1Y81A 3FBTA 4FJ0A 3V2HA 3U62A 4CLDA 5JO0A 5ER6A 1LLQA 1XU7A 1PU2A 1MP0A 1I2ZA 3FR8A 3HSKA 4LCEA 4DLLA 3GVCA 3QE3A 4IDBA 5I7FA 4RORA 4BKRA 3ANMA 4MIOA 4IZIA 2HDHA 3EC7A 3LDHA 4E31A 5G0TA 3FWNA 1YQGA 4BNNA 3I6QA 1DLIA 2GNAA 1BVRA 4K6CA 1BW9A 1VL0A 2RH8A 4AJ4A 4W82A 1OBFO 2CZCA 4JLWA 5G0VA 3LC1O 4WPGA 3DBLB 4YT5A 2BD0A 4M89A 1MC4A 4KQWA 2NWQA 1ISFA 1KVQA 2CY0A 3ABIA 1FMCA 1KETA 2ZYDA 2QQ5A 3ZU5A 4IMPA 5COAA 3HQ4O 1VJTA 4DC0A 3PQFA 5J23A 3TL2A 4B7XA 1KC1A 1EUZA 3I9KA 2WD8A 1AXGA 2D5AA 4WCFA 2DFDA 2RBEA 1U5CA 2NQ8A 4NG5A 4R51A 3ITDA 5A1TA 4R1UA 5I9LA 4PLPA 1GZ6A 3O03A 4HFMA 1NBOA 4CM1A 4WJZA 2VHYA 2I67A 4MVJE 1JW9B 4UVEA 3M1AA 4R41A 3HNPA 3UXYA 3ZWAA 3SC6A 4J0EA 1E3WB 3W6UA 1HZJA 2Y1FA 2J3JA 4PLTA 4RVDA 4DL9A 4AJEA 2SCUA 4CM8A 1ZJYA 1S6YA 3I6IA 1R37A 5G0SA 3MTGA 1NVGA 2FSSA 5KOIA 3RUEA 1B8UA 3GPDG 1WZEA 5DCWA 2BRUA 2HQ1A 3WMWA 1T2AA 1W8DA 2I3AA 3NYWA 3DMTA 3JSAA 4UAGA 4WK6A 4Y6PA 3WLFA 1GU7A 1YL5A 4Z9YA 4L4RA 5IF3A 1LDYA 1EDOA 4NPCA 4BGEA 5JY1A 5IZ4A 2A94A 3DDNA 1T26A 1ZEJA 2Q99A 1B8VA 1CQIA 4BO8A 1KBZA 3WBBA 1GUFA 4QT0A 3GAFA 1E3LA 4HADA 4OMUA 1U8XX 3P19A 1XA0A 4YEDA 2WYVA 3NTRA 3ZHBA 1E1LA 3TNLA 4HV4A 1TEHA 1X0XA 4CM3A 3NJ4A 4GKBA 4WASA 5A03A 3VOSA 3PDJA 4RZHA 3VVBA 3W1VA 3WYBA 2BKAA 1NNUA 1NFRA 4XCVA 2Q46A 1A7AA 2V6GA 1NTOA 2C59A 3Q11A 3T7EA 4NHEA 3K73O 2IYPA 4CUJA 2B4QA 1P3DA 1NQ5A 1XG5A 3WMXA 3ZWMA 4GX5A 1X7DA 4EUHA 1XQ6A 2QRJA 4CR7A 2FRDA 2PD6A 2HMWA 2WTBA 4XDZA 3DZBA 1DIRA 1IB6A 1R4NB 3Q6IA 4JQCA 1YVEI 4QSMA 1ZEMA 1TI7A 3ZWWA 3NV9A 5K9ZA 2O50A 5T8KC 4D45A 4DVJA 1GYQA 3FRJA 3GEMA 3WFIA 3BZUA 3VPGA 1H93A 2A92A 3HWRA 4IXTA 4CM4A 2Y0EA 2IZ1A 3ZU3A 1DC3A 2JFHA 3OIFA 3LT0A 4DMMA 4ITUA 1U8FO 1UDCA 4MPDA 2GF2A 3L6OO 1E6UA 3WGZA 2OO5A 2D2IA 2FP4A 1XEAA 4N7RA 1NQTA 4RPJA 1C1DA 4TRNA 5C37A 3JQ8A 1LXCA 1X15A 1BDMA 1VI2A 1WZIA 3BMOB 2VNAA 1U7TA 2NADA 1W73A 3CIFA 3DZJA 1ID1A 3HZZA 4KUEA 3JQ9A 3CINA 2ZKLA 3HB4X 1N9GA 4ID9A 2YDXA 1O8CA 2ZB4A 3GVXA 4BO2A 1Q2XA 5JDCA 2AQIA 3ETDA 3JQBA 3QVSA 4L75A 1YE3A 4QEDA 3WGQA 4L4XA 5A04A 1I01A 1ZK0A 1ARZA 1PR9A 4TRRA 4RVGA 1C1XB 2E4AA 8ADHA 1T4DA 4PRLA 2P91A 3V1YA 1E3WA 3VTFA 3GGPA 1Z75A 4XR9A 1XGKA 3WQSB 2VOEA 4GLLA 2Q4BA 3DEYX 3S1LA 4J1TA 1XHLA 3JYLA 4RV9A 3DHYA 3JD2A 1U28A 1RWBA 1ZZEA 4Z9FA 1T25A 3RC9A 4B4WA 1R16A 5KJ1A 2PGJA 3DZIA 3G3EA 1X7HA 3GLQA 3OEWA 4XZ3A 4UEOA 1YXMA 1J5PA 1KY5A 2C5EA 4CM9D 2YYYA 1Q7BA 1UUFA 4ZA2A 5L45A 3TN7A 1EFLA 1EFKA 4J0FA 4PFJA 3WDSA 2DTXA 2ILTA 3PPIA 2EW2A 1A4UA 3ZWCA 4LMPA 4DQXA 3OJOA 1GAEO 1V35A 2Y93A 1CQJA 2Y1CA 3AY6A 3G0OA 5H83A 2XPCA 3FF4A 3QLJA 5F3RA 3W6ZA 2EV9A 4GSKA 5FYDA 2YV2A 3RD5A 2IEBA 1V3TA 2F00A 2UYYA 1DLJA 3JQ8B 5L4NA 3AUAA 3OIDA 2PD3A 4GMGA 4XGNA 5CEFA 3GZNB 1PWXA 2I76A 3X2FA 2G17A 2VHVA 3RCBA 5F1KA 3JQGA 3ZHZA 5HTOA 1PIWA 1DC5A 1WNTA 3RI3A 4GH5A 4E13A 1IYZA 1QV7A 2DC1A 4HBGA 1O6ZA 4IGFA 1NPDA 3K5PA 5L7YA 4DQUA 2PH3A 4P22A 1JWBB 4RO0A 3LF1A 4XQEA 2DAPA 3PWSA 2O3JA 4NIMA 1YOVB 3S2FA 4UEKA 4W7IA 3WR5A 2VNSA 1J4AA 4J90A 5JS6A 1T24A 1I36A 3PEFA 3L9WA 3QRWA 4OXYA 3TOXA 1DRWA 4II2A 2NUAA 4NNJA 1UJMA 4Q3NA 4BMNA 1VRWA 2D8AA 2V6FA 5TT0A 4D0RA 2ZQZA 2HK9A 3DZHA 3RKUA 5KVQA 4EITA 4RPGA 1E1MA 4ONEA 3WGYA 1KOLA 2P9GA 3CMCO 1LSOA 2D1YA 1CEQA 2VYNA 5IDWA 1DFIA 1QORA 1U4SA 3Q0EA 4R9SA 1PQWA 1UP4A 1V8BA 4IMRA 1UXGA 1NVTA 2HK8A 4D44A 1LSSA 3ZV5A 5CFZA 5CG2A 2UUPA 4LW8A 4LMRA 3NT2A 1NASA 4XKJA 3NJ8A 4YRBA 3EVTA 4J1NA 2Y1DA 2ZCVA 4CL8A 5BSGA 4URFA 3ZWYA 4BNXA 3JQ6A 1QRRA 4AJJA 5TC4A 3LYLA 4NBRA 3RUAA 3D3WA 2EG9A 4UUNA 1LLUA 1PZFA 1U2GA 3FCOA 3SVTA 3JD4A 2NACA 4UUMA 2YY7A 3RQSA 4R1SA 1WPQA 1IE3A 2B36A 4IJKA 5CP8A 2BFAA 1PX0A 1P1JA 2FHSA 3C1AA 1TT7A 1MG5A 3I9LA 1Z7EA 3F3SA 2XF8A 3ZWNA 4PZCA 5TLSA 3CH6A 3F4LA 1D3AA 4M55A 4R1NA 1E7MA 1HYGA 1JTVA 2NU6A 1ADBA 5COQA 3M1LA 2GDZA 4NFYA 3ZU4A 1DSSG 2TMGA 2X0IA 1E7WA 3BHMA 4OYRA 2PA3A 4M54A 2HRZA 3ICPA 3WNQA 3DMTC 1YWGO 3KYDA 3VTZA 5JSFA 3WSWA 4FFNA 3KVOA 4M1QA 3D64A 3ETGA 4BQRA 3WGGA 2POQX 4LRSB 4J9VA 4BB5A 1DIGA 2UDPA 1GPJA 2BI8A 2YDYA 4JP3A 4DXHA 4NK4A 2QYSA 1QKIA 1R15A 1GZ4A 2Y1OA 1EDZA 3DQPA 1O5IA 5EQDA 1E5QA 3GHHA 2O3QA 4BGVA 2G5CA 1ULUA 5B4TA 3W4IA 3H9QA 1M67A 1EEHA 4AL4A 1R66A 5FFFA 2ZJ1A 1UP6A 1BXGA 4IJUA 3HE3A 3S2EA 3HFSA 1GTMA 1GEGA 1H6BA 3DAFA 3OBBA 1BW9B 5L95A 2J5RA 5A9TA 2OUIA 3UFXA 5IN4A 1TLTA 4TVBA 1LRKA 3ZNNA 2AHRA 4D3SA 2QW8A 4ZRMA 2I3GA 2I65A 2VHXA 2BMAA 2WM3A 3ASVA 4IUYA 4ND5A 2QIOA 5CAEA 1GQ2A 4JJFA 3WYEA 1IPEA 1B26A 4CLHA 4KP7A 2IE0A 4DUPA 4CMHA 3HHPA 1WP4A 3FN4A 4O6VA 4HFJA 3DBRB 1Y9AA 3RUDA 1XIVA 2C54A 3R3JA 3UN1A 1HYHA 2EKPA 1U3UA 4WKGA 3GR6A 4CV1A 2OL4A 4GBJA 2NU9A 1PS9A 3GDFA 1HDCA 3ZU2A 2FR0A 1I3LA 2B69A 4BVAA 3B20A 2EHDA 3GG2A 3MOIA 4A0SA 1JAYA 4RL6A 3WIEA 1CWUA 1PZEA 3MJEA 3QJ5A 1OMOA 3GY0A 3WICA 4J16A 3RU9A 4N5LA 3WGTA 2W90A 4IS2A 3JQBC 3I9NA 4E2WA 5CDSA 2AA3A 1T4BA 1DRVA 4QO7A 4J7XA 3UKOA 1EVZA 3DR3A 4J4HA 4KUGA 4Q3CA 3ROMA 3ONFA 5A4DA 4MVJD 4OH1A 3D4OA 1GADO 2B5WA 3F4BA 4XYEA 4W7HA 1E6WA 1UZNA 1HE2A 3PHIA 5AVOA 4D0SA 3K2EA 3EZLA 2P5YA 1HDOA 4MIYA 1MXHA 2HUNA 3AUTA 2DFVA 2PD4A 1QG6A 1EZ4A 2GGSA 1G0NA 2VWHA 1U4OA 4YJFB 4L73A 1M2WA 4Z3KA 1XYGA 1E3IA 1KY4A 2GLXA 1UDBA 2W4QA 4MVJM 1HRDA 4PLVA 5BQFA 4S1VA 2PH5A 4I5EA 2DLDA 3QVWA 5DNAA 1Q1NA 4RQUA 1DC6A 4NBTA 4ZQHA 2OBYA 4TKMA 5G4KA 4ALKA 2GO1A 5L4SA 1G0OA 3ADPA 3IKVA 4XRGA 5IZCC 4YWJA 2I9PA 1L1FA 4OXKA 3RVDA 3TWOA 5EINA 2ZYGA 2B0JA 3LLVA 2PLAA 2B83A 2RH4A 1LDGA 2HO5A 3E6AA 4LK3A 1XLTA 4YAEA 5T5QA 3A14A 3TOZA 1LDMA 1NM5A 2X1HA 1PSDA 1HLDA 1IZ0A 1SO8A 2YUTA 4YAIA 1ISHA 1B16A 5LCXA 1VM6A 1DFHA 4IXWA 4PG7A 1IUKA 3H3FA 3U09A 4MP8A 4BNUA 1PS0A 4YA6A 4XA8A 1IOLA 2O4CA 3HDYA 4XB1A 5JMPA 1PEDA 1F14A 1RM3A 2PV7A 5I9MA 1DAPA 3I23A 4KWHA 5BNFA 3BA1A 3DL2A 3EDMA 1RM0A 1KIFA 3QA9A 3O8QB 5G0WA 5HS4A 2PZJA 1Y5MA 3H9EO 3D3EA 5AXDA 1VL6A 4FGWA 4I9UA 2HK7A 3P2YA 1HE5A 4BKOA 1I3KA 5BR7A 4TQGA 5BSEA 3SEFA 4NU6A 4ZHSA 1K6JA 1UH5A 3LT2A 5DBFA 4TRMA 2GERA 1HL3A 3QHAA 4OKNA 4NR0A 5T67A 1BRMA 3GDGA 4AJHA 3O4RA 1PS8A 1TXGA 1DHRA 3LU1A 2EP5A 3V1TC 4E5YA 4U5QA 3IQDB 1CF2O 4AICA 5IXSA 4HP8A 1LC0A 3GNTA 1ISGA 3LSYA 4CQMA 5BNTA 2X86A 3N7UA 4FOSA 3OA0A 4B3JA 3PK0A 3CEAA 3JQEA 1TB4A 3ZV6A 1QYDA 3O9ZA 4RGBA 4BUCA 1P1KA 4CQMB 4YAJA 1EBFA 3E82A 1GY8A 1ENOA 1NVMB 3H9UA 4HFNA 1IPFA 3MWDB 4UVHA 4GX1A 3TDKA 5A05A 1H6CA 2GN9A 1NAHA 4FC6A 1UZLA 4M49A 3PQEA 2DBZA 4CMJA 2VWGA 3BHJA 4XEHA 1NP3A 3PRJA 4Y9DA 4FN4A 1HZZA 1N1EA 3VPSA 1LEHA 1DB3A 1VC2A 2GN4A 1I3MA 4I5GA 5MGBA 3KXDA 1YB5A 1GV0A 2WJPA 4D43A 2WYWA 1C0KA 2ZTVA 1GV1A 2NSDA 2FPPA 3V2GA 2X0RA 2EF1A 3KEOA 4Z0HO 4AJIA 1HDXA 1FJHA 4WLVA 1DEHA 5IN5A 1QSGA 2OBNA 1D1TA 2XAAA 2A4KA 4ALLA 2LDXA 4NK5A 4YB8A 3WG9A 5K6AC 1MB4A 1F8FA 2Q1WA 4RVSA 1NR7A 4WEOA 3PZBA 1ISIA 3HB5X 4BOYA 5CG1A 5MDHA 4GWKA 3NGXA 4XJTA 4YBZA 1A71A 1UAYA 2PKQO 1LUAA 2LDBA 3LC7O 3OETA 2QRLA 3FNHA 5L3ZA 2YFQA 1S7CA 4BNIA 5A9RA 2B5VA 3B1KA 4DWVA 1T2FA 4O0LA 1B2LA 5JBIA 1NHGA 1W0CA 1YONA 2VWPA 1WDKA 2R00C 2ZK7A 3BMNA 1ENPA 4UUPA 5ES3A 3VZQA 3ZI0A 4OOFA 3AU8A 1NX6A 2J6IA 2GZ2A 4J4TA 2D59A 1PGNA 1F17A 2DPHA 2VHWA 4OAQA 4BNVA 2DUUA 1AE1A 3GHYA 3PYMA 4YT8A 5IFLA 3DTTA 3GNQA 3A9WA 4CM9A 1E7YA 4CMCA 2NVBA 5B4VA 4EJ6A 4U8GA 3H5RA 4FC7A 2WWRA 5G0UA 4LISA 1KEVA 2E37A 3AFMA 3HG7A 4JNKA 3A06A 4BNYA 4OO3A 4A26A 2Q4EA 4CM6A 3BMCB 2BELA 2FY8A 2IZ0A 1I8TA 3ASUA 2OHXA 3H2ZA 3GVIA 5F1OA 4YACA 5L4LA 2HJRA 5G2OA 4I8XA 5EIOA 1AUPA 1BDBA 1C1DB 1GEEA 3L0DA 3PYXA 4XGIA 4BIIA 1YBMA 2Y0CA 3NEPX 1X0VA 5F1PA 1ZXLA 3RC1A 2AMFA 4H3VA 3ROPA 1HE4A 4R3NA 3AU9A 2RHRA 1F8GA 1HTBA 4U6SA 1ZXBA 2CUKA 3IP1A 3L6EA 2VTDA 1LDBA 1N5DA 4E5PA 1PL6A 2GR9A 3WSVA 2P4QA 4YJHA 1KVRA 3Q2KA 1OAAA 1ONNA 2HMUA 2J3IA 2R2GA 3B70A 3H65A 3DBVO 1IZ9A 4G2NA 4YJHB 3TRIA 5LC1A 3JD3A 4NDNE 3NTOA 4CV2A 4ZN6A 2XOXA 3CMMA 4WUVA 4NQZA 3IIEA 4JBIA 4TWRA 3RFTA 1ZO8A 4BKUA 1UZMA 4BNLA 4DLAA 3VZRA 4CR8A 2C5AA 5JFOA 1B3RA 2H6EA 4UREA 1Q0QA 4FS3A 3VC7A 2GN8A 2C2XA 1FXSA 3JQGB 3R3SA 8LDHA 3E18A 1O9BA 4NBVA 3V8BA 1GQYA 2HKIA 5U1PA 4BNJA 1NFQA 4WNIA 1PJTA 3PLNA 5DBIA 2H1SA 2DTEA 3EUWA 3ZV3A 1B8PA 3ZDFA 3G1UA 3ZV4A 3KB6A 1A4IA 2NU7A 1KVTA 1PGQA 3RUIA 4ALJA 3WB9A 4B79A 1P1RA 1D4FA 4H15A 2HMTA 1UXIA 3QV1A 2P9CA 5ILOA 1B14A 1I24A 4B7CA 3ONEA 4A03A 2D4AA 2ZB7A 4XIYA 1CERA 2C7GA 4YRDA 1DIBA 1EVIA 1E3EA 5TJHA 5LDHA 3KM0A 2OP0A 3JQFC 1NYTA 4YQYA 4OJNA 4E12A 5KJ6A 3ZGYA 4DQVA 1QLHA 4J7CA 2PNFA 2YHIA 3A1NA 3I9JA 4YQZA 5FI5A 4IY1A 3RAJA 1GPDG 3STHA 2W2LA 3EHEA 2FR1A 2ZB3A 4N18A 4DGSA 1WW8A 2ZATA 1J0XO 1QP8A 1ZSNA 4F46A 1WDLA 4PLFA 4BO6A 3C1OA 4FJ1A 4R5MA 3JQDA 3WTCA 1SPXA 1KVUA 5JDCC 1VL8A 1I2BA 2WYUA 5KVCA 3FPLA 1T2EA 3S2GA 1XU9A 3SLGA 2WEKA 2VOJA 5FF9A 3VAZA 4B3HA 5K0ZA 5K6AA 1ZSYA 4WCFB 4ZVVA 2NU8A 2UUOA 4RDIA 1DXYA 5KVSA 4DMLA 4EGFA 3DXFA 2P9EA 3PJGA 2Y1EA 3KYDB 3U9LA 1M75A 1HKUA 2QX7A 3ETEA 4P38A 1NR1A 4P4LA 5AXBA 1ZIDA 1X1EA 2YJZA 3FSRA 3I9MA 1ZW1A 1KS9A 3A28A 4AJOA 2ZIZA 4A7PA 1YKFA 4R01A 3TQHA 2W8ZA 1LX6A 3RKRA 1YJ8A 3CPSA 4Q39A 7ADHA 2AXQA 3ZH2A 4ZD6A 3VPFA 4CMKA 2JAPA 4DIOA 4CPDA 3H9GA 3AI3A 2JCVA 3ZHYA 1B3BA 2FOIA 3W8EA 3JD1A 4YAKA 1PL8A 1K3TA 1VSUA 4FFPA 4J4BA 1LDNA 4WLEA 5CDGA 1OZAA 1PGPA 1NAIA 2A35A 4GX0A 4FSHA 3OF2A 5BSFA 1MFPA 3UOGA 1LDEA 4ND2A 4PZEA 4BV9A 4MP3A 2VRCD 3G79A 3ZNPA 2GUGA 1R6DA 2BGKA 1RYDA 1ONPA 1SOWA 3IMFA 3K31A 4IQGA 1K89A 4YAGA 1LNQA 1P0CA 1N7HA 4YJGB 4OL9A 2HRBA 4YT4A 1Y8QB 2PFGA 1HSOA 2X23A 3WGHA 4B8WA 1F06A 4GGOA 5DOVA 1QXSA 2X5OA 3D1LA 3FBGA 4JBGA 2VRCA 2B37A 2NVUA 4RVFA 4BNKA 2NVUB 2WDZA 1LRJA 2CVOA 1YRLA 3OECA 5GZ6A 4CUZA 5B4UA 4BNGA 5KKCA 3H6KA 1XELA 1MLDA 3GVPA 5A3JA 2RHCA 1SZJG 1DOHA 4XJSA 5IDYA 1VKOA 2DVMA 4DC1A 4E3ZA 1HWYA 4ZGWA 1PGJA 2EIHA 2JD1A 4X54A 4TSKA 1ISJA 4HFRA 1QMGA 4XYBA 1MFZA 4E5NA 3COSA 4PLCA 3C85A 4YTEA 5GZ3A 1GUYA 4BO4A 4MVJA 3DFUA 3LK7A 3MCVA 4MVJF 4PLZA 3TPCA 4BO3A 3OICA 3ULKA 1VSVA 3JCZA 3ANNA 5TGDA 1JKIA 2NTNA 2VTEA 3H5AA 1MC5A 3U3XA 5B1YA 1O94A 5IDQA 4A5OA 2O7SA 2F1KA 1PJCA 1OFGA 3HFGA 1LBEA 4DRYA 5TS3A 4RLSA 4CMEC 3GT0A 4Z6KA 4J43A 4JGBA 3OM9A 3AUUA 4R5HA 1ZK4A 3OFSA 2EW8A 1B15A 3ZN2A 3H5NA 5B12A 5EPOA 3GPIA 1E3JA 2DQ4A 3FWZA 2O23A 3R6DA 2AG5A 2EGGA 4NFHA 5BT9A 3PXXA 4K26A 2YV1A 3OJLA 3WNVA 3WFJA 5DBGA 4DIFA 4XQ9A 4I5DA 5U9CA 1FDVA 2WE7A 3KEQA 4RZIA 4MIEA 2JD2A 3JQFA 4LVUA 2PKQP 2E6UX 1E6EA 5JAIA 4JXKA 5HS6A 3U49A 4RVUA 3VVCA 4AJPA 4UULA 5L7WA 3IOYA 1QYCA 3MJ4A 2GZ1A 5F5LA 2Y99A 4OQYA 2Q1UA 4Y6RA 1LQTA 3JQ9C 2IEDA 3CSDA 3RBZA 1U2DA 4MVJH 3PJDA 4YCAA 2TMDA 2J5KA 3D5TA 4XB2A 1HSZA 2YQ5A 1BXKA 2AQ8A 4O59O 4MINA 5I8WA 3WBFA 1C1XA 1Y5RA 2PWZA 1Y7TA 2NQTA 1AXEA 4IQ8A 4YRAA 2JKVA 4FFRA 3JTMA 3JYNA 2R6JA 2IXAA 5JC8A 2V7PA 1YH3A 4OSOA 1X13A 3ZZNA 4FFLA 1N92A 3WX0A 3NDIA 3RC7A 2D5CA 3AI2A 3V2UA 5HM8A 3BMOA 3MJSA 3EK2A 4TZTA 4CL3A 4XGKA 1P44A 4CLEA 1UAGA 3QVXA 5JPIA 5I8ZA 3AK4A 3AM5A 4DTIA 3IJRA 3H9JA 3AY7A 4NI5A 4L4SA 3ZNOA 3RIHA 4B4VA 4BNHA 3PHHA 5EJ2A 2PZLA 4DPLA 2H63A 3L4SO 2GRAA 3GGOA 3PP8A 9LDTA 4NJMA 5TRTA 2RAFA 5DN9A 1X1TA 4E6PA 1ZNQO 1W6UA 4KWIA 1K5HA 4R69A 4MKXA 4C7JA 3GFGA 4CMIB 3EVNA 5HBRA 3E48A 1YL6A 1KEUA 1PJ4A 1DO8A 3OHSX 2OMEA 1XR3A 2WD7B 1I33A 4U0KA 1CETA 3H2SA 3SJUA 4GVXA 2QYTA 5JNLA 4CMAA 3SBOA 1GYRA 1BGVA 4FFMA 1HEUA 3PHGA 4PGFA 2P5UA 3VHRA 4FD3A 3B6ZA 3IS3A 3VKVA 2VN8A 1HDRA 5CPFA 3I5MA 1X14A 4PIVA 3AUSA 4TKLA 1XSEA 3QW2A 4OQZA 2PY6A 3AOGA 3DB2A 2AEMA 2AW5A 4CM5A 3RROA 2VUSA 3SLKA 3JQAA 2X58A 1YQDA 4CLOB 2Y66A 4UVIA 1O89A 5AOVA 3RWBA 1E1NA 4WCDA 3RASA 4OIMA 1LLDA 6ADHA 5DDIP 1D8AA 4GGPA 3TZCA 1GYPA 2QHXA 4YR9A 4AJKA 2JFFA 2EEZA 1R12A 2X9NA 2NV6A 3WOHA 3GZ4A 4YJDA 1KYQA 3W4KA 3GRPA 2JCXA 4CUKA 3BMCA 4K9DA 1Q0HA 3E9NA 4KDEA 4Q9NA 2GCGA 3ZHXA 2C0CA 4J3FA 4LCJA 1BWSA 1H2BA 3VDRA 4Y6SA 1KERA 3ZWBA 2QG4A 3KYCB 3OEYA 3R1IA 1PJBA 4EZBA 5GY7A 1BMDA 2Y05A 2IODA 4G5HA 2CF5A 4I9NA 4AG3A 1ZK1A 1QYVA 2I5PO 3RBVA 2YZ7A 4XQGA 2HLPA 2VZ9A 1PL7A 1PZHA 4RVHA 2XXBA 4JP2A 4A73A 2VT2A 3BMNB 3C7AA 3GVHA 4W9NC 2C7VA 4M8SA 5KJFA 4GSLA 2DUWA 3ANLA 3C7DB 4Q3BA 4DLBA 1E92A 4IDDA 4A2CA 2AE2A 3D3WB 1K6IA 4BGIA 1ISMA 4NBUA 5KTKA 5CDTA 2X5KO 4MP6A 1TT5B 3QWBA 2FN7A 2J8ZA 4WLUA 2GSDA 3Q3CA 1UP7A 1ZSVA 3INTA 1DIHA 3IDSA 1JVSA 3NGLA 3FNEA 4JBHA 4UVDA 3VZSA 3I9OA 3PFFA 1R0LA 3E9MA 1EE2A 2V6BA 3GDOA 4LVCA 4J7UA 3UCFA 2GD1O 3ROKA 2RIRA 2Q45A 1IULA 3H8VA 4ALIA 3LT4A 1L7DA 2VYVD 4PN3A 4CLOA 3L6DA 5G4LA 5DCUA 3D7LA 5DT9A 3PFWO 2WMDA 1GFSA 5TSDA 4ZICA 3MJTA 1GUZA 1JAXA 3HDQA 3ZWOA 1EVYA 4F6CA 2JL1A 4Y8VA 1HETA 4FW8A 4YDRA 4KTTE 2ZTMA 3C24A 4QFCA 5JC1A 1H0KA 4AFNA 2GYYA 3RJ9A 1V3UA 1SEPA 1V3VA 2A9FA 4BMVA 4J2HA 3TZHA 3CZMA 4QQRA 4BKQA 4Z0TA 1OC4A 1PJLA 3A4VA 3JQ7B 1SEVA 1ZK3A 4E5KA 4R68A 3F6YA 3L4BC 5EERA 3PI7A 1ADCA 1NQOA 3UICA 1Y1PA 2DT5A 1Z82A 2FMUA 4GX2A 3KV3O 4BKPA 2X9VA 4RCVA 2JAHA 4WECA 3M6IA 3PJEA 1YO6A 1PGOA 3WQRA 4Q3EA 3DBRA 4LGVA 2G1UA 4GMFA 3GN2A 4H16A 3T7CA 3JQCA 1DPGA 3I52A 2B4RO 2BGMA 3PWKA 3KLPX 2DPGA 4Y98A 4D7AA 4BNZA 5JAQA 1H6AA 3RFVA 4WE3A 4U0JA 4BO9A 7MDHA 5ICSA 4JJGA 5L40A 3ENKA 3F5QA 1ZJZA 4XWYA 3VPHA 4RPLA 2CSUA 2B4TO 2G0TA 4EEZA 3DAPA 5ENDA 4B3IA 5JW6A 1KVSA 3GGGA 2FZWA 3QWHA 5AXCA 2JHFA 4CMBA 1L7EA 4K6FA 4YT2A 4O63O 4Y67A 1JVBA 3T4EA 1VE9A 1UXJA 4W99A 2D3TA 4B4OA 1PWZA 1EVJA 3X2EA 3DO5A 2P68A 5JYEA 1MV8A 3ZCXA 1ULSA 2Q2QA 1P45A 2W2KB 5CHEA 1HF3A 1D7OA 1EQ2A 3KSDO 4CQLA 3U4HA 5JCXA 4RF4A 1Y6JA 1JA9A 1C0PA 1M6WA 2HSDA 1EQUA 1WMBA 3DHNA 3GFBA 3OA2A 5KVVA 4A27A 1I5RA 3KSZO 3NDJA 1E3SA 4INAA 5H82A 3FNGA 3HJAA 3V5NA 4CLXA 4IJVA 4MJLA 4ALNA 3LVFO 1OC2A 2Q1SA 3F9IA 4XR4A 3U4CA 2NNLD 1I30A 4BNMA 2X8LA 1F0YA 3INRA 3BTVA 1Z74A 3NT5A 4IDCA 4XYGA 1UR5A 3TF5A 4ROSA 4IIUA 4BL5A 2HMVA 4MVJI 1ZCJA 3O38A 1WDMA 4TVOA 4E33A 2O4UX 5ER9A 2J5QA 4CLRA 4ZU3A 3Q1LA 1P77A 1CYDA 4NJOA 5I7SA 3DC2A 1N9GB 2JHGA 3GMDA 1RPNA 3G17A 4YYZA 2BFPA 5DULA 4DBZA 4JJIA 4N54A 2EJVA 3BIOA 4YJFA 3PZRA 1A9YA 4YPOA 2CDBA 1C0IA 3IUPA 1UDAA 5EN4A 4WLFA 1P1HA 5C5IA 2O3UA 4GWGA 4J49A 5IZCA 4N5MA 4ZRNA 1D1SA 1Y8RB 4TMFA 3UAGA 4UVGA 1YQXA 1M6HA 3QWAA 3TFQA 5TX7A 1BVUA 3NRCA 4H7PA 1QR6A 4LSMA 4GI2A 5TIIA 3DMYA 4GAEA 1PQUA 5FWNA 1DJNA 2VCYA 5F21A 3E5RA 1XKQA 3GEDA 1NXQA 4CMGA 1R4NA 1A27A 3TL3A 4M87A 3CXRA 4I9HA 4IS3A 1LTHR 2NTJA 2WD7A 2C07A 1ZMOA 2O7QA 1G6KA 1Y8QA 3KETA 4YJGA 4E0BA 4L8VA 4PZDA 1KEPA 3ADOA 1Z6ZA 3H3JA 1ZVMA 3CE6A 4BO5A 1BHSA 1MGOA 4RF5A 3ZWPA 3K2BA 4DREA 1QV6A 2VZ8A 3ITKA 3UW3A 3JYOA 4E30A 4RF2A 4NJMB 4BO0A 2CMDA 3RFXA 6LDHA 3VPXA 3HADA 3ONDA 3CTMA 1ZK2A 3DOJA 3DZKA 4JX8A 2WE8A 3N74A 5HRUA 3N58A 3PVZA 4E2YA 2AE1A 5C7IO 2IRWA 3DAGA 5DP1A 5A3VA 3VH3A 3C7CB 4DA9A 1ZKMA 2XXJA 2X5JO 1P74A 3BMQB 1PZGA 1U9JA 2AG8A 1B7GO 4CJXA 1BXZA 4I08A 1RJWA 2NLOA 1PJSA 1PJ2A 2C20A 1U5AA 2ZQYA 3KSUA 3Q2IA 2Y0DA 3QWIA 1WXDA 2G82A 3PHLA 3UHAA 4M86A 2E48A 3WLEA 3GC6A 5U4QA 1LC3A 2PGLA 3OP4A 5IDXA 3OH8A 1Z7BA 3BHIA 3DBHA 1RM5A 4R4JA 3UCEA 2Y1GA 1KC3A 2B35A 3WWYA 2DKNA 2CF6A 1CRWG 2Z95A 3FI9A 2E82A 1VLLA 2FPIA 3WGIA 4B4UA 1FDUA 2AEFA 2J3HA 3R0IA 3KHUA 2X6TA 4TRJA 3JD0A 1UXHA 2W2LD 5EL0A 3TSCA 3ST7A 5T6BA 1EK5A 3OSUA 4EUEA 3FPCA 4EBFA 3MJVA 1CDOA 1HLPA 1V9LA 5JAMA 2DBVO 3ORFA 1HDYA 2EP7A 2FSVA 3AY3A 3G49A 2CVZA 3OQBA 4QXMA 3TJRA 3WJ7A 3OQ1A 5JE8A 1C14A 4LRTB 4GKVA 4XYLA 4W6ZA 5KWEA 3ON5A 1R4MB 4C7KA 2DBQA 2YHIB 4A10A 5JDIA 1M76A 2H5LA 1FF9A 4NZ9A 4OHUA 5FEUA 1RM4A 4MDHA 4OOEA 4D41A 4ZQFA 4FJ2A 4J9UE 3GF4A 3PGJA 4RF3A 3HUDA 4DBVO 3M2PA 4E4YA 4PVCA 4P4GA 1X7GA 3EY4A 4R3WA 2QRKA 2Q50A 3IC5A 4HWKA 3L77A 4IQ0A 2BI7A 4FPXA 1J6UA 2Q49A 5BNIA 3IP3A 4U7WA 2R00A 3UF0A 4E32A 2EKQA 3AW9A 3HN2A 3ROQA 1AHIA 1QYWA 1N8KA 2EERA 2DTDA 3QVTA 4HY3A 1NQAO 4CM7A 1GD1O 1KEWA 3SC4A 4GLOA 2BFOA 4O5OA 2IXBA
chains in the Genus database with same CATH superfamily
3NV7A 3PCXA 2PR2A 4ZQCB 1QBGA 1NNSA 1U8CB 2UZAA 5CW1A 4COKA 2D1QA 1K7EB 4I0WB 1FRFS 1JU9A 2JHAA 2Q6IA 3CUUA 3OVMA 1LTQA 4G8CA 4PSAA 3TMKA 5I7EA 3QYPA 2PS1A 2QTVA 1V1RA 3ENNA 2BE9A 2J9FB 5JZ9A 3BAZA 5DGXA 5KIAA 3I01A 3DZGA 1X1CA 2PXAA 3V6MA 4BBJA 3ZXYA 2M32A 2NQ2C 3VBEA 2MU1A 2CK3A 2ZTLA 2FX3A 4ZQEA 1E1QD 2PX5A 2V58A 3AJRA 1LPBB 1VMAA 3IUQA 3NTUA 1VBFA 3UC5A 1ZUNB 1GFIA 4GM1A 2V3CC 3KJIA 2JIMA 3S8MA 2Q9AA 2CNNA 4P4TA 1RXCA 2BTQB 1HE1C 1YUMA 2F8LA 4LOJA 3ZXIA 1Z6AA 2VYND 4KFRA 2CNWD 4XGRA 3WY9A 3BXZA 3SKXA 3TQTA 5C8YB 5K09A 3FJYA 4K9MA 4II3A 2NSYA 2OPHA 1TZ2A 3DV0A 3RRJA 3CONA 5A9SB 5IFKA 5L9AA 2GBFA 2CNOA 2BFFB 1MT0A 1WB6A 1USGA 2ENWA 2CB0A 2XMBA 3D7KA 1TYCA 3MA0A 4MGZR 4MTCA 4N82A 3PIDA 1LS6A 1XMQB 4TWIA 1SG9A 2Z9CA 3D02A 4H1WA 3HTXA 3A25A 4MRSA 3M9LA 1C7IA 5TQVA 1UQRA 1UBTS 2AOVA 2AFRA 4KXLA 1WOMA 4PRYA 1KYTA 4QGHA 3SYLA 4FQ8A 3WL8A 4C05A 2V74B 1HXHA 1Q0ZA 1WB5A 2HHLA 2OORC 3B3FA 4HO1X 4J1SA 4TTQA 2XQKA 1M66A 5EYPB 5BURA 1R8YA 4IVRA 1JDSA 4NCJA 1X7XA 4CR6A 1SCBA 1Q91A 5EWMB 3U81A 5HP4A 4KNYA 1C7EA 4RA6A 3L6RA 2B8EA 4FFOA 4J1TC 1G8PA 3HJCA 4UCFA 4XCQA 1GT6A 4B34A 4CM8B 4DJAA 1ZVVA 1P2UA 2YVUA 2XWQA 3BF8A 1P61B 1HPLA 2H11A 1QB8A 4AZ3A 5EUCA 1E2DA 1MHPA 1XJQA 3HCAA 3MSCA 4HXYA 3RIMA 3RUFA 5IKEA 1GPAA 2FPGA 2BMDA 1XZNA 1QOQB 3IESA 4PQYA 4RDHA 4U6QA 1PYOA 4OLHA 5B57C 5FAXA 2ZSAA 3GN1A 4CDGA 3EZNA 3ZVMA 4PG8A 1O08A 3K4HA 1L3BA 1H3NA 1V37A 1OLXA 4W4TA 4BIMA 8AT1A 4XPIA 3GO4A 1FK8A 2FLWA 5DN6D 4P0QB 4MKHA 3A70A 5AUOB 2BFEA 4MVCA 1A9XB 1YUNA 2XH8A 3JATA 3PBKA 2V4MA 2XSZA 1I3NA 2ZUWA 1P2VA 1NPTO 2PRZA 4WNCA 1Q15A 3P7MA 5JXHA 1L5HB 2FPGB 1RQXA 3DTVD 3G2HA 3HEBA 1TC2A 2DHDA 4P5EA 3E2PA 1K4KA 3BTSA 4R9RA 3N87A 3HL0A 4D42A 5B7NA 3WKCA 3GRKA 1I2MA 2FHPA 5HIMA 1T0UA 1L5RA 3BXXA 3IQIX 3OQPA 2GB4A 4G4SP 2OMKA 3QWFA 4HF7A 3BXFA 2IY7A 4RXTA 4YHBA 5ALGA 2IH2A 4G9EA 5AKZA 2IYXA 4NFSA 3ND9A 2GAFA 3X1YA 4HQ0A 2G9QA 2FPMA 3TRJA 1BEZA 1QNFA 4BJ1A 1OYVA 2ORED 4WOJA 1T1SA 2FEAA 3QF7A 4GSYA 5DNVA 3N8GA 1MUUA 1T3HA 4J2OA 4NOJA 3RTCA 4EPWA 3WJAA 1NYLA 1P0FA 3AWDA 1NE2A 1XDUA 2HBRA 2ZS9A 1FXUA 3AVOA 3TRDA 1PQPA 1JV2B 1V8DA 2AMVA 2FFAA 2ZJ0A 1NFFA 4R2LA 2ZW9A 2E3JA 4EVIA 1EWTA 4AVYA 1WMAA 2RGNA 3RVOA 4C4TA 2J3KA 1O0SA 3HU3A 5AQ1A 4IIVA 3E03A 3KHKA 1E8MA 1KO4A 1JAZA 3NH6A 3I6MA 3WS7A 2BYTA 3GEGA 2ZJ4A 3WMRA 5LD2C 4BB0A 1NJFA 2XCUA 3EAGA 2NXWA 4IDGA 2QEQA 4BC1A 4L9RA 1A9OA 4YXWD 1PK8A 5AVWA 1NVBA 4ETIA 3D5QA 3L6UA 3UK2A 2CFSA 4W5OA 1ZBQA 4KUHA 2IUYA 4KQHA 1TZCA 5MN5A 1HQKA 3COPA 3ZDYB 4TQ9A 4KN5A 5G1OA 3NM6B 2PAAA 4O3FA 1CQWA 5KEIA 2V3VA 2OOSA 2VDPB 1BXRA 1L7NA 3PDIB 5KQSA 4C0XA 3IQXA 1YS4A 1H2HA 1YB6A 2AH5A 2IHJA 3KALA 3TB4A 1A8SA 3NNNA 1D0SA 3USES 1C0LA 3K2IA 3KT3A 4KN9S 3DMFA 1YRAA 1A9ZA 4DT1B 4XWTA 3D6FA 3IBYA 4ZT4A 1H0SA 1PTJC 3AI1A 5CNMA 2IZZA 2WT8A 1N34B 2II6A 2Q41A 1GTZA 1RWQA 1UBOS 3M5DA 4X41A 1NY6A 1COZA 1IG3A 2JJYA 3MIZA 3LZ6A 2Y68A 2DY0A 3FVTA 3MLEA 3TEMA 2RK3A 4EHAA 4ZCIA 3UJ3X 1Z18A 4M53A 1ZC3A 1ML3A 2GZDA 2X3UA 2QVLA 4P80A 3GA0A 1E1KA 2AJCA 3KJEA 4RPKA 3EODA 1J06A 2HUPA 3ILHA 1XD9A 1QRSA 5DOZA 3LO8A 3RIXA 3F5DA 4X9XA 3AEKA 3LT1A 5D01A 5JMWA 1ZGGA 3T5GA 2WWYA 3P2OA 2ADOA 2C3YA 3C6YA 5L3QB 4BP8A 2XUJA 2C4HA 1QM5A 1NVVQ 2QLJA 4MQ6A 1A04A 1FP6A 1Q0LA 4WXPA 3LJKA 1SOAA 2FXVA 4KOAA 5ALIA 1R0ZA 3JWEA 3MUOA 3Q9NA 3VR5D 4DCJA 3EMKA 3ZJ5A 1UMKA 2V1XA 1CK4A 3IPRA 3C3XA 1ONOA 2AKYA 2B8TA 3A27A 5FO0A 2C29D 3FLEA 4D8WA 2I4IA 2LKDA 3UWPA 2ZRGA 1Y34E 4NCHA 5F33A 3TZ6A 3QZUA 3PGVA 4JUCA 3EA5A 1L7RA 4ARZB 3TFOA 1G1AA 4YRLA 5HA5A 1I2DA 3GCGA 4IDAA 4PHHA 5EQJB 4ENRA 4PONA 4O4LF 1EVLA 1NKSA 3NNSA 1BCRB 1SU4A 3G9TA 3SHWA 3AH8A 1E18A 1U3VA 4HCJA 4HQ6A 1DRUA 2XVAA 3D0OA 2OAGA 1I7PA 5BQOA 2F3PA 4LOKA 5IJ0B 1M6VA 2R60A 3GJ0A 3PA8A 4M9UA 3KQUA 4TZ6A 1O6CA 3HUFA 1SIUA 1XWFA 2QRVB 2ZTUA 3UPTA 4RGVA 2GEDA 3UB2A 4YCLA 4N9WA 2NO7A 4PPQA 1WTCA 1BSVA 2A0WA 3NUGA 5AK5A 1F20A 4LHYA 3JR7A 3KYCA 1L4NA 1CY8A 1XKLA 4KQCA 4BLQA 3UT0A 4R8SA 2BBOA 1PHRA 3AHDA 4F2WA 2H06A 3Q8LA 1QP4A 4RBNA 5KNDD 1D9XA 1WPRA 4KDFA 4KPYA 5CLJA 4HEA6 4F93B 3T5CA 3BL5A 2JJ2A 4IHQA 1ZFNA 1FQWA 3A6DA 2XLBA 4ZREA 2YMMA 2ZUVA 5DF1A 3SX0A 1JJAA 4C0KA 1LNZA 2BSXA 4L74A 5JS7A 1PNVA 4FR5A 4WCFC 2PZEA 5K8LA 4CLOB 2HHJA 1SPBS 1R74A 2B7CA 1TO2E 2E4UA 5DHRA 5KB3A 3W5VA 3CO5A 1U4NA 4CG3A 4PX3A 3KQKA 3GT4A 3JYQA 3HVRA 4CN8A 3RSHA 4KMSA 3AZQA 1UMCA 4LY0A 3VH2A 4EUFA 10MHA 4CEJB 5EMHA 1GAJA 2CNBA 3EDOA 4G81A 2RG7A 2HX1A 3TH5A 1XQXA 1P33A 1GJRA 1TM2A 1T8WA 2FW9A 3LK6A 5JYDA 3DCJA 3CRZA 1XT6A 2I7VA 2DYKA 2I4NA 4PGMA 1DTWA 1QYXA 4C2AA 3BIFA 1CIVA 4X7RA 3ANXA 5T3YA 3R09A 4EGCB 1HDGO 2ZIFA 3CJRA 3ICVA 4I1RA 2WHEA 4Y1EA 2OXIA 4XWKA 1JQKA 2UYHA 4PLYA 4EJMA 4FDUA 1QZUA 4RY2A 2VYVA 3QY9A 1ZXXA 5LDGA 3M6UA 4JIGA 1ULZA 2DHCA 1UBSB 1C1HA 3CVXA 3E4DA 2EWMA 1NBEA 2QPAA 4HDRB 4KKXB 2R7MA 4RM2A 4V3CA 2C2YA 1QP7A 1KJ8A 3ZCVA 1NRWA 3L43A 4ZEOA 5BSWA 1R0SA 3BFKA 1FP4B 3I9FA 4M76B 4TZ0A 1G7SA 3S68A 3TAHA 4EEKA 4NARA 2QSYA 4D1YA 4KIWA 2MINA 2UVDA 4ALMA 3F6CA 2V65A 4AJLA 1FP4A 1P3JA 4K28A 2BGWA 5EP1A 1UT8A 5TMEA 1L1QA 1ZRSA 4BMSA 2WOJA 2IDZA 3S55A 2B99A 1LVHA 1FP1D 4ILKA 4URWR 4YRCA 3FHCB 1UBKS 4RZXA 3SSNA 1KJ9A 4DQUA 2GZRA 4PAGA 4F6RA 5KCZA 5HPYB 2BDTA 4LDAA 1ZMTA 4MOWA 2YJ4A 4HKTA 1NVUQ 1UDXA 1U7HA 5T64A 2PJDA 2DXIA 4EI2A 1JEEA 1KKUA 5CYFA 3H04A 4PGAA 3WLKX 3TLGB 4HYYA 1UJNA 4MA0A 4BWYA 1MB2A 4XRRA 4BHTA 4Z2AA 4QUIA 3WXMA 2WIBA 5T4EA 4YRFA 2GPTA 2IUFA 1OLSB 3M2TA 1K92A 3IAAA 2F62A 1XKTA 4RJKA 2ZCUA 1DP4A 1AMOA 3ELDA 1SKBA 3VR4H 5IG2A 5KQPA 3BYZA 1P2SA 3FH0A 1QLJA 2I6XA 4KZPA 1VJGA 2X2FA 4IV5A 3ZX5A 2VWQA 4K3VA 2OCIA 4Z7OB 3D2CA 2H07A 4MUIA 1KK1A 2HBZA 3V1MA 4B33A 2A1TR 5AVQA 3DYIA 2IZ7A 2MSNA 2ZJOA 1SBNE 4ND4A 2WQZA 3I58A 4WEQA 4I5IA 1ICIA 2LGJA 1PJQA 1UBRS 2ODNA 5BSHA 4PR0A 1IHUA 1ZONA 2WU0A 1WV1A 3DVAB 3QX8A 4UAJA 2VHCA 3VO8A 1AUQA 4D26A 3RIYA 4BNFA 3VNVA 3PDCA 4K0RA 3S2UA 2XMSA 1U0FA 2F3RA 1BS2A 2JK1A 1ZICA 3LF2A 4MGEA 4CODB 2Z6QA 1JYEA 3E8XA 3GK3A 4P6VF 3ZWXA 1ZUD1 2VP9A 3ZYCA 3DTVA 4OGWA 3HGTA 2XKKA 2Q5EA 2WIAA 2Y67A 4EJFA 4LSWA 2DY1A 5IRCD 3Q1KA 1JGTA 2JFVA 3L0PA 2BZSA 5EVCA 3OCZA 3RNOA 1TA4A 2RMKA 4R05A 5B37A 5M3BA 3L8MA 5EWMA 1P4SA 4MJ3A 2JH8A 1W96A 1OZFA 2FSIA 5K3BA 4MWSA 3K9HA 4CVNA 1X9GA 2I6TA 4K8OA 4MARA 5HOEA 2GKSA 2VHUA 3ZY5A 1JLMA 2RI0A 3A3OA 2O2YA 4IVPA 1Z33A 4ECEA 4UAUA 5FULA 3UG7A 1KA9H 3FDJA 1M2HA 5LYJA 3GROA 3LUGA 4C7MA 3ANSA 2Z09A 1W59A 4X24A 3TMYA 3GMSA 1CY0A 3B52X 1GNSA 1II9A 5BWBA 3MCWA 5HOQA 5GMOA 2IVZA 3B1JA 4HS4A 1CHNA 4FLEA 4F45A 1NHWA 2QV0A 3GW8A 5DM60 5I9NA 1M2FA 4NBWA 1JLLA 1AKMA 1LPNA 5E6RB 3QU2A 3BTUA 4OXNA 3QIVA 5C8YA 5CDYA 3LIPA 5I4BA 3NIBA 4TROA 2NVWA 5CNKA 1JN0A 2C7BA 2Y76A 4Q05A 4QOEA 1SOMA 1FYWA 3BQNB 3D3KA 3KLMX 3NC1C 1SUCA 1QNLA 1QQBA 4JT4A 4L0QA 1TZBA 3GUZA 3BL6A 5AR1A 4AUEA 1LLCA 3BQMB 5C7YA 1KJWA 2FZ4A 4UNNA 5KBYA 1TDJA 1M2OB 3DWIA 2J9GA 4DT1A 1DCFA 4DV3B 2Q1YA 2B4KA 1QFJA 1YFKA 1ZNZA 3NFRA 1Z12A 2X4GA 5KYWA 2PGNA 3ZW7A 3K9GA 1NN1A 1EBUA 3GLIA 1CE8B 4EABA 1K9VF 3NBQA 3AETA 4QUHA 3U56A 2W6CX 1QGUA 3SX2A 2GASA 3DPSA 4FB5A 5HZMA 5ECDA 1DWUA 4F4DA 3CVYA 3CNHA 5AKLA 4JI5B 3ZKWA 3TZKA 1ZH8A 3AR4A 5D7BA 3LLMA 1N6LA 4H3SA 1R9JA 2XHEA 3UXHA 5JQWA 2W2TA 4LKRA 4P36A 3U39A 4N48A 3PIIA 1HG1A 2K6GA 3CKYA 1NN5A 1JUDA 3ZOKA 3ACBA 1ZN2A 3HYNA 3I6BA 2HQSA 4AMBA 3GZNA 3FBTA 3V1KA 4CLDA 3U62A 1VG8A 2ZJ3A 3OZVA 3NG1A 4AZTA 1MP0A 2EZ9A 2Q6LA 1FDOA 2PO7A 2V54A 2FSUA 2QN7A 1E9RA 1WY5A 3EDRA 1E9BA 4IDBA 4LV6A 4RORA 3WYNA 1K7XB 2ZBVA 4YRJA 2XD4A 4IZIA 1RI4A 3ORRA 2D7CA 4MUJA 5CTJA 2RGNC 5EXPA 2OQVA 1JWLA 1OIXA 4GOJA 2GNAA 3RV4A 4FI3F 2ZSUA 3ENZA 2E4WA 3NVDA 4EYQA 3KHSA 1CZNA 3OIVA 1BE8A 1N3BA 1VL0A 3IQGX 2IY8A 2O7VA 1OBFO 2H4ZA 4XWWA 5M2QA 4Q7LA 2WVJA 1VBKA 3THOA 4ZDIA 3DUFB 1WCV1 4YT5A 3MG9A 2FN3A 3WK6A 1MEJA 1K98A 1ISFA 1M0SA 2NPFA 3SXUA 4URXR 4JI8B 4CT5A 4ENPA 2EBFX 1FMCA 4FHFA 1KETA 1GZ5A 3ZU5A 1ZGHA 4DNQA 1V8OA 3PSAA 4XXHA 5COAA 1OBOA 1I51A 4N1AA 1SKYE 1XVVA 4DSNA 2PUDA 2XKBA 1KC1A 1EUZA 2GXSA 2AJLI 2WD8A 4WCFA 1J24A 5EKXA 1PT5A 1M2VA 1CCWA 2IQIA 4FMPA 4A92A 3DS8A 2N0SA 3U16A 4MRMA 1U5CA 1XF1A 4NG5A 5A1TA 1GPYA 4ZMRA 5AW0A 3MK31 3MS4A 1SXPA 1MJHA 1GZ6A 1ULAA 4LE1A 1INLA 1RWPA 2BMFA 1W5FA 1V7PC 3OP1A 4Q4LA 2JKYA 4Z49A 3HR7A 2SNIE 5D1HA 2CLMB 5B58C 1ZZGA 2I67A 4TUYF 3C16C 4BVKA 1G8HA 4NOKA 2NIPA 3TGPA 4R41A 3HNPA 3ZCQA 5LMUB 3SC6A 3EFHA 4XVCA 3PD0A 2MWMA 2KX7A 3HS3A 2IHKA 1HTWA 1MOPA 3DZDA 4RVDA 4DL9A 4C1BA 4G24A 4AJEA 3JVEA 4G0ZA 2NU6B 2ONJA 4CM8A 4L08A 1QZZA 2QRZA 4MVXA 4X1IA 2CCGA 3HXMA 4WFQA 1UK7A 5D84A 3HPRA 5G0SA 1Q21A 3IRVA 4EGSA 2K87A 3FSGD 3MERA 3RVKA 3VI3B 4K0KB 3IDFA 1X7XB 2IZ5A 4O2AB 4D9MA 1LX7A 1FRVA 2BRUA 5A5GA 1Z4OA 4WK6A 1Z2DA 3DE7X 1EFCA 3NHFA 5LQSA 1C2TA 4L4RA 1UM9B 3RVBA 5IF3A 1LDYA 4NPCA 3UJDA 2IYEA 3EBLA 3HVHA 5JY1A 4IQ4A 3M4XA 4HAWA 1ZEJA 2A0YA 1KRHA 1IJBA 5AVYA 3T1TA 1B8VA 3RO7A 3I9V6 1KBZA 2C9OA 4BMPB 4BE7B 1E9AA 1GUFA 2WJWA 3SYTA 1NULA 4M7RA 3GAFA 4DG5A 1YIAA 1YRYE 2QORA 1XZHA 1XA0A 1ZM9A 3P19A 2XVYA 4KQ2A 4U7PB 4AULA 4RENA 1N75A 3NNDA 4NMMA 3DV0B 4CM3A 1D04A 3LQRA 5KYXB 3NJ4A 4WASA 3VOSA 3PDJA 3W1VA 2R1TA 3WHLA 4BMZA 2EZUA 2BKAA 2J48A 3JWGA 3PFIA 4N3NA 3WA7A 4DB2A 1G20B 2C59A 3U1BA 1UK8A 1TQHA 3B13B 4UPDA 2OAQ1 3CY6A 5FNVA 3W3ZB 3WK8A 4G1UC 5DRYA 3MIIA 4C6HA 3W2IA 1XG5A 1UMDA 3WMXA 3VSCA 4GMDA 1XFAA 4P0TA 4RPIA 4CR7A 1GNVA 2FRDA 2PD6A 1C80A 4KXWA 5HZKA 1UINA 2RH9B 3BCUA 4ZARA 5K3FA 1V1RB 1FX0A 5CVVA 1J1IA 1YVEI 1XNJA 1ZEMA 1TI7A 2L0XA 4N0DA 4MSUA 1J56A 2RB4A 5AM4A 1I7LA 4YI3A 3ZWWA 4B0OA 4ZODA 4AYTA 5T8KC 1OB5A 1GYQA 2ICAA 2VTKA 3MILA 4UARA 4JC0A 2A92A 2W6QA 1WCIB 3A2KA 4AP9A 4ECAA 4IXTA 2Y0EA 1W29A 1G38A 2V7TA 4N0PA 4RSRA 3CO0S 2OC4A 3LL4A 4DMMA 1SXJB 3K0AA 4WKOA 3FOCA 4IYRA 4MPDA 3WIOA 1PFQA 2ZDGA 5A7FA 4RD4A 1JEOA 2V8BA 3E9CA 3H1FA 4FYWA 4G1CA 2D2IA 3C5WP 4O08A 4QXQA 4RADA 4EJSA 3K9FC 4HATA 1XEAA 4N7RA 3OQHA 2JVIA 4RPJA 4B3TB 3C14C 5EHQA 2DWPA 3TEJA 2FETA 1X15A 1BDMA 1VI2A 4FGLA 3TLAA 1PT8A 3H2KA 4GZMA 2VNAA 1GCGA 1T6XA 4H77A 4JNCA 3KSBC 4HAXA 4PXAA 4R6XA 3ZCPA 2C4WA 3HZZA 3HJRA 1U1FA 2ZKLA 3HB4X 4MKIA 3UXEA 2WUFA 4ID9A 5DNUA 4XTRA 5E4FA 2FEWB 3D1JA 4J16C 4RW0A 1G4AE 1RKVA 4O0MA 3KZXA 4RZ3A 3VMFA 4BO2A 4CHTA 2EJTA 1TCUA 5AW9A 1YE3A 2F3SA 3FCYA 3WGQA 2AFIA 3E9DA 5CDHA 1ARZA 1PR9A 1RIIA 3RHFA 4RVGA 1GPUA 2SCUB 5EIBD 2OFOA 1W9HA 8ADHA 3WBKA 2OWDA 5KDOA 4MCHA 4PRLA 5AHRA 4LZWA 4KVZA 5DMHA 1E3WA 3B3GA 1W36D 1JH9A 3FLAA 5FDFA 3H1AA 4Q1AA 5A6SA 5J63A 2EBWA 2M6LA 1DBIA 1NE7A 3N6XA 4YRTA 5HG0A 4N0QA 2OCYC 4B4DA 4EKDA 3NXSA 1L4BA 1VLZA 2CHEA 4NF2A 4OI1A 4I4TF 1EB8A 4U2EA 5BV0A 2ZYHA 4O1HA 4M1EA 3DHYA 1FMJA 3JD2A 2LXNA 2OXRA 4X8LA 3LBAA 4N41A 1LD3A 4B4WA 2VP5A 4G8JA 3HM9A 3FFAA 2PGJA 3TNFA 5DIFA 3G3EA 4QE3A 4XDGA 1P2GA 4JCCA 3SFZA 3T3OA 2PZGA 3C3KA 4UEOA 2W6JD 1W0JD 1KY5A 1YS7A 2WM2A 2JBAB 4HZUB 2QN1A 2XGGA 3DFFA 5LZ7A 1RSZA 1RJDA 2YYYA 1Q7BA 4C3UA 1UUFA 3LQYA 2R48A 2P30A 1RQRA 3C6MA 3NEYA 4K2HA 4A8JB 5L45A 3T3MB 1EFLA 3LE8A 4OXRA 4HWTA 5CBPB 2AWNA 4JR2A 2IYQA 1DWQA 2X40A 2XUPA 3B7GA 2E2WA 3F7MA 4YN3A 1ORVA 4G85A 5IKOA 4D0NA 3AVYA 2ILTA 1U31A 1N6IA 5B7PA 2O5CA 1M2KA 5JFGA 1YVRA 3B3JA 1V5WA 5E38A 2H1CA 3FYHA 3E4CA 4WZBE 2VDOB 1EESA 4DQXA 2AZTA 2PH7A 3JAKA 4B2LA 1GAEO 1KI9A 2Y93A 2QPLA 1QCCA 2Y1CA 2Y4OA 3FF4A 2IYRA 3QLJA 4LYFA 2XGMA 4V2UA 1DI0A 1DKRA 1H8HA 4MRVA 4U9UA 4G0XA 2YV2A 2KWIA 2B20A 2W71A 3G9QA 3NORA 1GU1A 3VYTB 5JHGB 3PQ4A 3KU1A 1Z5WA 2E55A 5AI0A 3SS7X 5KNCA 1GTSA 5CEFA 4ZAXA 2I62A 4KQKA 2DOKA 2I76A 2J85A 2G17A 3N0VA 4Q7JB 3TLJA 4BAZA 2X2OA 4XVUA 2ZLBA 5HTOA 3DOEA 3WGJA 4JOSA 2Z9DA 4E09A 1WNTA 4E13A 1IYZA 1QV7A 2DC1A 2GBPA 2JK0A 2EJCA 4LJYA 1QUEA 1O6ZA 1S96A 1XXHA 2NXJA 1NPDA 2WZDA 4IGFA 4LE2A 4EW3A 5AM0A 5TEWA 5GP1A 4PHTA 1U11A 1JWBB 2DWOA 4N7JA 4V2IA 1HOTA 3LF1A 4CKCB 1EP3B 3WB0A 4A2QA 1BWQA 1NQVA 2DAPA 2KMLA 3AW8A 3PWSA 4KAJA 5E3JA 4N12A 2YOGA 3S2FA 1VSBA 2R5NA 4W7IA 2VNSA 2WTNA 4YAUA 1NATA 4MR8B 2Q6KA 2CC2A 3LXMA 1U7PA 3OTHA 3QRWA 3L9WA 4UKDA 3TOXA 4Q9JA 4EF4A 4OHRA 1HI9A 4ZI7B 2HRQA 4II2A 4DMGA 1FZQA 3FKQA 4MR7B 1SKQA 1J9ZA 3WB2A 4YDQA 2D8AA 2F2TA 2V6FA 3PNVA 4D0RA 2XLCA 5H59A 4CG0A 4RTOA 5E95A 2WAAA 5BSRA 3RK0A 5F9HA 2PRSA 4JEHA 1FNNA 2ZJYA 2HK9A 3RKUA 4RGQA 3S4YA 3T3GA 5JMTA 4RPGA 1ILWA 1H5NA 1XJCA 3BDAA 3SBEA 1CEQA 1CG6A 1Z25A 1P8AA 2OWEA 1ZRHA 2YRWA 3ZOZA 2O1WA 3Q0EA 1Q1ZA 4R9SA 4W6QA 3TAUA 1APBA 2WSLA 4Z4QA 4QBKA 3PKIA 4RETA 3K8OE 3VX4A 2HK8A 1MH1A 1UBCA 1US8A 1LSSA 3ETHA 2I78A 3ZV5A 8ABPA 2A4MA 3OHPA 4ENVA 1YR2A 3U80A 5IKPA 2QRQA 4LW8A 1Q0RA 4HNTA 5KO2A 3NT2A 3K6SA 1BH2A 1ZGJA 1NASA 1YFLA 1NF3A 4YMWA 1BMFD 2PBZA 4FHDA 2C8VA 1C3OB 4KAAA 4RS4A 1EP9A 2G77B 1FTSA 1XROA 1Z4KA 2PWAA 2R6AA 3KEGA 1YQ9A 3JQ6A 4HMOA 3ZWYA 1KJQA 5TC4A 4PICA 2Q5HA 3KC2A 3SQMA 3CLUC 3OZGA 3L7AA 4PBSA 3V8PA 1PZFA 3FCOA 3K0EA 4IKEA 2BBSA 4DHEA 3MOSA 1CT9A 2B36A 3NBFA 2PXHA 4R1SA 1JQEA 3IE1A 5KSOA 1SBHA 1FRQA 4BZWA 1R27A 3M3DA 2VDVE 2GHTA 3C1AA 2ZETA 2XF8A 3F3SA 1HQYE 3QELA 4PZCA 5TLSA 4I81A 4K1XA 4M55A 4CU5A 2XBUA 1E7MA 1HYGA 1T9HA 2IHYA 3DPIA 3T15A 2XCSB 4UOQA 1E7WA 2VK4A 4M54A 1G3MA 2RSLA 3IUMA 1CDZA 1YWGO 3KYDA 3WSWA 5DBHX 4BQRA 3V2IA 1RXVA 4AIIA 1TRHA 4LRSB 1CQPA 4B6RA 3GLHA 5GONB 1DIGA 4QSHA 1GPJA 4BB5A 4JP3A 4DXHA 1BWRA 3B6MA 2HF9A 1SUSA 2QYSA 4H7DA 4NK4A 4NVRA 4PHGA 2GN0A 4ZI2A 2PO5A 4DNFA 1GZ4A 3GBPA 4BCDA 1V6SA 1MABB 3D6HA 4NNPA 4RE6A 3DQPA 4HDSB 1F8XA 4F5ZA 4YRGA 3GHHA 1ZCBA 3HXKA 4YHHB 1XE3A 4BGVA 3A3PA 3COWA 2RC6A 4Q00A 5DM2A 1MX9A 1CUXA 3W4IA 1GGHA 3H9QA 1M67A 3IX7A 1RI5A 2IU3A 1GZHB 3OO0A 3MMPA 2RHGB 3DE0X 5LUAA 1BXGA 2YMQA 3DUFA 3BJEA 4ZEMA 4X6UA 3WBJA 2F7SA 3HFSA 3ZGZA 4DIEA 1H6BA 4LRXA 4RPCA 5ARDA 1KP2A 3FSGA 4JELA 3ZQ6A 5LQCA 1J00A 4PFSA 2FPPB 4P3KA 6GPBA 3IAS6 4XQCA 1RRVA 5A9TA 2OUIA 2PQMA 2WWXA 3CEMA 3QXXA 1FQKA 3ML1A 4IO0A 5KHAA 4TVBA 1LRKA 4B2PA 2JLWA 3TJMA 2NZJA 2HDWA 3PPXA 2OYCA 2BMAA 1KFKB 2O2GA 2VHJA 2WM3A 3EXFB 3UJNA 1Q3TA 1Y80A 2VFAA 1GKUB 1NX9A 1H0RA 1O95D 5LMNB 5C4IA 3R5SA 5KC8A 3AERA 4URUR 2D2VA 1WP4A 3TW6A 1B43A 2ASVA 3PI6A 4HFJA 3DBRB 3MWDA 3ZG6A 3QU9A 4LS3A 3RUDA 4ANFA 1L0BA 2DKOA 2D0DA 3H5OA 1WU8A 3GYBA 3R3JA 1HYHA 2YINC 4FXOA 1Y1KE 4UHHA 1SHUX 2ERXA 1XDBA 5H1YA 4FMCB 1U3UA 1CUJA 2WWIA 4HVCA 2Z3ZA 1AHPA 5HCUA 3WOVA 3CLRC 1HDCA 3R9WA 2PX4A 2QUHA 3OX2A 4DC9A 1D6SA 3N2KB 1KE2A 3MOIA 2HOQA 2PRIA 4CF6A 4TVSA 1CWUA 1PZEA 2BGUA 2HRRA 2OD9A 2QE6A 3GLIB 3AERB 1C50A 1XZPA 3QJ5A 1J8DA 4HQFA 4J16A 5BYKA 3AESA 2W90A 4QLOA 4YUVA 2FR8C 2KS6A 3AXSA 2B25A 3I9NA 2ZSEA 4ABTA 4E2WA 5CDSA 1NYRA 1CUYA 1ZU5A 4Z4CA 4FZ5A 1WD7A 2EDAA 4J7XA 3UKOA 2JI9A 3DR3A 4B2IA 4OLJA 1ZCFA 3ER8A 4ENUA 2I4LA 3SC2A 4NCAA 3HC7A 4NOLA 2V9CA 2XKJE 3D4OA 1JEYB 1SIBE 1S7GA 4XYEA 1UKZA 1HE2A 5HIIA 1FYDA 1JZTA 1DCMA 2HO4A 3L3BA 5AOAA 5FBWB 3SF8B 1HNWB 5L3SA 4F7WA 3LL7A 1GPH1 3EMDA 3K2EA 1NTRA 3D6AA 1HDOA 4FT2A 2AI3A 4G23A 2PLWA 1MXHA 1XEFA 2HUNA 4MYSA 5AHXA 3ZE9A 3OOSA 3HU1A 3L8DA 2M1XA 4HC4A 2NW6A 2PD4A 4JVSB 4N6OA 1EZ4A 3G8AA 8GPBA 1G0NA 1TFRA 3A4YA 1V4BA 3WK4A 3SR3A 2A9PA 3PDWA 1U1EA 4M9SA 4N8DA 2D6FA 4NZYA 1H4QA 2GLXA 1VL1A 3ELUA 3BBPA 4E1AA 3GGJA 3SK0A 3P94A 4JUDX 1O4WA 2R65A 3RJMA 2VPYA 4N0MA 3TS1A 1J09A 1WF6A 3VNQA 4X3PA 5A4KA 3WRXC 4UTVA 3LS2A 3PXBA 1Y7PA 2J4CA 4FX5A 4WZBA 5IUNC 2DLDA 3H19A 4EI9A 2XDWA 3OQOA 5DNAA 2CXTA 1AD2A 4MCJA 3T9EA 1Q1NA 4XSVA 1DC6A 2OHOA 3ZJUA 2H1OA 3A1UA 5CT8A 2QN9A 1R00A 1R0XA 2GO1A 3DOUA 4AZSA 4FE4A 2R1VA 3ZWKA 3T7TA 1ZOPA 1T9GR 2EWVA 3GLHB 5GONA 1L1FA 1GTVA 4OXKA 3TWOA 5BQXA 3KE9A 2ZYGA 1T9ZA 1L5QA 3RARA 3WK9A 3PU6A 5IARA 1SKUA 5IMSA 3LLVA 1E9FA 1YHZA 4KI7A 3SAJA 1WMEA 1HT2E 4WESB 5BUZA 2RH4A 3E6AA 2HO5A 1L1EA 3MFYA 3TTSA 2XNDD 3IQWA 1IHOA 3A14A 4ZCRA 1AT1A 3TOZA 1ZGAA 2PSSA 1R0BA 1LDMA 2IXFA 1F9AA 1OLUB 1NBME 4IX9A 2HXGA 3VI4B 1HLDA 1W4BA 1WXEA 1G2QA 2C8JA 1KHTA 1SIWA 3IBTA 4WKPA 4G0OA 3UJHA 3DTNA 3DVAA 4Y0VA 3WMEA 4B3GA 2Y0PA 3C8ZA 5LB2A 4IIFA 6NULA 5FA8A 1HFEL 3ZGLA 1CF9A 4CFYA 4OJYA 4IEEA 4M0CA 4BNUA 1PS0A 4RJJA 3DAHA 2UYQA 2WILA 3UJ6A 5K4HA 4JUBA 1NIPA 2YFKA 2JLXA 1SD2A 2N9UA 1YK0A 4XA8A 3QUSA 2CE2X 2WP8J 3AEQA 3HDYA 4RAQA 5JMPA 2PV7A 1C9EA 5IAEA 3K6SB 1EQAA 2MSCB 2PL5A 4AYWA 2HNKA 3DL2A 4N65A 1F4VA 2Q9BA 1Y5MA 1OLSA 3M70A 1AGXA 1VL6A 2ZT6A 2JGIA 4UQOA 4UHKA 1E1CA 3FETA 5DNCA 4I9UA 3T4PA 4OH7A 1FNDA 3P2YA 1J5EB 1HE5A 4BKOA 1MNQA 2XHZA 4TQGA 3I64A 1FTNA 1J7JA 2OCKA 3LY7A 4HPJB 4NU6A 1U3FA 4PQRA 3L6BA 4QG7A 1UH5A 4M0MA 3WKDA 1VHDA 5DBFA 2CLIB 3CRRA 5I5EA 2GN1A 3ESXA 3QHAA 4LDNA 1Q7TA 3BG5A 4NR0A 4ZIRA 4MICA 3OZUA 4N03A 1V41E 3GDGA 3VMMA 3L0BA 4LHWA 4V0SA 4AXXA 4F6RB 2HJVA 2WUWE 1X9IA 2XA2A 4FK8A 4JJ8A 4BMCA 2EP5A 4MS1A 5CW2A 3TBKA 2ZREA 2W42A 3QPWA 4U5QA 3IQDB 4ZVSA 1VG0B 4FGJA 4ZDKA 2QB5A 1TKBA 3IOMA 4ZGBA 5IXSA 1H4SA 3LSYA 1SQ5A 1TD1A 1YQQA 4CQMA 4TTVA 5BNTA 2X86A 3N7UA 1XN1A 3G0BA 3OA0A 4FOSA 3SCZA 5BUSA 3WL7A 2O6LA 3CEAA 3GELA 1W34A 3JQEA 1TB4A 4TLMB 3ZV6A 1X74A 2M6SA 1SQ0A 1E4VA 3EFOB 4FT4A 5AKIA 2BONA 4HJXA 4LXHA 4BUCA 3B8HA 1KQFA 5DX0A 1YB7A 5DSTA 1CY6A 1GY8A 1ZNYA 1OXMA 2OGWA 3E5NA 4HFNA 4FHEA 2SICE 3SSOA 3PNOA 4PAWA 4UVHA 2B34A 3M9XA 4M0PA 3TDKA 3HXOA 2GJ9A 4C0AC 2XVMA 5K3OA 1NJ5A 3AL2A 3B85A 3ZZ1A 1NAHA 6AT1A 1UZLA 3DG9A 1EX6A 4FSXA 2YW2A 1OH8A 1Q1GA 2VWGA 4BZZA 4TKVA 1LJLA 1DUSA 4QDXA 4UTXA 5IVIA 5KREA 3ZDBA 1VRVA 3EIXA 4EY3A 2BGTA 2ONZA 4Q6WA 3UJCA 1XC7A 2GN4A 2YVLA 3KXDA 3D81A 4OEHA 2BMJA 2FLVA 4D43A 1C0KA 2NSDA 4PV7A 3W3AD 3CB4A 1O4VA 4YAOA 5SYMA 3ZZ0A 2EF1A 2QU7A 3KEOA 4Z0HO 3NC0C 1E1YA 1FUKA 4HTFA 1FJHA 4UHEA 2GPWA 3WNCA 1QSGA 2YVKA 2JH3A 1D1TA 3H42B 1NJ6A 5I7HA 1PV1A 4AU1A 2YKGA 3VNRA 3LFUA 1C2YA 3PQ3A 4YB8A 2J7KA 4NK5A 3LFHA 4BASA 5K6AC 3JZIA 3NANA 3S1SA 1NR7A 1CNFA 3DC7A 3KPYA 4TT8A 1B42A 3T7JA 5CG1A 2JBAA 4GWKA 1RWMA 3LCCA 3NGXA 1UAYA 4QTUB 4XJTA 3W5DA 1JG4A 2QRLA 4M2LA 5KWVA 1ZESA 1S7CA 2R11A 3B1KA 4RZQA 4ZK2A 2JC3A 4DWVA 4X3CA 5FT9A 2QOEA 1MRSA 1WDKA 4UMDA 1U3GA 1M7HA 4G8DA 3R7LA 4OOFA 1NV9A 3AT1A 1Q7RA 1NX6A 1QH0A 1QHHB 2VEDA 3AU8A 5C1DA 2J6IA 4E94A 4J4TA 5CB8A 1PGNA 3SZRA 5I9SA 2VHWA 3ZY3A 2CYCA 2OHHA 4BNVA 4XPZA 4X45A 3KKKA 5IFLA 2ECFA 3GNQA 2FAXA 1RXIA 1Y1TA 3FOEC 2FSPA 3AUJB 2RGUA 1QF7A 1R4AA 5FP0A 5B4VA 3ND8A 5AUNB 5EIEA 3GGDA 1WUKS 2CJXA 4S0XA 2O8EA 4FC7A 4DSAA 1G21A 4FI3C 4IDQA 4QGGA 1Z8HA 1G5HA 2WKRA 4KGVA 5DWVA 1TK3A 3TPFA 1RC8A 1P29A 2PSFA 3SQXA 4KO4S 2VLBA 4M8LA 4A26A 1BGWA 1X1QA 2Q4EA 3OESA 5JTTA 3IRUA 2A9JA 4KRXA 3BRCA 4Y6QA 2O7RA 5CYOA 1V5EA 2AXNA 1L8XA 5T4HA 4AKTA 5U4XA 2B30A 4J07A 1VCOA 3CNNA 3E35A 3NHJA 4PW0A 5JOQA 5G40A 1S8OA 2BUAA 3G2NA 2XMPA 3GVIA 3U7EB 2I2BA 2IEIA 1E9VA 2Q9UA 1OASA 1DOZA 5C46F 1IB0A 3FUVA 1L7XA 1BDBA 3L0DA 1Q44A 3QF4B 3S6JA 4BIIA 5CX1A 1YBMA 5CH5A 3NEPX 5EIAA 5F1PA 2IE8A 1FIUA 1Q1QA 1NT2A 3KAJA 3MN1A 1ZXLA 2FUEA 5DNDA 2HB6A 5AMXA 3IUNA 4M46A 1D7AA 2ACWA 4M88A 4FNGA 5C2JB 1XK6A 4R3NA 3UAZA 2J0UB 2Q4TA 4DZTA 1N57A 1GHTA 2QJOA 4URZR 2DFKB 1U81A 2CUKA 3QY0A 3RV3A 1LDBA 4GYYA 4QXPA 1PL6A 4QEKA 2P4QA 3R41A 1ZLXA 1KVRA 1T4MA 1T5SA 1RPAA 2H18A 2HMUA 2CWWA 2J3IA 2QP9X 1N2OA 4QODA 1XWWA 3EQ2A 3ZBPA 1FBTA 2R2GA 5DRTA 3L1HA 4BVHA 4MA5A 3UZUA 5KOYA 3RK4A 4LZZA 1D2AA 5G3ZA 1T8TA 4NDNE 4HHEA 3VPDA 3SQNA 3BJZA 2VAPA 3S2ZA 4ZN6A 2XOXA 4DR1B 4HGNA 4B46A 4FZVA 2J3QA 4NQZA 4X63A 3GNLA 2MMGA 2ZP1A 1E1QA 4IKOA 3RFTA 4DLAA 4LHSA 4DR2B 5INTA 1B3RA 4UREA 1Q0QA 5TMDA 1BX1A 2P90A 3BEDA 1SVNA 1QUFA 2IV3A 5CM2Z 2C2XA 4ZOLB 1FXSA 1MJGM 5JNWA 1ZHOA 4DM3A 1AN0A 8LDH