4WV1C

Crystal structure of the fgfr2 d2 domain in complex with fab 2b.1.3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
98
structure length
98
Chain Sequence
PYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor receptor 2
publication title Redesigning a Monospecific Anti-FGFR3 Antibody to Add Selectivity for FGFR2 and Expand Antitumor Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/immune system
total genus 17
structure length 98
sequence length 98
chains with identical sequence F
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wv1C00
2HVJA 5IK3A 5J11B 4EUPG 1WIUA 5HSFA 4LARH 4P99A 2EH7H 4Z78B 2Q8AH 4KVCL 5H37G 1OGAA 1G7LA 4R2GB 3OJVC 4NCC1 2CLVB 4Q9RH 3M1BB 4JO1H 5I18H 4BZ1L 4HWBH 5IUSA 4F3FB 3UJJH 3V52H 2MPAL 1FVEA 1ZK9A 4J4PA 4NYLA 4PUBH 3ZLQC 2V6HA 4FFYH 2VITB 3TLRA 3VGGA 4Y19E 4WI6A 3C6LD 3OJDA 5D7JC 5E6IC 1BEYL 4Y4HA 3C60A 2R0LL 3HZKA 3C5ZC 3L95A 3TZVD 3FAWA 4QWWD 3VDCA 4PGBB 3DUUB 1YA5A 4P23D 2ED7A 3MRKB 4LPCA 3JSSA 1EPFA 4M8QA 2EDOA 2YA1A 2W1NA 5C6WH 4WHTB 3ALWA 2EO9A 5FA3A 1A6UL 3DECA 3K46A 2EKJA 4CU6A 3VU2A 1DL7L 3SE8H 5HYJB 3WEXB 1MCWM 3MOAL 2PYFB 1MEXL 1FBIL 3DURA 4EI6B 4HUVB 5DRWB 3CH8A 4JG0H 4OQTA 5DMGD 5GS0L 1KLUA 3SDXB 4QHLA 5KSBA 2ZP0T 3EYUL 2GITA 3OAZK 4AMKL 1DLFL 4HC1L 3M8OH 2EDTA 4X7CC 3IDNB 3E6FA 4HCRH 5D70L 3VMPA 1YY8B 3HLAA 3U83A 4JM4L 4JPVL 1XGYL 5C70A 2AW2A 4MX7B 4NQCA 4KGLA 3MRBB 4M61B 5C9KA 5ITBL 3SGEI 1SYSB 3SOBL 4YBQD 1CQKA 3OB0K 4LAQH 1LEGA 1Q8MA 3BD3A 5J7CC 1MEXH 1CQYA 1FIEA 4K8RD 2PETA 5GSVA 5EOTA 1U8IB 3D18A 5JOFB 4L29A 4Z76A 4XNYH 1MIEH 2W65B 1MCJA 5GJSL 1FFPA 2YD2A 3GO1H 4PR5A 5D7KD 3L6FB 4NC2B 1QVOA 2EDXA 5SX5H 1J9CT 3IXTB 1OM3H 1OQOA 1UM5L 5HXMA 3MO1A 3QDGD 1GGIH 3GIVB 1UEMA 2N1KA 3BDYH 3ZKNC 1S7VB 1UACL 1CWVA 4IRJD 3VI4F 3SDAA 3CD4A 2CIIA 5ITBH 1HWHB 5DJYB 5TQ0H 1TVDA 1Q0XL 2R39A 4K9EH 4DN4L 3HE6B 3VFOB 4RMUA 1CGYA 2WQ8A 3H7BA 5DYOB 3CCHB 4FFVD 1WISA 3C87A 3NCCB 3SJVD 3VFVB 1GGUA 3V6BR 3OSKA 4ZUUB 4ZDHA 1GZPB 3VWJD 1UXSB 1KXTB 4G9FE 4OSUH 4AH2B 5E08L 1X5LA 3FQXB 4NJ9H 4GG6B 3ETBF 1LO0H 3BXNA 2Y5TB 1KFAH 4YQXH 2GTWB 3BPNB 5DDHA 3HMXA 2GY5A 2Q7YA 2Z0BA 1CLCA 4N8VA 1G7PA 1A4JA 5DTFA 1Z2KA 5HGHB 1R3LB 4QXGL 3T1FB 2DKMA 4AL8H 5EIVA 3QUZA 3VFNB 1CICB 5K9JH 3TA3C 1RIVH 1LD9A 5TDNB 5CIPH 4BQCA 4GS7C 2ATPB 3UCRA 1MHCA 3W0WA 4X0KB 1D5XA 1MH5B 2C1OA 5SWQA 5T5FL 3BGFB 4QY8B 1OLZA 2H32B 5J8OA 5J11C 1AIFB 3DO7B 4XZUA 2IC2A 5MENA 2KL6A 5FUZH 1LO3H 5FM5M 4KU1A 3IVKA 2BSRA 3DI3B 2J88L 2YHGA 2CDGB 1URLA 2EDJA 3D69B 1VKXA 4ZFZB 3H3KA 3N9GL 4OLYL 4UNUA 2DQDH 1VESA 1FP5A 3GRWA 5DI8B 3BVNA 1JF6A 1L6ZA 3L3IB 1GGCL 3GMPB 4DAGH 2UVEA 4X9FA 4LPXA 1FVDA 1QSEE 4ZXBB 5EU5B 4KK9C 4F7MB 3VXMA 2GUOA 3ORJA 3ELAT 4EDWH 1RZJC 5C07E 4J12A 3HNTL 3KWWA 1NBYB 1T1XB 1JZ6A 4TUOB 5C8JA 1JFQL 1T7XA 3BE1H 3WNNA 1VFAB 1BM3H 1DVFD 2IMNA 4IIQC 1DDHB 4XRCA 1LO2H 4Z6AT 5T5NG 4NRXB 2WWKO 2ATKB 2YPKB 3JVGA 4M93C 4H5SB 1ZHNB 4D0BA 2E6JA 4MJIE 4KAQL 1F4YH 3KYMA 3O6LL 1C5BL 3TNNB 2GYSA 4UUJB 4X6CA 4JN2B 5TQ2H 3SQBA 4CBPA 3CDYA 1BQLL 4CVXA 2PYEE 4IHOA 5CP7A 3ESUF 3JUYA 2NX5E 3IGAA 4B7LA 1A02N 4R7NA 1ZA6B 1D3CA 3DRQB 4D0DB 4F58H 1HSAA 1DQMH 5I19H 2CRZA 3IJSA 3UXFA 2R1XB 5ICYA 4YZFE 4MJ5A 3MRPA 1KEMH 2DQFA 3OB8A 1BX2A 4P2CG 5GRUH 1A1NA 2NY4B 4J8RA 5EC1A 2JJTA 2H8PA 4UTBL 4Y7MA 3ILPA 3OAUH 5J6HA 4U1MA 2CD0A 1F3DH 4KUCF 2VL4A 3ZT5A 3O4LB 5FIEA 2GJZB 2J8HA 1X6LA 1IGIL 1B0GA 3PHSA 5I76B 4A6YA 1YC7A 1JWUA 1U8NB 2BC4B 3TV3H 4ZFOA 1BQHB 2WIIB 3AUVA 2HRPH 4PJGF 3RVWD 4ZNCD 3O41B 3R06A 5F3BA 1YEDA 4G8GD 3QCTH 2CDFB 4GKNB 1G7MA 5DQ9A 1NMAH 1IGFH 5DEGB 4U3CA 4DVRH 2DLHA 3G5XB 3CVHL 1MJ7L 4H8WL 3W5MA 1BQHG 4MXWL 4W4OC 4Q6YA 4S11A 2UUDK 1IQDA 1QSFA 5C92A 5C2BH 4HK3N 3IS1X 4OUUB 4OV6F 3WS6A 1BVLB 1RZ7H 5HI5C 1RJZB 2FX7L 3CSYA 3F58L 4XBPB 4HX1A 4C54A 1RULL 2R23A 3MBEB 3D85B 5C1MB 4WUUE 4E42B 5D7JA 4U1HA 3O8XC 4ELKB 2NR6D 4LP5A 3P73B 4MD5B 4TSBL 3MNVB 5IG7A 4OZGB 3PF2A 3GGWB 4BELD 3EJJX 3ZTNH 2DDQH 4QHUB 2A6KB 1VFBB 1T7VA 4M3KB 5C08E 2DQTH 1JNNL 3VXOB 3MUY1 2EC9U 3LIZL 5CP3H 4EZMA 5TDOB 3MRMB 5F70A 4HGWA 4LVHC 4MYWB 4AIXA 5GJTH 3I6GA 4RX4A 1NJ9A 1FYTB 4JFDD 1INDL 3VRLE 3VXQA 5JO5A 1OGAD 2CDEB 4M7ZC 1BLNB 4G80A 5HYIA 5BV7L 5C0DB 2FECL 1IGMH 2DLFL 2XN9B 2F53B 3OX8B 4ODXB 4JO4H 2KH2B 3E3QE 4K94C 2B4CH 1L0QA 4Z0XB 3LN5A 2BSTB 3HAEH 4TSBH 3DSFL 4G6KL 4QTIH 5GGVY 4XCCL 3C60D 3RWEA 4RBPK 3MJ8A 4PS4H 4ZOAA 3GNMH 1RURH 3F7VA 4Z5RA 2XFXB 3TFKD 3RY6A 4X7TA 3K4ZA 4FNLH 4NSKB 2Z35A 4HKXB 1G7HB 1SYVA 1NGQL 3LIZH 4XP1L 2W9EH 3WIIH 3RVTC 2IPKA 1ODAA 3ECBA 1MREH 5JR1H 5D93B 4P2OD 4UINL 3TBTA 1JVKA 5BV7H 2GT9A 5E2TL 2NW3A 3DVGB 1A6VL 2BNRE 2FR4A 1DLHB 2NY6D 3RVUD 2DBJA 5TF0A 4HQQL 5BVPL 4FZ8L 3CSGA 3EDFA 2ESVA 2PO6C 3TJHD 3X3FH 4TUJB 2VZOA 4FRWA 3BWUC 2V2TB 1TCRB 1EDQA 1F4WL 3MV8E 1ACYH 1WGOA 3THML 2CQVA 3HA0A 5J3HD 1K2DA 4IMLA 1WSST 5E9DE 1A14H 3DX8A 5IF0B 4KHTH 5JLZB 1X3DA 3CFIC 4OAWB 1T22A 2E7LC 1FNGB 3ARVA 4JFOB 4YHYB 3B9KC 4QRPE 2PTTA 1AGDB 2XQBL 4Y2OA 3S34H 4RWYL 2G60H 4LEXL 4P2QA 5E2TH 3O6KH 3BRFA 2BX5A 2V5MA 2BVPB 5E2UL 5D5ME 3B6SA 1E4XI 4AENA 3T77A 2R4SL 5INDB 2DQCH 1A4KB 1N64L 3NA9H 3UJTL 5IW6B 4NQVB 2DLIA 2X7LA 3FRUA 5CKGA 4OLEA 1R3JB 1ZVSB 4PJAE 3FB8B 2Q76A 5JIHA 4M7KL 2VDPL 1S7TA 5TGBB 4DOHE 3V4VH 1PY4A 2I25N 3WUWB 3T8XB 1EJ6A 3TO4A 3K8KA 4ZAKC 3TA3A 2ICWJ 2JELH 2D0GA 4OIBA 3UTQB 1EGJL 3LKOB 3V5KB 5EBWA 5BMFH 4JFFE 1H8OA 4JKKA 4CVUA 4ZTOL 1I9JL 3TJEL 1IT9L 3WUWG 4Z78A 2DIJA 1NCDH 2OMNA 2CLVA 3M1BA 3D39B 4JDTL 2CK2A 2FEDD 3L5JA 3JWOC 3UJTH 4W68A 4YHOL 4F3FA 5IKCB 3H9SE 4J3SA 3EDDA 5JHLL 1QQDB 4Y0GA 4Y1AB 2VITA 2OJZH 4XGZB 2XQYG 3MJ9H 1YEFH 1FGNL 3SDCD 4MNQE 4OM0L 1IAMA 3EJYC 4X9GA 3U36B 3QUZD 5FHAH 4J23A 4PGBA 5DT1H 3DUUA 2FBOJ 2VQTA 3C8HA 1YJDH 1RMFH 3F62A 3MRKA 1GZQB 1P69B 5I1CH 2D0HA 4FFZH 4WHTA 2O5YL 4I0KA 2NYYC 3RWDB 4UNVA 2YUWA 4APQB 1FO0L 3G6JE 5HYJA 3NFPB 3WEXA 3FO9B 2PYFA 2Z93B 5BRZE 5F7EH 4EI6A 4HUVA 1Q72H 5DRWA 2SEBB 1KYOJ 3WFZA 3SDXA 4M7JH 4UT6H 1I3RB 1L7TH 2Y36H 3P30H 1FZMB 4XPGH 1AQKH 1KC5H 4IOIB 1FGNH 2R0WH 4RAVA 3IDNA 1OOAA 3P4OB 1XR8B 1KCVH 2O5XL 5D96C 1XIWD 1YY8A 3DMMD 1Z9OA 1UYWL 4OFVA 4MX7A 2DL2A 1NAMH 3MRBA 4M61A 4J6RL 1YECL 1SYSA 1UM4H 4PJ7F 3GSOB 1CFSB 1UG9A 5DD3L 3K4DA 2FO1A 1U3HB 4Z7UB 1S9KC 5JA9A 1BQUA 1PVHA 4O00A 4HJGB 1U8IA 3WNPA 3TNMB 2XG5A 3HR6A 5JOFA 2H45A 2W65A 1NAKH 5AYQA 2L4OA 5IIEB 4Z7QE 4YZFF 2IH1B 3L6FA 1KT2B 2YMXL 3PJSB 1CFVH 2R4RL 3QUYC 2A1WH 1ACZA 3IXTA 4ZOCA 2R0ZL 3ALPA 2WK2A 1W72L 3GIVA 4TULL 1AXIB 1G6VK 2A73B 4K07A 2L7UA 1CDUA 5I74C 3U4EB 5D7LD 5HGBB 5B4MC 3RTQD 3V6ZB 1S7VA 3HNVL 3CC5B 5I6XC 5D7IE 2J1KA 5DJYA 3QIBD 1JNLH 4YX2L 4OZFH 3HE6A 3VFOA 1XCTB 1QFWH 3HTLX 4YHYC 2FGZA 4FTVD 4KJQD 2Z8RA 4KV5E 5DYOA 5H94B 3CCHA 5C07A 4Y4KC 4M62H 3VFVA 1KGCE 4ZUUA 3F5WB 3V0WH 1GZPA 1UXSA 4F9PC 1KB5H 2HFFB 4AH2A 5JXAH 4XT1C 5GZOC 3Q1SL 4WEBL 4KHXL 4HUXB 2DQIL 3FQXA 3GBNH 3MOBL 4NZUL 5C9JB 4GG6A 4JDVB 2Y5TA 3RKDC 1I8LA 3EOBB 2GTWA 1XAUA 1KCRL 1T04B 3K8MA 2X41A 4CW1B 1A5FH 1WZ1L 3T3PF 1NLBL 5HGHA 3PGDB 3T1FA 3LVEA 5IFAH 5FKAB 3CLFL 3VFNA 1CICA 5AG9A 5C0AB 3IFLL 3S3JA 5IVXF 4H1LB 5TDNA 3IFOB 1KTRL 2ATPA 5IBTL 4Z7UE 3HE7C 5FGCE 1JHTB 4X0KA 1MH5A 5J0BA 4H88H 2B20A 3FRPG 1TETH 1QLEL 4QY8A 2H32A 1DBBL 1AIFA 3DO7A 4XCYB 4LP4A 4OI8A 2GK0B 3VRLF 5D7JD 3X12A 4WFED 5E6ID 5GZNC 3C5ZD 4I77H 4KHXH 1HWGB 3MOBH 4H1LG 5HHVL 2NLJB 1FG2B 2CDGA 4I9WD 3JV6B 3D69A 3J7HA 1FFNB 1K6QH 3RWIB 4ZFZA 1LP9F 1NFDE 2M26A 4X6DE 3KYKH 4TSAH 1CK0L 3DYOA 3JUZA 5DI8A 2YEZB 3L3IA 5KAQG 2XZQL 3GMPA 4ZXBA 3B2VL 5EU5A 3S35H 1MI5E 4F7MA 2BOBB 5CD3B 2EEDA 1QNZH 4GQ9H 3LY6A 1NBYA 1T1XA 3CK0L 1PKQE 4TUOA 2VDMH 2PO6A 4PB9H 2X05A 5MI0C 4KUCD 1VFAA 4APQC 1QBLL 5EU6D 2EE9A 3DROB 1DDHA 4PP2B 2HYMA 3MLPA 2C3WA 1IM9D 4NRXA 4PJDB 4TVPD 2ATKA 2YPKA 2B0SH 4KKNA 3GSNL 2H2SC 4H5SA 3VWKC 4KI5F 3WLBB 1T7ZA 1PG7L 3WO4C 3RUGB 3TNNA 3MRJB 4UUJA 4JN2A 1NLDL 1RUMH 4L3EB 2F74B 3B9KA 1CN4A 5T3XH 2J8UE 1FLRL 7CGTA 3VFRB 1MHHB 5T3ZL 5JNYB 2QQLL 1DBKL 3NCYS 3KGRA 4N1HB 4KZEL 1FFQA 4XNUH 5D2LF 1ZA6A 4X5WB 3DRQA 1IAII 4YC2B 4D0DA 1DBML 3A6OA 3GKWL 2XACC 4HFUL 1OP5K 4NKIH 2BOCB 2R1XA 5AWNH 3PGCB 3RL1B 1MRDH 2A9NL 3G9AB 2ZKHL 4L1HA 5DD1H 2ESVD 5CGTA 3UC0H 1HCFX 5DJCB 1CU4L 4MJ2A 5L8JB 1INEH 1FHGA 1F02I 3QI9B 1BWMA 3INUL 1ONQB 3K0WA 3ZKND 4Y19D 2ZUQC 3O4LA 2Q6WB 2GJZA 1CIDA 1NC2B 5TF1H 2OP4H 3MODH 5I76A 5FUOL 1MCEA 2BC4A 1U8NA 4XBGB 1BQHA 2WIIA 4PRPB 4KRLB 4RFOH 4PJAF 5T3ZH 3O41A 2AK4B 4CMMB 4JEGB 4ELMB 5FM8A 3TPUB 2CDFA 4GKNA 1TQBB 2X6MA 5DEGA 3G5XA 4JY4B 1YEIL 1YUHB 4RRPG 4OFDA 2H9GB 5L9DL 1T4KB 2Q3ZA 4ODHH 4OUUA 1BVLA 1WCQA 3MV7E 1RJZA 3O9WB 4XBPA 5DJ6B 1G9NL 3MBEA 2ARJQ 3CFCL 3CMOH 3D85A 5TE4L 4E42A 4ELKA 3BP7B 5H35B 3SKNB 4HPYH 3VRIB 2VN7A 3NIFE 2HVKB 3OKEB 3P73A 3FFCB 4GXUN 4MD5A 3MNVA 1CFTB 4OZGA 4LVNC 4Q0XL 3SO5A 1U8OB 3GGWA 3MLRH 1I85C 4QHUA 3TA3D 2A6KA 3W39B 5I8KL 4WO4C 2YRLA 5EBGA 5KSAB 1VFBA 1ZKAA 3P0YL 3VXOA 4ONFL 4FXGB 4YGVA 5TDOA 3MRMA 4S1DC 4P4KC 5ILTH 1FYTA 2Z4QB 1PG7X 3MQIA 5IBLC 3TIEA 3ULVL 5EZJB 4HS8H 2CDEA 1RZKH 1BLNA 3U7YL 3ZE1E 3QG7L 5D5MA 5I1KH 3OX8A 2F53A 3QAZC 3ARWA 4ODXA 2YD8A 4ZS7L 4M1DH 4Z0XA 2E3VA 4UDUB 4UIKL 2BSTA 2Q3AA 1J05B 2VXTH 4RNRB 4Y5YB 2BVTA 4KK9D 3QB7C 4NSKA 3QEQB 4HKXA 4ETQB 5I15H 1G7HA 5GGTA 1ZHKB 2E27H 4CJ1A 1KJMA 3F7YB 4AM0A 2FRGP 1WWWX 3O45B 2FDBP 2EIDA 2ZUVA 4DKFH 4G42B 3EO1B 2DM7A 15C8L 1QKZL 3DVGA 3QQ3A 4KH2A 1AC0A 1DLHA 1GGBH 3BFOA 4FQ2L 1Z9LA 4JO2L 4RGNE 5ADPH 1C08B 3U46B 4KMLB 3RHWK 3ZT6A 1H3GA 4YBLB 3VGAB 3QUYA 4TUJA 1MCSA 2V2TA 1TCRA 2AI0H 2ZCKH 3H9SA 4UQ2B 3DNKA 3PP4L 5FYJU 3ZDYE 5IF0A 4M6MH 4XWGH 2MJWA 2Y6SC 4I1NB 4AIZB 5JLZA 4Z7QF 3VXSE 1YQ2A 4PJFF 4ODVL 4YDVA 1QFOA 1FNGA 4JFOA 1YNKH 2EDBA 3DUSA 5ECJE 5JHDB 4TPRH 1KJVB 1AGDA 2XXMB 4Y4KA 2HWZL 3OG6B 2OYPA 1WAAA 3OKMB 3GSXB 1RUPH 2BVPA 4JQVA 5D7IF 3VGBA 4F9PA 4FQ2H 4JO2H 1H9VA 3LOWA 1KN4H 1VERA 1XEDA 3ARFB 5INDA 1A4KA 1TNMA 5KZCB 5CZVH 2C3VB 4KV5F 1CE6B 2WIMA 4NQVA 1AGBB 4LDEB 1J8HB 4JRYB 4Z0BL 4ZYKB 1R3JA 1ZVSA 4NM8L 3FB8A 3P9LB 1GSMA 5F8QC 1KBGL 3D87B 4OKDA 1NC4B 1V7MH 3L3KB 2FBJL 4JPKH 1HHJB 4MDIB 3T8XA 3WUWA 5DJZB 4G5ZL 2HKFL 3AXLB 1JPTH 2ZSWB 2HFGL 3NTCH 4K8RL 1HQRB 1QSED 1NKOA 4LSSH 1CXHA 4P5MB 3UTQA 3LKOA 3V5KA 4UILL 1MAJA 3EOTH 5C07D 5HI5D 2CUMA 3RIFK 3MXWL 2Z92B 3QUXB 3MMEB 2O61B 3O8XD 4X7FC 2BVEA 4QHNB 4YDKL 2ADFH 3BW9B 5E1AB 1T6WA 4FXLA 3PXJA 3MLWH 3D39A 2BXYA 4UAOB 2WP3T 4OI9A 3RIAK 1OQXA 4WEUD 4P0DA 4MJID 1QQDA 4Y1AA 3U1SH 1A6TB 4RGNC 2FX8H 4XGZA 4XXCC 1N26A 3FJTA 4NPYB 3EYVB 3LZFL 3MTRA 1A0QL 3PDDA 4U3XA 3UROR 3U36A 2PYED 2DQJH 5CIPB 1WK0A 3STZB 1GZQA 4U1LA 5E03A 4KMTH 3Q6GH 2LV4A 1QLRB 3RWDA 2YKLH 5IJKA 3G04B 1AJ7H 4POUB 4APQA 4YXHL 2J6EA 3NFPA 4PFEA 1E4WH 3FO9A 4LSPL 2Z93A 3VMOA 2NXZB 4BSVB 1RUKH 2SEBA 3FQTB 4MAYB 3VWKA 1KJ2H 2NY7L 4DGIH 4K3EH 5EULV 1I3RA 3DX7B 1FZMA 4NC1E 3DRTB 4M00A 1TXKA 3TVMB 4IOIA 1A21A 1CD9B 4IM8A 5GGRY 3RVTD 5D4QA 3P4OA 2VXVH 1XR8A 2NY5L 4CAGA 4TN9A 1NDGA 2YA2A 4Y5YC 5F6IC 3S4SG 3CFKB 4JFQB 5BXFB 1C5CH 3RRQA 3T08A 2CO7B 3GSOA 5C09E 2VJXA 2PO6D 1CFSA 1O5DT 1U3HA 4Z7UA 4YO0B 5F7YC 3H3PL 3FQRB 1JPSL 4HJGA 3BMWA 3GSWB 5EO0B 3TNMA 1FRGL 1OARL 1YMHB 3RX7A 2UVFA 4WUUD 3LS4L 4DN3L 3W2DL 2DJ4A 5KOMC 5FYLH 5I8CB 1CVSC 2IH1A 1KT2A 1QYGL 3PJSA 1MFCL 5CGYC 3VGAC 4MXQC 4QOKB 1MELA 4HKBB 3B9KD 3HMWH 1IVLA 12E8L 5C08D 2A73A 1D5IL 4X6DA 3U4EA 5HGBA 3U0PB 1EO7A 3V6ZA 3EYFB 5LXGH 2KZWA 1Q0YH 3T4YB 3CC5A 1P7QB 4LSVH 1FNAA 3R0NA 5DGRA 5AEAA 5L6YH 5KG9A 1XCTA 3BEVB 4FQCH 3V6OE 2WINB 5H94A 1L0YA 1U8MB 1EEYB 1F6FB 4L8SC 5HBBA 2EC9T 3R0MA 3F5WA 4HV8B 4U2ZA 4NN7C 5GRYA 2N56A 3BKMH 2H6PB 5J56B 4OZHE 4N8PA 2HFFA 4HUXA 5C9JA 4ZAKD 5HYQB 3P0GB 4Z7NE 4JDVA 2AQ2A 1OAXH 3F7QA 4PJXB 1CG9B 1F13A 3EOBA 1RIUH 1T04A 4M4RA 3TBSB 4LFHD 3B9DA 4HAGA 4CW1A 1B88A 3DO3A 1ZHBB 1CCZA 4NC1C 3OKYA 4LQ1A 3FRPA 3NIFF 3DVNB 3PGDA 4MWFB 1CTOA 5FKAA 5C0AA 4NN6C 3UEZA 5DMJB 1U58B 4H1LA 3IFOA 2BNRD 5FOJA 1JHTA 1HHGB 3QDMB 1G6RH 5JW4M 4ZUWB 4EVNB 3KJ6H 4U1GB 1FIGL 5DFTA 5DUPH 4XCYA 3D85D 2GK0A 2QQKH 2R0KL 3IDJB 5GGQH 1VADB 4DW2L 3SKUD 1KENL 2NLJA 3EJYD 3MV8D 1FG2A 5J6GB 1I1FB 3JV6A 4P2RB 1FFNA 3BKYL 5DWUL 3RWIA 4LMQI 1N7MH 5E9DD 1TJGH 4IRSC 1QPXA 3EDJA 4LCIH 1T5WA 2NYYD 2CIKB 4M4PA 2YEZA 2QSCL 4QRPD 3N85H 4X8JB 1KSRA 2BOBA 2F5AL 4LPWA 2NY2B 4UIMB 5F9WC 5CD3A 5DZNA 4HWEH 2IQ9H 4F7CB 5D1XB 4NNXB 5DLML 3IFPA 4M5ZH 4NWUL 3QFDB 1QP1A 4Z7VB 2X70B 3DROA 4PP2A 3NCBB 2OL3H 1BVKB 4PJDA 1I8KB 4PJXE 4XCNB 4F7TB 3WLBA 1DQJB 3QRGH 4N9GB 4N0RA 2HA1A 3SCMB 4R0LB 3RUGA 3Q6FB 3MRJA 3QRFM 4OCSH 1HEZB 3SGEH 3HAEG 1WFNA 4L3EA 2F74A 4M48H 2O26U 4TVSa 4L4VB 3I2CL 3VFRA 3N1QC 5JNYA 3SBWC 2F5AH 4XVTH 5JQHC 3VGEA 1DBAL 4JFFD 3A67L 4OFYA 2CUIA 3H2WA 4GMSL 4X5WA 3LQAL 3LV3B 1T89C 4KTEL 1MHPH 2BOCA 1RZGA 2VAAA 3RL1A 3PGCA 4OLVH 3QUYD 5DJCA 3L5HA 1B90A 3MLVH 1EFXB 2PXYC 1MCHA 4LK4A 4XC1L 3VXPB 1ZVYA 3OAYK 3NACL 3H9SD 1MCOH 4NJAL 3SGJA 1ONQA 5GS2H 4LHUD 5B4MD 1HK6A 4WV1B 2Q6WA 1XZ0B 1JYXA 1N59B 1NC2A 1PDKA 3RX8A 4LCCC 4RRPA 4LLVB 4XPBL 4XBGA 4N0UE 3I2CH 4PRPA 2YN5A 4XAWL 2G5BB 5IVXB 5DD0L 4OQTL 1KELH 2AK4A 4CMMA 5E6ZA 1P4IL 4ELMA 5E95B 4Y4KD 3TPUA 2CGRH 1L9NA 4FQJH 2DOCA 2LFGA 2OZ4A 4JY4A 5C0BB 4NRYB 1YUHA 1DANU 4Y8DC 5J06A 2H9GA 5DSCB 5C3LD 3MRCB 5GZOD 1M7DB 1T4KA 3QA3B 4X4XB 5C6PB 3RKDD 3VDBA 2V5YA 3O9WA 4XXCA 5DJ6A 5A43C 1LP9B 1QRNB 1VA9A 3BP7A 5H35A 3SKNA 3VRIA 3O2DA 3OKEA 3DBXB 2D31B 3FFCA 1CFTA 4WFFE 1U8OA 2FH8A 2I24N 3VXRB 4K3DH 5JUEH 1AXSB 4LSRL 5DA4A 3U9PL 1UADC 3QHFH 3F8UB 5KSAA 5F3HB 1NCNA 2VDNH 4RIRB 4DGVL 3HE7D 1WWBX 5DK3A 3VXSA 4L9LB 4E5XB 4FXGA 5EORH 1J5OL 2GJ6E 1NDMB 1W0VB 1YEEH 3UZQA 3I6LE 1N4XL 3RBSA 2EEAA 4NC0B 4D3CL 4NO0B 2Z4QA 3QH3B 5EZJA 3T65B 3RU8L 5GZND 5DUBB 3DV6B 5GGSB 3HRZB 4HWBA 1K5NB 4U7SA 3CU7A 4ZNEE 3QEHB 4ODSL 4HJ0C 2W07A 5CS7A 1LO5B 3S37H 3BSZH 2YPLE 4UDUA 3SKMB 1J05A 1OWRM 3NOIA 4O02H 2AS5M 4OIAA 3RKPA 3KAAA 1I1YB 4RNRA 5D8JL 2W0PA 1A64A 4Y5YA 2YXMA 2VWEE 1UM6H 4OIIL 2MKWA 3QEQA 5D2LB 4ETQA 1ZHKA 3U82B 3MLYL 1SM3H 5E2JA 3F7YA 1DEEB 1JK8B 3GJFH 3O45A 4H20L 2GCYB 3NCYP 4H8WC 4APQD 5B39B 1WBYB 4G42A 2PNDA 3EO1A 1U2CA 3NZHL 1KGCD 3HMXL 3SHSA 2H2SD 3VWKD 2EICA 4PG2A 1C08A 3U46A 5DZLA 3MUHL 4K3JH 4PJ9B 3WHXB 1BZ7B 4HCRA 5B39G 4JRXB 1KN2L 1RK0B 2V2XB 3QP3A 1IFHH 1GXEA 3KPMA 4S1RH 2VLJB 4UQ2A 3D9AL 1RVFH 5HD8C 1NAMB 4AIZA 2P24A 4UU9B 5IMLB 4I0PC 1E6OH 4NOFA 3VDAA 1JWMB 4IRZL 1T21B 1P7KB 5JHDA 5D1QC 3HUJE 2D7NA 1DQDH 1KJVA 4DZ8B 3T0EB 3RVXC 1S7SB 2DN7A 5BV7C 2IAMB 2C3GA 5F9OH 3FO2B 3SDDB 3OKMA 5FYJL 3GSXA 1B0WA 3D5OF 1IKFH 3GRWL 1TNNA 2JIXB 1VGEL 1VACB 4YFDB 3TGXA 4OD3H 3ARFA 3MGTB 3Q3GB 1CIUA 2C3VA 1CE6A 35C8H 3NPSC 4WTXA 1AGBA 1J8HA 4JRYA 4PJ8C 1AO7E 4ZYKA 3KPOB 3P9LA 1A6WH 4CJ0A 1CDBA 5ADOL 2V7HB 2JB6B 1NC4A 3L3KA 4NZRL 5HYFA 4MQXC 1HHJA 4MDIA 1SEQL 4WGVB 2EYRB 1IC4H 1EAPB 5I66B 3AXLA 2ZSWA 4OGAC 1UC6A 1HQRA 5DD5L 4P5MA 1U6AH 2JF1A 3W81A 2VWEC 1MI5D 4C4KT 1D5MA 1MRCH 4HD9A 2V5RA 4OF3A 3KPTA 1ZT4B 3H9ZA 5DVNA 4NQSB 2Z8SA 1Y18B 4MB4A 2Z92A 3QUXA 3MMEA 2O61A 3LD8B 4OZFG 5IEHB 4QHNA 4WUKH 3BW9A 5E5MB 5E1AA 3MCG1 1H3WM 4OF0A 1K8DB 2P43B 2QSVA 1XGUB 3A6BL 1MQ8A 4JRXE 4YHKH 2P46B 4WO4D 2V9TA 3UMTA 4OF8A 2GI7A 1A6TA 4B5EA 3BWAB 2LTQC 5EZOL 5ANME 4PTTA 3X13B 5C86A 1T5XB 4S1DD 4P4KD 3WKML 3EYVA 3UJIH 3ZSTA 3JBG7 1FGVH 4ZPVB 1J12A 5IBLD 3P4LA 5I8EB 5CIPA 1OAYL 4OD2B 3STZA 5GS3A 3QXVA 3FCTB 4AEHL 2FB4L 1QLRA 4GAGH 1OW0C 4UTAH 4GAFB 3G04A 2BVOB 2BFVL 1IC1A 4ETYA 2EECA 4A6YL 4K23H 4ZFOL 1V5JA 4PLKC 1J1PH 4BSVA 2A9MH 5ERWB 3FQTA 4MAYA 2B5IB 2A83B 1OAKH 3LCYA 4YE4H 2Y4SA 4GRWH 3NPZB 3S4SA 3DX7A 5GHWH 3VXUB 3GHEH 4K2UH 1IEAB 3DRTA 5AZ2L 3TVMA 5JQ6L 4J2XA 4PJFB 4PJCB 5ISZB 5GRVL 4NKQB 1G9MH 4TYUA 1RJLB 1UWEH 2X1XR 3VGFA 4HULB 2B39A 1U92B 3ARDB 3MLZL 1D6EB 1YJDC 1TQCB 3CFKA 5LGJB 4JFQA 3DVIA 3WSQH 5BXFA 1F4AA 1W8OA 1E4XL 1XCQB 2CKNA 4GG8B 4F7PB 5B3JF 1AE6L 3WXWL 3OJMB 4NHUB 2X44D 2VR5A 5I1JH 4DGYL 4YO0A 4GAJL 3AFLA 3KPSE 2V17L 3FQRA 3KS0J 3KLSA 3UTTE 5ETUB 1W0WB 3MV7D 5EO0A 3GSWA 5IQ9B 4R97C 3OXRB 1YMHA 5KOVC 1NCCH 2Y6SD 3V4UL 1TZGL 2AAVA 5SWSE 3T2NH 2VH5H 1J0HA 4I3RH 4OCXH 4YXKL 5T33L 4WTZG 3V5HA 4PJ9C 1A7OL 4LBEB 4QOKA 4HKBA 3MPCA 4RGMC 1EMTL 4KXZH 1WICA 5JDSB 5BZWB 3U0PA 3EYFA 3T4YA 1KB9J 1PQZB 3WXVH 1E4XH 1P7QA 4OFYD 1CVRA 5F7DB 1C16B 5KVFL 5KW9L 4H0HB 5IW3A 2DWEB 3BEVA 2PR4L 3GBMH 3MNZB 3IRZA 1X5JA 2WINA 3IFNL 1DN2A 1U8MA 1EEYA 5DURD 4ZD3H 3IDYC 4HV8A 1LDPH 3H0TB 3O3BA 2H6PA 1MQKH 1II4E 25C8H 4OM1H 1TZGH 2I9TB 5I30H 1TCMA 3ZDZE 4GRMB 3JWDH 1QO3B 4KDTC 5HYQA 4NBYB 3ARRA 4NHCH 5I17B 1ZEAH 2VLKB 4PJXA 5F21B 4YR6B 1CG9A 5DFVC 3U9UB 4G8IB 3TBSA 1C1EH 2AABH 1P1ZB 2JE8A 3HI6L 1MFDH 4F57H 2IEPA 3WHE1 1ZHBA 1YEJL 1PLGL 1BBJA 3DVNA 4MWFA 2IPUK 1FORL 5SV3A 2DI9A 5KVEL 1MFBH 4OZIE 4FN0A 1CR9L 3C09C 1U58A 3LN9A 3F6IA 4PRHB 1KIRB 5GRVK 3VFMB 2NPLX 2YA0A 5C0RH 1S7XB 3ZHLA 1HHGA 1SVCP 3QDMA 1J1XH 4ZUWA 4RGND 4EVNA 1VPOL 1YC8A 1K3ZA 1F90H 4DQOH 3ZYZA 5ALBL 3IDJA 3LD8C 1GVIA 4Z77B 2QADC 1VADA 4WHCA 3K80A 1VFOA 2KPNA 4JLRB 3VD7A 5BS0B 1AI1L 2LU3A 3QNYB 3BD5A 5FK9B 2AEWA 4R4BB 5J6GA 1I1FA 1JN6A 4P2RA 2ITCB 3LMJH 4PRDB 3X3GL 4PJEE 4IBLT 3DARA 4L4TB 1BOGB 5CP3A 3V7AG 5CBAB 5I8OH 5EBMB 3VG0L 3VXSD 2IADB 2CIKA 5I1HL 4N0UA 5CINL 4NUGH 1A7RH 5KS9E 1HSBB 1BF8A 4X8JA 2NY3B 1JF1B 1I3GH 2AGJL 4UIMA 4N0YL 5IVOA 43C9B 5E4EB 4JN1L 4RA0C 5D1XA 4F7CA 4NNXA 4PJBF 3WHE0 3RZCB 1U8QB 2UY6A 4PP1C 1GH7A 3QFDA 4QXUH 1J7VR 3HC4L 4Z7VA 2X70A 3IKCB 2VUOA 3G6DL 4HW6A 1BFVL 5GGVH 1QRKA 4MQTB 1BVKA 5EOCH 4GMTL 1Z0NA 3NZ8B 1I8KA 3NGBB 5T3ZE 4I3SH 4XCNA 4ZUSB 4F7TA 4PRIB 1DQJA 2LABA 4HIEB 4N9GA 4KUZL 2MWCA 4ORGB 3SCMA 4R0LA 2AJZB 3IXAB 3Q6FA 1A6ZB 4MA7L 4NO2B 1HEZA 2Y07L 2BHYA 4L4VA 1QBMH 4FQ1H 4NQEB 1KIPB 1OWWA 1YN6B 4BFBD 1JZ5A 1DFBH 1U8LB 2WLYA 1NGPL 2F54B 4YHLH 2R2HB 1TQCC 3B2UC 3TT3L 3C2AL 1JPGB 1T1ZB 2PTVA 1J1OL 3IYLW 3LV3A 5I16B 2EXWC 3P4MB 3SY0B 3HUJF 2ADIB 1U3JA 5CGYD 4Q9QH 1YMME 4HFWA 1FNFA 4MXQD 5ACLA 1IC5H 3GMOB 1EFXA 5HVHC 1CE1H 3VXPA 1P2CB 3TF7C 5E6YA 3LEYH 1AD9B 2JB5L 1YYLL 2FJFB 2R69H 4WV1A 1X4ZA 1JHLH 1XZ0A 1GAFL 1N59A 1K8IB 2P5EE 1R3IL 1JMXA 4K55A 3VFWB 2V9RA 3BQUB 4LLVA 1EBPA 1EHAA 4AIOA 1A7NH 2G5BA 2XV6B 5IVXA 1ZGLM 5C0CB 2CMRL 3LKSB 5J1AB 1UA6L 1P9MA 4MGXA 2BCKB 1KV3A 1F42A 1KF9B 5EPMB 4JB9L 4JG1L 3U2SB 3WJLC 5C0BA 4NRYA 4U0QB 4OKVB 2BERA 5FEBA 5DSCA 2ARJB 3MRCA 4QRQB 2VDKH 5DHXB 1M7DA 3QA3A 1Y0LB 4LSUL 4X4XA 4R26H 4MMZC 4WW2F 2ENYA 4FMFA 2C4FU 1B6DA 1LP9A 1QRNA 5KSUB 4XVSL 3OF6A 3DBXA 2D31A 5FGRA 1BFSA 1R6VA 2IBGA 3VXRA 3RA7H 3Q5OA 4MD0B 2NW2B 3JV0A 1AXSA 4WI3A 3ULUH 4O5LL 5F3HA 2CUHA 4OGYH 4RIRA 3NH7H 2P1YA 3S5LB 1LDSA 4L9LA 5I1GL 4E5XA 1HYSC 4NNPL 5HHME 1NDMA 1W0VA 4PJ5E 3DXAE 4HBCH 5ICZB 5C09D 4NO0A 4XH2B 3QH3A 3LH2L 4JO3H 5DUBA 3DV6A 1SJEB 3HRZA 5GGSA 5I9QC 5I0ZA 2ZPKL 1FNSH 3F6LA 3HG1B 3QEHA 3EKCA 3EOAB 1P4LB 4F15B 2BRRL 1LO5A 2F8OA 2WSKA 3CIQA 3MJ9A 3MLSL 1DJSA 4LLMB 1FNEB 4IRSD 1RUAH 1MSPA 1KIUA 1N0XL 2FWOB 4PJHB 1MIML 3WD5L 2OK0H 1FN4B 2YOCA 2DYPB 1I1YA 4G3YL 4U2YA 3PQYE 5JW3L 3HZVB 5D1ZB 3KYNB 5D2LA 2BNQE 5DUML 1IAIL 1P84K 5TFSL 5CJOH 2X10A 5FDWB 1DEEA 1JK8A 3BPOB 3W11C 1GOFA 1JTPA 3UTSB 5AUMB 3BD4A 2GCYA 5B39A 3NABH 1KCKA 1RZKC 4E9LA 1WIPA 4P5TB 4C56B 3KR3H 5HHOE 4ZO7A 2WBJB 5E4EC 3EYQC 2P7TA 5I1IL 3P4NB 3FHQA 2XY2A 1F3DJ 3BIKB 2AK1L 4HPOH 4JGUA 4PJ9A 3WHXA 3WNOA 1BZ7A 1ZSDB 2HKHL 4OBSA 4JRXA 3BKCL 2PW2B 2YD1A 3AVEA 1RK0A 2V2XA 4KK8C 1IGCH 5E2WL 2IALB 3J8F7 2VLJA 3NGBC 3TCLB 4QXTB 2CR6A 1NAMA 4GBXB 3MLXH 4K94L 1G1YA 4UU9A 5IMLA 5CJXC 5IB3B 3Q5TA 5F93C 1NSNH 1JWMA 1A1OB 1T21A 1MJJB 1P7KA 4NDMB 1Z5LB 3TC9A 3QFJB 3D2UD 4DZ8A 5B3NA 4J3XA 3T0EA 1S7SA 3UPRB 2IAMA 4J3TA 2PXYD 2FIKB 3FO2A 3SDDA 2BY3A 5FYKU 1U36A 3CSBA 2WWKT 2DQGH 4Y2DB 2JIXA 1VACA 2CXKA 4KDTA 3MGTA 3Q3GA 4TOYH 4BZYA 3FT4B 1PX4A 5LGHL 1T03L 1JI2A 3HCVB 4S1QL 3WUZA 3KPOA 2V7HA 4R4FH 3QQ9C 1CDIA 1JGUH 1NBQA 3JWNC 1R3HB 2EYRA 4JKPL 1EAPA 3CAFA 1MAMH 2APFA 4OZFA 5I66A 1U8JB 3O0RH 4R90H 3BO8A 3E2HC 1OAZL 3BQUC 4X9IA 4NM4L 2G9HB 1MCFA 4P3CH 2FX9L 5CCKL 2WBKA 3T3MF 2RCSL 1QZ1A 5DMKB 1ZT4A 5I75B 2A77L 4NQSA 4QRRB 4V1DE 4L3AA 1Y18A 4I2XE 5INCB 1KB5A 5IEHA 4PB0L 4OZIF 1UB5B 3PWLB 5E5MA 1TPXC 3GI9H 3PGFH 3MGOB 5KVDL 5I1EL 1K8DA 1CL7L 1XGUA 4CMHB 3E8UL 1QUNA 2XZCL 2ICEB 2VZ3A 1M7XA 3N1PC 2D7TL 1JGLL 2A0LC 3BWAA 4M8VA 2J4WH 4PJIE 3X13A 1UXWB 1T5XA 5IROC 5JW4Q 1EJOL 1PD6A 1EEQA 3IRPX 4S1SH 2VXUL 1ZLWH 1FDLL 4ZPVA 3WJJA 4R6UA 5I8EA 1GRWA 4PJEF 1YEKH 4OD2A 1WBXB 3QFJE 3QWRA 4TTDC 4BQ9A 4HJ0D 3FCTA 1G6RB 1WFOA 3QWOB 1PSKL 4LASL 2BVOA 5KS9F 4DTGL 5IHUL 3CUPA 5HVFB 4EBQH 2ERJB 3JTSB 1ZT7B 2C7UA 5E2VH 5ERWA 1RZFH 3KVQA 2A83A 4YDJB 1QPPA 3RGVB 3BJLA 4F15C 2D4FA 5K59E 1T0MB 1IGYB 3VXUA 4BFEA 5FGBA 4PJFA 5HDQH 4PJCA 5ISZA 4EN3B 4NKDA 1RJLA 2YPVH 4JPIB 3PWJB 4HGMA 5A16B 2W91A 1U92A 3ARDA 1D6EA 3VFGH 3ZL4L 4U49A 5LGJA 4MLSA 1I9IH 4ONHB 4QGTA 1CGUA 1XCQA 4Y5XC 2AXFB 4GG8A 5DJ2B 5DQDL 4JM2C 1JE6A 5F89B 3CDCA 4OLXL 5IGXL 4NGHH 4WTZA 2DD8L 4NHUA 4M6OL 1ZLVH 2OL3B 1IJ9A 1F4XH 5KVMC 1ETZB 4JQIL 5F1SA 2B8OT 3HNSH 2ZUTA 2ZG2A 5ETUA 1W0WA 4OQ1A 1NGZB 5CZKA 5LG1A 2AJSL 3OXRA 4YDLC 4RISH 5HD8D 2P5WB 2QHRH 4F80A 4ALAH 1DANT 4L8CB 4I0PD 1U95B 2Y06L 4POZC 3EYSL 4WFFD 1QFWI 2YS4A 5D1QD 3IAGC 2OM5A 4TSCL 3RHWF 4W70A 3BHBB 3RVXD 4GW1B 2MSPA 5JDSA 5BZWA 1AKJB 5FUCE 1NMBL 1PQZA 2GJ6D 1EH9A 2UWEB 2AEPL 5F7DA 5DZOA 1C16A 3I6LD 4Z8FH 3NVQA 3BI9X 2DWEA 2FD6L 1CDYA 3MNZA 3PWPE 2H1PH 5MERB 3PP3H 1B2WH 4XTRC 2R9HC 3H42H 4PJ8D 5IVZB 4MB3A 4CVZB 2HH0L 5GGTL 4HXAH 3H0TA 4N0CC 1OLLA 2YPLD 5FV2A 1A3LL 5CEZH 4MQXD 4Y2DC 4WWKB 3FZUC 2BHUA 2K7QA 4GRMA 1QO3A 2X4SB 3PL6B 3PDOB 4O2CB 4OGAD 5I17A 2VLKA 1H3XA 4YR6A 3U9UA 2UY7A 4G8IA 2XA8L 1GOHA 3NCEB 1HI6B 1P1ZA 4TUKL 4UI2A 1C5DB 1P4BH 2EYSB 2YD5A 2CR3A 4GOSA 4JJ5B 5AYUH 2Q20A 2YUZA 4JFEB 1GC1L 5CJ8A 1BAFH 4OF5A 4G6ML 3ULVF 3TBVB 4PRHA 1KIRA 4OGXL 2ZUSA 5FM4A 4U1JB 3VFMA 3NFSH 1FAIL 1S7XA 2EDNA 1KACB 4HUWB 1OAUH 1WC7B 1ZA3B 5A2FA 1WEJL 3W9EB 5F44A 4U4BA 1WBZB 3TT1L 2OQJB 1NCAH 4XNXH 4UT9H 4XB7A 3RIFF 5FO8B 2D03H 1JL8A 3QNYA 2R2EB 4BZ2L 4NZTL 1A3QA 4R4BA 2HT4C 4PRDA 2ITCA 4PTUB 2CKBL 1Z3GH 4L4TA 1Q38A 3MCKB 5CBAA 5EBMA 3MLUL 4NQTA 2P5EA 1RY7B 2IADA 3RIAF 5DMIL 2ZCLH 1O7VA 2UWEE 3QEGH 1JGDB 1HSBA 1JF1A 4NO0D 4P46C 3DIFA 4PLKD 43C9A 1I9RH 4HXBH 5FUCC 4I48B 2E6QA 5DR5L 3RZCA 3KPRB 4CDGC 5EOQL 1RZ8B 3TH4T 2ZJSH 3IKCA 5DHYB 1KCUL 4XNQB 1OGAE 5FF6B 3UYRL 3NZ8A 1K4CB 4U0RB 4KQ4H 1AO7D 4PRIA 4HIEA 4JR9H 2R8SH 3ZYIA 3IJHA 5F96L 4ORGA 3VH8B 5CJXA 3IXAA 1A6ZA 4HKJB 4NO2A 3GJFB 5CUSL 3JV4B 2QSTA 3CVHB 5IT2L 3MXVH 2VDLH 5J12B 1OPGH 1OCWL 4NQEA 1KIPA 1TTGA 1YN6A 2DTML 1U8LA 3K7UA 4OCRH 3NCFB 1B6UA 4GRLC 1OP3H 2F54A 2BVUA 3OTTA 4BYHA 3VH8G 2R2HA 2QQNH 1JPGA 1T1ZA 3QR2A 5I16A 2Z31C 3IU4L 2CRYA 2ZG1A 5CSZB 3CVIH 3GM0A 3BKJH 3P4MA 1UKTA 3SY0A 2ADIA 4PJ9D 4HMEA 4LQFL 2J2ZA 3GMOA 4JRXD 1CTNA 4XP5H 1P2CA 1X4XA 4OJFL 2GIYA 3RVVC 4R8WH 2BDNH 1WITA 1J87A 1AD9A 2FJFA 4OFKA 5KSBE 1K8IA 4Y16C 1MPAH 1DUYB 3VFWA 3BQUA 4YPGB 4M5YL 1Q9WB 3F7RA 3S9DB 2VZSA 2VTFA 5C0CA 4JHAL 2Q7NA 3LKSA 1MFEH 5J1AA 2VUYA 4FG6C 1HH6A 3RDTB 1IBGH 2BCKA 4XMLH 4NQCE 4JM2F 2YD3A 5EPMA 3U2SA 1KJ3L 4OKVA 3NAAL 2R1YB 2ARJA 2O5ZL 3LEVH 4KJWC 1F58H 4QRQA 5FM5O 4EXKA 5B21A 1Y0LA 1BF2A 2P4AB 3ZE2E 1FZKB 1H0DB 4YLQT 4JKMA 5DFVD 2OJEB 4JFXB 4N8VG 1F6AB 3QCVL 5KSUA 1D7FA 4XP9L 5BQ7B 3MX0A 3NA4A 5GRJH 5GIRB 2FJHB 2J6EH 5IR1B 4MD0A 2RB8A 3OHXB 3LKPB 3C5JB 3IJYB 5CWSB 3OXSB 3QJHB 3NCJL 1X5AA 1WZKA 3S5LA 4J4PC 4XMPL 4PJIF 3JV5A 1GIGH 4PJBB 2B1AL 3HC3H 4PY7B 3LQAC 3QULB 1GL4B 4YUEH 2ICWB 5ICZA 5TE6L 4XH2A 1S7UB 4Y4HC 2QADD 1SMOA 5ESQB 3U4BL 2X4UB 2XQYK 3C8DA 2OTPA 3KPSD 3HG1A 4QRUB 3UTTD 2XWTB 5AZEL 1AFVH 3EOAA 1P4LA 4MA8L 1TJIL 3GSVB 4LLMA 1FNEA 2JJSA 2NY1B 5LBSH 5SWSD 1DSFH 3QXWA 5LAXB 2FWOA 4IJ3C 4PJHA 4JFZH 1FN4A 2DYPA 1VSCA 1T0NB 4Y8AA 4XP6H 3HFML 2EXYC 1QHPA 5IESL 3LDBB 3HZVA 5K59F 3O2VL 1NGWB 5D1ZA 2AQ1A 1CBVL 2O93L 1GPOL 2VLME 3QWRD 4HWZB 2J3SA 1H3PL 2B1AH 4PP1D 4ERSL 3UTSA 5AUMA 4XNZB 1NUFA 2WM0A 2CK0L 3BGMA 5LVEA 4P5TA 1OSZA 4C56A 2DBLL 1XGPB 4GRWB 4O9HL 2WBJA 3B3IB 1AXTH 2Z8WC 3W0WE 2LVEA 3P4NA 5KJRH 2ADGB 2VLRB 1YPZB 4XPTH 2MQ3A 3BIKA 4XWOC 3BUYB 1ZSDA 4X4MA 2YK1H 5DF0A 2PW2A 3KJ4C 3TEUA 5MENE 2IALA 5T1DH 3TCLA 4QXTA 1FL6B 4NN5B 1EEZB 3CH1B 1UKSA 3B2UD 5IB3A 5FYJE 1V7NH 5T1KD 3ZKXB 1X5YA 1JIBA 2EXWD 1KTLB 4NDMA 1YQVL 1Z5LA 4XPAL 1SMAA 3QFJA 5FHBH 3UPRA 3BH8B 2DKSA 3LS5L 4AEIL 4NBXB 2FIKA 3VXME 4RGOL 4FQIL 1T2QH 4ZUTB 4K7PL 4G7YH 4CN4A 3EHBC 4U6VH 4Y2DA 4XVUC 3SDAC 4KQ3H 3IB4A 4R3SB 3CXHJ 1N5AB 1S7QB 2CSPA 4G9DB 4YHPB 1FV1B 4KPHL 5D72L 4OT1L 1UCTA 3N0PB 5FYKL 1MY7A 1PY9A 3BX7C 3ZYJA 4LLQB 4JE4B 1R3HA 1MCPH 3MCLH 1S7RB 2FH6A 1U8JA 1SY6H 3G6AB 3QIUB 3QPXL 5IM7B 2HRLA 2G9HA 3K1DA 3Q5YA 4NQDB 4OZ4B 5DMKA 1MFAL 2EE2A 2VNCA 4GRWE 3RDTC 4M43L 4PRBB 3GK8H 5EO9B 5INCA 2IWGA 3UDWA 3PWLA 4LIQL 2W9DH 2KQNA 2OXGA 2X89A 4XP4H 4EJ1C 3MGOA 3ARBB 1EVTC 5C6TL 3T2QA 2GTZB 1D5BB 3MACL 1MFNA 4KK6C 5GPRA 4EI5B 1EUTA 2ICEA 4G7VH 5E4IA 5EIQA 5IB2B 5T3ZD 4ZSOB 3GUTB 2FEEI 5D72H 4ACPA 2AEIT 2AJUL 3T0XA 1MCLA 3MR9B 3O81A 1HYSD 1UXWA 2EDFA 2VE6B 1D6VL 3EO0B 2VQUA 1DBJH 4Z7OE 5ID0B 3L3GB 4MVBC 3BPLC 1WV7T 1WBXA 2HJFA 1JTOA 1MCDA 4O58L 1G6RA 4OLZL 4NWTH 4PBXA 4PRNB 3AREB 3QWOA 4MD4B 5C0EB 2IANB 4LPVA 1KCSL 4Z7WB 1Z6JT 5F6HI 3JTSA 1ZT7A 4TRPH 1YMMD 1NL0L 1QSFE 1YY9C 4YDJA 1W72B 3RGVA 1T0MA 1IGYA 5DGQA 4L4TD 4D0CB 1JHKH 2AJUH 5F7LB 4EN3A 2C5DC 3H3BC 4DKDC 2P5ED 3W11D 5DC9B 5KVGL 5CJ5A 4OTXL 5EO1B 4JPIA 1CXKA 2AEQL 6FABL 4K7PX 3C08H 2VXSH 5A16A 3CPLB 3OWEA 1FH5H 1V3MA 3SKOB 4QT5B 3JVGC 4ONHA 4LRNH 4LF3B 3S88H 2YZ8A 3EYQD 3IDXH 1BP3B 2AXFA 5DJ2A 3O2DL 5F89A 3FQWB 5CZXC 3OR6B 1FPTL 2OL3A 4PBWD 3QIWB 1ETZA 3QHZL 3DHMA 4YHML 2XI9A 2OI9B 4KK8D 3U7WH 2DMKA 4YDIH 1NGZA 4XX1E 1E4JA 2DWDB 4LARL 5MEPA 2EKSB 2EH7L 2OZ4H 2Q8AL 4L8CA 4KK5C 4NNYB 2VSDA 4M6NL 4Q9RL 1U95A 1DEDA 4JO1L 1LILA 1G9MC 5I18L 3DV4B 5KVGH 4CUCA 1IL1B 3SGDH 4HWBL 3UJJL 3V52L 2X9WA 3QXUA 3BHBA 4PUBL 4P49A 4GW1A 4FFYL 3IF1B 2XTJE 1NBZB 2JJTC 4NN5C 1XH3B 5KSBF 4WW1B 5HHMD 4NQXA 2UWEA 4HK0B 4PJ5D 2UYLB 1AP2B 4L4JA 3PUCA 1FVCB 1ED3B 3B5TA 3D3VB 4KTDH 4M1GH 4HUUB 3BZDA 5MERA 5FAAA 3CSPA 2UV3A 3GEWB 1XF3B 5DRNB 3V4PH 4AG4H 4KFZC 1BHGA 4F33B 5IVZA 3ZTJH 3DSNA 5TH2B 3QQ9D 1MJ8H 4JREB 1OTSC 4M6NH 3SE8L 2F58H 4WWKA 5EUOE 1IGJB 2X4SA 2ESVE 3PL6A 3PDOA 4O2CA 5HJ3A 1IM3B 3BQUD 4JG0L 1BD2B 1DN0B 3PQYD 4EIZC 5L8KB 3VG9B 4DFHA 1HI6A 3EIFA 2QSQA 5SWZB 3WS6C 3D0VA 1C5DA 3OV6A 4UOW1 2EYSA 4JJ5A 2BNQD 5EFIB 1PEZA 4FQXB 4IDJH 3M8OL 2V7NB 4JFEA 1IE5A 1RHFA 3ZT7A 1KLFA 3WFBH 4HCRL 1FL5B 3G5VB 3PV7A 4P57B 3TBVA 5HHOD 4U1JA 4HUWA 1ZLUH 4P2QE 4IS6A 1WC7A 1ZA3A 2A0LD 4OD1L 2IG2H 3W9EA 1WBZA 4HIXH 2OQJA 1HXMB 4LAQL 4G43B 2OCFD 3MYJB 1CFNB 5F6HJ 5FO8A 1RUQH 1MRFH 1OTUC 2R2EA 1L7IH 5EWIH 4PTUA 4OCWH 4HZAA 1KEGH 4XNYL 1MIEL 4TTDD 4Y5VB 3MCKA 4P9MH 5IEKB 3GO1L 5E8OA 2BSED 3LHPH 4U6XB 1U8PB 1H8NA 1A7PH 1OM3L 2VSCA 3CLEH 3D3VE 1TVHB 5ACMA 1GGIL 4C59B 4MCZB 2XTJC 3FAXA 3BDYL 4UOW0 3RY6C 3L5XH 4I48A 1KXQE 2YD4A 4ZPTB 3O3DB 3MA9H 3KPRA 2H2PC 4OD1H 5TQ0L 4K9EL 5CKAA 2FLRT 5DHYA 2CJUH 4KZDH 4XNQA 1WFUA 4MZ3A 5FF6A 2AJXH 5IQ7H 1K4CA 2D9QB 3ARGB 1A22B 4K3GA 4XBEH 3VH8A 1NBVH 4JY5H 5B38B 1KCLA 4BM7A 3X14B 3KNBB 1UQSB 4HKJA 4G6FB 2WZPD 3GJFA 4KRPB 4OSUL 3JV4A 2YZ1A 4JM2D 4J3VA 2LAGB 4FXKB 1TTFA 4HT1H 4NJ9L 3GJEB 4HEPG 4JFHE 1LO0L 3RNKA 1JGVH 1KFAL 4YQXL 3OKKB 3PHQB 2D0FA 2VB5A 4XNMB 4HGKC 5B38G 4RA3A 4V1DD 2EDEA 4GFTB 5CSZA 1EZVX 4AL8L 3PIQB 5HPMB 2W0FB 1XF2B 5IFJB 1UCBH 5K9JL 1RIVL 4POZD 1YEGH 3WN5B 5ALCH 1CXFA 1MVUB 5HYJE 5T1LD 4NP4H 4IEFB 4PY8I 3WL9A 1G0XA 3ULUE 2OI9C 1UWXH 3CGTA 3B9VA 3SDXE 3WBDA 2VC2H 1T6VN 3ARUA 1L6XA 2IH3B 4R96B 5FUZL 1LO3L 3UO1H 4YPGA 2FATH 1Q9WA 1MLBB 3C5SB 4Q9BA 4XTRD 3QFJD 3WDJA 2R9HD 4HIHB 1NUGA 3VFPB 1GYAA 3RDTA 1X5KA 2DQDL 4X6CF 4N0CD 4WDIB 1I8MB 4DAGL 2R1YA 4Y2DD 1I3VA 5EU4B 3TO4C 1AD0B 3FZUD 1UZ6E 4ZTPH 4WI2A 3REVB 4EDWL 1FZKA 1H0DA 5IWLA 3MUGB 2OJEA 1PZUB 4JFXA 5ACZB 5SX5K 1EBAA 5EB9A 2FL5B 3MBXH 2V2WB 1ZLSH 1J18A 2YD6A 5HDLA 3BE1L 5BQ7A 2XA3A 1BM3L 1A6AB 5GIRA 2FJHA 1LO2L 5IR1A 4R2GC 5L0QB 1LE5B 3OHXA 3LKPA 1LK3H 3C5JA 3IJYA 2J12B 5CWSA 4D2NA 3OXSA 3QJHA 4WRLA 3QG6B 1F4YL 4L5FH 5JOPE 1MWAB 1JBJA 1CGSH 5TQ2L 1IARB 4PY7A 3QULA 3TZVB 4Q58C 2ICWA 1X5FA 4ONGH 1V3KA 1HKLH 1S7UA 2BY2A 4QYOB 5ESQA 2X4UA 2IBBA 3RAJH 1B0RB 4QRUA 5I1LB 1RZJH 2XWTA 4HS3B 2HT4D 1Q9OB 1MY5A 4NKOB 2MMXA 5CJQH 1QD0A 3T0BA 3VJ6B 3GSVA 5EH1A 4F58L 5D9SB 1DQML 5I19L 5D6DA 1PBYA 3OKLB 1F45A 2FHCA 2E7MA 3QDHA 1UH4A 2I5YH 1QR1B 2DMCA 1KEML 1T0NA 4EQ3A 5LCVH 4XI5C 5GRUL 2Q86B 4DKEH 4JFPB 4P46D 3ULUC 4GG6E 1NGWA 4LSTH 4YWGH 2QKIB 3OAUL 4AT6B 4HWZA 2E9BA 2E9WA 1ZTXH 3ZSSA 1L4IA 1G7QB 3SKJH 3MOQA 3TV3L 5D7SH 3GSQB 2HRPL 4LAJH 1JYVA 3PWPD 3QQ4B 1E6JH 3QCTL 1XGPA 4DZBB 3B3IA 2VR9A 1NMAL 3TM6A 1IGFL 3QYCA 4HF5H 4DVRL 2ADGA 2VLRA 1YPZA 5CILH 3BUYA 1UWGH 1OTTC 5FO7B 1X5GA 5C2BL 3CXDH 1RZ7L 4PY8J 3AB0B 1FL6A 1M1SA 2FECI 1EEZA 2RHEA 4GRLD 3CH1A 1XR9B 3G9VA 2Z31D 2DM3A 4KRPC 1FCCA 2WANA 1KTLA 4WCYH 3ZTNL 2DDQL 3DX6A 3BZFB 1AC6A 3QDGB 3Q0HA 3BH8A 1CDJA 5ENWB 2DQTL 3WFDH 1PYWB 3U48A 2FGWH 4IRJB 3RVVD 5ESAB 4I13B 2BJMH 4UBDC 1YN7B 4ZUTA 1ZWIB 3FFDB 5GJTL 4N8CH 4R3SA 2OR9H 1DQQB 4Y16D 1N5AA 3L9RB 3EGSB 4PRAB 5E8DH 4G9DA 3HE6C 1PKOA 3LKRB 3SJVB 4NUJB 1LEIB 3IAQA 4P5KB 1T83C 4YHPA 1FV1A 1IGML 2APWA 3GMNA 4P3DA 4Y4FD 4WIQA 4JO4L 1NFIB 4FG6D 2B4CL 2DLGA 5AAMA 3BP6B 4LLQA 5IMOB 4YHIB 1S7RA 4QTIL 5HGGS 1B4JH 1A9BB 1WT5A 2ICWI 3ARPA 3G6AA 4LPYA 4CADB 3QIUA 4PS4L 3GNML 4KJWD 5IM7A 2XOTA 1RURL 2MKLC 3QXDB 5HVWA 4NQDA 4OZ4A 1I8LC 4FNLL 4RDQF 3BPNC 3E6HB 4UT7H 4G6JH 2W9EL 3GDBA 4PRBA 1S78C 5EO9A 3WIIL 3RP1A 3S36H 2KBGA 3HN3A 4Q7DA 1W8NA 5MHSE 3ARBA 1MREL 1CICC 3QCUL 5JR1L 2GTZA 1D5BA 4N0FB 3ZE0E 2R29H 1H5BB 3BGAA 5IB2A 4ZSOA 3GUTA 3CX5K 2NTSP 2VISB 3KDMA 3H9HA 5MEQB 4WTWA 4E41B 3I9GH 3IDUA 4J4PD 1JNHB 3BGFC 3MR9A 5E24E 3LPFA 1CXIA 2MFNA 2AJVH 1WLHA 2VE6A 3X3FL 3O4LE 3EO0A 5DJ8B 4Y4HD 3L7EB 1ACYL 5ID0A 2F5BH 5L0QC 3L3GA 4P59H 2ORBH 1HE7A 1ZE3C 1A14L 4WHYH 4EQ2A 4KHTL 4PRNA 3IDMB 5TPWH 3AREA 5DJXB 1Q94B 5C0EA 1XFPA 2IANA 4Z7WA 1ORSB 1S9WB 4FABL 4WI8A 4MCYB 3R1GH 3QCUH 3S34L 4ZXBC 2G60L 5GRXG 5JPNB 5SX4H 3MUZ1 4MJ4A 2EXYD 3O6KL 1W72A 1A7QH 1HYRC 3LPWA 3O6FB 1KTDB 4MA1B 1EK3A 4D0CA 1JV5B 1U41A 5L2KB 1DVFB 5EUOA 3CNKA 2DQCL 3NA9L 2G5RA 2WUBH 2RIKA 4OB5H 5EO1A 4OZGE 3CPLA 3IU3B 4TNWK 5J1SC 3BN3B 3SKOA 4QT5A 3X11B 4WFGE 3TPKA 2EDHA 2CLRB 3V4VL 3BZEB 4NQCD 3RQ3A 3UZEA 4CN1A 3FQWA 3HPJB 2NTFA 4XWOD 1P5VA 5CEZE 5IV2B 4N5EC 2JELL 4FABH 3OR6A 1FYTE 3QIWA 2D2OA 2HFTA 5MP6H 5BMFL 3IDIB 4N1CA 5HY9B 2QR0B 4KXZI 3FN0H 2FJGB 2DWDA 2XN9E 4G8EB 3SE9H 2F53E 4DKAA 2EKSA 4E41E 2IPTH 1NCDL 3OKOB 4NNYA 1A3RH 1WUNT 1RHHB 4UV4H 2VDOH 4QGYA 3WFCH 4X7EC 3DV4A 1M05B 1IL1A 3QNZA 2WAHA 2A6JB 1AY1H 5BW7A 3IF1A 2NY4C 2OJZL 3MJ9L 1XH3A 1TZIB 4WW1A 1YEFL 3EJZC 4XCFL 4HK0A 2UYLA 3EHBD 1AP2A 4YEFA 4XVUD 4ZUVB 3SDAD 1FVCA 1ED3A 2XWJB 5FHAL 3D3VA 5DT1L 4HUUA 2MTPA 1LO4H 4G8GB 1BBDH 5DRNA 1YJDL 1RMFL 3HC0B 1G84A 4F33A 5E1HB 5I1CL 1EHLH 5TH2A 4FFZL 4LU5H 1NCBH 4J1UB 2E7CA 3TYGH 5GRZA 3DHJA 1WWCA 1FSKB 5E8PB 5L2KE 1JCKA 1IGJA 3MNWB 3JWOH 4Z95H 5F7EL 1IM3A 1Q72L 4X7DC 1BD2A 3MRNB 5DJ0B 1DN0A 1F11B 4M7JL 4UT6L 5SWZA 1L7TL 4MMXC 2JCCB 2Y36L 3RJQB 3P30L 4P3WA 2EC8A 4XPGL 2VLMD 4KY1L 5EFIA 2ZWLT 1AQKL 4FQXA 1ZHLB 1KC5L 3MBEC 2NZ9C 2V7NA 3BT2H 3RDTD 5IB5B 4XCFH 2R0WL 5EZLB 1T2JA 3AMKA 4MQ7B 1FL5A 3G5VA 4P57A 1KCVL 1V8HA 3R8BB 1XT5A 4KK6D 1K3IA 3O3EB 2J5LB 2HN7B 3AM8C 1NAML 3MJ7B 4AY0A 3B9AA 2GHWB 4YXLH 1N5YH 1WAAE 3SDYH 3W0WD 3OGCB 1R0AH 5J1TC 1LQSR 3MRFB 4GLRI 3A6CH 4JFDB 1UM4L 3D0LB 3ILQC 1HXMA 4OCYH 1G7LB 2VAJA 4G43A 3MYJA 1CFNA 5MEND 4D8PB 5LWYH 1EIBA 3P11H 1NAKL 4Y5VA 1OAQH 3FTGB 2OLDA 4KY1H 5FYJD 4U6XA 2DS4A 1MLCB 1U8PA 1CFVL 2A1WL 1HHIB 4GG6F 1BIHA 1TVHA 2Y7QB 4MCZA 1F8TH 5EU3B 1YY9D 4N5UA 3VXMD 4UQ3B 4UB0H 3L3OB 2XIDA 4ZPTA 3O3DA 4LVOB 2Q87A 1MCKA 3EO9H 1PG7W 1JNLL 1AQDB 2X4NB 1ND0B 3RY4A 1QFWL 4P2OB 1NUNB 3LRSB 1RK1B 3D39E 3I3BA 4M62L 5D93C 2NY6B 3ARGA 2XKSA 3V0WL 4YPJA 5B38A 2I07B 2APTA 3X14A 4Y1AE 3KNBA 1EO8H 1UQSA 3NIDE 3O6FC 3PWVB 5F8RC 4EKXA 1KB5L 1VEMA 5JXAL 4NZDA 4RQQB 4FXKA 3GBNL 3GJEA 3LRGA 1GC1C 2AXGB 1Z9MA 5F7KC 5CZXD 3OKKA 3PHQA 4OI7A 4XNMA 3GZKA 3RI5K 1P6AB 5B8CB 1NMCB 1A5FL 1ERNA 1RU9H 4I18B 1FZJB 2ILLA 5L2JB 3PIQA 5HPMA 3WO3B 2W0FA 1XF2A 5IFJA 5IFAL 4KK5D 5GGRB 1S9YB 3WN5A 1MVUA 4JQXA 1ADQH 1T83A 5T5NF 4X9HA 2VDQH 2PCPB 1CT8B 3EFDH 3EZ8A 3UPAA 4H88L 3RWFB 1TETL 3V5DB 4PGJA 4JQVC 2FHBA 2I60H 2IH3A 4R96A 1XF1A 3O2WH 2WBWB 1BZ9B 4N9OB 3BPCB 4I77L 3RBGA 4OLWH 5FXCH 3MJGX 1MLBA 3C5SA 1K6QL 4NO5B 4HIHA 1L9MA 3VFPA 3KYKL 4LMQE 4TSAL 4AYFA 5BO1H 1R3LA 4WDIA 1SHMA 1MNUH 1I8MA 3AY4A 1OTSD 5EU4A 1AD0A 5BOPA 3S35L 3FO0H 4WY7H 5FKPB 1R3KB 3REVA 3MUGA 1QNZL 1QSFD 2F19H 4GQ9L 5ACZA 1HIMH 5EZIH 2FL5A 2V2WA 2DQUH 2VDML 2PTUA 4PB9L 1CD0A 4LLWB 3QZWB 1A6AA 4NKMB 3ZE0F 1LE5A 4PLJC 2B0SL 2DLTA 1O0VA 3LQZB 4XC3H 3ZZ1A 1QFWM 3QG6A 9CGTA 1ROWA 1MWAA 3SDCB 3GI8H 5DTFB 1RUML 3I50H 3QZWG 4JZOB 2VABB 1QTYT 5T3XL 4X80H 2IBZX 4RX4D 2DI8A 4QYOA 4KC3B 3WFEH 3KYOB 3K2UH 1BGXH 1B0RA 2BMKB 4MZ2A 1OTUD 2AVGA 2Y23A 5EOCJ 4Z18A 5I1LA 4HS3A 4XNUL 1Q9OA 2J5LC 1DQLH 3MC0A 4NKOA 3RL2B 4ZO9A 3VJ6A 4KVNH 5EA0H 4YHZH 4TQEH 5D9SA 4NKIL 4YK4B 1IQWH 3OKLA 5AWNL 5IJKC 1MRDL 3VFUB 3QUMH 5DD1L 2A74B 1OHQA 3UC0L 1QR1A 1JPFB 4NRZB 2Q86A 2HJKB 2PKDA 4JFPA 4BJLA 2PW1B 1INEL 1ZHNA 1RFDH 1TENA 1QFHA 1A47A 2QKIA 2XTJD 4AT6A 1DR9A 3GHBH 3GBLA 3R8QA 2FSEB 1G7QA 4EIGB 5TF1L 2H2PD 2OP4L 3MODL 5H2BB 2IAND 2QV2A 3GSQA 1XIWB 4PV9B 4RFOL 3DMMB 2VZTA 3VD9A 3MZTA 5C0AE 4B41A 1X6NA 3GKZA 3TFKC 2AJYH 3QQ4A 3H6JA 2XZAH 1JUFB 5FA4B 3L5IA 3HB3C 1OD7A 5DQJB 3FB6B 4GXUM 2W0KA 5FO7A 3RNQB 1RPQA 3H8NA 5E99H 1HINH 3ARTA 5BVJB 1CXLA 2RGSA 4ODHL 1U3HC 5ABDE 3SE3A 1AHWB 4OFIA 5DC0A 5D5MF 3CMOL 4WJ5B 2MHAB 1XR9A 4S2SB 3S35X 2DJSA 2UZXB 4HPYL 3QO1B 5CGMA 4R7DB 3C8KB 4XPFH 4MQSB 3MLRL 2ID5A 3BZFA 3QDGA 4IHOB 5ENWA 5GS1B 3I75B 4KI1A 3FONB 3QSKB 5D7LB 4FQLH 5L7XH 5AD0B 4NCDA 1ORQB 3RTQB 3V9FA 1PYWA 1BFOB 5B8CC 4IRJA 5ESAA 4F7EB 1FE8H 4P2QD 1YN7A 3QIBB 1ZWIA 2D7QA 3FFDA 5ILTL 4QLRA 5FYKE 3EDEA 4ZFGL 1DQQA 3L9RA 3EGSA 4FTVB 4PRAA 2B1HH 4HS8L 1RZKL 4X7SH 3LKRA 3SJVA 1LEIA 4MJ5B 4NUJA 4P5KA 5JMRA 1A1NB 4PJDE 4A2MA 5I1KL 5EC1B 2K3TA 1NFIA 4NIKB 1QFUL 4M1DL 3BP6A 2B2XH 3RUGE 3MGAA 1EVUA 1IAKB 4UV7H 1A9BA 4CADA 1J88A 2VXTL 4ZFOB 4L3EE 3TO4D 1S3KH 5J13B 4LIQE 2BP3A 1KXVC 3QXDA 4NT6B 3WNMA 2IFFH 3SQOH 3D3VD 3AM8A 2X1PA 4Z9KB 3M45A 5I15L 3E6HA 2E27L 3LKNB 1G7MB 5CLTA 3F7PC 5F9DC 3NN8B 5A40E 1CLOH 4ODTH 1YNLH 2WUCL 2XT1B 3P0VL 4ZFGH 4PBVC 4RMQA 4DKFL 3KG5A 1NANH 4R2GD 5C0DA 4N0FA 4KKLC 2HT2C 1H5BA 3ZTJG 1GGBL 1WAAF 1CLZH 2VISA 2B7DT 2XN9A 2HLAB 4QRTB 5ADPL 4E41A 5MEQA 3TO2B 1JNHA 1QFUH 5E6IB 3G6JF 5HHNB 1FQ9C 2YUVA 5DJ8A 3C5ZB 2X42A 1B9ZA 4HWNA 5KTEH 2AI0L 2ZCKL 5K33A 3L7EA 4JFHD 1X4YA 1FJ1B 2AXHA 1A8JH 4X5LA 4PRPE 2XFXA 1MF2H 2HMIC 3GIZH 4M6ML 4XWGL 2AK4E 3FMGH 4DUWA 4QHMB 5DJXA 4ELME 2XRAH 1Q94A 4JDZB 2VN4A 1JRHH 1GHFH 2DM4A 1ORSA 1S9WA 1YNKL 1T20B 2WUCH 3P0VH 4TPRL 4MCYA 2VDRH 5EN2B 4G80B 5HYJD 4M9OA 5JPNA 5HTSA 3G5YB 3QXTA 4XI5D 3EFFB 4I5BB 5TE7H 3VXNB 3ULUD 5HHXH 1RUPL 1H3VA 1UZ8B 3O6FA 1KTDA 1KN4L 3VW3H 1R5VB 2IGFH 5L2KA 3U0WH 5EU6B 4XPHH 3STBA 1DVFA 4HJJH 2P48B 1R5WB 3LN5B 3RWJB 5CZVL 1IM9B 3OZ9H 3FFCE 2OS7A 5CMAB 4PJGB 4MAUH 4OLUH 3TBWB 3X11A 4O4YH 4X7TB 1IC7H 2CLRA 3NIDF 5A2LH 1V7ML 3BZEA 2ZCHH 4JPKL 4LSQH 3QISA 1WJ3A 4OAWA 4YNYB 3HPJA 2W92A 4XVJH 1JPTL 4ZOBA 4JPWH 1I7RB 3NTCL 3S3SA 5IV2A 1OTTD 4LOUC 4LSSL 4M3JA 1TJHH 1NCWH 3O6MH 3EOTL 5HY9A 5E5RB 2QR0A 2E8YA 3GMLB 2FJGA 2VIRB 4YC2C 3VGDA 3OKOA 2ADFL 1RHHA 1YYMH 4GW4B 4EOWH 3HS0B 5FCUH 1OGTB 4KRPD 1NUDA 1S9VB 3MLWL 5IW6A 1M05A 4GSDH 2QLVB 3L5WB 2A6JA 3D48R 4PLNC 3U1SL 4Y19B 2FX8L 3DX8B 5L88H 2GEEA 5TGBA 3QI9C 1TZIA 5C7XH 5JOPD 3SGJC 3QEQE 4UBDD 2Q8BH 3W9DB 3EOYG 1XMWA 1JYNA 4PD4K 1ZGLB 4ZUVA 2CLZB 3MFGB 2XWJA 1CLYH 2GQHA 1T0PB 2DQJL 4G8GA 3HE6D 3QNXB 3WS3B 1UGNA 3HC0A 2FEEL 4P9HH 4KMTL 4JVPA 4J1UA 3Q6GL 1TQBC 2VXQH 2YKLL 3T0VA 4FQHB 1AJ7L 5E8PA 1RIHH 3RWCB 1L0XA 2EH8H 1E4WL 3MNWA 1RUKL 4Z7UF 1IZJA 3MRNA 5DJ0A 1F11A 1KJ2L 4LLAA 5IKCA 4DGIL 3DYMA 4K3EL 4KDWA 1NQBA 2JCCA 1CFBA 5JPMB 4RMTA 3O9WC 2X9YA 2DQEH 4EUPB 5IB5A 1S78D 1ZXQA 5EZLA 4R9HA 5I1AB 2VXVL 4M7LH 3LB6C 1FL3B 4MQ7A 2A6DB 1WTLA 2CH8A 1CICD 4GS7B 3OAZH 5JHDE 3O3EA 4FP8H 2MCPH 4OCNC 1NFDF 5KSAC 1MJUH 4X6DF 3MJ7A 1C5CL 3OGCA 4C55A 1FC1A 1PZ5B 3MRFA 2DM2A 4JFDA 3D0LA 2RQ8A 5FB8B 1K85A 1XF5B 2GJJA 4B7IA 4D8PA 1S5IH 1WVZA 5K9KB 5HDBE 4AEFA 1J8HE 4JRYE 4ZG1A 3OB0H 3FTGA 1Y6MR 4JGMA 2HTLC 1TMCB 5DVMA 2AJ3B 5FYLL 1MLCA 4IOSD 4M03A 1HHIA 2DQHL 3EZJB 3HMWL 7FABH 2OMBA 1N6QH 1OSPH 1DZBA 2V5SA 2Y7QA 4ZXBD 5EU3A 3SO3B 3BAEH 4UQ3A 3L3OA 5LXGL 1Q0YL 4QEGA 4LSVL 3VFSB 4L8BB 3MRLB 1T1YB 1AQDA 2J8UF 2X4NA 1V3LA 2BVYA 3CX2A 5L6YL 4KVCH 3NBNA 4IIQB 1ND0A 4FQCL 4P2OA 5HPOA 1H3TA 2W59A 4HDIB 3LRSA 4Y88A 3T4AB 1RK1A 1H15B 2I9LB 4M93B 3V0VB 4U1NB 4PIRF 4BZ1H 5E8NB 5T1MB 3B43A 2MPAH 2I07A 3BKML 3IT8D 4PG2C 4G9FB 5ELIA 4DEPB 5IIEA 3PWVA 4QHKJ 4YBLC 4RQQA 4WNQB 1BEYH 4LKXB 4RAVB 2R0LH 2DQHH 5KAQF 2VZUA 2AXGA 1OAXL 4N5ED 5E70A 3FHAA 3TYFB 4P48A 3DUHA 1RIUL 5B8CA 3L1OL 4XXDB 4I18A 1FZJA 5L2JA 2ZUUA 2XYCA 2RAMA 3U6RB 1A6UH 5E00B 1DE4B 5GGRA 1N3NB 1DL7H 1SJXA 5MHSD 1CZ8L 1S9YA 5JA8B 3CZFB 3MOAH 1FBIH 2GKIA 5IHZB 3BESR 2PCPA 1CT8A 5GS0H 1EEUA 3QPQC 3AS2A 1G6RL 3RWFA 5GGUB 2NY4D 3V5DA 3KJ6L 3WNKA 5DUPL 3EYUH 2QQKL 3EJZD 4AMKH 1DLFH 1C7SA 4HC1H 2F15A 2IMMA 5GGQL 1BZ9A 5C0IB 3O4LD 4BSWB 3BPCA 5TJWK 1U3YA 3ARFC 3OL2A 5IB4B 2E7BA 5D70H 1VENA 4PJDF 1X5XA 4U6YB 5DHVH 1IZKA 1RAMA 4NO5A 1N7ML 4JM4H 4JPVH 1TJGL 4U1IB 1FAKT 1XGYH 3L1OH 1CGXA 4LCIL 3RUGF 3S97C 3M17B 1E27B 1QSEB 4K9EC 3SOBH 3N85L 1OF2B 1CZ8H 3T0AA 5FKPA 1R3KA 3WLWC 5FCSH 5C07B 4HWEL 2IQ9L 3OR7B 3HI1B 3EYOB 5J9PB 1BJ1J 3O8XB 4M5ZL 3OG4B 5GJSH 3MBED 1CD1B 4NCC2 2NZ9D 3AU1B 3QWQB 3QUXC 4LLWA 4V2CB 3QZWA 3MRHB 1SY6A 4NKMA 3WIFB 1GOGA 5C0NC 4LCYB 2OL3L 2MQ0A 3ZE1F 4S0SD 4LHQB 4MSWB 3UAJC 4QOKE 3LQZA 4MJIB 1MCRA 4LPTA 4UAOC 3QRGL 1UM5H 5B22A 4WFGD 1HCVA 1Z0MA 4M1CC 4LVHB 3SDCA 3NCMA 4OCSL 1UACH 4QF1B 4JZOA 4M48L 2VABA 4DWHA 4PJ7B 3ILQD 1Q0XH 2PYEB 5CEZD 4DN4H 4M7ZB 1FYTD 3KYOA 2KKQA 2BMKA 2NX5B 4XVTL 4ELMF 3RL2A 2XN9D 1MHPL 2F53D 1UH3A 3VGHA 4E41D 1ZV5A 4OLVL 3X12B 3VFUA 3AC0A 2A74A 3EDKA 2JKXA 5E08H 1JPFA 3MLVL 4NRZA 1FFOB 2YR3A 2W60B 2HJKA 3F12B 2NXZC 2PW1A 4MAYC 1MCOL 2J8OA 3GFUA 2FSEA 3KHOA 2P44B 5CLWA 4M7LT 3TVMC 4QXGH 4YFLF 1J0KA 2VL5B 3QJFB 5H2BA 4MJ6B 2WWMC 1XIWA 4PV9A 3DMMA 1MHHA 1KELL 4WHYG 3ZDYF 1MCQA 4HBQA 2CGRL 2FZ3B 4FQPA 3SO3C 4FQJL 1JUFA 5FA4A 5T5FH 3QDME 2WW8A 5DQJA 2PO6B 3O6FD 3FB6A 3V8CA 5L2KD 3RNQA 4WI4A 5BVJA 1PJ9A 2OSLB 2CXGA 1AHWA 2J88H 5MEOB 4WUUB 3QI9A 4WJ5A 4P2RE 3UX9B 2MHAA 2UUDH 4S2SA 3N9GH 4JZJB 4OLYH 3QO1A 3EBAA 3ULSB 4DEPC 4R7DA 3C8KA 1IKNA 4DUVA 3B9KB 1GGCH 2KZ1B 1KIQB 4K3DL 4PJ7E 5JUEL 5JIIA 4TTGA 5C08B 3QHFL 3B83A 5GS1A 3I75A 2VDNL 5D7LA 3FONA 5F71A 1NEZB 2AKRB 5AD0A 1ORQA 3RTQA 1BFOA 2EDWA 1Q9LB 3P3YA 5EORL 4F7EA 3HNTH 3BISA 3I02B 1PGRB 3QIBA 1YEEL 1JFQH 4GUPB 1NPUA 4FTVA 4Z7VE 5F7WC 4N1EA 1EUUA 2GSIB 1NEZG 4Q74A 3QEUB 4FA8A 1VEOA 2A6IB 3QXAB 1JI1A 1KPUB 3S37L 4KAQH 3BSZL 4QO1A 2BY1A 3O6LH 5DJAB 1C5BH 3S98A 5F7MC 4JHZA 2HVKA 1P5UA 1IAKA 4ZAKB 3WIHA 4O02L 4AJ0A 1BQLH 1CDHA 2X1WL 5DFWH 4L4VE 5GSRB 3W39A 4NT6A 1UM6L 1TVBB 3DOSA 4GJTB 3LKNA 2HP4A 3PWNB 3NN8A 1SM3L 4RBPH 1D5ZB 1S9XB 4LCUB 1FCGA 3CFDB 2CRIA 1P53A 4JY6B 2R2BB 4NFCA 4PLJD 4LFHG 1HILB 4Q6IB 2BNRB 3DVFA 3D39D 5JIPA 2APVA 2HLAA 4QRTA 5CEXB 3TO2A 2I27N 3BZ4B 4UTBH 2QHLA 4Y1AD 5E6IA 4YGAB 4K3JL 4U1GC 2YUXA 5HHNA 3T3PE 3N1MC 2XWBB 1UB6B 3C5ZA 4C58B 1IGIH 3MV8B 4AEEA 4TNVK 1IFHL 5HDBF 1FJ1A 4S1RL 4BK4A 5E9DB 5LJYH 1RVFL 1N6VA 3OBAA 5IVXE 4KGJA 3DETC 3G5ZB 4QHMA 1AGCB 5I73B 1NH6A 3T04D 4JDZA 4YGVB 5JTWA 1E6OL 3ME0A 4WHDA 4LGSB 3CVHH 1T20A 3JZ7A 4QRPB 5C0BE 1MJ7H 3DI2B 4H8WH 3TIEB 1DQDL 2D7MA 4MXWH 2AP2A 3HZMB 2JJUA 5EN2A 4GQPH 3G5YA 2NY2C 5F9OL 3EFFA 4I5BA 3VXNA 5D5MB 2FX7H 3F58H 4GO6B 1IKFL 1UZ8A 1RULH 5D1XC 3V6FB 3C6SB 1R5VA 2B4CC 1LP9E 5EU6A 3BDBA 1QRNE 1R5WA 4OD3L 3RWJA 1IM9A 4RMSA 35C8L 5F1OB 5D96B 5CMAA 3WKNA 4PJGA 2IFGA 3VXRE 4X99B 4PJAB 3TBWA 1A6WL 1MAKA 4DOHB 5DK0B 1JNNH 2XTLA 4YNYA 5ESVB 1KJMB 3ESVF 4R0LC 3SCMC 1IC4L 2EDQA 5E5UB 4AM0B 2BXZA 3HB3D 1I7RA 2OBGA 2X4QB 1U6AL 1INDH 3S37X 1I3UA 2VKWA 3SGDI 1MRCL 4JFFB 1EHNA 1U3HD 4ESKA 3QQ3B 2DICA 1WZMA 1Z9SA 3GMLA 2DLFH 5C0FB 4KI5E 2VIRA 3K2MC 4WUKL 4GW4A 3HS0A 3QUYB 1J8KA 1OGTA 1S9VA 1C12B 3DSFH 4G6KH 3L5WA 3H9SB 4XCCH 4YHKL 3GJFK 1GJIA 5I74B 2E9IA 4CL7A 4LHUB 4Y19A 4BSJA 4OZHF 5I6XB 1FC2D 4MNQB 5D2LE 4O2EB 3W9DA 1NGQH 4XP1H 4ODUB 4WV1C 4JZJC 1I1RA 4YDVB 5DJZA 1ZGLA 3UJIL 2CLZA