4WV1C

Crystal structure of the fgfr2 d2 domain in complex with fab 2b.1.3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
98
structure length
98
Chain Sequence
PYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redesigning a Monospecific Anti-FGFR3 Antibody to Add Selectivity for FGFR2 and Expand Antitumor Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/immune system
molecule keywords Fibroblast growth factor receptor 2
total genus 17
structure length 98
sequence length 98
chains with identical sequence F
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wv1C00
2VN7A 4PYGA 4OCRH 1QO3A 5J12B 4ZUWA 1L0QA 4P2RA 4UNUA 2IQAA 4CN6A 3VFPB 1UXSB 4J4PA 4IMLA 1HIMH 2YD7A 4HCRH 3GM8A 4GMSH 4QT5B 1ZT4A 2ERJC 4RAVB 5GGTH 4NM4L 4OI8A 1F00I 2X1WL 3C5ZA 2YA0A 4OLVL 5AYQA 1MRCH 3P0YL 2P43B 3TGXA 3P4LA 4YLQT 1R3IL 3VXNA 1F02I 5EO1B 2AV1A 4MAYA 5F96H 5C0CB 2IPKB 2DQTH 1S5HA 4R26H 2XTLA 3P4NB 4WEUD 3THMH 1GXEA 2CUIA 5B3JE 4WW2C 3BRFA 2YC1A 3VWKB 2V5MA 4JRXB 3DO7A 1IE5A 1HINH 3SOBH 4FFVC 5E08L 1D5IL 1AJ7H 5GS1A 1TJHL 1MI5D 3TESA 5HGDA 5ANME 4HWBL 4QRPB 3WXWL 4OZFH 3V4UH 3TBYB 3D0VA 1I1YB 5GGTA 2PO6B 5SWSA 3S7GA 1KCRH 3S4SG 2MMXA 4KRMB 4X9IA 1J0IA 3S36X 4I3RL 4P23D 1XR9A 2R4SH 4LVNC 4XC3L 5T1MA 3NN8B 3QXDB 1A7QL 4RFNB 2R29L 3MRMA 3QIBA 3MODL 4JFDE 1U8JA 5B8CC 1DBBL 4ZODA 2YUXA 1FVDA 2JIXB 1YUHB 1AIFA 5J4MA 1WWWX 5B22A 4G6ML 4FTVB 3GMPB 3N9GH 5AAMA 5BQ7B 3V8CA 3BYTA 4EUPG 1ERNA 4OCRL 3ELAT 3UEZA 2XY1A 1ZT7A 2R1XA 5EOCJ 4JHAL 2FECL 2Q6WB 3P9WB 3IYLW 1XF3B 4GKZB 4NNYA 4Z7WA 1NCCL 1IC5H 1ADQH 1URLA 4LPUA 5JXAL 4CJ1A 3U79A 4KK5C 4XVJL 4NQDD 2VAAA 3NCJL 2QTEA 4ONOA 2K1MA 5IUSA 1HH9B 4YGVB 5IEKA 4R96B 5I76A 4M00A 1I9RH 1JRHI 2BC4A 5E5UB 1GCFA 1Q0XH 3C6SB 3GK8H 3WYRA 1P4LA 2CLRB 5JHDD 4FQXD 4LDEB 4NCC2 3IDMA 1C16A 1UA6L 5F7WC 4F8TA 2Z91B 3NAAH 1W0WB 1FIGL 5I1GL 2H9GA 3DGCR 4P4KC 2OXGA 2BK8A 4R97C 3AM8A 3BN9C 1MUJB 1U41A 3G6JA 3G04B 4K23H 3BKCL 4NPYB 4L3CA 4YHNA 3U4EA 3VWKC 1ONQA 3O11A 3FB7B 4J6RL 1P69B 1ZE3C 4BFIB 4GRLC 4LLMB 4XBGB 2P42B 4FQ2L 4OCSL 5GRVK 5BVPH 4LAQH 4P2QA 5D7SL 4DVBA 4PLJC 4I3RH 2P5ED 4G6AD 4QXUH 5CP3H 4K3HA 2NY0C 3H9ZA 4PTTB 3RDTA 1EZVY 3W5NA 2NY3D 1WCBA 3QUZB 4MA8H 2ARJQ 3RUGB 4Z7WB 3S35H 1OQOA 4YFEA 1ZXQA 4ZXBD 5LGJA 4U6YB 4TUKL 2FDBP 1EO8H 2BNUA 2X40A 3UJJL 5FO7A 2YBRA 2EDFA 1IC7H 2AXHA 4HG4J 4PY7B 1BVKA 4F7PB 4R2GD 4GW5A 3RWFA 3TO4A 4AEHH 4CVWA 2EKSB 4MD0A 2H8PB 2CUHA 2VQTA 4Q6YA 5GJTL 4NQDA 3HNSH 3QXDA 2XYCA 3PWPE 3T0BA 1UH4A 5JUEL 1IBGL 1H5BB 4FXKB 1T2QH 2Y06L 4I0PA 4XRCA 3V6ZB 2GCYB 2NXYB 4FQXA 2W91A 1A6TA 4XPTH 3H3PH 3CLFH 5SWSE 2Y36H 2PXYA 3UTSB 4O58L 2F54B 3NAAL 3HMXA 3I75B 3MA9L 3GUTA 1JL8A 3DVIA 4YIQA 2ENYA 2CSPA 5CD3A 4QHUA 1AGBB 1A1OA 3I6GB 5GS1B 1SYSB 4PJ8B 5BMFH 4YAQA 4EQ2A 4LSSH 1A5FH 4NJAH 1VFOA 3O2DL 3D2UB 2QSCL 1MCCA 2YC1B 2KQMA 4GAFB 4DEPC 1R24A 4M5YH 2Y7QB 1Q72H 4FNLH 4K2UH 3LKNA 2ADGB 4HCRA 4XBEH 4TYUA 4HIEA 4Z7QE 4NQEA 1NCCH 5DRWB 4F9LC 4PJ5D 4OCYL 3TO2A 3VA6A 2IH1B 2CKBH 4GRWF 3IKKA 2I9LB 4RMTA 4WNQB 3EKCA 3QUMB 5E08H 3O6FA 4P2RD 2DQGL 3OZ9L 2DMCA 1AHWA 1KTKE 5JIPA 3ZT5A 5FUOH 2V7NB 1FG9C 4OB5H 4GG8B 3LD8C 3G5XB 1DBJH 3LCYA 3HC4L 4LLWA 3NIDF 4XVTL 3EOAA 3BESR 1ZMYA 4KU1A 1J18A 1QBAA 1UB6A 4GXVH 3QSKB 3O4LA 1LEKB 3Q48A 4R96A 5I76B 1N0XL 3VJ6B 3MGOA 4XPAL 5DC4B 1IEAB 3HE7C 4HDIA 4WCYH 1QLFA 2QL1A 1R5IB 5GS0D 4PGCB 4C56B 4OB5L 3KPRE 4ZFOA 4TTGA 3G9VA 4ODSH 3SDXF 5FOBB 4HQQH 3KPSA 3DUUA 2PXYD 3GJEA 2YPLE 4XPTL 5DJCB 1OGAD 3IFLH 2HP4A 4QRSB 3NIGE 4HLJA 4HWEH 4P0DA 3HUJE 1YC8A 4MNQB 2F5BH 2IPUK 3LS4H 4KJWD 1U3ZA 2G5BB 5FO9B 1R6VA 5TFSH 1NGYA 3O2DH 5E8NB 5IQ9A 5FECA 2JB5L 2VR5A 4PLJD 2FSEB 4QRQA 3I50H 4S1DC 2P44B 3LAFA 3K4AA 1HHIB 1UM4L 3QIBD 4PV9B 4U1LB 5T1MB 3GSRB 3WMSA 4ZFGL 3STLA 3L3DA 4X7FC 5J9PB 2M8XA 4UQ2B 3EHBC 2V17L 4EUPA 3TO2B 3ZHKA 5J6GA 5D6CA 5B4MD 1YNLH 1Z9OA 4OUUB 3MV7B 1EPFA 4FQIH 2PR4H 4YDJA 5GHWL 1J0HA 4OLZL 5IESL 4GAGL 5E1AB 2V2XA 4I8DA 4S1RL 3OJDA 3RWIA 1YPZE 1FFOB 3MO1B 1ZA3A 5C71A 3AROA 3MUZ1 3BPNC 4FQCL 4E42A 4MNQE 2BSRA 3IFPB 3ILPA 4TSBH 2JJTA 3WIIH 2YWYA 4J7RA 4P9ML 4XWGL 1U8PB 4MAYB 1RUKL 4S2SB 5GISL 3OKMB 2FCBA 2R4RL 5KSAA 4N68A 3OL2A 3FO9A 5GGVH 1LNUB 1RMFH 1P6AB 4D2NA 4I0PB 3T4AA 4BQ8A 2XZCH 1I3GL 1V7MH 5FM5M 4OCLC 4N0FA 4NRZA 3LQAH 1NMCB 1CYGA 3UZVB 1TZGH 5C8JA 3SDCA 4EIGB 4GRMA 1NFDA 1KGCD 3TT1L 4XP1H 3VMNA 5GISH 1I85C 5C2BH 1G9ML 5IGXL 3MRKB 3VXTB 2O5XL 3V6BR 2F53B 2DQTL 3THML 4JO4L 3MLYL 4UT9L 2Z92A 2F5BL 5F7DA 4TOYL 4BUGA 5F3BB 5ALCH 5GGUA 4JZOB 2COQA 5D7JA 5ICYA 4JO2H 1T7XA 3MV8D 3FONB 4R7DA 3P9LA 4YBLC 1PY4A 5ITBL 1YYML 3FO0H 3PP4H 5JOPD 4Z9KB 3C09C 4OZ4B 4S1DD 5JO5A 3VG9B 2YOCA 4PTTA 2G60H 1XGPB 4QWWD 5BW7A 2DTML 4LHQB 5AUMB 4MMZC 5EORL 4PJDA 3MLVL 4YHIA 3RNQB 3CNKA 5GSVA 5F9OH 5DK0B 1S9VB 2BCKB 3AS2A 5ECJE 2EXWC 3H42L 1JK8B 1BPVA 3GI8L 5KANI 3EYUL 1W0VA 2NNAA 4JDVB 4E0RA 4GRWH 3MNWA 3D18B 1U2HA 5D1QD 3IVKA 1BX2B 3PIQB 3TBVB 3U2SB 3QO1A 5GS1C 3A67H 3RY4A 2BY1A 5GS0C 1U6AL 5C07B 5T3XE 2R69L 5EZIH 5KSVB 5GGVL 5J13C 4RMSA 1FN4B 1UM5H 2IH3B 1I9EA 4V1DD 3SDCD 2AJ3B 4JFPB 2IGFH 1ZS8B 4JVWA 1EHXA 5CMAB 1OW0C 4BFEA 2GITA 4MJ6B 2E7LC 3S5LG 1HE7A 2R4SL 4LGSB 1OF2B 5IESH 4PBWD 5GRWA 2CMRL 2CPCA 5EC1B 4Q9BA 1I1FA 4X98B 4AY0A 4S1RH 5IEHB 3HCVA 1U8MB 2DICA 3MGAA 1W2KT 1C5CL 4OZGB 1F4WL 3R06A 2GJ6A 2V9RA 4PRAB 5DUMH 1A64A 3G5ZB 4H5SB 2A9NH 3GO1L 1MFDL 1MH5A 4Y5YA 4FABL 2QQNL 2CLZA 3ZSSA 3LD8B 1AO7D 1BD2D 2HH0L 3MV11 3UPAA 3VFSA 1IGFH 2Z4QA 3G08A 3HC0B 1KIQA 1I1YA 4IOIB 3FT2B 1XCTA 4Y0GA 4XP6H 3W81A 3J7HA 5DGQA 3BVNA 4JFXB 3L3HA 1S7UA 5LBSL 2Q3ZA 2C3GA 3DV6A 4Z77B 4AL8H 4ZFFB 5ISZB 5DDHB 3MRFA 3PJSB 1S7SB 4GBXA 1NQBA 1C1EH 1XFPA 3HE6C 2HKFH 4X6CA 2EEAA 2R56L 4BQ6A 1IGYA 2UVEA 1JGEA 2MFNA 2ZG2A 1OP3K 4Y88A 1T4KB 3QUYD 1JTTA 4N5UA 1PG7L 1RPQA 2IFFL 4FXGA 4FG6C 3VFVB 2VTFA 5JPNA 2JB6A 4HS6B 4MAUH 4QHNB 4YDVB 5E2UL 2XQYK 2BY3A 2X4OB 2WM0A 1XIWB 5IF0A 3DUSA 4OZIB 1ZLVK 2VLJA 2OL3H 2FX9H 2QQQA 1TJHH 5FA4A 5F89A 3F58H 5EIIB 3L3IB 1NLBL 5KZCB 1D6EA 4HWBH 5ADOL 1MQKL 4OKVB 4IRSD 4LCUA 3MRBB 3S35L 1FIEA 1JJUA 2HFGH 5JLZA 3GSNA 2AI0H 5E2VL 2QV2A 4OUUA 2BHZA 3CDFA 3CC5B 3FO2B 5IV2B 3WNPA 1U2CA 4RAUA 4ZUUA 4UTAH 2DN7A 2R0WH 3I85A 1Q72L 1Q9OB 5F88B 2XZQL 2ARJA 4EN3A 3FAXA 3QFJA 1HIML 4GMSL 2GJZA 1Q1JL 2ID5A 1K8IA 1SHMA 4FMKA 3IRZA 3L7FA 3TM6A 5HVHB 2VDLL 1W0VB 4JDVA 4E0RB 4LLQB 1MCOL 1YA5A 4QCIA 3VI4F 1XCQB 1GGBH 4GUPB 1CL7H 2HN7B 1E4WH 1K2DB 2EDEA 1X44A 1S7VA 2Y36L 2YPLA 4JAMB 5D5MB 1SM3L 2C1PB 3FFCA 4WU7A 3T0WA 1VADA 2IC2A 4JQIL 4LBEA 5IIEB 4FOMA 5D7IF 5E8DH 2YPVL 3TN0A 1MFBL 4GRLB 3L95B 2A83B 4JREB 4F7CB 4M43L 5FUZH 5DRXB 4WFFE 1N59A 5T1DH 2HMID 4NQSA 4M5YL 5K93A 4N90D 1J1PL 3KYNA 2G2RB 4FABH 3WLBB 4JG0L 4G8EB 3X14A 1T83C 3RQ3A 3K74B 5I8CA 3WNOA 4P9HH 4KI5F 4GQ9H 4J3TA 3GB7A 3NA9L 3PNWA 4ZUTB 2HVJB 5ADOH 1NAKH 3RY6A 4ZTOL 4YX2H 5T5FH 4YEFA 5GRJL 3VGFA 3RKPA 1MELA 4I3GA 1I1RA 4F8QA 3CCHA 3VI3F 4DKFL 2WUBH 1H8SA 3V52L 1Y6NR 4LHUA 4QXUL 2F5AH 5IWLC 1DBJL 3CZJA 1VENA 5HYSG 1CL7I 5BRZA 2ADIB 2FJHB 5D2NA 5DMKA 1WBZA 5GRJH 4JZJC 1OAKH 1FZMB 2AP2A 2YXFA 4KKBD 4UV7L 1EERB 4RGOH 1N5AB 4ELKB 4O02H 4H0GA 5CILL 1UWGH 2PTTA 2NY2B 1DTUA 4X8JB 2CR3A 3J8F7 4S1SL 2JCCE 4K9EH 1QRNB 1JHLL 3B9KA 2AGJL 3GSUA 3IFOB 1S9YB 3O2WH 5L8KB 3L5XH 2Y5EA 1A9EB 5DRZA 1DBKH 4FXGB 1EEQA 1U3HB 1EDQA 5TQ0L 1DEEA 2VOTA 5TQ2L 3RWCA 2ZUUA 1UVQA 3CSPA 1NUGA 3VGDA 1MNUL 3QDJB 5M7QA 2C1OA 1S78C 4WUUE 4LCYB 3TIEA 3O6FC 4ISVB 3DX9A 5DGRA 3QT2A 4P5TD 3QG6B 4QRSA 5DMGC 5FGCE 5K9KA 4NHCH 3DOSA 3FQXA 3QIWD 5JDSB 4PD4J 2D4DA 2M1KA 4M7LL 3T0AA 2RIKA 4Y5XB 2DQUH 3ZKMD 3ZTNL 5HHQA 3TA3C 5C09E 3OHXB 4Q58C 1N4XH 3O4LB 2AK4B 3LEXA 3HE7A 1YEHL 2VSCA 3SDCC 1SEQL 4LLAA 5BRZD 2D9CA 2WV3A 4HJ0D 4UINL 4KRLB 2VL5B 5EU6A 3TH3T 2CK0L 4YHKH 4OLEA 1I1CA 3G5XA 4S0TD 3VH8G 1NUNB 1FO0B 1P5UA 3F58L 3MV7E 4X6DF 1AHWB 4XVSL 3TFKC 4R90L 5IT2H 5D7JC 4UUJB 1F42A 5D7IA 4ODWB 4FA8A 2ESVB 1JGVL 3IDMB 5MEPB 4PS4L 3PGCB 4LLVB 4L4VD 5DFVD 4EDWH 1W8NA 4OIIH 2P5WA 3E3QC 1JZ4A 3I2CL 3QEUB 3FB5B 5T3ZE 5HSFA 1DN2A 2XN9E 1W8OA 5IEKB 3INUH 1UJ3A 3MLRL 3HUJB 3NFNA 2BRRH 3HR5B 2LVEA 3GMRA 4K3GA 2XFXA 2PW2A 4WHYH 5IMOB 5GJSL 2J8OA 3GSWB 1SYSA 5ITBH 3OAYK 4G5ZH 1Z9SA 4AT6B 4QTIH 3UPCA 5L2KD 1UKQA 5CSZA 3RY6C 2ZCHH 3P30H 4PRDA 3U9PH 4WW1B 4G9FD 1FRGH 3LEYL 4GW4A 5C0AE 4NOBA 1P7HL 5IMLA 4NHUB 2PNDA 3VFTB 4MWFA 3G6AA 3GKWL 3L5WB 4YHYB 3IDYC 3BP5B 1A8JH 5F7EH 1PFCA 4AENB 2VLKD 2C3VB 2H3NA 4TNWK 3CMOH 3BJ91 4K3DL 4JN2B 2IADA 4GW5B 3ARPA 2J3SA 2R23A 4JFZH 4PBXA 5DUML 4MQXD 5EU6D 1OCWL 4GAGH 1LE9B 5IBUB 3RX7A 5ACLA 1N26A 2PYEB 5CEXB 1X5HA 2BNQD 2GEEA 1X5GA 2AERT 4MA8L 4PRHD 1GC1H 1WIPA 5IW1A 3PWJB 5JIKA 5SX4H 4OAWB 4PJIA 3E0GA 5ID1B 5JMOC 4CJ0A 4DKFH 4EVNA 2P7TB 1HCVA 4Y4KC 3LN5A 1BBDL 2IAMD 3AREA 5HGHA 1H3PL 4Q9RL 3C5ZB 1QQDA 1XGYH 3KXFA 4PFEA 43C9B 2HRLA 1AJ7L 4K8RC 3QDMA 2NY5L 3UTSD 1NUDA 1U8MA 4AT6A 4GXUN 3N85L 2WIIA 3F7YB 4WI9A 1O7SA 4Z8FH 4EI6A 4JPKH 1X9QA 2XKSA 4J3SA 3ZHDA 5CMAA 2VJXA 3G6JE 4OV6F 4O5LH 4OIBA 4M1CC 3FQTB 1F2QA 2V2XB 1CDGA 1JPSL 1HH9A 3O6LH 3MV7A 5T1LA 5FGSA 1PGRB 4JY5H 4YHLH 4ZFZA 1YJDC 5KSVA 3JV6B 2XTJB 1OPGL 4J1UA 2VDRH 2EDLA 4DCQB 2F58H 3GSVA 5C0EB 4Z7WE 2P48B 1G7IA 1HKLH 2BRRL 4LVHB 4UIMA 3F5WA 3MLTA 5FO9A 2NX5B 5F7MC 4LPYA 1MCLA 4MDJB 4NKIL 4M03A 3QZWB 4JRYA 4FFVD 3UTTB 1M05B 3SJVB 4MQSB 1FGNH 1DQDH 2AVGA 2VLRE 3GMLB 1R3HB 1CT8A 5HI4D 1FORH 1F3JB 1HQRB 5IBLC 4BSWA 5C0BD 1AGEB 1FRGL 1HDMB 4PGCA 5E99L 4C56A 4RMVA 3BI9X 3A6CH 4PGZA 5EU7C 1K6QH 3L3GA 4UILH 5KSAC 5E8OA 5F93C 2QADC 3MJGX 1GGCL 2NY5C 2J4WL 1T5XA 2E6JA 5KS9F 4O4YH 3SDXA 4NZTH 4C4KO 3MRJA 2H45A 4DQOL 2Q76A 2F53A 5E9DB 1J1XL 2V7NA 2C1OB 1YECL 1BVLB 3GIZH 1G7JA 4DUXA 5ERWB 3KPNB 3O6FB 3DYPA 1ZLWK 5GGVY 3P9MB 2H32B 4CMHC 1R5VA 3VG9C 3L3JB 1FNEB 2IF7A 3UPRA 4N0FB 5FIEA 5HDLA 4KPHH 5T1LD 3SKOB 4KTDH 2W60A 3RWDA 3NOIA 4YX2L 1MREH 3B5TA 2MCG1 1NEZB 3KG5A 5L6YH 5TPWH 3T2QA 3BRDA 3U0WL 4K8RH 4ELKA 3P4MA 5I1CL 4MD4B 4PJ9C 2A74A 2EDQA 4M8QA 1DE4A 1B2WL 4YE4L 4X7EC 1NL0L 4M1GH 4H8WH 3MO1A 3JUYA 1U8QA 3N1PC 3FFCE 1T5XB 5KJRL 4H20H 5IB3A 4NNXA 2MJWA 4KAQL 4LHUB 3I3EA 2DLFL 2Z93A 1TZHB 4HC1H 1DN0B 1D6VL 1ZSDB 5HI5D 4OCNC 5CILH 4KDTA 5CJQH 4P2QE 3ROOA 1ZHLB 4K8RD 1PKQA 4NC1C 4DKDC 1KIUA 1N6QL 3WIIL 4J3XA 1RUPL 2FJFA 1TCRA 3FKUS 4C4KT 5DC0A 2AK1L 3O3UN 2CRMA 2P5WE 4HIHA 4G43B 1KPUB 4OTXL 3RWFB 4YGAB 4X4YA 4RFEA 3WLBA 4I18B 2F53D 4U3CA 4PRBB 1KPRB 3OBAA 4EI5A 2WMPA 1YNKL 1C5DB 1SJVA 2YUVA 2YA1A 3GIZL 4X7SL 3T4YB 1MFAL 3AU1A 1HNFA 2VERN 4JVPA 2RJMA 1BM3L 4C54A 1FNGA 1U58A 1I8KB 1A22B 2IBZX 3HR5A 5CINL 3DYMA 3EOTH 1VEOA 3MYZA 3RDTB 2CRIA 4N90E 3EYQD 4JFYB 1RURH 4JKPL 4XCCL 3JWOC 4LNVA 1XGYL 4P2QB 2AKRA 3QFJE 3VW3H 5J1TC 4XNUH 2ZG3A 3TNMA 4HGWB 1FFNB 1H3UA 4MSWB 4ODWA 5C0AB 3PDGA 5D8JL 2WWKO 5JXAH 4ZO7A 8CGTA 4MXQD 1UH2A 1XF5A 4OGZA 5EN2B 4EEEA 4NZJA 1CLYH 4RFOL 1FO0A 4G6KL 5MP6H 4HIIA 4X6DE 1Q9OA 2VLJE 2DS4A 2X89D 5E2WL 4RGNB 4WHDA 1OSPL 3KYMB 1FIGH 5IV2A 3FB8A 2G9HB 1F90H 3KVQA 3MV9E 5C0ND 2AJXL 4OZGE 1IL1A 5I1JH 3CD4A 1OTTD 2NY7H 4AG4L 3OXRB 2FD6L 3O3DA 3JV0A 1WTLA 1P4IH 3SHSA 1ZA6B 5KS9B 3SCMA 1DBAH 1K4CB 2JELL 3HPLB 1MHEB 3BUYB 5CZKA 3O9WD 3QI9D 3L3OB 2JB6B 1G1CA 5A16B 3DIFA 3T8XB 1LP9F 4ZQKA 3K0WA 4TVPD 2JIXA 4YHKL 5D71L 5HGBA 5E99H 4TUKH 5DHVH 5HY9A 4Y5VC 1YPZA 1A2YA 1TQBB 4TUOA 1T5WB 2WP3O 3GMOA 4MWFB 2IG2L 1CR9L 3CXHJ 3BZ4B 3IFNH 1S7UB 3F6IA 5F7YC 1WZ1H 2DD8H 4HUUA 2R2EB 2OR9L 4HKZB 1CXHA 1INQB 3QQNA 4OIIL 1LEGA 1HWGB 2W07A 4OZFB 4XNQA 3RJQB 2MCPH 4N8CH 1CF8L 2Z4QB 2FX7H 1R3JA 2CDEA 1YDPB 4LSRH 1ACYH 4X7TB 1T3FB 4JFHE 3DO7B 1R5WA 5E2TH 3PQYB 1J87A 2DAVA 1A6UH 4G6JH 3SDYL 1U8KA 4EOWH 5LGHH 4F7MA 3EDJA 2J2ZA 3DX7B 1A7NH 4JRYE 4NRXA 1OGAA 2LE9A 3O8XC 2BVQB 1EBAA 5C9JA 5DEZA 4PJ7E 3IGAB 5CGYC 4LEOB 5D7IB 5EB9A 1ZK9A 4Z6AT 1NL0H 3S9DB 3MUGA 4IIQA 1MUJA 3G6JB 3ZDZE 4LPCA 3KPRA 4BZ1H 1OT1A 5EFIA 4KI5C 5EOQL 1AC6A 1TZIA 5ITFB 1C16B 5KG9B 4ODUA 3LKQB 2JIXD 1MPAL 1FFPA 1RK0B 2ZPKL 1LGVA 4WI5A 5M94B 1F8TH 1LO2H 4LRNL 1ADQA 5JUEH 5IR1A 5MEOB 1HHJA 1UWEL 3IFNL 4OSUH 2EDXA 3MRIB 4KRPB 3OKNA 3WD5L 2VXSH 2E6QA 5I1LB 2UZIH 4ELMB 4R97B 4DOHE 2K9UA 1K2DA 2Y9RT 2CD0A 1AKJA 2GY5A 3CDGB 1A3LH 4D3CL 3RJDA 1XCQA 2OTWB 1B88A 5FAAA 2X4UA 1DBKL 2OP4H 3TJEH 3F7VA 2V7HB 2EZ0C 1YEKL 4RCAA 5EDXA 4BFGA 1PZUB 5LAXA 4GH7B 2OX5A 1A1NB 3VRIA 2KBGA 4K2UL 5EU4B 5FYKE 5CFHA 4RMUA 4L8BB 2ARWA 2ERJB 5I1EL 4P5MA 1EGJA 1CWVA 2CIIB 3QUKB 2XA8L 2H32H 2ZJSH 4PUBL 3E6FA 1BZ7B 2YK1H 4XMPH 4Y19E 4OLVH 5E8DL 1I1AA 1TNNA 3LKSB 3QNZB 4X6DA 2DBLH 4B7LA 2VLJB 1YNLL 2NY4C 3S35X 2NY3B 1CF8H 1CICC 3DMMD 2E9JA 1KB5L 3BQUD 2VUOA 1XAUA 5F9WC 1EHLH 4XMPL 1K4DB 3NGBC 4JG0H 5CHNA 2YMXL 3EYFB 2A1WL 2A2QT 1OAZL 3EYFA 3UYRL 1HKFA 2X4QB 1T80A 1UACL 3GGWB 1YEEL 3NTCH 4X5LA 4NKIH 4N8PA 2BMKB 3CU1A 1OAYH 4M6NL 1ROWA 1IGFL 4P4KD 3S4SB 5IW6A 2QKIA 1OSZA 1S8DA 4XP4H 4ENED 2NXZC 4R4ND 1Q9WA 4MD5B 3PWVA 5D1QA 3WJLA 1E4KC 3DV6B 2RCSL 3MV9D 1QFPA 1L6ZA 2E9WA 3EZ8A 4PJCF 1FGVL 2P8PA 1HSAB 3G08B 3HC0A 5C70A 4Y2DA 3SGDI 2E9IA 2ED7A 1FDLH 2E27L 2NYYD 4KI1A 4HT1L 3ESUF 3PABA 4DZ8B 3OB0K 4U6HA 1K85A 4QHKJ 3S8WA 4GRLA 1BLNA 2VXTL 1AY1H 43CAB 3L3GB 1JPGA 4JFFA 4JANB 5SWZA 5DHVA 5ALBH 4KY1H 4BSWB 2W0PA 4PY8I 1JNHB 5FUOL 1MCFA 4WO4C 3ZT6A 3MLPA 3GJFK 1EJ6A 3GMQA 2FBOJ 4PB0H 1JF1A 1ND0A 5ISZE 1KF9B 4QCIB 1G7IB 4UIMB 1P4BH 5I75B 1DUZB 1SJEA 4U1KB 1P84K 2X09A 3VXQA 3DUUB 4HUKB 1LO4L 3GBNL 5B4MC 1JPTL 3TVMD 3C9NB 1T7ZA 3QIWB 4ZFZB 5DEFA 1BIIA 3QRFM 3QNXB 4JJ5A 4OJFH 1KCUH 1T1WB 5KVDH 4L5FL 4YE4H 3BH8A 4P48A 1UKSA 1ZWIB 4ZAKC 1C7SA 3IFLL 1PLGL 3O3EA 3O6KL 3EYSL 1NCBH 1PAMA 2BVEA 3NZ8B 1MCWW 3FN0H 2V2WA 1NMAL 4OKVA 2VC2H 3QO1B 5H37H 2WIIB 5B38B 4U1MA 3BHBA 1OWRM 4OLXL 1H0DB 1QFWH 2ZUQC 2YK1L 4F37F 1DLHB 4KXZH 4OZIA 1N6QH 4GKSB 4NO5B 4XVTH 1SMOA 5ALCL 2IH1A 3FN0L 3AREB 1OGAB 3UO1L 3X3FL 4U6VL 2H2SC 4LMQE 3I6KA 5BZWB 4TPRH 5BJTA 2JCCF 1RJLA 2FIKA 1MF2H 3KYOA 3BEWA 1BAFH 3K2MC 2BNQE 2YRLA 5IW1B 3QCUH 4NN7B 3JXAA 2RFXB 3UYRH 4AEHL 3ZE2F 3HZMA 1FL6B 2X4PB 5GGRB 1PKOA 5EA0H 3HC3H 1BM3H 5FYLL 5IVZA 2E3VA 2B0SL 1KTLA 1B6UA 2OSLA 2XWBA 2D7PA 4PJ9A 4KHTH 3I02B 3VWJD 5F7DB 1UH3A 4Y89A 2W0FA 1P4BL 4PJ8C 5DMIH 3LPGA 3SQOL 4P5TC 1YJDH 4XBPA 4AENA 1P7KB 3BKML 2AK4E 3QIUD 3BP5A 5DD5L 3UC0H 5A43C 1JWMA 3GMOB 3BDXA 3V8OA 5HGAA 3SE3C 4DWHA 4P46B 4FS0A 1HN1A 1JVKA 3IDIA 2D7TL 4PGEB 2VE6B 3BFOA 4HXAH 5SWSD 4N0YL 4HT1H 2GFBA 4QRRB 3R4DA 2VXTH 4ZMAT 5D71H 1ORSA 2UWEB 5L7XH 1I3VA 1YMHB 3SCMC 2JE8A 4X0KA 1NMAH 3QHZL 3FO1A 1NGWA 1DEDA 2X5PA 3BXNA 4M4RA 5FYLD 4LCWA 1WC7A 3CVHA 1MCBA 2VLLA 5F7EL 3DVGA 4HD9A 3KJ6L 5LGJB 3T0EA 5BO1L 2XN9D 1MCDA 4ONHB 1DBML 2XG4A 1K6QL 3FFCD 4UILL 3JUZA 1T21B 2YEZA 4OBSA 2YRPA 5E7FA 5D7IE 3IRPX 4H20L 1JF5A 1HXYB 3ILQC 1OAZH 3VCLB 1MCPL 4O4YL 3QHTC 1RJCA 3QEUA 1OOAA 2X6MA 2XRAL 4HLZG 4U31A 3NCEB 4LEXL 3FB8B 3MXWL 5BO1H 1VKXB 3B83A 2X4SA 3PWUA 3RU8H 2ESVA 4UT7L 2E9BA 4KZEH 5LGHL 1EMTH 4RFNC 3CAFA 4U1HB 1QYGL 1ZVYA 3A0OA 4ZPTB 2XNAB 2ILLA 4MXVE 4G6MH 1VPOH 1NBZB 3BKYH 4PJIE 3WN5C 3QPQD 3GBLA 4M93B 1OT2A 4NO0D 4KKBC 5FUCC 3DPBA 1VFUA 2AK4A 3LEXB 4J12A 2LTQC 3QQ3A 2GTWA 4FHBD 5DD5H 1I9JH 1K8DA 3V0VB 1TENA 1WLHA 2IGFL 1RURL 1OAUL 4PG9B 4HFWB 3MLZL 2BNRB 3QO0A 4GG6B 3ZDYE 2Z31B 1E4KA 3MV9A 4YZFF 3NGBB 3OR7B 1KC5L 2J1KA 1JN6A 3MRLB 4A6YL 2IBZY 4LCCC 4NO2B 4NQDE 2AJYH 5E6ZA 2D0GA 3KJ4B 5EA0L 4WTZA 5FF6A 3FQWA 1OTUD 4OCWH 1HYSD 4ODXA 3VU2A 3EFDL 1NFDE 5IVXB 3JZ7A 1RHHB 1FZOB 3SDCB 3UJIL 1OP3H 4DGIL 1RIHL 1L4IA 4OTXH 4UZGA 4C83B 1LNUA 5HYJD 4B41A 4NDMA 4I13B 4KVNL 4U1NB 1OTUC 4MJIB 2BDNL 2OI9C 2PN5A 3MOAL 5F6HI 3VFGH 2AEQH 2J8UA 4ZFGH 5L2JB 5HGDB 4TVSa 4XCEB 1H9VA 3UTZA 4NP4L 5LBSH 4G7YL 3VXUB 4CBPA 5E9DD 1WBZB 1JNJA 4PJFE 2B2XH 2WAHA 4YIQB 1L6XA 5F8RC 1WFOA 3N1QC 5T3ZH 4WEBH 4F58H 1HOCB 3VXMD 2HAZA 5A3IC 2O61A 4NN5C 3G6JF 5JZ7C 4LMQI 1DVFD 3K4DA 4BH7B 3CMOL 4JQIH 3NFPB 3BRGC 1WGOA 4Q9CA 4P9MH 3CCHB 2O26U 4H1LB 4U1IA 3T2PA 4LDOB 2UY7A 2C4FT 3LH2L 2IQAB 1WFTA 3RVWC 4QOKE 4YDLB 1RMFL 2AEPH 4PJ5A 1KULA 4F15B 4LOUD 4DK6A 1TJGH 3FFDB 5E2WH 1KXTB 3P0YH 4WV1C 5DWUH 4ODXB 5EIVA 5DJ2B 4Y16A 2DI7A 4JHZA 4Y4HD 5D9SA 1RZFH 2OTWA 2X4RB 5ENWB 5H8DA 3H9HA 1VEPA 3WUWG 1CXFA 1CD9B 3MLVH 5DFVC 2NZ9D 1A5FL 4NJAL 4P3DA 2CRZA 3RNKA 1S7RA 1HHJB 3RZCC 3G9AB 1DL7H 1NC4B 5IIEA 4NCC1 4XXCA 3CJJA 2PW1A 4FTVE 4OD3L 2JK5B 2YPLB 3MMEA 4JO2L 1GPOH 2A6DA 4Z7UB 4E41E 2C1PA 1F3DH 2DJUA 3CSGA 3PV7A 5I16B 2A6IB 2DLFH 1IGJA 4W68A 4XNZB 1TZIB 1TXKA 1D5MA 5MENB 4LCIL 4O9HH 3O11B 5JNYB 1K8IB 2FEEI 4EUPH 1RZJC 4O5LL 4PRHE 3D85A 1UACH 4NC2B 5KBNC 1IARB 2DWEA 2F53E 2R2HA 3LQZA 3TBSB 2GJZB 3T3ME 4D94A 3B3IB 2XXMB 5B3NA 1M1SA 3JV6A 2BERA 4QYOB 5DRWA 2Y07H 1WCQA 5CIPH 3DROB 3QUXB 3W9EB 5I19H 2G75B 1MI5B 4HIXH 1FGVH 3MA9H 3AS1A 2LTQB 3EYOA 4P2QD 4PJBB 4WHYG 5EBMA 1F13A 4UI2A 3C5SA 4KTEH 3BZDA 2OLDA 5BV7B 1K5NB 4JFOA 4OSUL 5FYLE 2BVPB 3BQUA 3WE6A 1HYSC 3MNZB 1U8LA 2IBGA 3WIHL 4TSCL 2O93L 1REIA 4PJXA 4R2GC 1KIRA 3C6LA 2BP3A 1RFDL 5SV3A 4JB9L 2CDGB 3GIVB 5K9OB 4HGKC 4M5ZL 4JG1L 2V5SA 3GKZA 4HUUB 1SQ2N 2XTJC 1FBIH 2X2YA 2H2PD 2GCYA 4V2CB 5IVXF 3QWQB 4HS6A 1JGEB 2CKBL 2QR0B 3MR9B 3MLZH 1NBVH 2BNRE 5C07E 1DDHB 5DHXB 1L9MA 4EVNB 1KJVA 4KZDL 3RTQD 4HK0B 2FECI 2IALA 4PRNA 3SGKC 2HLAB 3AM8C 2ICWI 2UV3A 1P7KA 3P73B 4GKNA 1HXMB 1AQKH 1JYWA 5IFJA 1E6OL 1V8HA 3D85D 3HR6A 4ZTPL 4O58H 4XPHL 3VMOA 5DQ9A 3DYOA 2N7BA 1JFQH 4PYHA 2IALB 1RI8A 4L8SC 1GZQA 3V4VH 1FL6A 1VACB 3GM0A 4JDZA 1BQHG 2WNGA 4P23A 3HKFA 4NFCA 5CUSH 3T09A 5ESQA 1J8HE 4NHUA 3LKOB 1DFBH 4LKXB 4XPHH 1VFBB 4GW1A 4JO1L 1JTPA 3H7LA 2NR6C 4JFFE 1Z2KA 5ICXA 1GIGL 4GKSA 3P11L 4X7DC 2DLGA 5LQBL 1G9MH 5IGXH 5B38A 3CXDH 3LDBB 4ODVL 4W6YB 1H0DA 1CICD 3AB0B 1IM9D 1XGTB 3UYPA 3MJ8B 4X6EB 1PKQE 4M8VA 1W0YT 1JHLH 3CZFA 3TYFB 3QFJD 5I30L 4OBRA 4PV8B 5HVWA 2X4TA 2F15A 3C6SA 1V3LA 4LIQL 2R0KH 1IGTB 5C0CE 3MRPA 4WHTB 2YUWA 3CGTA 1MQKH 1MCOH 3HRZB 4WI2A 1ZLVH 5I6XB 1CL7L 2PXYC 3VG0L 2V6HA 3ULUF 2ZUTA 1RY7B 1RHFA 1Y6MR 1B0GA 4OZGF 3ARDD 1S3KL 3CPLB 1TJGL 1XR8A 4WWKB 3RWGB 1VA9A 1KB5B 4Q6IA 4X4ME 4K94C 5C3TA 3IDXH 2VAJA 3ESVF 4RWYL 4L9DA 1ZT7B 4XAWL 4ZOAA 1EMTL 1JUFA 5E5MB 4MXVF 1A9BB 3IJHB 3GMNA 1IILE 4J6RH 5JOEA 1YUHA 3BT2L 5DXWA 3X3GL 1J1PH 1DR9A 1JWUB 1KTDA 4OZ4A 4XP4L 2LU3A 5GSRA 1E0OB 1S7WB 1QLRA 4UDTA 1CFQB 3TPUB 5C86A 4JANA 5SWZB 1UGNA 3DSFH 3D69B 1UKTA 1PLGH 3V5HB 2BZDA 3TPKA 4F9LA 3DVFA 3STZA 1QSFD 4WU5B 3PABB 4O9HL 4AQOA 5DO2D 5DSCA 2GY7B 2YPVH 3WKML 4MYWB 3U9PL 1U8QB 1UG9A 5D9SB 1KN2H 2E7HA 4UOW1 3RGVD 2H2PC 1RK1B 4GT7A 1KC5H 1U3YA 1CFNA 1A6ZB 1EK3A 2DIBA 4XCYA 4ZUVB 3Q5OA 4GRMB 1N5YH 3SKMA 3O3BA 4LSDA 4HQQL 5IW6B 1AE6L 4NRZB 1Q9WB 3ZKQD 1NJ9A 4OIAA 4LCWE 3LPWA 4Q74A 5KTEH 1UADC 1QSZA 3H2WA 4X5WA 2XQBH 4JE4B 3VFMB 1A9EA 3OKMA 1L7TH 3TT3H 5C08E 5AD0B 5KSAD 2MNUA 1T2QL 3CH8A 2EIEA 1A6WL 1FNEA 1GGIL 3GI9H 3UPRB 3QWOB 3ULUL 2VISB 5CS7A 3TCLA 4G6FB 1GAFH 3VWKD 3SKUD 3CLEL 5TDPB 5FHBL 1CFVL 1W72B 1IGML 3VXSA 4XP1L 2OJEA 3I3DA 5DJ0B 3MRJB 2VLJD 1GOHA 3RPKA 5FB8B 4DK3A 1JTOA 2I5YH 3CXDL 4LFHD 1N7MH 4JHBA 1JHKL 3DMMB 4MJIA 3RZCD 1HQ4B 2BJML 4WUUA 4B50A 1OGTA 1A6VL 3SE8L 5DVNA 2PYED 1CFVH 2F8VA 3SGDH 2OK0L 1NDMA 4UQ2A 2EH8H 1HHIA 1QD0A 5T3ZD 4NHCL 1KB5H 4MNGB 1JCKA 3VD3A 2G5BA 4FFWD 3OG4B 4YDIH 3SDDA 3QHZH 5IKCB 1V5JA 3HAEH 4NZTL 3CDGA 3C5JB 1YZZA 2DTSA 2RR3A 4HPOL 1IKNA 1U92B 4KVNH 4NO2A 2A6IA 5TGBB 3MRIA 1KYOK 1ZT1A 1A7BA 2ZWLT 1I7RB 3N06B 1N8ZA 3MACH 2ATPB 2C4FU 1X3DA 3RHWK 5E70A 4Y1AB 1OY3B 1XGUA 4UIKL 2OS7A 1CS6A 5LGKA 4RIRA 3VGEA 3LKQA 4WEBL 4P9HC 1DANU 2DKMA 2HT2D 4LHJB 2C7UB 3UBXI 1J8HB 2JCCB 4ZO8A 1U95B 3D6GA 5ENWA 3EDKA 4P2OC 4L8SB 4V1DA 1AC0A 3QEHA 1XGTA 3H0TB 3RP1A 3KPRB 5IJKA 4QRPE 1EFXD 5DD6B 1S9WB 4HK3J 5EORH 3H9SB 1H3WM 2Y6SC 1F2XK 2XTJD 5CEZD 1A4KB 1FYTE 3F7RA 4JQXC 3T2NL 1PW3A 3CFCL 4YH6A 43C9A 3M45A 1JHTA 5BXFB 2ZOLA 2YR3A 4JGMA 4BH7A 4KAQH 3T3MF 3CMGA 4DUVA 1X7QB 4KKNA 4S0SD 3KS0J 1YQVH 1S9XA 2ED8A 1XT5A 4L4TB 4FQLH 4Z7VF 2VIRA 3O45A 4DQOH 1T20B 1G9NC 3DECA 2F19L 1A6AB 4YUEH 1J1XH 3PWJA 1LO3H 3SKNA 1CFSB 1YMMD 3MX0A 1AD0B 1DP0A 3KPQB 4XPFL 5IJVA 5CGMA 3RL2B 1R3JB 2CDEB 3SY0A 5C0BB 3VXUA 1WC7B 3ZDXF 4JFEA 2HFGL 3MRGA 2XRAH 1FE8H 4DTGH 4KK9C 2WQRA 1S7XA 3BT2H 3HG1D 1JZ8A 3EYVA 2VLRA 5D5MF 3WS3A 4N5EC 4QXGH 2GFBB 4RA3A 5I74C 4QRRA 5BV7H 1KELL 4IHOB 1MRDH 2HJFA 3DSFL 2FGWH 3ARDA 2EKSA 1J05A 2HKFL 4LNRB 3ARBC 3EYVB 3EO1B 4NZRH 1CFTB 1MAKA 4XBPB 3C2AH 5E6ID 3BUYA 3D48R 4MB5A 4UU9A 4DZBB 4ZSOA 5C07D 1IKFH 3O4OB 1IAOB 1O5DT 5DHYA 2KUTA 4O2EB 1D5BB 3O81A 3L9RB 1FZJA 4L8DB 2OSLB 4PJ8D 4BQBA 3BPLB 3PWNA 3RUGA 3EO0B 1IM3A 3OR7A 1G6RB 4KWUA 1BMGA 4HX1A 2NW2B 2Z8WC 4JM4L 1NGZA 3S6CA 3C5SB 2GSGB 2WBKA 3L5XL 5HI3D 5BJTB 4YQXH 1CXKA 3QAZC 4O2FA 3FZUC 3NABL 1FL3A 1Z0NA 2EIDA 4JCLA 1QFHA 4BH8B 4M62H 15C8H 4TUJB 5JORA 5J6HA 4Y5YC 3G04A 5JXEC 3HE7D 5E2TL 5DFWH 3V6FB 5CJ5A 3TBSA 2VXUL 5T5NF 1PBYA 3LZFH 3TBWA 4MZ2A 3HN3A 1R3KB 2Z91A 3HI6H 4IMKA 5J6HB 5EN2A 5DD0L 4UQ3A 4TUJA 1OWWA 3MRDB 5C0DA 4EKXA 5A2KH 5GRZA 4E5XA 2RHEA 1CBVL 4HBQA 2VDLH 2VLRD 2WWMC 3MJ7B 3OX8B 2F5AL 3GSXA 4J3OC 3GSNH 1P4LB 1BIHA 1FPTL 3TEUA 5HYQA 4G6AC 3QZWG 1MCHA 4MA1B 1BIIB 4HFUL 4HX1B 2LV4A 5E1HB 1A4JA 1MLCA 3MLWH 1P9MC 1FNGB 1U58B 4NZRL 5CGYD 3WL9A 1TVBB 1JMXA 4GAJL 1IBGH 1XH3B 1C12B 4Y4HC 1XGRB 4KJPC 4U1KA 3GJFA 1KJ2L 4JLRB 4RFEB 2FYYB 1CLZL 4IS6A 5E8PA 4ELME 5C0FA 4U0RB 3BKJL 5DVKA 4KROB 3E3QE 1CD8A 5FKPA 4LSVL 1KG0B 2J7LA 4LGRB 4JO1H 1WT5A 5EOTA 5JW4Q 3P11H 1UVQB 1QBLH 3QIBB 2SEBA 5GPRA 4XCCH 4G8FB 5EUOF 1KJ2H 4L4VE 4OM0L 3V0WH 5JDJA 1WISA 2OZ4L 3FT3B 3U6RB 1CDYA 5H94B 2VLKE 5JZ7D 4PJGB 5DJ0A 3U36A 3MRHA 4PLOB 5GIRB 4M6MH 3U1SL 2YD1A 4KPHL 3R0MA 5C08B 1CLYL 4RFOH 4OM0H 1OAXL 2BY2A 3KLAB 1RZKH 1CGXA 3HI6L 5BZDB 4MNHB 2DQIH 1UEYA 3PL6B 4Q9QL 5C8JB 2Y1VA 1JYXA 1S3KH 1CBVH 4RWHA 2FJHA 5D2NB 5I2IA 4NBYB 2IG2H 1JGUL 2DM4A 5E9DE 2IPKA 3EDEA 2FIKB 1RU9L 4LDLB 3QUYA 3QEQA 1HNGA 4S1SH 1B9ZA 2ZSVB 2CK0H 4X5WB 3NH7L 1WZLA 4ZTOH 3O9WB 3D3VD 3DMMC 4MXQC 1EFXA 3GFUA 3Q3GB 4EZMA 4ZAKD 4F15C 2X7LA 5DD6A 4B53A 2IWGA 5I8KH 1GSMA 3CFEA 4RA0C 5JW3H 4HBCH 1CDBA 1ZA3B 3ULUH 1KEML 4WI3A 1CGSH 3JWDH 2MKLC 3KDMA 3NTCL 3W0WE 4ALAL 4LSVH 4ZUSB 4OQTA 3VXMB 3HZKA 1FNSL 1NMCC 2Q3AA 5D93C 1Z3GH 2HMIC 1N2RA 5B21A 3DNKA 5D1XD 3L3DB 3ARQA 4QTHB 1VADB 3KXFE 3FRUA 4LBEB 4LPXA 4MQ7A 4QRQB 3C2AL 1UM4H 4P4RB 1I7UB 1ZLUK 4JFDB 3HA0A 3RRQA 3QUZD 4EN3C 1IKFL 5I1EH 5DD1H 4KVCL 4BZ1L 1Q94B 1UB5B 1KEGH 1I8MA 3SDDB 3BZFA 4X4ZA 5C0EA 3L7FB 5JIHA 4Z8FL 3KLHD 1I9RL 5I1LA 3OQ3B 4DCQA 2A73A 1ZVHA 4JM4H 2QADB 4P59L 4L8CB 3PHQA 2Y5TA 4JHWL 4JRYD 1QLFB 5I1GH 3IDJA 4GLRI 3JTTA 3VE0B 1BLNB 3IU4L 4CNIB 2AV7A 2H6PB 1NPUA 4Y8AA 4WTWA 4EXPX 3U7WH 3RWHA 1I1AD 3NH7H 5I66A 4EXKA 4Y2DB 4P46C 2FZ3A 3BP7B 5KSUA 5T1DL 4DVRH 3ZYIA 4IRSC 5BRZE 3RIFF 3FQTA 2XWTB 1YY8A 3QB7C 4RWYH 3KPTA 5TDPA 1T83A 1OB1B 8FABA 3MC0A 5IMMB 1JNNL 1SBBA 2FBJH 1BQLH 1NAKL 1QSEE 4AIOA 1LHZA 4ZSOE 1CVSC 1VFBA 4K94H 3IDGA 3LKOA 3VFVA 3QEQB 2PR4L 1QEWA 1D9KD 3JWNC 1E4XH 3LKNB 4A6YH 1YEGL 4PGDB 1GZQB 3JBG7 3LEVH 4WFGD 2UZIL 3OB8A 4J2XA 1FLTX 1YDPA 4ONGH 1ACZA 2FEDC 4JR9L 3IJSA 4F2MA 2A6KA 3DWTA 4OCWL 1I9IH 1X4ZA 3BKJH 4TSAL 4NQUA 3ZKNC 5CEXA 1OD7A 1U3JA 5F6IB 5F9OL 3MBEA 5GIRA 1QPPA 1XCTB 4Y4FD 4M6OH 3QCTH 1RQ5A 1CU4L 3BEVA 1KIQB 4Z18A 3VFSB 2AEIT 1SEBA 4NN6C 3H9SE 1LE5B 3H3PL 1ZGLM 1M6OB 3E8UH 4LNRA 3VFUA 2CIKA 1DDHA 1E4JA 1QSVA 3AREC 4OGXH 3BO8A 2CLVB 2ZSWA 2PUQT 1KCLA 3SGEI 1CZ8H 5DFTA 3OTTA 4KDVA 4X80L 3TO4B 1MRDL 3QG7L 3V5DA 1ED3A 2PO6D 1KB9K 4L4VB 5FKPB 5GGTL 2NZ9C 3O0RL 4R6UA 1IEBB 5AZ2L 3CFBB 1INDH 5GRVL 3DJ9A 1VEMA 3VXRA 5KS9A 5IMOA 1J88A 5I75C 4MJ6A 3BHBB 5F8QC 2P8LB 3PP3K 1KN4H 4LPVA 1B0GB 5MEOA 5KSBF 1WZKA 4V1DE 2K7QA 1G7HA 4JM2C 3O45B 4G80A 2YWZA 5K33A 2G75A 2IH3A 4CGTA 5FYKD 5CSGA 3FB5A 1HINL 3DROA 2EC9U 4KK8D 1X7QA 3CFKB 3S37X 1JHTB 3MV7D 3RAJL 4LLMA 3MJ8A 4X6EA 1LD9B 1LEIB 3RVUC 5DURB 1MJJB 2OTUA 1HHGA 3WO4C 3DV4B 5KSBA 1VESA 5J8OA 5ABDE 1FAKT 1G6RL 1FNLA 5CIPB 4NKDA 3PUCA 5DMIL 5D70H 2MHAB 1AR1C 4GOSA 4P2RE 5EU6B 2A6DB 4NRXB 2NLJB 3E8UL 1T2XA 1NC2D 1VGKA 2VAAB 3EYSH 1MCIA 1NCBL 1ORQA 4X99B 1F11B 2WZPD 4ZAKA 3S5LB 3LSOA 4NWTL 4Y4KA 3LQAC 3G6DL 3MLRH 1KLFA 2Q7YA 3FQXB 5L9DL 1B2WH 3P4OB 3L7EB 4L3EA 5DI8B 4HXBL 5D7JB 3CFBA 5MI0C 1YN7B 5HXMA 1HK6A 4L8DA 3D39E 3LEVL 4O2EA 4NUJB 5CKGA 1LO4H 2IAMC 3FFDA 3N1MC 2V2TB 4NWTH 3X17A 1C5CH 3MRKA 4WGVB 3KJ6H 1DVFA 5EU5B 4M62L 5DVLA 6FABL 4PJGE 5E6IA 4KK9D 1A3LL 4U1JB 4F7EA 3QFDA 2VITB 2QKIB 4GO6B 5JTWA 4WRLA 3VGAB 1CGWA 2BVTA 2ICEB 4MB3A 2GT9B 4LARL 5F9WB 3KLHC 2X05A 2HJFB 1BFTA 5ICZA 5CJOL 5EBLB 4POZD 3BQUC 4FQLL 5E00A 4YHOH 4H26B 3FTGA 4LSUH 4ZOCA 3TZVA 3CIQA 3WUZA 3DMMA 3QIBC 5FUCE 4HUXB 5EUOA 1LDSA 4ZG1A 1KENL 2A6KB 2OTPA 4JY4B 1YJDL 4QHLB 3U4BL 2ZCLL 1BJ8A 3RGVB 5GS2D 1VPOL 2FNBA 3MREA 4G3YL 4C55A 25C8H 4RGMB 2G5RA 4XCEA 4U0RC 1H3GA 1X5XA 2HJLA 1ETZA 3UJTL 3TCLB 1VCAA 1QEWB 3MOQA 2F54D 3VDBA 2HT4D 3AY4C 2DQCH 4JQVC 4YNYB 1A1MB 1U3HC 1WT5C 3I9GH 4ZYKB 2DL2A 3C60C 4CU7A 3BMVA 5ACMA 3T77A 3LY6A 3BSZL 5DA0B 3HZYA 3MLUH 2QSQA 3B2UC 3UTPE 2PO6C 5F70A 1ZLWH 4KKAD 1EHLL 1X5AA 5JW4N 1RUML 2O5YL 4QNPF 3UTTD 4F58L 3DBXA 4ENEC 5KTEL 5GS2H 4PP2A 3SN6N 1MHPL 3HZVA 5TJWK 2DQJL 1I7ZB 2NY1B 3Q6GH 3BP7A 5TPWL 3QNYB 4M93C 3V4VL 5INDB 2Y06H 5I1IH 4Z7UA 5AYUH 2OI9B 4G9DB 4BSJA 1FYTA 3TN0B 3SJVE 3P40A 3UTTE 4Z95L 3D69A 4HXAL 2QQKH 3S5LA 3ILQD 4PJAF 2LU7A 4YHLL 4OLYH 1ES0B 5C0JB 1TPXB 4E9LA 2GTWB 3Q5TA 5KVFL 5DMJB 3TVMA 4POYA 3FFCB 3D25A 3K81A 4UMGA 4BYHA 3C6LD 3FN3A 3O6FD 1BGXL 3SE8H 1IC7L 3REVB 4N0CD 3UBXA 5BS0E 2A6JA 2LFGA 3BGAA 2R0LH 3WUWA 4FFZL 3ZL4L 4AH2A 3VW3L 2DLEA 4Y1AE 4JGUA 2HN7A 1ZV5A 3LN4A 5ANMB 3REWA 4TQEL 3V4PL 3DV4A 5TDNB 5IP4A 5KW9L 2DQDH 4XNMA 4ZNEA 2APTA 4N1CA 9CGTA 4RAHA 2IQ9H 3V6OC 4R3SB 4JKLA 4M7KH 3HAEA 1FORL 3W2DH 3CFKA 4YO0A 4X5XA 4PJ9D 4ZS7H 1SY6L 1ZSDA 2O5ZH 5CZVL 3SE9H 4WHTA 1MWAL 1NCWH 4RAUB 3FCTB 1J9CT 2BSTB 1JI2A 2E6PA 2X4TB 4LAQL 1EAJA 4LLUA 4LARH 4LCUB 2H2SD 1T21A 1FJ1A 2YKLH 4UDUB 2NY0D 5F72S 2RB8A 3QEQE 3NPZB 4KRPC 1MOEA 4DGYH 3TFKD 2DIAA 5EO0A 4Y4FC 1MNUH 3UTZB 1XIWA 5F89B 1A1OB 5IF0B 4HHAB 2BY0A 1EFXB 4XPAH 2E7CA 5D70L 5T1KB 1H8NA 3GUTB 5E6IC 5KZCD 4QXTB 5EU3A 1FC1A 5D4QA 1V3KA 2NW3A 1B0RA 1YNTB 2HH0H 3PDOA 5D8JH 4ODHL 1NEZG 3S36H 3WFEL 1KEGL 2ICEA 5I2IB 1S5IH 3LKPB 1CE6B 3W82A 4G8IA 4HPYL 1U9KA 4MD0B 4F80A 4Z7VA 3KHOA 3QIUA 1CDIA 2X10A 2A9ML 1ZLSH 1CFNB 5DK2A 1LK3L 2BNQB 5INCA 3RHWF 5I1JL 1LK2A 2AJUL 2DBJA 3IDNB 5DSCB 5IBLD 4IOIA 5KANG 2X4PA 2DQJH 4M9PA 1N0XH 3ULSB 3HI5L 4MAUL 4YXHH 4FQQB 3T2OA 1R3LA 3V5HA 5F1IA 3DI3B 1KSRA 5HYJE 2Z9TA 4PGDA 3BEWB 4DGVH 3ULUE 4A6YA 3VWJC 1SY6H 1C5BL 2AJUH 4XC3H 1MWAH 1NCWL 2ZNXA 4GRLD 2EDNA 5IMLB 2G9HA 3OMZA 4HIXL 5DJYB 1AXSA 5D2LB 4G42B 2MSPA 4JLRA 3N0PB 3BISA 4LSTL 2I9TA 2R4RH 3LMJL 3ARBB 3GHEL 5GGSY 1A4JB 3RU8L 3EO9H 4OGYH 1UXWA 4APQA 4ONGL 1R3IH 1F3DJ 1H15A 1UJ3B 4WENB 1AQDB 2HT2C 4QRTA 4U05A 5IM7A 1SEQH 2YD9A 1Y6KR 4D0DB 5J56B 3RVXD 1M71A 3F62A 4PJBF 4D9QE 3VE0A 4UV4L 4O51B 3C09B 1OAXH 4WI8A 2H41A 4Z7VE 1R3KA 3AU1B 4PJHE 2MQCA 4OFDA 2DBLL 2LAGB 3K80A 5DUPH 2VLLB 3LHPL 2FH6A 2R1XB 2FO4A 4UT7H 1I8MB 4MX7B 3CFDB 4CVZA 3D18A 5DJYA 4ZTPH 3MRRA 3LS5L 3G5VB 5EOCL 5E5RB 2AJYL 1RIUL 3FL7A 4M6NH 2GSGA 1WEJL 3L3KA 4BA8A 4QTHA 1J1OL 2CIKB 3C8KB 1Q0YL 4P23C 4U6HB 1G6RA 1GJIA 1ZVSA 1MIMH 4Q6IC 2Z93B 1WIOA 3IAGC 1UYWH 5DK2B 2APXA 1OAUH 1U6AH 2B5IB 2YS4A 3VXTA 1LK2B 3BGMB 2DWDA 4GKNB 4ISVA 2Z92B 4F2MB 4LF3B 4U1GC 1NFDB 1T03H 3WD5H 4JKMA 3TIDB 5EC2A 4LU5L 3BJLA 3JV4A 3AY4A 4NP4H 4ETQB 3CVHH 1S7TB 4PJGF 4XVUD 3NCYP 4MA3B 2R0KL 3IDGB 2EH7L 4KDTC 1T22B 2W60B 4QXTA 5EU3B 3OXSA 5HHME 4R4NC 4KV5E 1VERA 3BKCH 1AE6H 4OT1L 1UXSA 3SY0B 3KPMA 1DQQB 1F3RB 4QF1B 3IFPA 3ILPB 2MWCA 4AK1A 3SQBA 2VDOL 5T33H 1FG2A 1IKNC 4NQCB 2V2WB 2XT1B 1KCUL 5KVDL 3DRTB 5TQ2H 4ORGA 1G7MA 3U36B 4LSSL 3SE3A 2IPTH 5DMKB 2HYMA 1GGIH 4GBXC 4L4TA 2O5XH 4PRID 4Y2OA 4OT1H 5K59E 1MCKA 1JV5A 1DFBL 5EOCH 1XGQA 1X5ZA 5EPMA 2V5RA 3IETB 3QH3A 3OV6A 5FKAA 4NDMB 4ORZC 1INEH 4KKCC 4YJZL 4G8FA 3VDCA 3ULVC 3UJTH 4HJ0C 1U91B 2ZOKA 1A1NA 1A4KA 2JJWA 2LQRA 3TJHD 4XWOD 4DOHB 1F3JA 3LQZB 3REWB 2NY3C 5HYFA 4NT6B 4HS8L 3BWAA 5ALBL 5DJ6A 4TNVF 5KS9E 3SDXE 1EO5A 3TNNB 1JF1B 1ND0B 3M8OH 1RUMH 2ENSA 4X7CC 1I1AC 4QRUA 2Q86B 3TH2T 4HZAA 3D25B 3HI5H 2AEPL 3TBTB 1B3JA 4UBDC 1G0DA 2X1XR 3IU3B 2XG5A 3HNTL 5DWUL 4JRXD 3RVTD 5DVOA 3FQRB 3OAUL 5I0ZA 1BEYL 5HHQB 4YWGL 1RK0A 1YMMA 2XA3A 2Z0BA 3SKJL 3OB0H 5JOPE 1OD9A 3U0TB 1MCQA 4DEPB 1YN6B 1WAAF 4FQJH 5I1DA 2F9BT 5C0NC 2Q8BH 1FVCA 3WO3B 2YPKB 5IB5B 5F96L 5FHBH 4M1DL 2Q8AH 2CO6B 4OGYL 3VXSE 5DJAB 1CQYA 3MJ9A 3HZYB 1DSFL 1I8IA 3DX6B 4OLXH 5LVEA 1EUUA 2BMKA 3WHE0 1RUAL 4BH8A 2EXYC 2D31A 3EJYC 3PWUB 4I2XB 2MPAL 1NKRA 4EIZC 3Q6GL 3V4UL 4FFYH 1INEL 1ETZB 4PPTA 2V17H 4TVPH 3LN5B 5IB1B 4NQTA 5L8LB 1RIVH 3ALWA 4OD2A 1BJ1J 1IGCH 1KNOA 1WSST 3Q5YA 3WSQL 4POZC 3ARFA 3QNZA 3SE9L 2Y4SA 5E0QA 2W59A 4AEEA 3CUPA 2QQNH 5JA8B 3DX8B 1IAOA 1LO0L 5C09B 4QHUB 4PJGA 2X4OA 3I84A 2J8UB 2PYEA 1X5KA 1YMHA 4YFDB 4FQXB 2H26B 4KJQC 3EO1A 1CFBA 3SGJA 2EYRB 4F3FA 4MA3A 2X9XA 3QXUA 3MACL 2FHBA 1A2YB 4TUOB 1CDJA 2NPLX 3VXPB 1MFAH 1MVUA 5EC2B 1T7VA 4BM7A 5DUBB 1CI5A 4K7PY 2YZ8A 1FSKC 1IAKB 2VXVH 2XZCL 3HE6D 3RWJB 3CLEH 4JRWA 1BWWA 1OAYL 4ODTH 5IVXA 4PJXF 1HI6B 3WFEH 3VFWA 4JPVH 4K71B 2AJSH 4U6VH 1AGCB 3UYOD 1PG7H 1RZKL 5HYIA 3JVGA 5DEGB 3H7BB 3UDWA 2OQJA 4K7PL 4QO1A 1T0PB 2W38A 4XPGH 1XGRA 4PJ7B 2EC8A 2P8MA 4MA7L 3DTXA 1A6AA 3WHE1 4U6YA 5CJQL 3A6BH 2D7NA 3PQYD 1F4XH 3ZDXE 1GVIA 2VXQL 1U0QA 1C8PA 4HKJA 2ZP0T 4KHTL 1D5XA 1S7QA 4G8GD 1ORQB 1RJLB 1BHGA 3G5VA 2FR4A 3FJTA 1S7VB 1P53A 3IJHA 3TO4D 2EE9A 4IJ3B 2MHAA 1UWXK 3MRDA 4WDIA 5MEPA 5IEHA 4Y16C 1KEMH 4KGJA 3W39A 1QZ1A 2X1QA 2P5EE 5CIPA 4BFIA 2AGJH 4R0LA 2OYPA 2NY7L 3U4EB 4X80H 5CP7B 1MFEH 4U1MB 5DT1H 3R1GH 1FFNA 3GBNH 2FH8A 1U95A 1MY5A 4XXCC 2D4FA 5HD8D 2CKBA 4ZUUB 2HFEA 2FIRT 5HHVH 4S1QL 3MOAH 4F7MB 3ZKMC 3HLAA 2BC4B 4PJ5E 4D8PA 4RISL 2ZCLH 3HS0A 1BFVH 2BOBA 3R1GL 2X44D 3O3AB 3FT4B 1QG3A 2L7JA 5L88H 2Q6WA 2P8LA 3W11D 2VDPH 3D2UD 4N0UE 3RPIA 4Z76A 2XWJB 3I6LE 5F7HA 2FX8L 1OAQH 3ARBA 4JM2D 3QXVA 2ZG1A 1RZGA 3P0VL 3GSNL 3MUJA 5K9QG 1UEMA 2QLVB 4LCWB 3C8HA 4X6CF 1YEJL 2DJ4A 3LPFA 3B9VA 4CVXA 4X0KB 4QRRD 3Q1SH 3QPXL 3V5DB 1D9KC 1MLBB 1V05A 2GI7A 5HGGS 5JA9A 3IU4H 2CLVA 2R2BA 1T5WA 1PKQB 4LSTH 3VD9A 5DHVB 2WQ8A 1MVUB 2XQYG 2N4IA 4X8XA 2GW5A 4P46A 1DN0A 2EECA 1SEBB 2XN9B 3LKRA 1AHWC 1J0JA 4HWBA 3NABH 1DJSA 4DZ8A 3LIZH 2Z8RA 1DQLL 2FB4H 3O6ML 4JFXA 5CJXC 5I71B 1SVZA 4K55A 4PJ7F 4LLYA 2P46B 1WWCA 3WNLA 4EDWL 4QRPA 4TSCH 4NNPH 4JPWL 5TE7L 3D87B 2YHGA 4JRXA 4K3EL 1IC4H 2BXZA 3P4MB 3AAZB 3S97C 4W4OC 4CRPA 4HV8A 1S5HB 5CGTA 3TA3B 1FZMA 1Z0MA 4FMFA 2AV1B 3VWKA 3G5ZA 1MEXH 1LQSR 1OTSC 2JB5H 3KYOB 4RBPK 2R0LL 2WINA 1HSBA 3KYMA 2CH8A 4HS3B 4UINH 2OMBA 1CXIA 4OZGA 1M7DB 1ZT4B 5F7NC 1KJ3L 3WDJA 4RNRA 4FQ1H 5TF0A 5I71C 1UWXH 2FX8H 3AXLB 4OKDA 3MRCB 1XF5B 4NO3B 3KR3H 4ODSL 4GLRH 5C0AA 4FZ8L 2PYFB 3TLRA 1K5NA 4YPGB 2XWTA 1IVLA 4G6JL 3SDYH 3ARYA 4MCZA 4QLRA 3E6FB 1JWSB 4M61B 3OKKB 4YDJB 4CNIA 1TVHA 3BP4A 3INUL 3U4BH 1N59B 3RWHB 2AQ3A 4PR5A 4XWGH 4BK5A 2P24A 4YO0B 3EHBD 4G3YH 1EGJL 2DLHA 3PG2A 5C0CD 3ARFD 4U1SA 3GMLA 1JWUA 4UB0L 5LG1A 2GHWB 1IAMA 2C3WA 3LIZL 3P77A 3AUVA 4MAYD 4PREB 4FQXC 3MRQA 1KCSL 1KXVC 2VZ3A 2JJTC 1G7PA 4JO3H 4QRPD 5I15H 2ICWA 4LLDB 5GS0L 3BAEL 1D5IH 3TVMB 2W0KA 1ZLUH 1ES0A 3OG6B 4J1UB 1MCNA 3VGAC 4WUKH 2Z35A 3ROLA 1JYNA 2UWEE 2ARJB 2EEDA 2NZIA 5F88A 1R5IA 4LSPH 3VXUD 2V5YA 4N9OB 2MKWA 2NX5D 1RU9H 3QR2A 4ESKA 4XCFH 4KH2A 1U93B 3WKNA 3HMXH 4M61A 2J6EA 2OL3L 5ICYB 1WZMA 3H9HB 4FTVD 5FA3B 4JFHD 2BOCA 4LLWB 4N0UB 2WUCL 2V5TA 4FQPA 3MPCA 1OSPH 1FG2B 2X7LB 1EX0A 2A74B 2A77H 4JKKA 4K71C 3NCBB 3AXLA 4GQ9L 4POUB 5I73C 3E2HB 5TE6H 1OPGH 2KH2B 3CU7A 2Q8AL 1FPTH 4QHNA 1RIHH 3T4AB 5JPNB 4DFHA 4W70A 4QOKD 3PDDA 4JFED 1G9MC 2WUBL 1FDLL 2E27H 5DMGD 4GRWB 3PXJA 4ETQA 5IW3A 4HXBH 3MV8E 2DQDL 1JGLL 5EULV 4KI5E 3N85H 4RQQB 1NBVL 1T3FA 5H2BA 2WP3T 4JPKL 1BQUA 5ADPL 4LF3A 4LQFL 5F6IC 3LKSA 1KLUA 1WWBX 5JHLL 1BQSA 2DWDB 3M07A 3WNKA 4YWGH 4XXDA 1FSKB 1VGEL 3ALXA 2QJDA 4LLYB 5HHNA 1X6LA 2R23B 5TDOB 1JGLH 2HT3D 3STZB 4HAGA 5ICZB 3V6ZA 3FT3A 1MSPA 4M43H 3ZHLA 4LU5H 4X6FA 3L5WA 3S88L 3LKRB 2X4NA 5EU4A 4HW6A 4H1LG 4JZJA 1PSKH 4WI6A 3VFTA 4U1JA 3O8XA 1QACA 5HGBB 2ORBH 2E7LA 4MQXC 2WWKT 4KJPD 4ZXBB 4KKCD 4HGMA 4ZQKB 5FM4A 4YHPB 5I73B 3WXVH 3U1SH 3VRLE 2WUCH 5F6HJ 4WV1A 1UM5L 3F5WB 3MLTB 4JRXE 3B9KD 4NQXB 2XWJA 3GSWA 1EHNA 4ONFL 4OZIE 4XH2B 5CEZH 3HS0B 3OXRA 4JFPA 4XC1H 1O7VA 4ZAKB 1QLEL 3VFRA 5BVJA 3IDYB 4QOKA 2XPGB 5CP3A 3PGFH 5HYQB 5ACZB 1EXUA 2P5WB 1MFNA 4OF5A 3K2UH 5C0DB 1CD1A 1YEGH 3CSYA 1I4FA 2CKBB 5JXED 3FB7A 2IJ0C 1NBZA 1EH9A 4DN3H 5BS0D 1JPST 1FCCA 5CUSL 5DJ8A 1FFRA 3MUGB 4IIQB 3QDHA 1EBPA 4U1HA 2C9AA 2I9TB 3MXVL 5BOPA 4HPOH 1B90A 4XI5D 3CXHK 5EWIH 1IGIH 4HGWA 5IQ7H 3ME0A 4JFDD 1D9KA 2R29H 3DXAB 1CLOL 2OMNA 4PS4H 1EGJH 3QRGH 1FL3B 1CIUA 4ZOEA 4X9FA 4O2FB 1QR1A 3I2CH 4P23B 1G7HB 4J3UA 4IOFC 4PJIB 4NSKB 2YEZB 4YEEA 1R24B 5D93B 2NTSP 2EDYA 3B8YA 3MGTB 3BZEA 4FQQA 3OKLB 1IGMH 3BD4A 4PJ7A 5HD8C 5K9KB 4XAKD 2DQHH 4YAQB 1T1YA 3QDJE 1MCEA 4RGND 3IDNA 2P8MB 1AGCA 3WNMA 3P0GB 4L4VA 2MTPA 4JQXA 4MHHI 3O0RH 4XVJH 3H7BA 2F54A 2VZ1A 3BPCA 4UTBL 2VDKH 3D39B 5SX5H 4LQFH 4NQVB 3MROA 4TPRL 4HK0A 4OLUH 3WFHA 2IFGA 3RWCB 4OFIA 3GRWA 1YEHH 2F74A 4N8VA 1KJVB 3W0WD 1DBMH 5FV2A 3K3QA 4KJQD 5HHOA 4E41B 1ZEAH 4NQDB 1RUPH 3AGVA 3F6LA 3M8OL 5HI3C 1TNMA 1F6FB 1CICB 3HPJA 5DQJB 1B0RB 3PDOB 1RIVL 5IK3A 4WCYL 4F7PA 1U8PA 3C08L 3NCMA 4JFZL 4XXDB 1S7XB 5BS0A 1WUNT 3FAWA 1KTLB 1RD6A 4PRIE 5TE4H 3QEQD 5DJZB 2YD3A 3BKMH 2ZZUT 5F9AC 2UY6A 4KROC 3BDBA 3BE1L 4RQQA 4EI5C 2VN4A 2OBGA 1WCBB 2RQ8A 3QUZA 2ADIA 3EJYD 5C2UB 1S9XB 1RV6X 3QXAA 3LS4L 3LV3B 3WIFA 3OKYA 3OF6D 1ZHBA 3MOBL 4I2XA 5TFSL 1CVRA 5A2FA 2MOVA 4U1GB 4JREC 5D6CB 1HHKB 3M1BB 4Z7UF 3FRPA 3SO5A 3STLB 5J9PA 1A21A 4H0HB 3IXAB 4PJBE 1QUNA 4IMLB 2QHRL 4QT5A 4ZUTA 2GJJA 1AR1D 1Y18A 4WGWB 2IMMA 1KN4L 4ZUWB 5DJAA 1T04B 2EYSB 4AEIH 4PJEE 4K7PX 4W4OA 4KK5D 2VABB 4QHMB 3FQNA 1A6WH 2B7DT 3GI9L 3U9UB 2NY6C 3GDBA 4Z7WF 5I18L 1J8HA 2B1AL 4LHUG 2BSED 4N9GB 3O2DA 1YN6A 1CGVA 3KPPB 4RIRB 5I1DB 5HI5C 1X4YA 4I0PD 3DGGA 2R1YB 3KPSB 2YD4A 4GG6A 1F4AA 2KL6A 3QDMD 4BK4A 4K7FB 4NRYA 1AGEA 1IC4L 4XH2A 1FNAA 1PJ9A 2I5YL 4H8WC 4M7JL 1UZ6E 3E1F1 4N0RA 2Q7NA 3VXQB 3IU3A 15C8L 3PQYE 2Q1EA 4NQXA 3RA7H 5MEND 3QJFB 4NKOB 4UAOB 2I60H 1H3TA 3TV3H 3HAEG 3GMQB 1EEYA 2Q86A 4QRUB 4QNPE 1G9NH 2B20A 3S37H 1R0AH 2UZYB 2LVCA 4ZPTA 3MV8B 1U8JB 1NSNH 5KOMC 3SEPA 2FJFB 4Z0XA 4MS8C 1MHCA 4WNQA 5CLTA 4U1SB 3FMGL 3JWOH 3B9DA 5FYJH 1OGTB 1WIUA 3UBXG 4WFEE 4FFZH 5DD3L 3RX5A 3ZSTA 2D7MA 1OHQA 2UWEF 1A1MA 1PX4A 4ZD3L 4ZYKA 5SWSB 4XPGL 2IEPA 4HK3N 3VGBA 5JLZB 3TBYA 3U7YL 1QSFA 1HQ4A 4D0BA 5DJDA 3KPOB 1F90L 1QSEA 2PTUA 5HJ3B 4DW2L 3HC4H 4MJ2A 1BBJA 5FB8A 2HFFB 3KWWA 3L3IA 4NUGL 3FMGH 2FX7L 3HMXL 3OKDA 5DO2C 3MBXH 5EU7E 3W2DL 3PWVB 5D1QB 3RGVA 3T0EB 5I8EB 1WFUA 3ULUD 1QA9B 3O4LD 1CTNA 1RZIA 5HDBE 4KHXL 1A7RH 5EUOB 1QFWI 1AI1H 4MGXA 2APBA 5BRZB 2DYPB 5I18H 4YDVA 1EAPA 4U1NA 4JR9H 4YXKL 4M4PA 2B0SH 2W9DH 4HG4K 1SJHB 3MUHL 5LKNA 4RSVA 4D3CH 1CE1H 1B4JH 4M6OL 2EIZB 2VXUH 4H1LH 5HGAB 3VRJB 1UCBL 1AI1L 2DQHL 5DDHA 2FGWL 3TN0C 2H8PA 2I26N 3ABZA 1BVLA 1F97A 5FYJU 4FG6D 1RAMA 3BGMA 1N4XL 5HTSA 3ET9F 4X4MA 4G8EA 1A6ZA 4HKXA 4P2OA 3I02A 2IANE 3SDXB 3HTLX 3QHFL 5L88L 4P4KB 1U93A 3FHAA 1RSFA 2I27N 3QYCA 1BP3B 4PP1D 3QO0B 4XPFH 5CJ8A 1LO2L 1QRKA 4PG9A 3RVWD 1GYAA 2IQ9L 3TYGH 3ZTJG 5AG8A 4R90H 5IT2L 4PIRF 3W9DA 2BVUA 3TPUA 5D1ZC 3MFFA 1K8DB 1RZKC 2GJ6B 5HHXH 4PJHF 1A7OH 3HE6B 4WW2A 4GMTL 2V7HA 1FLRH 4G9FA 4YDIL 3CFDA 3MRRB 4Z5RB 1KIPA 4ZFOL 4MDJA 3GSQB 1X5YA 4LLQA 3BN9D 4XGZA 2GK2A 3BIBX 1WV7T 2NX5A 1WAAE 5F7FA 3V2AR 3ARWA 3VRLF 3UTPD 5ISZD 3DRQA 3T65B 1NCUA 1KJ2B 3NZ8A 1J11A 4XNYL 2UUDK 3MRPB 5L6YL 1CD1B 4OZIF 1PEZA 3KPLB 4M5ZH 4PTUA 3U0WH 4JZNB 4C59B 4U3HA 4PTUB 2W9DL 1FBIL 2M2DA 1GGUA 3C8DA 4PUBH 2VMFA 4MA7H 2ITDA 4PJAB 1KJ2A 1H3PH 4UQ3B 1XIWD 1XZ0A 4D0CB 4LCCA 4UAOC 3TBVA 5FA4B 4YHZH 4HKBA 4XCNB 1UXWB 5ESAA 4NO3A 3RBSA 1YY9C 1NC2A 4L29B 1KJMA 2AJZB 3RVXC 4NCDA 5E2UH 3OJVC 4LAJH 3RTQC 2DQEL 1NGQH 1KUMA 5I1IL 3KXFD 2UWEA 4KK6D 4OCXL 3WLWC 3BN3B 4AJ0A 2WINB 1HEZA 5J13B 2K3TA 4JHWH 1YEKH 4M7ZC 3IDIB 2X4NB 4O2CB 4OI7A 4XCFL 3OKOB 4HV8B 3PWNB 4Z0BH 3F12A 4D9LL 4AG4H 3Q0HA 4JB9H 4J23A 1VB9A 1KACB 1G9NL 1NUFA 3G5YB 1FVEB 1TQCC 5BVPL 3G6DH 2VZUA 2R2EA 3GSOB 4PJ9B 2CRYA 12E8L 1HKLL 1VDGA 1JPFA 2EZ0D 3LRSA 5JHDB 5CJOH 2VDPL 1J7VR 1KLUB 3VGGA 4U3XA 3EOTL 3VFWB 2ZUXA 3HZMB 5GGRA 1AFVH 2XKNA 5F7LB 3OR6B 3VFGL 4RDQG 5D6DC 2OJZL 5DZOA 2GK0B 4TVPL 3CX2A 3VXRE 2HJKB 4NZUH 5KSAB 2VH5L 1EIBA 1HCFX 1S9YA 5T1KD 2CDGA 3HPLA 3DI2B 4R4FH 4PRDB 2DI9A 5EC1A 4X8JA 1QA9A 2AJZA 4I0CC 3GBML 5C0BA 3QWRD 3ULVL 1RZGB 5C0GA 4MDIB 3PHSA 1IT9L 5I8KL 4IOFD 4DAGL 2Z8SA 2EEBA 4LSRL 3W9EA 4P5MB 5IB1A 1NAMA 3ZDZF 1TLKA 4JZNA 1UM6L 2F8XC 3S3PA 5D7LE 4TTDC 3QUXA 2QEJA 4I4WB 4YQXL 3VFNB 2DLTA 4HPYH 1J1OH 5DEFB 2DQIL 4XZUA 3K1DA 2DWEB 3RX8A 5E8NA 5FECB 3PF2A 2YRZA 1AY1L 2IPUG 1AO7B 1K3ZA 2ATKA 3UDWC 2DM2A 1IZKA 3UC0L 2WBWB 1J0KA 4MVBD 5JIIA 3ARGC 1HILB 1A0QL 1KIPB 2B8OT 4MJ4A 1P84J 1Q94A 4WDIB 3SE4A 2G2RA 4YHIB 3DVNB 2AKRB 5DJCA 3IB4A 1FNFA 2A6JB 1T1XA 3ZKND 2CK2A 4UV4H 2A0LC 1YYLL 3OGOE 5SX4I 3WHXB 3Q6FA 1QLEH 4Y1AA 5D7LD 5FHAH 4PY8J 5CBEA 2ATPA 4WIQA 1N8ZB 4WJ5B 2IBBA 4JZOA 3PL6D 1HSAA 4HUMB 4F9PA 4URTB 3UAJC 32C2A 3K4ZA 3QG6A 4QWWC 4HKXB 3IKCA 2AS5M 1CLCA 4X4YB 5HHOD 3ULUC 3DARA 4PJ5B 3IDUA 3UZQA 2J8UF 4HCRL 5FDYA 4NT6A 4EOWL 1QNZH 3H9SD 1BGXH 2NY6D 2Z31D 1MIEL 4H1LA 4U1IB 4CU8A 2ORBL 4IRSB 4QHKI 5GZNC 2JJSC 3PV6A 2HTKD 2ZNWA 4X83A 5MHSE 2YKLL 4P5TA 1KCVH 2HLFC 1HHHA 4JO3L 5I15L 4NQEB 4I4WA 1WWAX 4WUUB 4PJXE 3CC5A 3FO2A 1RZ8A 3CH1A 2Y7QA 2P4AB 1T7YA 2B1AH 4M7KL 1MWAB 3EGSB 3WFCH 1BF8A 3WEXA 3OGCB 4C57C 2W9EH 4M8QB 4OF0A 4ZD3H 3CDCA 1EEZB 4J8RB 3V9FA 3AAZA 5E94B 4MDIA 3WXWH 3U7YH 1N3NB 1BBJB 4KDWA 4QF1A 3PWPB 3VGHA 5D2LE 3A6OA 5GQBA 4HUWA 3U30C 4NBXB 5E8EA 2PXYB 3WEXB 3ULVH 1MCPH 4TSAH 1AO7E 2R15A 4HUXA 4AIXA 4LEXH 5IBTH 3MYJB 5F1NA 1ZTXH 1SBSL 1A7RL 3V79C 4X7SH 1N6UA 2ADJA 3ZTJH 2EKJA 3EZJB 1R0AL 5ERWA 5F21B 3BGFB 4PB9H 4ODHH 4IRJA 5E6IB 5CLWA 5IFHH 2V2TA 3DIFB 3T8XA 3C08H 4MJIE 1GGYA 2ESVE 2XIDA 4MNQA 5JHDA 1SVCP 1DVFB 5EU5A 1IAIH 3RVTC 4NKOA 5E8PB 2VB5A 3FT2A 1PX3A 5HHMD 3QEGH 2Z31A 3BX7C 1HYRC 3D5OF 1A0QH 4J3VA 2VZOA 3NACL 5DRXA 4Y4KB 3ZE0E 2NXYC 5T3XL 3RPIB 2OK0H 3QUXC 4O2CA 2QSTA 4HWUA 2BOBB 1RJYA 1KTDB 1FYTD 5IROC 2Y6SD 1TVDA 4WI7A 3QQ3B 3U9UA 4XPBL 1UWGL 4GG8A 2VLKA 4LSQH 2CDFB 1BZQK 4NKDB 2CUMA 5AWNL 1JNLH 4Y4HA 1OF2A 4YUEL 3TBWB 2D03L 3RWGA 2AJVH 4ZS6D 4EN3B 1JP5A 2NY2D 1U91A 2ZOKB 2W65A 5D7SH 2BVQA 4LP5A 2ITDB 4PJAA 2XV6B 3F7QA 3VFNA 4LSUL 1FN4A 4OM1L 4NKMB 1J0ZA 5EPMB 5D5ME 1HXYA 1MCRA 1BOYA 3C5ZD 4H0IA 3ETBF 3ZT7A 4ONHA 2VXVL 4IRJD 1QRNE 4EI6B 1RJZB 2OR7A 5BS0B 1U8IB 4FFWC 4WV1B 3L9RA 1T1ZA 3ZE2E 3ULVF 2NXZB 4ODBD 5DLMH 3BIKB 2HLFD 3O2VL 1Z6JT 4PLKC 5KVGL 1KPUA 1ED3B 1T22A 4X6BA 4LSPL 5GSVB 4OLWL 4PGBA 5HGHB 1HI6A 3BSZH 1IMHC 4GKOA 2LAAA 3HE6A 4WW2B 1I8LA 4JZJB 2X42A 5IWLA 5FHAL 3T1FB 3MFFB 1YPZB 3EOYG 5D7KE 4WY7H 2JTDA 4L1HA 1XR9B 1N6VA 4JDZB 1M6OA 2EICA 5FM5O 3WSQH 5GRXG 4OF3A 2FRGP 1WBYB 3V7AG 4F3FB 3D0VB 2NY4B 3VDAA 2VLME 1N0LA 1LE5A 4XP5H 3LB6C 1K4CA 4GRWE 1V3MA 3NIFE 3C6LC 4PJHB 4S11A 2OL3B 3IJSB 3MBEB 5DK3A 4NM8L 3S3JA 2VWEC 3MBEC 3ARSA 1Q38A 2HVKB 4MNGE 4HEME 1WBYA 4GJTB 1A7QH 3KPQA 3D39D 1MFEL 2WBJC 1RUAH 2AEWA 3MODH 2QQLH 2VDNL 5C0CA 3ZYJA 3C8KA 4OD2B 1AKJD 2QR0A 4ODTL 4OM1H 1HZHL 5DQDL 1GZPB 4UTBH 4LVNB 2AJSL 4XBGA 1B4RA 5BW7C 3SPVB 4YR6A 1T7WA 1M7IB 2XTJE 1AGFB 3MNVA 5CEZE 2EO1A 1I8IB 3DX6A 4YHNB 3CX5K 1DUYA 3H9SA 5E7BA 3B6SB 3KJ4C 4UNVA 5I8EA 1NC2B 4L29A 5E9DA 3QDGE 1QSFE 1OB1A 3NCJH 5L2KB 4ETYA 1YEDA 1ZS8A 1I4FB 3X3FH 4HAFA 5FA3A 1OGAE 3HUJA 2CLRA 1IEHA 3ARDC 1BREA 1MF2L 1DVFC 3ZLQC 2AV7B 1RZFL 5T33L 3PGDB 2RBLA 4PRPE 1T1WA 5E2JA 5TH2B 2R0ZL 3KPLA 1BVZA 1JMZA 4M02A 4KTEL 1KB9J 4Y5VB 3WXVL 1LDPL 3HG1E 2FLRT 1AFVL 4Q2ZA 4Z0XB 4FP8H 3WIHA 1C5DA 1DBBH 1ZT1B 2KZ1B 5F9JA 3WFDH 1P7QD 3E6HB 4K7PH 4YZFE 3WUWB 4BKLB 4G8GB 1G6RH 1UB5A 4MA1C 4I77H 1VFAA 3QCVH 4P4RA 4JO4H 1OM3L 3MLYH 4UT9H 6CGTA 4NQCE 5SX5K 4PJDB 3O8XB 4NGHH 3WV0A 4WWKD 1ZANH 4I48B 2C4XA 4HJGB 3V4PH 3W9DB 5KW9H 4KK6C 4NRYB 2VYRE 2VQ1B 2XICA 3UJJH 5DR5L 4P3DB 1TVHB 3WFBL 3IETA 1XF4A 3HZKB 4ODVH 4OD1H 1XGQB 4Y2DD 3OKKA 1Q0XL 5EO9A 5FK9B 3WS6C 4N9GA 3OAUH 2VRAA 1YEIL 35C8H 2P8PB 2K7PA 4B0MM 3DX9B 3TWCH 1NLBH 5D1QC 5IOPA 4FQCH 5AEAA 3VXSB 3HZVB 1JFQL 1IGIL 3H42H 1DANT 2EYSA 5H2BB 3FHQA 5SWZD 2PCPB 5FOJA 4G8IB 4EI5D 1OSZB 3ZDYF 5JPMB 4KFZC 1J12A 1EO7A 2VDRL 3M1BA 1KTRL 4M7LT 1LP9A 2OZ4H 1K4DA 1MIEH 1LP9B 5CHNB 1QYGH 1YNTA 1OL0A 1YPZF 1MVFA 1KCVL 4Y19D 2BVOA 3QXAB 1NJ9B