4WV1C

Crystal structure of the fgfr2 d2 domain in complex with fab 2b.1.3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
98
structure length
98
Chain Sequence
PYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redesigning a Monospecific Anti-FGFR3 Antibody to Add Selectivity for FGFR2 and Expand Antitumor Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/immune system
molecule keywords Fibroblast growth factor receptor 2
total genus 17
structure length 98
sequence length 98
chains with identical sequence F
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wv1C00
1KT2A 5D8JH 5EA0H 4MA1C 3SDDC 3RGHA 3AMKA 2IAMC 4TNWK 4P4KB 1P7QB 5B39A 1FZJB 3CFJB 4WUKH 1IGYA 4I2XE 1BOGA 3CSGA 2GY5A 4PRHB 4L4TA 5H37G 1X5FA 4FQCL 4KMTL 1BZ7A 3LKOA 2AJXL 2VDRL 3BKYH 3GSOB 5ESVA 1ETZA 5AYUH 1MCCA 3CNKA 1H3PL 5T5NG 3QEHA 4KGJA 3G6JB 4HX1B 1FHGA 1I7ZA 2YSSB 2E7LC 2ZCHH 1BD2B 1R5WA 1LE9A 1RJZA 2V2XB 3SE8L 2Z92A 3HG1D 1D5XA 4PJIE 2VR9A 1FNAA 2C1PB 1T7WA 1QSFD 4RRPG 3BO8B 3VU2A 1CT8B 1BFOA 5C6PB 4LP5A 1V3MA 5F6HJ 1G6RL 1HHIA 4FQQB 4XMKL 3DRQB 2XA8L 2X41A 3N85H 4KGLA 1JZ8A 4GMSH 2F53A 5EBMB 2UVFA 3WFDL 1FGVH 4PLOB 1X5XA 5AUMA 1MNUH 5IVXE 4HUUB 2EE9A 3SDAB 3BQUC 4LMQI 1X5ZA 3H42H 1QPXA 3V6BR 1L7IL 4OZ4A 4K8RL 3ULSB 1ZA3A 5FIEA 3KYKL 2UWEB 4ZDHB 1AGDA 2BRRL 1N4XL 4NKOA 3MYJA 5T3XE 2B2XL 2PKDA 3ARGC 3M1BA 5M94B 1TQBB 5FA3B 1XF4A 3RY5A 1T4KA 1DLHB 1I8LA 2ZJSH 3BJ91 3ELAT 4O5LL 1F4HA 1VADB 1FZOB 3JWOC 5I1JH 3MJ7A 3HUJF 3G04B 3SO3B 5IV2B 1A9BA 3O2WL 3VCLA 4NQCB 1CFSB 4HLZG 4QHMB 1YPZF 4N9OB 2A6JA 1FFNB 1BMGA 3FO9B 3OXRB 2AI0H 3HLAB 3KYNB 1JPTL 2VZOA 3ARXA 5EZJA 1EEZB 4IOFD 1KJ3L 5FOJA 1NEZA 3D3VB 3W9EA 4FN0A 5DUPL 3BKMH 5L0QB 5SX4H 2CR6A 3MV01 4WI7A 1SEQL 5KSBE 4XBPA 2XA8H 3PWLB 4EI5C 3STLA 5CWSA 3OF6A 2KZ1B 2YD2A 5DK2A 1MIML 2QQNL 4G42A 5ENWB 4LSUH 3QWQB 3HUJA 5IHZB 1YQ2A 1DQLL 4GXVH 2ZUYA 5FYKD 1FVCA 1UEMA 3DSNA 3H9SA 3MNVB 2YK1L 4KJYA 4U3HA 4XWGL 4K71B 1IGIL 4FTVE 1N7ML 2FIKA 2W9EH 4PY8J 5LGKA 1E4XL 3KJ4B 2AV1A 3CC5A 5IMKA 3VXMA 4L1HA 3LB6C 2DQUL 2XKUA 4JANA 5HBBA 1MHCA 4LKXB 2LU7A 5MEOB 3QDJE 1A7BA 1C08A 2IPTH 3G9AB 1JMZA 1OW0C 3EYVA 2FWOA 3GSUA 3FHAA 3KPOA 4XP6L 2B4CL 4PJFF 3QQNA 5D1ZD 1Q9KB 4KRLB 5LWYH 3TA3C 1UJ3B 4U1GB 2MFNA 4M9OA 1GGTA 1SMOA 5F72S 4UUJA 3G5VB 1QO3A 1T2XA 1DE4A 2FWOB 4Z7VE 3RL1A 4MA7L 4R96B 3GI8L 4HC1A 3FQRA 2VUYA 5BQ7A 4X6BB 2AABH 4HUWA 2WUCL 1BM3L 2LQRA 5HY9B 5MEPB 3TYFA 1AKJA 2DQUH 4Z7WF 4XWOC 5FKAA 4RWHA 4GRLD 1JF1A 3IFLL 5LGJA 1JTPA 3T2PA 3QDGA 1NBYA 2WIIB 3R1GH 3RWCA 1ZT7B 1E4JA 4FG6C 4KAQL 5BJTB 3GSNH 4RQQA 3F58H 4ZAKD 4MJ6B 5HDBF 3SKMA 3NPSC 3SDDB 5EPMA 3WHXB 1WWWX 3DWTA 3ZE0E 4JY5H 5JOFB 5BOZG 5EFIB 1HQ4B 4OI8A 5L9DL 5FK9A 4XBPB 3HPLA 4ONFL 1JYXA 1ZLSL 1A7OL 1A3RL 4XC3H 4HGWA 3BPOB 1VA9A 3VFTA 5IB4A 3EO1A 2FGZA 4IRSB 4URTB 1UB6A 3NAAH 1PG7H 4QTIL 4ONOA 1H5BA 3DMMB 1TZIB 4UDTB 2OJZH 4MWFA 3TM6A 5J6HA 3MV9D 5B3JE 2GITA 3S37L 1E0OB 5HSFA 2C5DC 1FZOA 4HMDA 4OCRH 2R23A 5EUKA 4HG4J 4JFED 1S9VA 2AJZA 2BDNH 1NSNL 3IRPX 3MUGA 5FHAL 4OZIA 5CBAA 3DVIA 3TPUA 1OAZL 3ZDYF 4X5LA 3FN9A 5J06A 3IDNB 4MQXD 3BP5B 1VEOA 1I1CA 4ZDHA 1P4IH 2B1AL 4PRIE 5DJXA 1ZT1B 2X7LA 3RWGA 2WK2A 5GRJL 3MOAL 4ZXBA 1WBYB 2R2HB 1ZLUK 5J11C 1I1AA 2MMXA 3A0OA 4BZYA 4PRAB 4KI5D 3X12A 1SYSA 4LHUA 4GMSL 4WFFE 3RUGF 4DTGH 4HUXA 3GM8A 5CBEA 1CLOH 3V4VH 2PW2B 2V5RA 3H7BA 3WFCL 1I85A 4JPWL 3SO3C 3L3IB 2Y7QA 4WHTB 3CH1B 1B0GB 1YYLL 3JWDH 4DCQB 1BPVA 1YY9C 2QHRH 2ADFH 2NLJA 3TGXA 3JV5A 4C59B 2PYFB 5C0ND 1BIIB 5E08H 1U42A 1RJYA 4G8GB 3CLFL 4UINH 3PABB 4PGDB 3JTSA 2VDNH 1RMFL 1RZFH 5TGBB 1FAKT 4Z7UA 3R8BB 1F58L 3CDFA 2X09A 3MJ9H 4XCYB 4F8QA 2WW8A 2EIZA 3OKMA 5E9DA 4ZFGL 3SKNB 5I8KH 4MNGB 3WFCH 4W81A 3KPRB 4P23D 4XHJC 5FDWB 4MXQC 2A77L 1R5IB 3QRGH 4LU5L 2FEEI 2VLJB 4HKJA 2KQNA 4LCCC 5D6DA 4D8PA 4JJ5B 2C26A 4KI5F 5JW3L 5IB5A 1XR9B 2D31B 4Q6IB 4LSQL 1FC1A 3O4OB 4PJIA 4AM0A 4RGMB 4M4RA 1DN0B 3RDTA 3U0PB 3PV6B 4H1LB 4O5LH 5E0QA 3D18B 2QQKL 1MHEB 3C08H 1RU9L 4FZ8L 5JW5A 1XGYL 2ICWJ 4RFOL 3WNNA 1MCEA 5IF0A 2ADIB 3LEVL 2EE6A 5DRWA 3C6SB 3MV7B 2EDRA 3HC4H 3RNKB 1GYAA 3QT2A 2D4DA 3MV8B 1I1YB 4CW1A 5MHSE 1YEFL 3BRDA 2FEEL 1N0LA 5EC1B 1LMKA 1KCLA 3GSVB 2H9GA 3SE9L 2GAZB 4L4JA 1YYLH 5B21A 3RZCC 2PYEA 5ILTH 1UZ6F 2C4XA 3CGTA 5E1AA 4X4YA 3CDYA 4RRPA 3QUMA 4ZXBD 1G6RH 4EEEA 4LSQH 3NN8A 1DEEB 2AJVL 5C2UB 4OFIA 4Y5VB 4M03A 3VW3H 1P6AB 4MDIA 4YBQC 5F7LB 4JGUA 3C9NA 4MNGE 3TNNA 5TQ0H 3DV4A 2FO1A 2IBZX 5DDHB 1R6VA 2BFVH 5DJ2A 2VIRA 1NDGA 1EVUA 3I85A 1WISA 2ICWA 5C0NC 3ULUF 1NFDE 4KVNH 3GJFK 3RHWK 3U1SH 4EZMA 4JN1H 1KIRB 3FL7A 1A1MB 4ZFGH 3NIFE 5CCKH 3T2QA 5HYIA 4JKKA 3QO1B 4U3CA 4NNYA 4UNUA 5F3BB 1CTNA 4R8WL 1UWXK 2VERN 2BVYA 4JFEA 4HZAA 1WZ1H 2VAAB 2F8OA 3NCMA 5F9JA 3ETBF 2DM2A 2R8SH 3FHQA 3IS1X 4ZO8A 3KNBA 3MYJB 1KJMA 5IB2A 2P43B 3UTQA 1RURL 2IH3B 3VRLE 5IVXB 1SEBB 3CIQA 3MLYH 3S4SG 2R9HD 3TNMB 5DQ9A 5AYQA 5EU4B 3U7WH 3HRZB 1CLYH 4H25B 3VWJB 2Y06L 2R56L 3BXNB 5D72H 4Y4FD 2ZCLH 3S5LG 4F3FA 5FAAA 1KOAA 2DMKA 1AP2A 5KJRH 3P0GB 4HUVB 3IFPB 4N0FA 1MHEA 1HHIB 2W65B 4RBPK 4EI6B 4GRLA 1XGRA 4Y5XA 3RGVD 5GS1B 4Q74A 2IFGA 1GSMA 4LEXH 4XI5C 4OV6F 4B7IA 2D31A 4Q6IA 4L9LA 2H9GB 5F1KC 4XNQA 3FT4B 4IS6A 1HNGA 1N2RB 1KJVB 1Q9WA 5IEKA 1YNLL 2R2CA 1S3KL 3QDGD 4NQCE 5T1KA 1H3XA 1XF5B 1IE5A 4OKVA 4HH9B 1RHFA 2Y1VA 5D7IE 3W0WD 5EULV 1ETZB 2XTJB 2GYSA 2X1WL 3P77B 5HGGS 4NNXB 1RI8A 2WWKO 1HOCB 4EN3C 2ED7A 4R4FH 1GCFA 3T2NL 4AENA 3F62A 1N3NB 3RKDD 5FM5M 3BN3B 1U36A 1U8NA 4MAUH 4HKXB 4IOIA 4R9HA 5HI5D 4U05A 4R0LC 3MV9A 2R9HC 3CFJA 4OT1L 1GGCH 4OZFA 5H37H 5DFVC 3IJSA 3LKRB 2G60H 3TIEA 4R3SB 4HC1L 3BZ4A 4IJ3B 5DR5L 4XVSL 4YDVA 2E6JA 4JJ5A 4M7ZB 4D8PB 3GHEL 5FGBA 3S3JA 2CDGB 2IADA 4BA8A 5F7DA 1B0GA 3ULUH 4HZLB 1MRDL 4M1GL 5F7KC 1G7JB 3WEXB 1YDPA 1KCVL 5E70A 2MKWA 3SDYH 5IT2L 4W68A 2QSCL 3TCLB 3KXFE 2M8XA 2W0KA 4OIBA 4Z7WB 4ZUWB 3BH9A 1D6EA 1N7MH 5DJCA 1WFOA 3QIUA 5AZ2H 4JM2D 1ZE3C 1TVHA 1YEIH 2GT9A 1WCQA 3BPLB 1PEWA 4PLKC 3SQOH 1B4JL 1HWHB 2C4FT 1MJ7H 3Q6GH 5F7FA 3DX8A 5KSVB 3ULUL 5L8JB 1JK8B 1OSZA 1K4CA 1EEYB 5DMGD 2DS4A 2P7TA 3LQAL 4XPBH 4QY8B 4R26L 5ISZA 3L7EA 5IHUL 1MFBL 4NQDE 3WXVL 4LHUB 3U6RB 1K5NB 3QJHB 1QFUH 3BHBB 3RGVC 3NFPB 3G5YA 5FXCH 4BSVA 4YPJA 3V4PH 1EK3A 1TZIA 4UDTA 1AO7B 5HPOA 3AGVA 2Q8AL 4ZG1A 3TJEH 5DSCB 4Q2ZA 4P59L 5CEZE 4NUJA 5FO7A 3UJTH 3QUZC 2E3VA 3GNML 4YUEL 4MA3B 4KAQH 2R39A 1RZKC 2DMBA 4MD0B 4WTXA 5IKCB 3RHWF 2VXSL 1N4XH 1GAFL 5IMLB 1YN6A 4FG6D 1NCUA 4OFKA 2HT4C 5HGHA 4ZPTA 2NPLX 3K4ZA 5HI4D 2BXYA 4ZUSB 1M6OA 3PIQB 4YDLB 3B8YA 2DQEH 2X4SA 3UXFA 1OAYH 1UM4L 3QEGH 4NKMB 3IVKA 5TDNA 2CKBB 4K9EC 5EOQH 1P4LB 1PLGH 5IK3B 2J6EH 4JFDE 3HG1A 2J8HA 1DBKH 3HS0B 4U6XA 1WWAX 3SDCA 2NZ9D 2P48B 1QZ1A 4OLXL 2YZ1A 1WTGT 3RDTD 1ZWIB 4AIZA 1CI5A 4YHKH 3OHXA 5I17B 4FFZL 2JCCF 1CGWA 2EDDA 3SDDA 5CGTA 4MQ7A 4NGHH 2DI8A 4L4TD 3KPLB 1CFQB 4JDTH 4X4XB 2C3VB 4XVTL 4ETQB 5IG7B 3T4YA 3G08A 3QHZL 3BGFB 4PRPB 4H26A 1Q1JH 1MELA 4PRDA 1I9IH 2JJSC 4QWWD 3WNPA 3SBWC 3KPOB 1CG9A 3P4NB 3SCMB 2DQDH 2LTQB 4RGNB 5KSUA 2AK1H 4NKMA 4F37F 3B2VH 3VFSB 2QQQA 3LEYH 2J1KA 3KPNA 4RWYL 2Y25A 1J0YA 5IMOB 4M62H 3TP4A 2FL5B 5BS0A 3GSRB 4MJ2A 1OPGL 1RULH 3HC0A 5BMFL 1MCHA 4XP9H 4Y5XC 4WEBL 3PP4L 3ARSA 2CK0H 4YQXH 2CKBL 4IRZL 3IVKB 3DLQR 3E8UL 5SWZB 4DJMA 1F2XK 4GFTB 1RUQH 1WBXB 1MF2H 4N1HB 4P4KC 4PJAF 2ZUXA 4LHUD 3SGEI 3GUTB 4JY6A 1NQBA 2OR9H 4M7JL 3VGDA 3G5YB 3GMLB 3P0YH 5GGVH 5DJ0B 3EYQC 1ZANH 3U2SB 3VFGL 1AQKH 3VRJA 4U1MB 4I9WD 2VL4A 5KS9F 3ROOA 1JNHA 2WV3A 1S3KH 4KC3B 4XAWL 2V5YA 3NZHL 1FSKC 4LHJB 1T7VA 4YE4H 1RSFA 1X4ZA 3VI3E 1EBPA 3H9SB 1CE1H 1FDLL 1EO8L 1N59A 3MRBA 3S37X 4NUJB 5GRUL 1EEYA 4LSVH 2AJUL 2HVKB 1QRND 3K8MA 3L3HB 3GSQA 3T04D 1ZS8A 2FYYB 5J13B 1YEEL 1HKLH 1M7IB 5D2LE 3WCYA 4ZOCA 1KGCD 1D9KD 4GW5A 4PGBB 3RJQB 3NFPA 4NRZB 1AGBA 2IG2L 5D2NE 3PL6A 2D7OA 5E94A 3P73A 2GCYB 3BH9B 5ISZB 5TFSH 1NLBH 2CDFB 1RZ7H 4NKOB 5JTWA 1A7RL 3QCVH 1VGEH 4YXKL 1GXEA 4HXAL 3Q6GL 4H8WL 1NDMA 2MHAB 3U30B 1ODAA 1M71A 4M1DH 4X4ZA 3C5ZD 4HZLA 3ARWA 3MLRH 5ANME 2P45B 3SDAA 5IEHA 4PR5B 1XGPA 1MFCL 3G04A 1JNJA 3IXAB 4HWBL 4XX1E 3VFPA 1ZHNA 4HUNB 1I9EA 4Y16A 4JFZL 3GMRA 2HFFB 2ZOKA 2HMIC 1T4KB 2JB5L 2EDTA 3TBWA 1T1XA 1YJDH 4K23H 1S7SA 1WAAE 4M8VA 3MJ9L 4PRBB 3MZGB 2JCCA 3MRLA 1U8NB 2VL5B 3MJ8A 2GTZB 1OWWA 3A67H 1W0WB 3QZWA 5D2NC 1J12A 3BDYH 2FH6A 1F8TH 3RZCD 3H9SE 4ODVL 3ZDXE 4G80A 2NTFA 4DVRH 4I3SH 3VXSA 1YC8A 2EDXA 4Z76B 4K2UH 2ZSWA 5KZCD 4G9FA 4R3SA 1VHPA 1KJVA 5IEKB 3S36X 3D69B 2I9LA 2XG5A 1CZ8H 4J8RA 4N0UA 5IWLA 4XXDA 4B0MM 3EYQD 3C8KB 2ESVB 3Q0HA 1EBAA 5FCUH 3CVHB 4HCRA 5GZOC 2Y5EA 3UCRA 1EDQA 3HI5H 1YZZA 1HZHH 4PJBF 1G6VK 3E6HB 4P3DB 1R3KA 1RK1A 3QUYC 5D7KD 2FZ3A 1JPSL 3N06B 1DJSA 3IF1A 5GHWL 3WS6A 4HKBB 4N8VG 1YA5A 3NCJL 1A9EB 5DC0A 1B88A 1BQSA 2VL5A 4N8CL 3VE0A 3UROR 5E03A 1LE5B 1F3DH 3VWKA 3L3OA 2F74A 2IPKB 4XPGH 1ACZA 4LSRL 3H2WA 1UQSA 2VAAA 4PGZA 1T66D 4MSWA 1B90A 3CSYA 3IXAA 1BX2A 2Y6SD 1I7TB 4K8RD 3ULUE 3FQXA 5EU4A 5EC2A 3HE7B 1N8ZB 1SEQH 4F7EB 3M8OH 3G6JF 2FR4B 1Y6MR 3OKDA 5D93C 2X4QA 1F02I 3KDMA 4K3GA 3QUZA 3B9KA 4OCLC 5C0BA 3DGGA 3L7FA 1MCWM 2ICWB 3X14B 4PIRF 3ARGB 4ELMF 4MB5A 5FHBL 4NRZA 5I1AA 2W0FB 3JV4A 4WCYH 2O61B 1RFDL 1G9EA 4NT6A 1UKQA 4TUJA 1FC2D 4Q9BA 1KCRH 5ESQB 4HIJA 3BSZL 4IIQA 5K9JH 1KC5L 4RIRB 5E1AB 2UZIL 2ADJA 2VR4A 4JO1H 5E95B 3OJDB 3CFCL 5GISH 3THML 2ATPA 3ABZA 4EUPB 3IDYC 4LDEB 2P8LA 5KSBA 4X5WA 1QLRA 2Y9RT 3LN5A 2CH8A 4WFHD 4ZUVB 5J3HC 1OTTC 4HAFA 5DLML 4FQXA 1GHFL 3NN8B 1FL5A 3NCJH 4MCZA 4WCYL 2OTWA 5D1XB 4AG4H 1ZGLB 1GGCL 5F70A 3RTQA 1IGTA 4Y0GA 1DN0A 1K8IA 2EH8L 5KVEL 1LK2B 3GMMB 5LCVL 1FV1B 4QYOA 2VC2L 3RA7H 5IB5B 2X70B 3O3BA 3P2TA 1YMHB 3QR2A 1ADQH 5JMOC 3EJYD 1IFHH 3OKOB 3U9PL 4YDIL 1T1WA 3KPNB 3C6SA 3MV7A 4GAGL 1FO0B 1QR1B 1AE6L 4KK9C 2Q7YB 3KPRA 2VSDA 4JHWH 2EECA 4K8RC 4OD3H 4OLWL 4TUOB 3N1GC 4HBQA 3S4SA 5CIPB 3O6FA 4ZPVB 1IBGH 4KPHH 4NDMA 4KZEL 2CRIA 1R3KB 1ZOXA 4MD5A 2FEDD 3MRNB 4JPVH 1RUML 5E7FA 1KTDA 4TULH 3OHXB 5I17A 1MCIA 4XPHH 2Y06H 1YY8A 4P46D 1QVOA 4R7NB 5TH2B 4BQ9A 2EIDA 2F5BL 5DRXA 1CQYA 4F33A 3L6FA 1F13A 3JTTB 2ESVA 2JKXA 3ZE1E 2EKJA 4O2EB 2HRLA 2LU4A 5C0CB 3MRHA 5F7YC 1A8JH 1H3WM 5F88A 2NX5E 4Y2DC 1A6UH 2FHBA 4X6DE 4PTTB 2ADFL 3N1QC 5DJDB 4BZ2H 1JPGA 3VXRD 4LPXA 2WQRA 5D1QD 5T1DH 4GAFB 2O26U 1M6OB 4HFWB 1JPFA 1CFTB 4JRXD 2JIXB 4H8WH 3EDDA 1QFHA 1OAQL 3QG6A 3T3PE 4M1CD 5FEBA 3G5XA 1HE7A 1RZ7L 4OD2A 5BOPA 4OZIF 1OY3B 1EHAA 1IVLA 2V5MA 1OCWL 3S98A 4ODVH 1MJ8H 3BJLA 1CU4L 1MFDH 5DHVH 5HYFA 5HYSG 5JW4R 1CL7L 4HS8L 4KRPC 1R3IL 4G43B 4F9PC 3I02A 1CYGA 4NM8H 4D9LL 1QBLL 1AGEB 3NOIA 2GITB 4OAWA 2IPTL 4K3EL 4FXKB 1LDPL 3ZO0A 3N1PC 3BWAB 5KSAC 3U4EB 4PBXA 1IT9L 4JZJB 4UTBH 3V4UH 4HLZH 1H0DA 4HIIB 2X9WA 1DBBH 1Q0YH 2IQ9H 1GZPA 3ORJA 4QNPF 5BW7A 5I8EA 1J05B 2PO6C 4JO2H 1MI5A 1GPOL 3QEQD 2VXQL 5DYOA 4XNMA 3TN0B 1SJEB 3FN0L 5I73C 4LK4A 2BOCB 2G75A 1NMBH 4KTYA 1FN4B 4IRZH 1CFTA 1H3UA 2QQNH 5CSBA 1B9ZA 4YBHA 5INCB 3TH2T 4J3WA 4NN7B 3WS3B 1ORQB 1WSST 1OD9A 4LQ1A 3REVB 4Z18A 3VGBA 3EO1B 2V7HB 3EJJX 3MROA 3ARQA 3RZCA 5C08E 4HGWB 4WJ5A 1XH3A 4ALAL 5D1XD 3BDXA 5C6TL 5SX5K 2AI0L 4LCUB 3C5SA 3RNQA 4YAQB 5DT1L 4ZO6A 1AKJB 1OLZA 1CFNB 1CE1L 1FDLH 1FFOA 3DMMD 3BP7A 3B2VL 4AEHL 2E7MA 2H26A 4OQTA 2P8PB 3I2CL 4HUWB 5JIPA 4K9EL 4YC2C 2I5YL 1ZANL 3JBG7 4M5YH 4NQSB 1A47A 5I15L 4HIXL 4K3DL 3TFKC 1CE6B 1ZLVH 2YMXH 1Q9OA 3DI2B 1J8HA 4A2LA 2AXGA 1PZ5B 4M8QB 2B0SH 5HDBE 4HIEA 1NJ9A 2ARJQ 1AY1L 1Z2KA 5I75C 4EKXA 3VWJC 2CIKA 3HFML 3GMOA 4NNXA 1NFIB 5C0AA 3QQ3B 1M7XA 3UEZA 3Q6FB 5DEZA 5GGRA 1DQJA 3O8XB 4WW2F 4WW1B 5KVFL 2PW1B 5E2TL 5GS1C 5D7JB 4I77L 2AV1B 4LLDA 2F19L 4BQCA 2NY7H 3GRWL 2FD6H 3WUWG 4B53A 4JPKL 2BNUA 4JFFA 1LK2A 1UZ6E 1CICC 2CUHA 1JHLL 3V5HA 1QUNA 3N9GH 4Z0XB 2HFTA 4GRWE 3UTPD 4N0FB 3IU4H 4MXWH 2BJML 1K3IA 3P4OB 1R5VB 4TRPL 1F42A 5C0CD 4P2YA 4WI9A 3KLHD 3H7LA 2W9EL 3RVWD 3HZMA 4LGRB 1XIWD 4HWBH 3PDOA 4HMEA 1CIDA 1U91A 2NY1D 4DVBA 4LLWA 1T5WA 1FYTD 2R0LH 4EUPA 4WHYH 2DN7A 3Q1SL 1UH2A 4POYA 1T03L 3GJFB 2EYSA 3MREA 4PJAB 1YY9D 5FM5O 4KQ4L 4UQ3A 4M9PA 4ZFZA 1VEMA 3FO9A 4M7KL 4E42B 4YHPB 3QI9C 3ET9F 4HIJB 1T22A 4NZJA 4AQOA 3ALWA 1BGXL 3O9WC 4KDVA 5BS0D 1KIPA 1NCNA 2HFGL 5HGHB 4A6YH 3IGAB 2YD5A 3TN0A 4AEHH 4KDTA 4YHYC 4M7LH 2J12B 4QXUH 1W72B 1X5LA 5F8RC 2VKWA 3M1BB 3V5DB 5I30H 4Y16C 3KDMB 3UP1A 1H8NA 4IMKC 3T08A 1UKTA 1D9KA 1JGLH 2D0HA 1E6JL 2X4RA 4RNRB 5I16A 3F65A 4PY7B 1MJJA 2I60L 3O6FD 3BWAA 2GEEA 3QP3A 4YZFF 1HHKB 4BH7A 3DV4B 2FJFB 3H9YA 4DGYL 2EO9A 3B5TA 4OM0L 4O2FA 4MNQB 1AGEA 1WAAF 4PJDA 5F7EH 4M5ZL 3FQUA 1S9KC 2HKHL 3MV7D 1OAXH 4PP1D 1UB5B 3CFBA 5TE4H 3EYFA 5EB9A 3RBGA 2XKSA 3LEXB 4K3EH 4NO5A 4MNHA 5JIHA 3BISA 3R1GL 4HJ0D 3ZSTA 4PBVC 5AWNH 3RWFA 4EIZC 3QG6B 1A5FH 3LN4B 1F3DJ 4Q9RH 2FZ3B 1FAIL 4OD2B 1CK0H 1VPOL 2GJZB 5JZ7C 4GG6B 4OT1H 5AUMB 4LCWE 4HS3A 3STZB 4U1HA 4XNUH 4MAUL 1CL7H 1NCAL 1XR8A 2OZ4L 5EU6B 3LKOB 2NY4B 2X4TB 4U2YA 1JPGB 4ORZC 3V79C 1FL3A 4G7YL 4WW2A 1A4KA 2VR5A 4AM0B 2L7UA 4TPRH 1MQKL 3D69A 1FNHA 1LO3H 2OCFD 4PV9B 1U6AL 3B2UD 3QEUB 1TZHA 4X4ME 1FNEA 3GB7A 1AXSB 3VFOA 2ZSWB 3GBMH 2OJEB 3QNYB 1RZIA 3FONA 1AJ7L 4HXBL 4EIGB 1NAMH 4IRJC 1F2QA 3O45A 3C60A 2IAMB 1YYMH 5FYKU 4GMTH 3EHBC 5EZIL 2RCSH 5AAWA 5JQ6L 5E8NB 3E2HC 3WDJA 3IXTB 4P2RA 2BNRA 4RBPH 2YS4A 2ZP0T 4TSCL 2QADC 4GH7B 1LO0H 1FO0A 3F7QA 5DRZB 3VXOB 5I1KH 2DF3A 3O4LE 4NP4H 3VFVB 3ARDC 4QHLB 5JIKA 3GB7B 3R06A 4Z7VA 3FRUB 4R6UA 5A2JH 3CLEH 5DUPH 4X6FA 5MERB 4QXGH 1IGTB 3MQIA 4JM2A 4MCZB 3OR7B 2NZ9C 1S8DB 2EDOA 5DMIL 3VWKD 5C6WH 4F3FB 1Z5LB 4GAGH 1I1AB 4GAYB 1YPZB 4JPIB 3MBED 3RFZC 3MFGB 1A3LH 1S9YB 1F4XH 4YHOL 3C8DA 3GKWH 1QLRB 5IJVA 4OCSL 3T0WA 1KCSH 4IOSD 5FGSA 4E41B 4BZ1L 1SEBA 4OB5H 2EH8H 5KVEH 1TNMA 1OB1B 1L7TH 1MEXL 4QKXB 2HP4A 2AK4D 4XGZB 3KPSA 3MRRA 4NN5B 1G7MB 3M45A 3HZKA 5E6ZA 3FFCA 5AD0A 5I8CA 5BVJB 1J5OL 3L5IA 1NBVL 3FB8B 2FJGA 3NFNB 4WHYG 5ILTL 4KQ3L 1I8LC 3KXFB 5ACLA 5HVHB 3JV4B 4OJFL 4QF1B 2NMSA 1OP5K 2A2QT 3DX6B 5C0BB 5FGBC 3B5HA 3HNVL 1ZT4A 5DJ8A 4XVUC 2WUBH 1CIUA 3OKDB 4XCNA 1ZA6B 1D9KC 4FOMA 3OR7A 5J13C 3Q5TA 3U7YH 3WFEL 3ALPA 5DJ2B 2OQJB 3AS3A 1J18A 5T1MB 3TPKA 2I9TB 5SWSD 4G8FA 2R1XB 5A16A 3QIUD 43CAB 5GS2H 5CP3A 5CINL 1G7QB 2QQKH 4GBXD 4Y4FA 3UJJL 4PYHA 1T3FB 3D0VB 4LAQH 4GQPH 4X6CA 3HAEB 1CG9B 4QRTA 3RWHA 2VQ1B 2K7PA 1TCRA 2X9XA 3C5ZA 5I74B 1LEGA 4DZ8A 1LE5A 4FRWA 4ETQA 1TZGH 3V6ZA 1A1NB 1TJIH 4TSBL 5CD5D 3WIFA 3CXDH 3AY4C 3MV8A 4WNQA 1KG0B 3IF1B 4HJJH 2A83B 2BMKB 4OQTL 4M4PA 2BC4B 1EFXD 1KLUB 3VWKC 4WHDA 2W0PA 4S1RH 3SQBA 4G7VL 1OF2B 2ZG3A 3P4OA 1AGFA 3PP3H 4YDIH 3ECBB 1TJGL 3I75B 1IQWH 1G1CA 3D18A 12E8L 3U4BL 3UC0L 4ODTL 5EZIH 1J86A 6CGTA 5JA9A 1FNLA 1QG3A 4GRWF 1R0AL 2WINB 2AS5M 4S11A 3VXRE 1NCDL 3T0EC 5MENA 4UU9B 5TF1L 4WW2B 1IZJA 1R3HB 1QQDB 3QI9D 2YA1A 4GRMA 4OLZL 2XRAL 3SCMC 2PO6D 4YHML 3BT2L 2B5IB 1TIUA 5FKPB 4ZUSA 4QEGA 5F1NA 4RAVA 4ODSL 4K94L 2CIKB 1EUTA 1K6QH 4PB0H 2GTZA 4HD9A 3RWFB 1ACYH 3FMGL 3JVGA 1T83A 5HPMA 3QUYD 2V2TA 4ZYKA 3MO1B 4LVOB 4QRSB 3QSKB 5EOCJ 5GIRA 5D7LE 1X5JA 5I1CL 5DD6B 3GMPB 3H0TB 5J0BA 1DLFH 2NLJB 2VZTA 1Z0MA 3DX7B 4BSVB 3EKCA 3CDCA 2EXYD 3OX8B 4NZTH 2C3GA 4ZFOA 3QJHA 1TZGL 5IJKA 5HYEA 5GXBB 1HHKA 4O02L 5T3ZE 1C5DB 2P5WE 1UACH 3JSSA 4QRQB 1IM3A 4HUXB 2HFEB 1ZLVK 2VDML 4JPWH 1IRAY 4YZFE 3RVVD 3V0VA 1JK8A 5TE7L 4GT7A 2DBLL 4JDVB 4V2BA 2AW2A 4M5YL 1IC5H 2ZCKL 1LNUB 1LNUA 1LEIA 1S7XA 3MRGB 3OJVC 3CVIL 1T0MA 2DWDB 4K3JH 1RVFH 5DFTA 3WIHH 5HHQB 1ZLSH 5EWIH 4FQ1L 5D5MF 1OP5H 4PJGA 1G0YR 1OGAB 5GRVL 1RQ5A 1CN4A 1JHLH 1HI6A 5EO1B 2ED9A 3TVMD 4N8VA 2CR3A 4OF7A 3PQYE 2Z35A 4P2OB 2XYCA 4FXGB 1QYGH 4XCFH 3U2SA 3P40A 1I1FA 4N1EA 3TO4C 1NFDA 4LLMB 5KVFH 3RVXC 1A6AB 4R0LA 3F58L 2NY0B 1YEEH 2DQEL 5JR1L 2CK2A 1G9NL 4K7FA 5DI8A 3KHOA 4ELME 2PYED 1U8KB 4UV7H 2H1PH 5CEZD 1QEWB 2P44B 1TQCB 4M93B 1OTUD 5F44A 1QBAA 4YFLI 4F9PA 4KY1L 4L3EB 2HH0L 1BQLL 3F8UB 3BP4A 1J1XH 1A6ZA 2L4OA 4JEGB 4HLJA 4FMKA 3G5XB 4XVJH 3S88L 3B9VA 4KVCL 1AIFB 5D2NB 1URLA 2E6QA 4M6OH 5CZVL 4PJHF 1JGUL 1I7ZB 4G7VH 4NFDA 3T3ME 5KTEH 3VD9A 4OKVB 2NR6C 5FKPA 2DLFH 4KHTL 3BKJL 4G6JL 2FIRT 4JDZA 3VXUD 1R3HA 4U1GC 1RUPL 4KJPC 3LKSA 4WUUE 4JY4A 1NANI 2AXGB 1JHTB 4PJEB 2EZ0C 1CXHA 4JFQB 4D0DB 3C87A 3L5WA 5FOBA 1E4XH 1DUZA 3BKCL 4NNPL 4XMPL 2LVEA 4WWID 3OXSA 4PJDE 1CD0A 1IGIH 1OVZA 1PY4A 3QDMA 4JAMB 3OG6B 3W2DL 4I3GA 5JHDB 1RHHA 5CEXB 4Y4FC 2EXWD 1HXYA 1U8LB 1FL6A 1CFNA 2N4IA 3BP7B 4N0YL 5KOVC 1IL1B 2AEPL 2OI9C 3VGFA 1NEZG 4MJ4A 1YEDA 5IB2B 4ELMB 3KNBB 2WLZA 3HAEA 1XH3B 3BGMA 2YMXL 3TO2A 2UYLB 3IJHB 1VFBA 4P9HL 1PLGL 3CXHK 2APFA 4KROB 5SV4A 4JANB 5E8DL 2EDBA 1JI2A 3V0AC 2ARJA 1YN6B 3WFEH 5INCA 2VDOL 4MJ5B 4LAJH 1CGTA 4MX7B 4IDLA 3VFNA 2I9TA 3S8WA 1F4YH 1SBSL 4WV1A 3GHBH 4EXKA 3HNSH 4NQVB 3GSNA 4HHAB 2YUVA 3CX2A 4NQCD 3NCYS 4FQXC 5FYJU 3DETD 4D9QD 2XZAL 4J6RL 5EOTA 5KSBB 1F4XL 4WWKB 5KANI 1FZMB 5IM7A 1AO7E 1AO7D 1N5AA 2V9RA 4OCYH 4U7KA 3SY0B 2EXYC 5IW1B 4ONGH 5IOPB 1F6LL 1BBDH 1YEGH 4LRIC 3RVUC 1BJ1H 4ZTOH 3MA9H 1OPGH 1RULL 3QIBB 3DX8B 4U6VL 2YKLL 3O3AB 4JM2C 5D7LD 5K9KA 4JB9L 3MV8D 4ZSOB 3QUMH 3SGJC 1CICD 4Y4KB 1QA9B 2AEQH 2NZIA 3IFOA 3ZLQC 1P5UA 3EDEA 1KPRB 4JDVA 4S1QH 3CLEL 3QUXB 3CFDA 3SQOL 1E28B 1OP9A 1IJ9A 4AH2B 4TVSa 2X4QB 1MCOL 2AJ3B 1S7WB 3HB3D 4PJBB 3TCLA 2NY2B 5CP7A 4OTXL 3VH8G 2EIEA 4FQPA 3TT1H 2CDEA 5C7XL 1CICA 5BO1H 2Z31B 1DQTA 5CD3B 3ISWA 4Y1AB 4OSUH 3R06B 4Z7VB 1B3JA 1NAMA 1BGXH 2OSLA 3ROLA 1N6UA 2F53B 4M1GH 1P9MA 3SE4C 3ZE1F 3VFRA 3L3OB 5C2BL 3WIIL 2DQHL 5CLTA 4JGMA 4TUKL 3LQMA 3VG9C 5BXFB 5JOPE 1FJ1B 1M05A 3WFDH 1GGBL 1MLCA 3D9AL 2VLLA 4KKCC 2FEDC 3C60B 3MRMA 5HHPA 4G5ZL 5T3ZH 2HT3D 4PGDA 5BXFA 3V8CA 3P0VL 4AENB 4NQDA 5IQ9B 1KFAH 2AQ1A 2YUXA 4FQHA 4ZQKA 1A7PH 4JFDA 5HVGB 4J3OC 4OF6A 1QSZA 3PHOB 4IBLT 4PJ9D 5C09D 1JL8A 1T7XA 5C07D 3MCLH 4D0BB 4H20H 4Q6YA 2OJEA 2D2OA 3O2VL 3MLWL 1A0QH 3L3IA 1SM3L 3KLAB 4NFBA 4YXLH 1YMHA 3MRCB 4S1SL 1L7TL 1MEXH 3T77B 3KLDA 3QEUA 1DQQA 3D39B 1QFWH 1GGIH 1MCDA 3EJZC 2UZXB 3UJIL 5J3HD 1RZ8B 2XFXA 4S2SA 4FABL 1J8HE 3VD3A 4LEXL 4GXVL 1YJDL 3FFDB 1LVEA 2X4TA 1A3LL 4YHOH 2XN9E 5DQDL 5ICZA 5SWZE 1KEMH 5HYJA 3CK0L 2NNAB 3IFOB 3BPLC 1J10A 3HFMH 2D0FA 3BQUB 2CIIA 1T0NA 3LN4A 4RSVA 3QUKB 3TNMA 4UBDC 4L9DA 1QFPA 4RGOH 1LEGB 3NFSH 2F8XC 4MNHB 2P47B 1TTUA 4X80L 5DHVA 3QDME 2Z91A 3LKNA 3MRQB 2ZCLL 1ZHNB 3ARFC 2J5LB 1B6UA 2IGFH 4F80A 5AEAA 1MCKA 3AXLB 1QSFA 5GS3A 5CFHA 4O58L 1TCMA 2FJHA 5F3BA 1RD6A 1ZAGA 1U9KA 1K2DB 4Z77A 4WFGE 5BV7B 3QI9B 1MJJB 2YD8A 1RURH 2X4UA 2CRZA 1IKFL 3P3YA 5GGRY 1MWAH 2J2ZA 1UADC 5IHLB 3EYSH 3O9WB 2NY5L 1A1MA 3B9EA 2P42B 3NPZB 4C55A 4PRNA 4LF3A 1YNTB 2RR3A 4M43L 3IKKA 2PR4H 2ZPKL 4YHLH 4OLYH 4MX7A 3O41A 4MHHG 1ONQB 5IBTH 3IDMB 2X1XR 5I6XB 2Q86B 5CS7A 3FQXB 4N8PA 4W70A 1RIVH 2XZQL 4ZS7H 1FBIL 3CMOH 1J8KA 1CDHA 3QUMB 4UOW0 5DEFA 4HK3N 4ZFZB 5EZLA 5HHXL 2FSEA 2W91A 2BJMH 1G7MA 2YD4A 1U8QA 4Y4HD 3H3BC 3CMGA 4LDLB 4PREB 2VITA 1BLNA 2CLVB 3QG7L 3QUXD 4PRIB 5EUOA 5LGJB 2J4WL 1S7TB 5E99H 1GC1C 5ADPH 4PJXA 4MD4A 2ZG2A 3FO2A 3O6KH 1NUNB 1UM5L 3KPRE 3RNKA 5JDSB 1NEUA 3QZWG 4HJ0C 4JAMA 3BGAA 3FQRB 1G6RA 1I1AD 3SHSA 5E8EA 1KBGH 5MENE 2PR4L 1BBJA 3L5WB 3QIWD 3DXAD 3KJ6H 2BSSB 4S1DC 3PV6A 2B1AH 4H1LA 3FMGH 1CU4H 3FO0H 3HC3L 4JM2B 4HWZB 3BQUD 4PV8A 1BD2E 2BNUB 2F54B 2DJSA 1MUJA 3TEUA 4M5ZH 1P2CA 1UVQA 1Q0XH 2APBA 4ODBD 4ZUTB 3FRUA 2Q6WA 4HWNA 2VLJD 2NW3B 2EC9T 4U1IA 5C9JA 5IR1A 1LEKB 5I1GH 2D7NA 3VFSA 3IDIA 4HULB 4MA1B 3OAUH 1KGCE 4U1KB 2XQYG 4HPOL 3TA3D 3MV7E 4JFDB 5C0JB 4GSDL 4DKAA 5DZOA 1R5IA 2R2EB 3L5JA 1T89C 4PJXE 5E9DB 1Z0NA 4HV8A 5I9QB 4Y5YB 3E8UH 4PRDB 1HSBB 5HHPB 4FNLL 4MNGA 4L8CB 4GG8B 2C7UA 1L9NA 1IAIH 2DLGA 4GS7B 4HIEB 1QBBA 1FJ1A 4QXUL 5DTFB 3TN0D 3WIHA 5JR1H 4FQ2L 4I3RH 4PG2C 3V6FA 4HFUH 3ARUA 4CU7A 3TBWB 1CE6A 4N5UA 1PSKH 2XZCL 1ZKAA 3DURA 5BVPH 1LWRA 1XGUA 5KS9B 1H3VA 5I1GL 3SDAC 2DI7A 5EG6C 2VLMD 3CH1A 2NY3C 3FTGA 1RIHL 1X9QA 4LPTA 1GOHA 4LCUA 4ODUA 5ALBH 2G2RB 3E2HB 1FFOB 3QH3B 1OHQA 2Y4SA 3EGSA 1GJIA 5EBGA 2GSGB 4ODWA 1I3RA 5FO9B 1FYTA 5EDXA 1ZHBA 1RPQA 2AJ3A 4Z7OE 3CVHL 1CGUA 1AD0A 3LOWA 4QRPD 1Q1JL 4TTGA 3C09B 3OWEA 1KBGL 4KTEL 4JFZH 3CD4A 3PIQA 5I19L 4Z8FH 1VB9A 5C0IA 1T0MB 1T0PB 2DWDA 3I6KA 3MV8E 2DIJA 2PTTB 3OMZA 2H1PL 4YHKL 2UV3A 3ZHDA 2Y36H 3MLPA 3ARDA 5JHLL 4X5XA 5L2JB 4LCWD 3P0VH 4JFFD 5I1LB 2Q76A 3WUWB 3LIZH 3ILQC 3ILPA 2BSRB 5JXAH 1I1AC 5H35A 5KBNC 1JNLH 1LO2H 2UZYB 1IM3B 4QRQA 2FDBP 3KPSD 4F7PA 2CD0A 5FYLL 4JQXA 1ZLWH 4R2GB 5D1ZC 1DL7H 1MCPL 1R3IH 2DM4A 4PJAE 4HIHA 4BJLA 2Y36L 3WD5H 3BEWB 2BSED 3KG5A 1UB6B 1WC7B 3WE6B 1XGTB 1GZQB 2O5XL 2FGWH 5MHSD 3MX0A 3ULVF 3UZEA 3VGGA 1NSNH 1C5CL 3LHPH 3EFDL 4I2XB 3HC0B 3S5LB 3V5KB 3D2UA 3VH8B 2H2PD 4DFIA 5L2JA 5LXGL 1J1OH 5I1HH 3CVHH 1ND0A 1ERNA 3AREB 4NHCH 1MJUL 1QKZH 5CUSH 4F7MB 3IAPA 4PJIF 4XPTL 4EDWL 2MCPH 5H8DA 2BNRE 5BRZB 2FBJH 4ZOEA 1MFEL 3O4LA 3MRJB 4YQXL 1AH1A 1DFBH 1I3UA 4GJTB 4PTUB 5KSUB 3IT8D 1OQXA 4BSWB 1A7NL 2XWBA 3FQWA 3PHSA 4P57A 3DJ9A 1YEJL 2AERT 3DYOA 3LY6A 2V7NB 4ZNCD 1JF1B 5CJOH 1S7UB 1YY8B 5CEXA 5GRZA 1FRGH 2ARWA 4JQVC 1NKRA 1MJUH 4OIIL 3QEQA 4GAJH 4GQ9H 4MDJA 3VFUB 1U58A 3FN0H 4POUB 3VD4A 1JTTA 2DQFB 3DURB 1NCCL 3Q5YA 3W0WB 2YPKA 1YEIL 3N0PB 2EDJA 4UB0H 3WNOA 1R5VA 1JJUA 1KG0A 1UH3A 5DHXB 2J8UE 2DM3A 1BVZA 2YC1B 1OAUH 4Q6IC 3WL9B 3HG1B 4LHUG 4LBEB 1HSBA 3GJEB 4JFFB 4FMFA 1NAKH 1V05A 1N0XH 2Q8AH 4YFEA 3O2DA 4M6NH 3RVUD 3ARFD 5C0JA 5C0DB 3OKLA 1U8HA 4P2QA 1CDUA 3U7YL 3QB7C 4BUHA 4MS8C 2R2BA 2VH5H 4HWEL 1AC0A 1NJ9B 3RTQB 1YMMA 1RZKL 4HK0B 3THMH 2N1KA 3ZTJG 2Z8VC 1T1YA 4WGWB 5DK3A 5IFHL 2OTWB 2CO7B 4OFPA 5E8EB 3D25A 3OTTA 2B8OT 4QF1A 4OCRL 1DQLH 3D85B 7CGTA 5FF6B 2IBBA 4Z7UF 1D5BB 2DLEA 2AAVA 5B38A 1VFOA 3PWLA 4ZUUA 2JB6A 4IEFB 2D9QB 3H6JA 4N8VB 1CS6A 3K1KC 1LILA 4OZIE 3OJDA 3C6LA 1PG7W 3HR5A 3HLAA 3KYNA 1OB1A 3ZE2E 4F58L 1OSZB 1NH6A 5KJRL 1ORQA 4LCYB 1CDCA 3QHTC 4F57L 3GI9H 1DCLA 2DI9A 2EEDA 5DUML 3HNTL 4CMHC 4X6CF 1M4KA 1OAKH 1FIGH 4BSJA 5EU7E 3IRZA 4MS8D 1WVZA 5DD1H 2CJUH 1JTOA 3TZVA 3M8OL 2DMCA 4MZ3A 4TQEL 4XPAH 3ALXA 2FR4A 3BOVA 2FX7L 2NXYB 3ARED 3B2UC 4OV5A 1TJHL 5E1HB 1JWUB 2H8PB 5DVLA 4OUUB 4KTDL 4UI2A 1EO5A 4O2CB 2R0KH 3BH8B 1OM3L 4R8WH 2FRGP 2P8MB 4XXCA 4IMKA 3LCYA 1YYML 5HHNB 2XFXB 3PWJB 3W11D 1CT8A 2F74B 5IFAL 3DGCR 3S3SA 1WF5A 2V5SA 1FVEA 1U2HA 1BQHB 5DJZA 4F7CA 3QUKA 5C0RL 5B8CB 2VE6A 3RUGB 5BS0E 4EQ3A 3P0YL 5EWIL 4HX1A 1MWAB 2K1MA 2H2PC 1KPVA 5GJTH 1X7QB 3W9DB 3HZVA 4EOWL 4FFWC 1JPFB 2VLME 1CGYA 3J8F7 5A3ID 2ADIA 3LV3B 3MLWH 4NZRH 2R4RH 3BW9A 3QPXL 2DD8L 4JG1L 1A22B 2PUQT 4WI6A 2A6KA 4Z8FL 1MHPH 1WK0A 4PRHA 1KPUB 4POZC 4S2SB 2X1QA 1RZ8A 3MNZA 1T04B 3QCUH 1CWVA 1H15B 3C8KA 3BD4A 1M1SA 5HHNA 1JI1A 1ZHLB 1ZLWK 4UMGA 2XZQH 4HUVA 3MGOB 1T7ZA 3VFWB 1QVOB 1HHGA 4R7NA 5IBTL 4G80B 5AWNL 1CGSH 4O2CA 4KKLC 3STZA 1NAMB 2OXGA 1EEUA 4AL8L 4JR9H 1QLEH 3BE1H 4MD5B 4HPYH 4U0QB 2DQJL 4G3YH 3O4OC 4LKCB 5IVZB 3QO0B 1S78C 4L8SB 1QLFA 1HDMA 3MBXL 3PGCB 3GBML 1F4WL 4QHNA 1OARH 5JOPD 1FNSL 2VLLB 5I1DA 5L2KE 3AS0A 4TUOA 4Z9KB 4G8IA 2DYPA 3SJVD 2PXYD 4LARH 3VWJD 1RJYB 1TVBA 4B41A 3L95A 5DF0A 3GGWB 3STBA 4Q97A 1HN1A 4U0RC 3ZTNH 3FQNA 3D2UD 3U0WL 4Y4KA 1MH5B 3VXME 3MR9B 3PGFH 1LHZA 3PL6C 5LXGH 4R97B 1LP9E 2IAND 5C6TH 2RQ8A 1OQOA 2FCBA 5DS8A 3HR5B 2BVTA 1NBZA 25C8H 5EU3A 2X4RB 3WJJC 1NDMB 1UA6L 4R90L 5ISZE 3MYZA 5GSVA 2Q20A 1LD9A 3L3GB 4P2QE 2BRRH 1LK3L 1V3KA 4YJZL 2VLRB 2R69H 5CJQL 4DOHB 2VISB 3X11A 2XT1B 3PG2A 5C3TA 5DMGC 3SOBH 8CGTA 1QRNB 3DVNA 3QHFL 3RU8L 3LN5B 1MNUL 4OGYH 1WIOA 5AD0B 1ZS8B 2FYYA 2R0WL 3BPNC 1ZEAL 3TJHC 4LQFH 3MRBB 4RAHA 3TWCL 4XP1H 3C6LB 3MLXH 5DVNA 1LO4L 4XC1L 2HVKA 2J7LA 4X4YB 4CRPA 5AZEL 5CGMA 1SJXA 3SJVE 3ZDXF 3ARVA 5EUKB 3SY0A 3K2UL 1HINL 1UM5H 4WTWA 3ZSSA 1JZ2A 3GBNL 3WNMA 5IMMB 1DUYB 3VRJB 3DMMA 2DIBA 3TN0C 4LARL 4AEIL 1IC5L 2O61A 1P1ZB 2ED8A 2IANA 3PDOB 1NC2A 3ULUD 1K9TA 4HKZA 1S7VA 4PJ7A 3I3DA 5IB4B 3ARGA 5T5FL 4L5FL 1U3HB 2NY3D 3IJHA 1S8DA 3FJTA 1D5IH 4M48L 3ZKQD 1TQCC 4M93C 4P5MB 1YMMB 3CFKA 3EYSL 2XTJE 2FL5A 4IMLA 4LRNH 4PJIB 4Y4KC 3NA9H 5D70H 3BAEH 1X5IA 4X0KA 4QHLA 4P23C 2DTSA 4XHJD 5C07B 2HJLA 2X6MA 2YEZA 4KI1A 3DUUB 4UBDD 5C3LD 3H3PL 4P48A 1KENH 4HKJB 1MI5E 1KTLA 3RKDC 3FOLB 2V7NA 4OIAA 4LASL 2QSCH 4YBLB 5E8NA 2VN4A 1NBYB 5IQ7H 3OKYA 1INDL 1N6VA 4BSWA 2OP4L 2A1WH 3OKMB 2D9CA 4JDZB 1IL1A 1EO7A 3WHE0 3VJ6B 2ITCA 1YJDC 2I27N 2CMRH 3SJVB 4QCIA 3VFUA 1NCTA 3KPRD 1IAOB 3TVMC 5D7IA 5TPWL 1KB5A 3MUHL 5FOBB 1EZVX 1FYTE 4NC0B 4XZUA 4U6XB 3T8XB 5DFWH 2R29H 2OTPA 1HH9A 2ESVE 3UTZB 1FP5A 1A6WL 3GIVA 4ODTH 2YK1H 3KJ6L 2R0KL 2I9LB 4TVPL 4CL7A 2H32A 4APQC 1V3JA 5C1MB 5JXEA 1HILA 1NFKA 4QRPE 3B9KC 4PG2A 3T1WA 3PWPE 3REVA 1BVLB 3FCTA 5GGQH 1WT5A 3AREA 1YNLH 1FN4A 3CXDL 4WUUB 2G75B 1JRHH 4JZNB 1WZLA 4NOFA 3UJTL 1KFAL 4PG9A 4WDIB 1II4E 2R29L 4I2XA 4YX2H 2DD8H 3KPSE 4F9LC 4UTAL 1MCLA 1HI6B 1OTTD 2OMBA 4YXHH 2WM0A 3IKCA 3PQYD 1GZQA 5I1LA 5DSCA 4PGJA 5I2IB 4KUCD 5HHQA 5CBAB 5FO7B 1JGVL 5DMYA 1HHJB 2OBGA 3E6FB 5CINH 2G9HB 3PNWA 1IQDA 4QTHA 4R4ND 1FH5L 1B2WL 3ESUF 1XAUA 3LS5L 4O2FB 4L8SC 5INDA 5HHOD 3WIHL 3X11B 2IALA 1E27A 1TETL 1NFDB 1T80A 5CSGA 3O3EA 1I1FB 4NSKA 1MSPA 1SMAA 2MHAA 1I9IL 3ARFB 4NQTA 1X5YA 3QDJB 1FYTB 2XPGB 4XWGH 5CGYC 3QRFM 1JVKA 4WEMB 1OAQH 2OK0L 1HK6A 4UT7L 3C6LD 1YEKL 1P53A 2FB4H 1CFSA 4QHMA 3T3MF 1RIUL 3NIGE 3B9KD 2A73A 2Q1EA 4EDXB 2OZ4H 4FFZH 1QHPA 4GAJL 4GQ9L 1T5XB 3ARBD 1SJHA 5F1OB 1CDBA 1BVKA 4M6AA 3K2MC 4PB9L 2JIXA 5E2VL 5ITFB 3HB3C 1RZKH 5FA3A 1E4WL 1D5IL 2OZ4A 4Z7WA 2P24A 2VH5L 4E42A 4IIQC 1HIMH 2XWTB 4CNIB 4X9BA 4NJ9H 4ZNEA 2EYSB 2R15A 3QDGB 4EN3B 1T21B 3JWNC 1WLHA 4P2QD 1VCAA 5F7DB 5JPMB 4ZFOB 1U91B 1W0VB 3MLVL 3Q3GA 2VDLL 1SY6A 2E7CA 3BZ4B 4U31A 4ZTPL 3IU3A 2VABB 1F90L 3V6FB 1DQMH 4U1SB 2XN9A 1FE8H 4KMQA 3IAQA 4QRSA 2YRZA 3TA3B 4JFHE 5MENB 4WWKD 4OF8A 1NMAH 5ANMA 1BECA 1NGYB 4M3JA 2EDHA 2BOBA 3P77A 2W59A 4JKMA 3C8HA 5E5MB 2VMFA 1TITA 4AQ1B 2RIKA 5D7IB 4XPAL 1A3QA 3SGEH 3EFFB 4YO0A 1T6VN 2DLIA 3DSFH 1QFUL 1Z6JT 3EO9H 2F9BT 1TPXB 1SBSH 3J7HA 3ZKMC 5T1KB 4PPTA 4R4NC 1R3JA 5HHOB 4FFYL 4Y5XB 1BQHA 4NHUB 2NYYD 4N9GB 4Z95L 5F3HB 4Z7UE 1WZMA 3U7WL 4LRIA 4RFNC 4GW4B 2YUWA 2ZCKH 1S7QA 1MAJA 3TYGL 5I9QC 4Y5YC 1NUFA 3SN6N 3EFDH 5KS9E 1ZWIA 5GISL 1NGQL 2H8PA 3BPCB 5JDSA 5L0QC 4NNPH 3HE6B 4ZUVA 3L1OL 3S97C 4OTXH 2O5XH 4GKOA 5D2LB 5F6IB 3IB4A 3SDAD 2BNQE 1F58H 4ETYA 3SKUD 5FA4A 4XCNB 4G7YH 3T0XA 1DBML 3AB0C 4HWBA 1U8QB 2CKBA 4PJXF 4L29A 4PS4L 2QKIA 1H8SA 4MQXC 4HK3J 3RX8A 2OR7A 1AR2A 2V5TA 1G7IB 5FM8A 2FJGB 1E6OL 4YPGB 1GHFH 1QSFB 3W39A 4I3RL 1G7HA 4TN9A 5T1MA 3DSFL 3WKNA 2YUZA 5DHVB 3S36H 1DBAH 4LCWA 3ZMRA 5IHBA 4HMCA 3S34L 4G9FE 2OTUB 4MMZC 3SE8H 3BQUA 1JGUH 1W72L 1OOAA 1KSRA 3F5WB 1PBYA 2H6PA 1EXUA 1YECH 2GTWA 4PD4J 5HYJB 3D85A 1F3JB 1UFUA 1I1RA 1F6FB 4L3ED 2NY0D 1Q0XL 4KV5E 1ZVHA 5KVDH 3G6DL 5EO0B 2Z91B 3MRQA 3T0BA 3G5ZA 2X44D 1AD9A 5GHWH 1JPST 5C70A 2DQCL 4HUMB 4YIQA 1YEFH 3GFUA 4LNRA 3ULUC 1GIGH 4FQLH 1ZMYA 3O3DB 3S37H 3PGFL 2BNQB 3JZ7A 2NYYC 4MXQD 4JQXC 4ZO9A 5IW6A 2Z93B 5I76B 2SEBA 3DNKA 4QXGL 3S96A 3K4AA 1VFUA 2X5PA 4P3DA 1IM9A 4GAYA 4FP8H 2V9QA 2CK0L 3HMXA 3GSOA 4TVPE 1CD1B 1MQ8A 3D39A 1VFMA 4LSRH 2IAMA 3TA3A 1OP3K 2H45A 4P5KA 32C2B 2YPKB 1P7KA 5F6HI 1P7QA 5B39B 3UBXG 3IU3B 2VLJA 3BPOC 2PF6A 3MGOA 1SBBA 4P5KB 4YDVB 4HH8A 1BAFH 2X42A 3QNXA 2DTMH 1EZVY 1QFWL 4GBXB 1I8IA 2YN5A 5CIPA 4UINL 1FYHB 3HNVH 5L8KB 2PCPB 3SDCD 4HGKC 1JWSB 3WFHA 1N3NA 5E08L 4GS7C 3MLTA 3KPMA 1T66C 2Q7YA 4TPRL 5EU6A 4CDGC 1MCFA 4GXUM 5ITFA 5TGBA 3GBNH 5JXAL 4P5TD 2W9DL 5BRZA 3DXAA 3ROLB 1KPVB 5FO8A 1KLGB 4HDIB 1BVKB 4ISVB 4GG6A 1IM9B 2X2YA 3EUUA 1XGQA 3BP6B 4CVXA 4IDJH 4NCC1 5EIIB 1XF5A 4PR5A 2PTVA 3IS0X 1DBKL 4NQEB 4D9RE 1AXSA 4NUGH 3VFOB 2P1YA 5A43C 2J6EL 4L9LB 4BM7A 5L7XH 3CX5J 5HHVL 3X3GH 3P9MA 2WANA 1NCDH 4JQIH 4TUKH 1X4YA 2JK5B 3HMXH 1E28A 2W65A 1D5MA 3LPGA 2FECL 4J3XA 2J8UF 4LRNL 5E6ID 2GI7A 3FQUB 3GSXB 1XR8B 2IBGA 5IBLC 2B20A 3G6AB 2ITDA 1HSAA 4XCCL 3W11C 2J8UA 5F71A 1IQDB 4QTHB 1JNNL 3EO0B 3F5WA 2UY6A 5C7XH 2GTWB 3HZYB 3UPCA 3DRTA 2X7LB 3RWGB 3V2AR 1PW3A 2MWCA 5CZKA 1CGXA 3I50L 4NN5C 1WEJL 1KJMB 1MHHB 4S1SH 1N6QH 2D03L 2Q76B 3PUCA 5AG9A 4OZIB 2EYTB 3UDWA 2Z4QB 2R23B 4JFYB 4NT6B 3BN9C 4NZUH 5KSAA 4JFEB 1BWWA 1U8IA 5F6IC 3GUTA 1L0YA 2ADGB 5D5MA 4MNQD 3P4MB 4TTDD 3DV6A 5AG8A 1EX0A 1FLRH 4LLUB 1CL7I 1RZJC 3BUTA 4ONFH 1D9KB 1YEDB 1ZHBB 2A9MH 4G6FD 3F7VA 4KKLD 3NA9L 2XOTA 3NIDF 2JB6B 4LFHD 2XA3A 3TBYB 5E7BA 2QSQA 1N64H 2VIRB 4M00A 4PLJD 1D5BA 1INEL 4XZUB 4MYWB 3TO4B 5L7XL 2HT3C 4X9FA 1JWMB 4UDUA 3AREC 4LOUD 4KK9D 3AM8A 2W60B 1EHNA 4OLUH 1J0ZA 4WIQA 3ULVH 5C8JB 4DKFH 4X98A 3EOBB 4HF5H 5F89A 3ZTNL 4EI5D 4RA3A 1FORL 3BD3A 3P4NA 3SCMA 5CMAB 4L8CA 2R2BB 4Z6AT 3MRDB 4TRPH 4MVBD 5MEPA 5HI3C 3G08B 3CCHB 4YHIA 4PJ9A 3TH4T 2VDKH 4DVBB 5T5NF 5C08A 3B9AA 4N90E 5BQ7B 1FNGB 5MP6L 2YA0A 4OBSA 1DQJB 3O8XA 2EC9U 4X80H 2MKLC 5C07A 5TE6H 2YKLH 4X9IA 3G5VA 4HWUA 3AM8C 3RU8H 2DOCA 4WVRA 1WIUA 4HEPG 3SPVB 3DUSA 3QEGL 3EYOB 3DUSB 2NR6D 4M8QA 1DR9A 3ARBB 2VRAA 4XBGA 1NGYA 2CUMA 4D0CB 4BH8A 1XR9A 2AP2A 5D93B 5IW3A 1DBJH 1IKFH 2XZAH 2HJFB 3FQTA 3X3FL 3WXWL 2XKNB 3ARYA 2VZSA 5HDOA 3RWEB 1A6AA 3VGAB 1MPAL 2HT2D 4HUKB 1KCUH 4TSBH 3F7PC 2B39A 3GMOB 5B8CC 4YAQA 3CJJA 3LPWA 4LCIL 2Z35B 4P2OA 1ES0B 4BFGA 2JCCB 3MRLB 5JMRA 1IEBA 2OL3B 1AQDA 3MCKB 2AEQL 4GRWH 3P30L 2CLRB 3CDGB 5JHDE 5KVGL 1NMCB 4JB9H 5CJXA 1DBJL 5DI8B 5D7LA 1K85A 5CUSL 1YNKL 1DANT 1IEAA 3EBAA 3V0WL 1E4XI 1ADQL 1TDQA 2YD7A 1XEDA 4ZTOL 1SJEA 1SJHB 5DJAA 3WFBL 5LCVH 4YDKH 2IF7A 2HAZA 5CAYB 3QA3B 1DSFL 1AKJD 1TJHH 5CBEB 4QY8A 4B7LA 2GSIA 4AEFA 2DB8A 2J8OA 3BEWA 2GCYA 3C5JA 4NC1E 4TVPH 5B22A 5ADOH 5DGRA 5EH1A 3WSQL 3ZT5A 4DW2H 5INDB 3TBTA 1S7XB 3DECA 4PGBA 3TIDB 5E6IC 4YGVA 1E27B 4DOHE 3L9RA 4E41E 5GS0H 1QNZH 1U95A 3QPQC 4F7PB 1T2QH 2LABA 1VADA 3OAZK 5IB3A 5FB8B 3IKCB 4M02A 2BVPB 3N85L 1RUPH 4NO2B 4OZHE 4GKNA 4OF0A 5F7UA 4X7DC 5T3XL 5HYQB 4X8JA 1CDIA 1B0WA 1IAKA 3NGBC 3NABL 2CIIB 3D5OF 3MBEA 1KCSL 1IGMH 3HAEG 3VXMD 2D7TL 3QQ9C 2NY1B 3OJ2C 2NQCA 2EICA 3BPNB 1BVLA 2NNAA 3CX5K 1IMHC 3DX7A 5I19H 1L0QA 4BFEA 1UWEH 1XF3A 3O3UN 2HJFA 4IJ3C 4IRSD 4W4NA 3BKYL 2AEPH 1AD0B 4ONGL 3UPRB 4X9HA 3DRQA 4X6DF 2GY7B 2HKHH 3P4LA 4LSSH 3TH3T 2X05A 3QH3A 1A2YA 3PXHA 5ERWA 3WDHA 5ALBL 1U3YA 1DSFH 3OF6D 3QDMD 1WFNA 1C5BH 4NZTL 2F54E 4PJFB 1X5KA 4JHAH 3CZFB 5K9QI 3LV3A 5I1KL 5HI5C 5FK9B 4NJAH 1KCVH 3SDYL 4BYHA 2ENYA 4OF3A 5IT2H 3QQ4A 3PHOA 1KB5B 5C07E 6FABH 1SYVB 4A6YL 1MWAA 3AC0A 5DT1H 5J56B 1UA6H 3KPMB 4JFXB 4Z0BL 4HH9A 1J0KA 1MFNA 1FPTL 4WI5A 1N2RA 3MRMB 4PJ7F 2AJUH 4L3CA 3O6MH 3UTPE 2EDQA 3S4SB 1XF2A 1HINH 2V17L 3EDKA 4XBEH 4XCCH 5E8DH 4DFHA 4U1KA 5JO5A 4JHAL 4W4OA 4KVCH 1EV2E 1NGWB 4XP1L 1JZ5A 4OCMC 1VKXA 2NW3A 1S78D 4Y1AA 4BFIA 3NFSL 2HTKD 3K3QA 2PYEE 3MLSH 4LPYA 1OP3H 3RWJB 4AEEA 5HYSB 3BMVA 3CFKB 3HR6A 2BY3A 5D7SL 4WO4A 3N1FC 3SDXA 4UV7L 5HTSA 3RPIA 3LSOB 4MA8L 4MLSA 5TF0A 2D7TH 2OL3H 5CKGA 3VMPA 2QHRL 5GGVY 4DVRL 1QYGL 4YHYB 3PDGA 1JZ4A 4ZSOA 1VERA 4YNYA 5IJKC 3MRFB 4L4VA 4PJXB 5E9DE 2P8LB 2YRPA 1YUHB 4QT5B 4JZOB 2OS7A 3UYRH 4Q58C 5BRZD 4GKZA 4JPKH 1SM3H 4YXLL 2PO6A 1K8IB 4Q9QH 2ZUWA 3G5ZB 4G6AD 5DJ8B 5IOPA 1QFWI 3BI9X 3MLYL 4FTVD 1NCBH 15C8H 3CMOL 3TBSA 4RMQA 3OL2A 3VGAC 3MRIB 5KSBF 4KV5F 4HIXH 4K3DH 4Y89A 1AGCA 3IDMA 1MFCH 1P7QD 3O41B 1AGCB 3MV11 4E5XB 1MVUA 5KANG 4E5XA 4OLZH 5I6XC 3TBSB 4PRHE 2YPLE 3GSNB 3CH8A 2YD6A 1LD9B 4DN4L 5IUSA 2I07B 3X14A 4OCXL 1RJLB 4O4YH 4Q0XL 3O6ML 2J88H 1D5MB 3N50A 1RIHH 2PYEB 3ARZA 3SGDI 3F7RA 3OAYH 3OKNB 3MLZL 2N7BA 5ETUB 1OT2A 1T20A 4XVUD 4BKLA 3ZTJH 3GIZH 5C0DA 3UYOD 3MLUH 2GT9B 3NBNA 3LQAC 3NACL 1ITCA 2ZUTA 1FFRA 1VFBB 3DYMA 5BRZE 4POZD 2EE2A 1MCQA 2J3SA 3DGGB 1KJ2H 1MPAH 1CR9L 3B4NA 3QJFB 3HE6A 1AQKL 2V2WB 5F9WB 1NANH 3ULVE 5IIEA 4NQED 4Y4HC 3QDGE 4LKCA 2RBLA 4LL9A 5DK0B 5DO2D 3SO5A 1NCBL 3BIBX 3UTSE 2OXHA 1IFHL 2UWEE 1U3ZA 3V4PL 4KJQD 1PD6A 1C8PA 3PWUA 4KKBC 4J3UA 2BSTB 3QXDA 4JQVA 3VFWA 4YDJB 3D3VD 4NHUA 4AG4L 3DBXA 3OKKB 4P4RB 3MRCA 4RMUA 2YPLB 5EOCH 2QADD 1HOCA 4KH2A 3MRJA 1TNNA 4PB9H 3O6KL 1LE9B 5DEGB 4RAUB 4JFXA 3T2OA 3UPAA 4F7MA 1CFVH 4XI5D 1YMME 5ESVB 1H8OA 1KENL 5E2UL 3HNTH 4YLQT 2XWJA 3K74B 4JKPH 2BNQA 4DEPB 3IFNL 1HKFA 4NRYA 1JE6A 4C56B 4ZODA 4XXDB 4EBQL 3EYFB 3QEQE 1W8NA 3Q2CA 1SJVA 4YDJA 1AP2B 1IGFH 2ZPKH 1CF8L 4YHLL 1INEH 1ZV5A 4PJDB 3AY4A 3MXVL 2F54D 1RZGB 3MODL 3MFFA 3VXSB 4TYUA 3W0WE 1KN2L 4GKSA 3U30C 4NO3B 2V17H 1KTRL 2NY3B 2CDEB 4XVSH 4P46C 4KI5E 1S7WA 5IVXA 3HG1E 1Y6KR 2E8ZA 4UV4H 1I3VA 2HT4D 1A6TB 3K2UH 6FABL 1OGAA 5ADPL 1IAII 2D7QA 4OIIH 4N0RA 5E94B 4X5XB 1EFXB 1U93A 4HCRH 3O11A 3MRGA 1MIEL 5SX4I 4QHUB 3TIDA 5ID1B 1KACB 1CXFA 1GRWA 2AK4A 3KPTA 4K94H 5KG9A 4RNRA 4LLVB 5D1ZA 5I16B 5C92A 3GK8L 3NIDE 2X4OA 2Y72A 5C0FB 2P5EB 1WBZB 1H3TA 3PWPB 5C0RH 2GSIB 4M6NL 3R0MA 5KTEL 4XPTH 1RJLA 3F12B 5HD8D 5DJAB 1NGXA 1KCKA 3QULA 5EOTB 2DQIH 4QGYA 1XT5A 1IEAB 2CMRL 2GFBA 4Y19A 3RX7A 1G0DA 4RMVA 2JJVA 5DMIH 5C0EB 3Q48A 3FN3A 2D7PA 4PUBH 4LLQA 1GGIL 1JGDB 5GIRB 1DDHB 4U1JA 1UXWB 5CILH 1MF2L 3VDAA 4DZBB 4Z7VF 4NFCA 3KYKH 3F6IA 2LV4A 1Z3GH 4KUZL 2WUCH 1ES0A 4ZNEE 3LN9A 1YUHA 3RWEA 3L3DA 1T89A 4XC3L 3H9HB 4ORGB 4WFHE 5HY9A 4W4OC 3VXRB 1U8PB 5D6CA 5DJYA 2HA1A 1CLCA 3U83A 4U1IB 5C9JB 4X6BA 1I8KB 3GJEA 5GJSH 3IDXH 3ARBA 3CK0H 3DUHA 2YPLD 3QFJA 4OLEA 5IROA 2FATH 2YC1A 3QAZB 3BVNB 5F1SA 4OLVH 4PJ8D 5HYSA 3LHPL 1BBJB 5IMOA 3U7AA 3HMWL 4NQUA 2ZSVA 2E6PA 4A2MA 2XTLA 5EUOF 5CGYD 4KJPD 1HCFX 3WD5L 4FQJL 1XCQA 3FT2B 1T2QL 1FNGA 3ZT6A 2EDFA 4ELKB 4Y5VC 1JGLL 4MD4B 1UACL 4PP1C 4O58H 5IFHH 3I50H 3K1DA 4KKBD 2F5AL 1J5OH 4AIOA 3MLXL 1XF2B 5IK3A 4XCYA 5LBSH 3BWUC 1Z9OA 4QRUA 3AVEA 3UTTA 1F11A 3JTSB 4ZOBA 1CK0L 5J1SC 2P24B 5B3JF 1MLBB 4A6YB 4UT9L 3O4LB 1FLTX 3HCVA 4K3HA 1JYVA 2E9JA 3Q5OA 3FT3B 3UTSD 2H26B 3IDYB 3S88H 4L4TE 4KXZI 3E3QC 4PJEF 1NL0H 3B6SA 5IVOA 3VH8A 1NGXB 3S5LA 3V5KA 1HEZB 1U3HA 5KW9H 2XPGA 4WEUD 5TPWH 1ZT4B 4F8TA 5CP3H 3VXUB 5C0FA 4MCYA 4P9MH 4K9EH 2R56H 5KZCB 1XF3B 1DQML 1WBYA 2R2HA 2V9TA 4Z7NE 2HG5B 5KSAB 4XBEL 3E0GA 2AXFB 4DEPC 2K7QA 5IV2A 2NY6D 1IC4L 1ZHKB 3VXPA 4G43A 3KYAA 1XIWC 3I6GA 4YFLF 1J0IA 3C2AL 1B0RB 5HYQA 1FO0L 1J05A 3DETC 4QXTA 4LVEA 2Q3ZA 2FD6L 4PP2A 3TO4D 3E3QE 2R1YA 1WWBX 4HIIA 4WU5A 4Y19E 1H5BC 4I18C 5FV1L 1F8TL 5JHDD 2EKSA 1U95B 3U0TA 1HSAB 1J8HD 3I6KB 2FBJL 5E2VH 3BZEA 4FXKA 4XNZB 3RIFF 1U8OA 5C2BH 3GSXA 5T3ZD 3QUZD 3PE9A 4I9WE 5SWZD 5DJDA 5FUOH 3VXNA 1A1OB 3B5GA 1MJ7L 1CF8H 1TQBC 4JRYB 2W0LA 3Q1SH 3VFTB 3BN9D 1A14L 4ODWB 3L1OH 1HEZA 5FV2A 1C5DA 2NX5D 1ADQA 3QCVL 4YXKH 3PP3K 1DBBL 4XNYL 2YOCA 4LEOA 2DQTH 3BO8A 2BX5A 1XZ0A 1X6LA 3OX8A 4Q9QL 4DKEL 1IGJB 2G2RA 3RVTC 3OQ3B 3GGWA 1G1YA 3FTGB 5L6YH 1JYWA 1P6FA 1MLBA 4A6YA 1MWAL 3DXAB 1VFAB 4U1NB 5CZXD 1I8MB 3ARRA 2VOTA 3IJSB 1FPTH 2DJ4A 1JWSA 4ZYKB 5JNYA 1BZ7B 3VXTB 3MLTB 3VG9B 5DTFA 1BZ9B 4WFFD 3GO1L 4ACPA 1IGYB 2HRPH 1OAZH 5IBUB 1I8IB 1EVTC 1G7JA 5FKAB 3LKQB 2C3XA 4NO0B 2X4NB 4RAVB 3AMLA 3VFGH 4KTDH 2YBRB 4APQD 4K55A 5HHXH 4Y2DD 5D6DC 2AXJA 3SE4A 2ATKB 1GAFH 2YHGA 2Y07H 4LVHC 4OCYL 4ZUTA 1KXTB 1WV7T 2Q6WB 2ZSVB 3BEVB 3CFEA 3TIEB 4AMKL 25C8L 5F93C 2KBGA 3AAZB 4HWZA 4PV8B 3K80A 2VZ1A 3DROA 4OZGB 4PV9A 4KI5C 5IVNA 1CZ8L 4I18A 4WEBH 4JHBA 2BSSA 2I60H 4OCSH 4DGIH 1WCBA 2BCKB 3EIFA 1BQHG 2HRPL 5F7NC 3ECBA 1J0JA 1KXVC 3KWWB 3FOMA 3VGHA 4Y4KD 4UT9H 4M6MH 2HKFH 3GM0A 5JOEA 2DQGH 5I71B 2NXYD 4U1HB 2YR3A 4H25A 3VWJA 5FDYA 1F6AB 2WZPD 3GIZL 1R24B 3M17B 3WIFB 1MFBH 3WXVH 4PJCB 5I0DA 1AXIB 1I7UB 2XNAA 2M2DA 4LPWA 4UIKH 5F7HA 3UTQB 3BIAX 3HPJA 5GS1A 5E2TH 3MNWA 5FCSH 5B39G 3EOBA 3CZJA 5IW1A 1KB9K 3WN5B 1HXMA 1T3FA 2NY4D 1AI1L 3S7GA 4LASH 1FNSH 2C4FU 3BH8A 4OQ1A 4V1DB 3A6BL 4TNVK 2PETA 4XNXH 5I66B 2AK1L 1J0HA 3ZE0F 3TO4A 1G7PB 1ONQA 4I4WB 1MI5D 2P5WB 4PGEA 2BVEA 4JRXB 3V6OA 4APQB 5D70L 4AT6A 4XMPH 1ZA6A 4PRHD 2IH3A 4G8GD 3PL6D 3UO1L 1NAML 1WBZA 3GO1H 1FCCA 2APWA 2IPUG 3DX6A 5EU6E 4I0PB 1OSPL 4OSUL 1N8ZA 3UBXB 5BV7L 3NFNA 3SKOB 5KAQG 1X44A 3DHMA 1QD0A 3IGAA 3CFIC 1BX2B 1GGUA 5ID1A 5H94B 2HLAA 5I8CB 3NH7H 1JP5A 4C56E 1N0XL 4Y5VA 4OZFH 2YPVL 4OD1L 3KLSA 5IFAH 5EN2A 3KPSB 4RMSA 1IKNC 5ICXB 5FA4B 2DYPB 1NLDH 2UZIH 3HMWH 4DGIL 2UWEA 2A74A 3UTSA 4G5ZH 5T3ZL 5KN5A 1AR1C 1I7UA 4L8SA 4JRXA 2VDMH 4WV1C 2AJYH 3GJFH 1T0NB 1RHHB 5DDHA 2JF1A 3ZYJA 1JIBA 1QACA 1RK1B 4HS6B 3LQZB 4M61B 1I7TA 3OB0K 4J4PD 4P23B 4I5BA 2VDQL 4X8XA 2EDYA 3I3BA 1HHGB 4NQXA 4V1DD 1H9VA 1WAAA 4NBYB 5DUBA 5DZLA 5JO5B 3FFDA 3X13A 4HK0A 5IHUH 1DQQB 3MNWB 4PBWD 4YBLC 3DTXA 5E6IB 2YWYA 3MA7A 5I1CH 3IDJB 1A4JA 2CRYA 1FO0H 1T04A 4TULL 5I8OH 5K9QG 3VFMB 1RUKL 2CLZA 4HCRL 3QXAB 5C9KA 1MCOH 4E41D 4YK4B 2EZ0D 2PW1A 2AV7A 5FM4A 3HNSL 1E6JH 5FO8B 3KAAA 3UTOA 5IESL 3DHJA 1RVFL 2GK0B 1WEJH 5C0AB 4YO0B 4P46A 3IXTA 4X6EA 2WAHA 4DKEH 3KXFD 4FFVD 2YPLA 5AZ2L 2NY1C 2W92A 2FHCA 5ERWB 5DJZB 4F7CB 3LRHA 2XY1A 4J8RB 4N0UB 1S7SB 1AR1D 1MVFA 1FSKB 4OLVL 3QQ9D 1X5AA 4JE4B 4Y16B 4K8RH 3QFJD 4JO4H 1PKQB 5IP4A 3VFRB 4V2CB 1W0VA 1WJ3A 5HD8C 4N1CA 4OFVA 5CJBA 1Q0YL 2Z31A 4NOBA 3RAJL 2EH7L 1I9RH 4H1LG 1U3HD 2KPNA 1ZTXH 1T21A 4DUVA 1UT9A 4S1RL 3W5MA 5CP7B 3BUYB 1IGML 4QRRB 4LEOB 3QZWB 5CLWA 1CCZA 3SKNA 3JWDL 1A4KB 2AEIT 5EO1A 2F5BH 1QBLH 2IPUK 1I85C 2EEBA 2HVJB 4L8BA 5TDPB 3MROB 2K9UA 3ZKSD 1OAYL 1PFCA 3QG7H 1F4AA 1C12B 3C09C 4Y19D 5DR5H 1LO5A 4DKFL 2BK8A 4L4VE 4H88L 5JLZB 5IEHB 2Z93A 5DA0B 1TMCB 1ZT1A 1NMAL 4ODSH 1M71B 1A7PL 1ZVYA 4O51B 4FFVC 4JHWL 2IBZY 3IDNA 3ARFA 3GNMH 2DQIL 7FABL 5DXWA 3IAGC 1N64L 2NXZB 5T1LD 1QPPA 5IM7B 1A1OA 5A2FA 3U36B 3BFOA 4HIHB 2OLDA 1O5DT 3VMNA 4H0GA 4CU8A 1X6NA 3I6LD 2OX5A 5BVPL 4BH7B 1IQWL 3GMQB 1J1XL 1KIQB 3GMPA 3H0TA 1RU9H 4CVUA 1BFTA 3L3HA 2XQBL 1DANU 1P69B 4MAYC 5DMKB 3DX9B 1IAIL 1VDGA 3IDGA 4HBCL 3B43A 1UWGH 2Q8BL 3JV6A 3REWB 3WV0A 3V5DA 5LBSL 1K4DB 1U0QA 2ERJB 2WBJB 4JZOA 2M1KA 1DVFB 3OGCA 2OMNA 1P5VA 4JREB 4YNYB 2VKXA 3QIBD 1KJ2B 4WFGD 2ARJB 2ZJSL 5I1IL 2JJTC 3FCTB 1U8HB 5D7KE 1GGYA 2DQGL 1JNNH 3LMJL 1PZUB 4KQ4H 4LDOB 4QRUB 4UU9A 4F58H 2ICES 2BNQD 1KEGL 3PHQA 3NCBB 4K7PL 1QLEL 4QLRA 3MJ6A 3T4YB 4O2EA 3UTZA 3U1SL 5I18H 4QNPE 5F9OH 1T5WB 2XZZA 5EBLB 1I7RB 4WU7A 3EHBD 2CUIA 3QFDA 4ZFFB 4JFOA 1GPOH 1KLUA 1HQ4A 2EO1A 4JFOB 43C9B 4TOYL 1QSVA 4OZHA 2L7JA 1QO3B 3PP4H 2VLKE 1HH6A 3RY4A 2E7BA 5BMFH 5C09B 4NO0D 3C5ZB 1Q9KA 3ARDD 3FQWB 1KN4L 2R0WH 3QFJB 1FORH 2IG2H 4OD1H 3CXHJ 2B5IC 4X98B 4EVNB 3WBDA 2X4SB 1XCQB 3BX7C 3EW3B 2YEZB 3TVMB 2HJLB 1R3LA 5IB1A 4X7SL 43CAA 4OZGF 1U8PA 4XPFL 2E9WA 4X7TA 3TZVC 1V7NL 1OGAD 5JHLH 3WFBH 1BFSA 2HWZH 3VXMB 1TTGA 5IMKB 4FS0A 5GZNC 1DVFA 5EBLA 2MOVA 3VXSD 1WQVT 1A6ZB 2MCG1 1YN7A 2VSCA 4E0RA 3GMMA 3HS0A 1OTSC 2JJUA 5ITBH 1SY6L 4LVOC 4LP4A 1PQZB 4JGJA 1CQKA 4WHCA 1P4LA 4YK4C 3KPPA 2EIBA 9CGTA 3GSUB 4UQ2A 4CDHA 5D2LF 4Q2ZB 2Q7NA 4J3VA 2WSKA 3TLRA 4KK5C 4D94A 3HAEH 5GGSA 4BQBA 4ZXBC 4RFNB 1NC2B 4XB7A 5KVMC 3V9FA 1P1ZA 2IANB 4LSUL 3VD7A 5CEYA 1VGEL 3WNKA 5GGSY 1IAKB 2VITB 1RUKH 4EN3A 3MRRB 2XXCB 3NMEA 1Q9LA 3MCG1 5EOCL 1YEJH 5HVHC 4DUWA 4Q9RL 4DZBA 5EZLB 4CN1A 4AYFA 4FQLL 4CN6A 3RX5A 4WY7L 4MA8H 4M7LT 4F7TA 3VCLB 3QWOA 2A77H 1A9BB 4KK6D 4GUPA 3GKZA 4JY5L 1TJIL 3U46A 5BCAA 5L88L 3MSPA 4M7KH 4G8EB 2MCPL 2HKFL 1MRCL 4JFEE 1JPSH 4PRNB 3U6RA 2VISA 3OAZH 4L8DB 3D3VA 3W9EB 4XB8A 3LDBB 5DA4A 2APTA 1SVCP 5B4MD 5KW9L 5K59F 5FECA 3OXRA 5IBUG 1I3RB 5ITBL 1AXTH 3MXWH 4UIMA 4LLVA 4R2GC 5D1ZB 4OBRA 3LD8B 4JFPA 3MR9A 2Y07L 3PWNA 3FFCE 5FYJH 2G5BA 4RMTA 3CAFA 3IU4L 3QCTL 2IH1B 3HN3A 4ISVA 5A40E 3LKNB 1U93B 1HHHA 4CBPA 5DRNB 5DD6A 1D3CA 3K4DA 3MCKA 4NN6C 2IANE 1IILE 1VEPA 1C5BL 2DL2A 1YDPB 4PGCB 4QHNB 1DBMH 3ULSA 3RDTC 3HE7D 3BRGC 3T0EB 5F9WC 2A0LC 5ICZB 3FB7B 4HUUA 3QEHB 1LK3H 3K8LA 2A9NL 4LSDA 1C16A 5I1EL 5DEGA 1CVRA 1OAUL 4PTTA 4JO1L 4J1UB 1RIVL 4ZS7L 3C08L 3QHZH 4I0PD 3HTLX 4NZUL 4BH8B 15C8L 2KZWA 3MV9B 3OKEA 3MNZB 1U8MB 4CAGA 1BOGB 1U8MA 4EI5B 3I75A 4JCMA 3BZDA 4MXWL 1B2WH 3FKUS 5DRXB 5DUBB 1D5XB 4X6EB 3K0WA 5JW4Q 4QOKB 1F45A 2FLRT 1KTDB 5L88H 1Z9LA 1X7QA 3W9DA 4P23A 3I9GH 3G6JA 2P49B 3ZYIA 4YEFA 1DP0A 3SDDD 4D9RD 2BC4A 5I76A 4NDMB 3VJ6A 2V2WA 3CCHA 4YHIB 4MJID 1W0WA 2ZWLT 1ORSB 2R4SL 2WBWB 1ZVSA 2YXMA 3IETB 5D1QB 1MFAH 1O0VA 2DQCH 3TF7C 2VLKA 1V5JA 1TCRB 5TQ2L 2FX9H 1AD9B 3MPCA 2BSTA 3O2WH 3QXDB 2HH0H 4QHKI 2BVOB 5B4MC 8FABB 1ZSDA 4KY1H 3U9PH 4I5BB 2WBKA 2OM5A 2P46B 3PGDA 4G8FB 4U0RB 4XAKD 5CHNB 2G5BB 2VXUH 4M1CC 4OCWH 1EXUB 2H6PB 5I73B 1UWEL 1PYWB 2NY0C 4PJBA 4S1DD 3VRLF 5JPNB 4RGNC 2A74B 1IKNA 3LKPB 5TE6L 4U6HA 3UAJC 1OL0A 1Q94B 3DVGB 3NABH 2KUTA 4AT6B 1EJOH 2AABL 3TZVB 1NDGB 3OB8A 3EJZD 5D72L 4HKZB 1K8DA 2F5AH 4NKIL 1U8IB 1M7IA 1NBQA 1T20B 4LSTL 5E4EC 1P7HL 4DN3H 1DUYA 5HVFB 2OP4H 1F00I 3MCLL 2HT2C 4NP4L 2NY5C 1DEEA 4RWYH 3D87B 4GLRH 4YHPA 5J6GB 3CPLB 3WXWH 2BVUA 3QDHA 4ONHB 5FYKE 1RJCA 5IGXL 4IRSC 1MY7A 2VXUL 5A3IC 1Z9MA 5A2LH 5ISZD 3GSVA 1Y0LB 2UWEF 1FAIH 1BP3B 3A6BH 2VDPH 3ZYZA 4LLWB 1G7PA 4ZUUB 3UMTA 2FX9L 3V52L 1RUAL 3IDXL 35C8L 3C2SA 5I1AB 5I66A 2RGSA 5ELIA 4I48A 1A6WH 1MCWW 3KPQA 4GLRI 4KKAC 2NX5B 3FOMB 5DD5L 4XH2B 4UQ2B