4WV1C

Crystal structure of the fgfr2 d2 domain in complex with fab 2b.1.3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
98
structure length
98
Chain Sequence
b'PYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor receptor 2
publication title Redesigning a Monospecific Anti-FGFR3 Antibody to Add Selectivity for FGFR2 and Expand Antitumor Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/immune system
total genus 17
structure length 98
sequence length 98
chains with identical sequence F
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wv1C00
1I7ZB 3MZGB 2JJSC 1Q9OB 3IAPA 1QSVA 3IETB 1S7QA 4FQ2H 3C60A 3ME0A 4N1EA 1YDPB 3TA3C 1X44A 1Q0YH 2DKUA 2Q7YB 1LEKA 3QBTB 4PJ7B 5DZLA 4S0SD 5I2IA 1Q9KB 1JK8A 3ILPA 2B4CH 4OCXH 3BRFA 4PG9A 4O5LH 5ITFA 5GHWH 4G42B 2GJ6D 1EMTL 3VFNA 2VDNL 4L3ED 2VDML 1KLUB 1XF1A 3W9DB 4FFZH 2M1KA 1OPGL 1NC4B 1NAML 3LQAH 4ZAKC 3LB6C 4WHYG 4DAGH 1RZKC 2WZPD 5D1QC 3MRRB 2R0LH 4NDMB 1EHLL 2VSDA 2YMXL 3AS1A 3BGFB 1CE6A 4KTEH 1BFVL 2CDGB 4PRAA 1KF9B 3QPQD 3WN5B 3WS3A 2W65A 3DVNB 4ZO8A 3HR5A 1CF8L 1J0HA 4YK4C 1OTTD 5CUSL 1OOAA 1T89C 3Q6FB 1SJVA 4I18A 3HZYB 4QRRE 5DC9B 3BE1H 3MCLL 2Z9TA 4R7DA 5E6IB 3OKNA 2BHYA 3TN0B 2Z31A 3HE7B 3WV0A 1KJ3H 4IOIA 5MEND 1T0MB 3DX9B 5DYOA 4Z7UF 2CK0H 1JGEB 5J6GA 2G5BB 4FQQB 1BVLB 5B38A 3P11H 4FQHB 4V2BA 1C08A 1XF3B 3NA9L 4H8WC 4OM0L 1OGAB 4K3DL 5F93C 1FYTB 1KPRB 4XH2A 2BNRE 2X4NA 4LNRB 2XTJE 2R4RL 1AD9B 4ZPVB 3RWCB 3TYGH 2J6EL 5GRJH 3FCTA 1DLFL 3PDGA 4XBPA 4I0PD 4TULH 4U1SA 1RSFA 4Z7WB 2WUCH 1PGRB 4AM0A 3IDIB 2D7TL 2X1PA 4PRBB 3KR3H 5EOCJ 1PZ5B 3T0EA 1P84K 1FL3B 2EO1A 4JFDE 4NC1C 2XWTB 3GB7A 2AEIT 1AXSA 4O4YH 4ESKA 2GTWB 4KI5C 1H3WM 2Q6WB 1X7QB 2W0LA 5I19H 3QIBB 3INUH 3OJVC 1K3ZA 4Z77A 3D39D 5DXWA 5ITBH 4QTHB 4NO0D 1U8LA 3RY5A 4JRYD 4ZS6C 1REIA 2FH8A 5IW6B 2G2RA 1R3LB 2CKBA 3FQTB 4EVNB 4HIJA 4XPFL 3LKNA 3SGKA 3QG6A 3QIWD 2YRLA 3R4DA 3BPNC 4MJIB 3BEWB 1UZ8B 2H8PB 2OZ4A 5KS9E 2EH8H 4L8DB 4O51B 5BZDA 3M1BA 1TPXB 2VKWA 4I8DA 4R2GC 2NY2C 4K94C 3PGFL 3GSVA 1RJLA 3GJFK 3IDGA 3ISWA 3QWRA 1WBYA 5C0BE 1L0XA 4XP4H 4LVNB 5LBSH 4LHUD 2J5LB 2FB4H 2BSTA 4I5BA 1DTUA 3OKLB 4OCLC 4X4MA 1H9VA 3KS0J 4XPHL 3WDIA 5J89A 3FT4A 3BIBX 1A64A 1KJVA 3D69A 5I8OH 1RV6X 4U1LB 1D5IH 3L3GB 2P8PA 3MLWL 5DHVB 5HI3C 4FZ8H 4ZFZB 3V6BR 4NRZA 5C08D 1U92B 5K59E 3CLEL 5DVOA 5ESQB 2W07A 3RVUC 1C5BH 1FFRA 1MFBH 2APWA 3P4LA 3P4MA 5IVXF 1N0LA 3L3KB 4XBGB 5F9JA 2QR0A 4UV7L 2O93L 4WW1B 2PTUA 3QR2A 4PBWD 3VFSB 4OKVB 1KN2L 4LMQI 5JOPE 3CFCH 5HYJE 4GKNA 4H20H 3V4VL 4W6XB 3VXMB 3QYCA 3A67H 3UMTA 5JA9A 3CSYA 3ARYA 5LXGH 4BZ2L 3NIGE 3WJJC 4LSVH 4PBXA 5E2UH 5ENWB 4UB0L 4J3UA 2O5YL 3MOAL 1I85A 3RGVA 3IJSB 4M8QB 5JDSB 1IT9L 2VDQH 1AGFB 1HILA 4P48A 5FYJD 4KK8D 3VH8B 4HIXH 3LMJH 1FLRH 5EB9A 1TMCB 1CGTA 3BKYL 1IGYA 5DVNA 1IGIH 4QRPB 2FEEI 4G8EB 1OM3L 3LV3B 2A9NH 4FXKA 4P2YA 2P5EE 4DTGH 5DD5L 1OCWL 3O11B 4HZLB 5I1HL 4D94A 1IC4L 1IAOA 5TFSH 3L7FA 2JB5H 1B2WH 5KANG 3NCCB 2BJMH 4GBXA 4OCWH 4M7LT 3U7AA 1UCBL 3EYSL 1A4JB 3V4UL 2F5AL 2DRUA 3O41A 3QXDA 3U82B 5DA4A 1IEBB 1YEGL 5HXMA 1OSZB 3SDXF 3JV5A 4XPBH 1IC7L 5C7XL 3MRQB 3GSOB 1QNZL 2UY7A 3MYZA 3P4OB 3IF1B 4OZFA 5C0CA 4OSUL 4AIZB 2H32B 4A6YA 1CU4L 1MELA 3L5IA 1HQ4B 5DO2D 3FN0L 3WKNA 1AHWB 5CEZD 6FABH 4TVPL 2I25N 2NY0D 3L1OL 2EXWD 5HDLA 3NFNA 3FO9B 4RFOH 4Y5YB 5L6YL 3TJEH 4QOKD 4OQTL 1AD0B 1A6AA 5CGYD 3KPRE 4NYLB 3ARGC 5SV3A 3MACH 5K9KA 3HI1A 4QRRB 3P0YL 4CN6A 3SBWC 3QXTA 2F58L 4M43L 5IMLB 4PTTB 2ZNWA 4LLUA 4PJBA 5BVJA 1V5JA 5TF1H 4E41A 5E1AA 2VQ1B 1S78C 3B8YA 3RVWC 1JGVH 1RU9L 4MA3A 4KMTL 3RKDD 4K8RD 2XTJB 5KSAC 3HPJB 4TUKL 2R0ZL 4XVUC 2MOVA 1T3FB 2JIXD 2VDMH 2JLLA 3QJHB 5DFTA 4A2MA 1AE6H 1OPGH 3BUYA 4HUWB 5L2KA 3I6KB 1NAMH 1TVHA 1RK0B 4XCNA 3EYUL 2DWDB 5IFJB 2ICWI 1U8OA 1T7ZA 1A14L 4XRCB 3IDUA 2R1WA 4PG2C 5AAMA 3LHPH 3G6JA 1BFVH 3L3IB 4RGND 4WFGD 5GGQH 1CK0L 1C16B 5D7JB 3GRWH 1CF8H 2NZ9D 3HUJA 4APQB 4FQCH 1RZ8B 3ZKSD 3ZMRA 1ZGLP 2GJZB 2VR4A 3WNNA 4EDXB 5IEKB 3ARFA 4PJIA 2RAMA 3CFEB 5C0EA 4LSDA 4O2CB 2K7PA 3GDBA 4D9RE 3BJ91 4KJWC 2NXZB 3HZVA 3QUML 4O9HH 5I1DB 3S8WA 5GGTA 4N0RA 4YBQC 3C5ZC 1DDHB 2HG5B 1A6TA 3FO1B 3VXQB 1M05A 4PV8A 5LVEA 5IVXE 2VLRA 2R2BB 2GYSA 4JY4A 3GMMB 4M7ZC 5KS9B 2HA1A 1JWUA 3MBEA 4K3DH 1HIML 1SEQL 4HS8L 1U8NA 2WUBL 4P46C 3RNQA 2GKIA 3H42H 4L5FL 5C0BB 3RHWK 3QZWA 3GNMH 4LU5L 1I1RA 1DBBL 1H3PH 2WP3T 2X7LB 4HUXB 5KVGH 1EFXA 2XPGA 3GMRB 4DKFL 1T1XA 5CJOL 3IDJB 4M1DL 2HFTA 1ADQA 4Y4KB 3ROOA 4KKNA 4G6ML 5CIPA 1IGJB 4R97B 2IBZX 1KULA 4RAHA 3VG9B 3OWEA 4G8GE 3HB3D 1SMAA 3PWUB 2YS4A 3ZE2F 2EDRA 3UZQA 3HG1A 1FSKB 1MUJA 3O9WB 2X4RB 3F65A 1F45A 5KJRL 3GI9H 4MJ6A 3PHQA 3S37L 3OX8A 4LSUL 3IFOB 1MY5A 3B9DA 5JIPA 4K3GA 5C9JB 1RZIB 4JPIB 3QQ3A 4XPFH 3U36A 2ZOKB 2ZUSA 4DEPB 3LN4A 2PKDA 3OB0K 1MH5B 3DURA 4QRQA 1OB1B 4F58L 1TJHL 5HYJB 2CDEB 4ALAH 2NW2B 2P4AB 5I17A 1GAFL 3UTTE 3SDXE 4TSCH 3TO2A 2ZCLL 5E8EB 1AQKH 3D25B 5ALBL 4YXHL 4XHJD 3ARTA 1UB5B 3G9VA 1NGPL 1N59A 4XPHH 1ZT1B 1AR2A 4OCRL 5F1NA 4UDUA 4P2QA 2W9EH 5TE7H 4HBQA 4BQ8A 2Y5EA 1M4KA 4JFED 1U3HC 1MHEB 4GXUN 4L9LB 3CDFA 3QEUA 4ZS7L 3MLWH 3SE8L 5FYKL 4HJJH 3TA3D 4CU8A 5I30L 2P5EB 3NCEB 2EIZA 1VFOA 3CLEH 4ONHA 2GSGB 1JPTL 1G7QA 5IW1B 3AS0A 4GG8A 1EDQA 4JFPB 3F62A 5HI5C 3ALWA 1C5CL 4FQJL 4K71B 5EIVA 3QDMD 3TIEA 5F3HA 4UV7H 4OLEA 4UBDC 1X5LA 1KT2B 4Z7UB 4ZAKD 3LB6D 4JRXA 3QCTL 1KN2H 4KUCF 4YE4H 5EU4A 2Q3AA 5C0IA 1OGTA 2YUWA 4ZFGL 5GGRB 5GGUA 1AO7B 5IB4B 3DI2B 5A1AA 3RTQD 1NGQL 1TQBC 4EBQL 5L0QB 1OLLA 3KJ4C 1FC1A 5EULV 2Q8AL 4X99A 1A2YB 2O5YH 3MOAH 4ZFFB 3KVQA 1J8KA 1IT9H 2H41A 3UBXB 4P49A 3WDHA 1W0YT 3VJ6A 1HHGA 3BRDA 1R5IA 3BKYH 1CICD 2ZZUT 5IEHB 2BC4A 1FAKT 5JNYA 2WMPA 2DQJL 2YKLL 4F8QA 3BH8A 1T5WB 3K1DA 5DJ2A 4XWGH 1OM3H 4GKSB 4Y2DA 5JHLL 3TBSB 1PKQE 5EORH 5GXBB 3GM0A 5HDQL 5I1HH 1JGLL 3G5XA 1IC4H 3UYRL 4DUWA 1XR8B 3HAEG 4JFOB 3E8UL 3IJHA 1BM3H 2YD2A 3HE6C 2R4SH 5H35B 1UCBH 1J1OL 3V4UH 2F5AH 2ITCB 1KYOJ 3NPSB 4PRHD 1P9MC 1F4YL 1FNLA 2MCG1 3MGAA 1YEGH 1R3HB 1IC7H 2IQAB 3EJZC 4YWGL 3ZZ1A 5DURB 2F8XC 4IS6B 1LO0H 1UYWL 4G80B 3BKML 1QNZH 4XAKD 5DEGB 3U4BL 4FHBD 2HRPL 4HAFA 2YWZA 4AY0A 4NUGH 1CU4H 2QSCH 1BAFH 4J12A 1XCTA 3FN0H 4R0LA 2HLAB 4HJ0C 4KI5D 3PE9A 3V52L 2VKXA 5D6DC 2PYED 1ZK9A 2MHAA 4HFWB 4TVPH 4UQ3B 3L1OH 2VUYA 3LZFL 2CO6B 1NUDA 1AQDB 2UUDK 3U2SA 5L6YH 2Z35A 4OQTH 1VDGA 4MXWH 4ZS6D 1CIUA 1UM5H 3V4PL 2DLFL 4KRNA 4HX1A 4F37F 4PLOB 4PJEE 4WHCA 1WZ1L 3LKQB 8CGTA 4TPRH 4P5MB 5FDWA 1AGDA 1QACA 1IILE 4PJ9B 3P0YH 3PWPB 1T5XA 5L8JB 1KLFA 5BRZE 1CGSH 1XCQA 4R4FH 3OKDA 3QPXH 4R2GD 4HFUL 3ALXA 3H0TB 5HHOD 5IVXB 3QEHB 1WWBX 2VDOL 1SBSL 3QDHA 2E7HA 1CGYA 2FJHA 4TNVK 1GGYA 2ADIA 4NCDA 1RU9H 1RIVL 2XWJB 3BGFC 3DUUA 4KMTH 3UBXI 3WN5C 1FNEB 4TUKH 3RWGA 5FA3B 2R0ZH 2MTPA 2GCYB 2IH1A 5DS8A 1I9EA 4NNXB 2FLRT 4U6YA 5FEBA 3QB7C 5HI3D 5E6IC 1DQLH 3EYUH 3QUXA 5E9DB 4X5LA 3TN0C 5FYLL 3HE7C 3MROB 3D9AH 4R96B 4L8SA 3P9MA 4G8GB 1IM9A 4LKCA 3T0BA 3RVUD 2Q1EA 1GGIL 5AZEL 3FQRA 4X7FC 1CK0H 2Y5TB 1SJEA 3QUYA 1O7SA 3OQ3B 3HNVH 5HYFA 5GGTL 3WKML 3CFDA 1UZ6F 2WWMC 4O00A 3A6OA 2Z0BA 2E8YA 2VWEE 4NZRL 3L7EB 2WW8A 1SEBB 4NJ9H 1FL5A 2C4XA 5E99L 3DRQA 5F7DA 4WDIA 1EBPA 4IDLA 5I1LA 4WCYL 4MB5A 3TJHD 3MRCB 2EO9A 4FQLL 4ZYKA 3UTTB 3SDXB 1HIMH 3WUWA 1SEQH 5HVGB 2WUBH 5HBBA 4NQDA 2EDTA 4FNLL 1JZ4A 4TNWK 3QIBC 3L5WB 1BF8A 2ZSVB 3G5ZB 4LU5H 1DBBH 3HRZB 3GUTA 4OV5B 1R24B 3MXWL 5CJOH 4M6NL 2IAND 2AK1L 1IGMH 4M1DH 2GHWB 2A6DB 3BZ4B 2IPUK 2NCMA 4JQXC 4M48L 1F58L 2ZSWA 1T0NA 3LKOA 4ELMF 1FGVL 1UWEL 2P48B 3T0EE 4CDHA 3BW9A 3GHEL 4P2RD 3E6HB 3RA7L 1YY9D 1Y6KR 3S5LG 4HWNA 3DX6B 1U8JB 3O3EA 3AFLA 4PJHA 4LCWD 1E28B 1TPXC 1XR9A 3BN9C 4QRTB 2WNGA 5HGBB 2X9XA 2V5MA 3M17B 2CR3A 1CFBA 3O6FA 4PJBF 4DZBB 3S37H 3NCJH 5J6HA 4D2NA 3T0VA 1FV1B 4LSUH 3RI5F 2Z91A 2KBGA 4HEME 5HGGS 4HWBA 4LVNC 5DGRA 5CBAA 2J5LC 2WV3A 4C4KO 5E08H 4JFQA 3AGVA 2EKJA 3WXWL 1NMAH 4M93B 1X5ZA 1Z3GL 1JYVA 4F58H 1TJHH 5JO5B 1MF2L 1HSAA 1GAFH 5INCB 2FJFB 4JVWA 3E2HB 5JMRA 2ZCLH 1JHTB 3P73A 5GGSB 4TQEH 3O3BB 1KTKE 5ALBH 4B5EA 4YXHH 3ARGD 4MCYA 2YPVL 8FABA 2VLJD 3R0MA 4V1DE 1GOGA 1XT5A 4P3WA 1LD9B 1NGPH 3OAUL 4MJ4A 5IT2H 1IGTB 4XXCA 5LAXA 3S36L 2C9AA 2C1PB 5C6TH 4AZ8A 1XGRB 1Q94B 4TN9A 1PQZB 3SE8H 5FYKH 1WISA 5I30H 5DK2B 5SWSA 5I76A 4PJIF 2R1YB 1PKQB 2BNQD 2YUVA 2R0WH 1I8IB 3VXTA 2NY1B 1U8HB 1S78D 3MLYH 1JPTH 3QI9B 4POZC 1RPQA 3RVWD 4X9IA 4RFEA 5AYQA 1G6RH 1VHPA 4GOSA 1C5CH 4FQJH 4JM2A 5KSAD 2FYYB 4JDVA 3WD5H 4NQXB 2W0PA 4XVUD 5ISZE 1YY8A 3CNKA 3BKCH 1Q9LB 4ZQKA 3QNZB 3WMSA 3QCTH 2XQBL 3NIDF 2C4FU 3RWHB 3EOAA 3EDFA 4Z0BL 4CU6A 3IFNH 3PWLB 4NBXB 4ODHH 3MGOB 2J8UA 4UAOB 4EBQH 4YQXH 1ETZB 2IADA 5BOPA 2Q8AH 3IDMA 4KK5C 1U0QA 3VXPA 4F7EA 2CH8A 5F1IB 4HULB 4Q9QL 4JKWA 4RCAA 3G6AA 4EJ1C 2AXGB 3IXAB 4KWUA 3C5JA 2YKLH 1KV3A 2VLLA 2XWBA 3MO1A 4KJWD 5E2TL 5DRXA 1TTFA 3C5ZD 4OI8A 3MLUL 4NOBA 1HWGB 3QXWA 5HDQH 3T4AA 4ZUTB 5KSUA 2A73B 3BP6A 3UYRH 2XN9D 1KCRL 4ZUUB 2Q86A 5J1AA 3V8CA 5A2FA 4WY7L 5CEXA 2FO4A 1UZ6E 2R56L 1OHQA 1P4BL 4LPCA 3VE0A 1J1OH 1LEKB 3F7VB 4P46D 4Y2OA 2VZUA 1AHWC 4UMGA 1JK8B 3ILPB 2IPKA 3GBLA 4Q6IA 1F4YH 4U6VL 5DFVC 5TGBA 4PG9B 3HMXA 1I7RA 3LQAC 4JVUA 4Y5YC 5ITFB 4XNYL 4LLWB 1UYWH 3R06A 3FB6B 3BKMH 3GZKA 3TLRA 1X6NA 3U4BH 4H88L 5IBUG 1IKNC 4NJAL 4DFHA 4X5XA 1QEWB 3HCVB 5C0CE 4L3EA 2Q20A 3R0NA 4F33A 3P77A 4JQVC 1BWWA 1AJ7L 3KLSA 4FN0A 2BX5A 5T3XH 1WV7T 2AJ3B 3LZFH 4NKQB 2Z93B 4G8IA 5TDOA 3HR5B 3HNSL 2IFFH 5JW5B 3SJVD 2DLFH 2V7NB 3QNXB 1FO0A 5IFAH 4OFVA 4ELME 4FP8L 4I18B 2XTJC 3VG0H 1T1WA 4F15B 2GK0A 2E7LC 3QEQD 1V05A 3RY6C 2Z31B 4EIGB 3WS6A 1I3VA 1DE4A 4IOIB 4HPYL 2DM3A 4PJBE 1R5WA 4LRIA 1SBSH 5ILTL 5B38B 4KGJA 1TZHA 4HQQL 3H8NA 25C8H 4M6OL 1C08B 1RUKL 3QUMB 4UU9A 5JLZB 5D7JC 4XH2B 2X4NB 2ZUWA 4APQC 2O5ZL 2COQA 1FFQA 3FCTB 4WHTA 4L4VB 5E2JA 4HWUA 5L2KE 3PWVA 2CJUL 3AAZB 4JZJA 5J9PA 1OW0A 3V8OA 3RWIA 3KLHC 2APTA 2NXZC 1LO3H 3T0EB 5AZEH 5HI5D 3KPNA 3GB7B 4WTZG 1AXSB 3S96A 4WUUD 4JO3H 1NGXB 3HUJE 5FYLE 1ERNA 3V9FA 3MFGB 3U7WL 2Y07L 3WKMH 3JV4A 4UBDD 3WCYA 4PJIE 4D0DB 3UZVB 1U8LB 3QG7L 1DSFL 4YIQA 4NZRH 2G2RB 5EUKB 2HKHL 4LGSB 4NO0A 5E99H 5GS1A 2ZUTA 1P4LB 1RJZA 1QR1B 2R23A 5BZWA 4R97C 2VLRE 4WCYH 3VG9C 5BZDB 4FQLH 1EAPA 4N90D 3FQXB 3TO4B 3GSNL 3EUUA 1FFOA 3J7HA 2ZJSL 3SE9L 1RFDL 3BSZL 1FSKC 3O9WC 4FNLH 3NIDE 3QFJD 4BQ9A 5AAWA 2V5SA 4V1DB 1GL4B 2D7MA 2ZUXA 2BSTB 4I5BB 1BEYL 4M6NH 2AK1H 2FSEB 2H45A 4JVPA 3FT4B 3V7AE 4MNQB 1KJVB 1K4CB 3D69B 1MCLA 4FQIH 2ERJB 3QEGL 4JAMA 1FGVH 3HE6D 1UWEH 4DCQA 2P8PB 3N1PC 4DEPC 4QT5A 5T1DL 4OM1H 3RA7H 1XF5A 4CU7A 2XY2A 4NRZB 3C5SB 5HY9A 3HG1E 3MUJA 4LPWA 4ISVB 3FQWA 1T21A 1NKOA 2VLKD 2LTQB 5CZKA 3EJZD 1FIGL 3IS0X 3P4MB 2CIIA 5ISZB 1VACA 2WM0A 5FECB 1F2XK 3AVEA 4JQIL 4JKKA 1GIGL 5K93A 3CH8A 3O4OB 3ULVF 1Z3GH 5EOTB 4HJ0D 4IRSA 3H6JA 3LQZA 3MCKA 4L9LC 3FKUS 5HGHA 1KOAA 3TFKC 4N8VA 2BNUA 2NY4B 3CSYB 4L3AA 4MJ5A 4PP2B 5FYJU 4DGIL 2GY5A 3SO3B 1AIFB 3RGVB 4KKCC 4HK3J 4JKPH 1K4DB 3OAUH 1HILB 3N85L 4K71C 1IAKB 3V0WL 3LKSA 5F9WB 4P2QE 3DSNA 1BIIB 1NC4D 5IG7A 3KXFA 3IGAA 4LSSL 1Q38A 3ECBA 3OKEA 2JJUA 1OF2A 1IAOB 3L7FB 5BO1L 3FHQA 2DBJA 3FN3A 3BPOB 4GBXB 2ITDA 3TBVA 3DETC 5L0QC 2EKSB 3TBYB 1AXTH 3RU8H 5C0NC 1H8SA 1IFHL 2BK8A 2YA1A 3UCRA 5E6ID 1F6FB 1FVEB 2XQBH 5BJTA 3TN0D 4HMEA 4HHAA 2APBA 2ZG2A 3MRJA 4Z0BH 3H9SB 3LEXB 5C07A 3S34L 4G6JL 4OZFB 5C0CB 4XCYA 5D7IA 2YD1A 1J5OL 4MMZC 3FT3A 1GJIA 5CP7B 5EA0L 4Q9QH 1D5ZA 4W81A 4I9WD 4WWKD 1FYTD 4C55A 3QHFH 2WWMD 3NFNB 2ED8A 3RL1A 3NPSC 3TV3H 4RAUA 1ZLUK 2YN3A 1UH3A 3WHXA 1DEEB 4QEGA 4ELMB 1EHAA 4GMSL 3MLUH 5TJWK 1MHCB 3DTXB 4LLAA 4XCCL 3VGHA 3MLXH 4HKJB 1ZOXA 4WENB 2EIEA 4WY7H 2R56H 4MA1B 1P4BH 4LLUB 4PJBB 1KTLA 1BX2B 5ABDE 5BVJB 1A5FH 3RWFB 1BJ8A 3QIBD 4U6VH 3A6CL 4NHUA 3L5XL 5JHDE 3I3EA 4U2YA 4XNYH 4YEEA 5FB8A 1J0IA 4GW4B 3BUYB 5FO8A 4PJ9C 1EEQA 4EEEA 4MJID 2P46B 3F8UB 4ODBD 1AJ7H 2MQ3A 5HHNA 1Z0MA 4G3YH 1F5WA 1DR9A 2HVJB 3BN9D 3DMMC 3MLPA 1FE8L 5KG9B 4F7PA 4L8BB 4XC1L 3SOBH 2D3VA 5IWLA 4KHXL 5GRXG 3C87A 3HNSH 2HYMA 1WFTA 4PRIE 4X7SL 4MA7L 1NCNA 3T3MF 4PJIB 3X3FH 2GFBA 2EXYC 4JM2F 1EJ6A 5C0EB 1WAAA 1ZWIA 4NWUH 4UIKH 1LEGA 1BFOA 4HPYH 4RRPG 4NNYA 1A6TB 4PV8B 1K85A 2OM5A 2DIBA 1RJYA 4XGZB 2VLRB 3NN8A 5F7UA 3HZMB 4GLRH 2BXYA 4JY4B 1IEAB 3MRNA 4M6OH 1JWUB 5T3ZL 3LEVH 3MBEB 3WO3B 3ULVE 5MP6L 4D8PA 4OFKA 4R7NB 1DLHB 2J8UF 4MDJA 1U8NB 3QZWB 3UJJL 2VJXA 1KBGH 3CU1A 1QLEH 2F53A 2XPGB 1P53A 3B5TA 1OL0A 3A6BL 2OXGA 3ROOB 3VXMD 4W68A 1HXYA 5CIPB 4POZD 4HXAL 4NUJA 3LN5A 4NQEB 1HCVA 4JY5L 1PFCA 2X4TA 4G7VH 1T7WA 2GQHA 2BMKA 2DD8H 3HG1B 3MRDA 4UDTB 3U7WH 4YZFF 1NLBH 4JANB 5GS2D 2IBBA 2AEPH 3PHQB 5A2LH 2XRAL 4QRPD 2GW5A 1Y0LA 2AXJA 4RIRB 3DRTB 2HKHH 3C6LD 3C8DA 4FFWC 1AFVL 2W60A 4OCMC 4R4BA 4UUJA 2H6PA 5FO9A 3GK8L 3LN4B 3RDTD 2FX8L 3SE4C 4J4PA 4KK5D 3DURB 3OB8A 4QRQB 1ZV5A 4OCNC 3GSNH 1IQDA 2ZJSH 2VXVL 5FOBA 3FMGL 2YD9A 1RFDH 2BOCA 4WVRA 3H9ZA 4NQDE 1Q0XL 5JPMA 3FT2A 1MQKL 4HKXB 4YR6A 1N59B 4EI6A 3MNVB 3U0TA 1EA9C 4UDUB 1BREA 4P2QB 1AI1H 1F6LL 3ZE0E 1S3KL 2H3NA 3QEGH 1VFUA 1A1NA 1SMOA 4M93C 4FS0A 4DGVH 1DVFC 4GS7B 1V3JA 2EIZB 1CDYA 2XZQL 4JCMA 4RMWA 5CSZA 4ONHB 4IOFC 1ACYL 3PQYB 1T4KB 3TA3A 4QRSB 3E2HC 1LP9B 1WK0A 1ES0B 4Z78A 3QISA 2IJ0C 3EAKA 1FIGH 3CVHL 5M94B 1RK1A 3BDXA 1T22A 2FD6L 2WP3O 4CVZA 3MRFB 5EBLA 3GBML 2A6JB 1YZZA 4QRRD 1J9CT 3O45A 1A9EA 4PJXA 3IKKA 4NM8H 4PBVC 5CWSB 1MVUA 5CS7A 4LSTL 1R3IL 2YSSB 3VWKB 1OGTB 4PJDF 4ZAKA 5GGUB 1HHJB 3UTSA 4N0FA 1OWWA 3SE3A 5D1QA 1Z2KA 2PXYA 2NY1C 4HGKC 1I4FA 4DGIH 3BH9A 4ODWA 1UXSB 3MFFA 3QI9C 3OR7B 4X99B 4WV1A 3I2CL 3NPZB 1BIHA 2Z4QB 4X80H 2XTJD 4ZNEE 3UYOD 3AM8C 3LKPA 3GSQA 4X0KB 2OL3L 1J10A 1R5IB 4MAYA 3I6LE 2BC4B 1QTYT 4NO5B 3TZVA 4ZXBA 3BPLB 1G7LA 4CL7A 4QLRA 5DUBA 4LSSH 2OBGA 3QDGB 5SWSE 2ADGB 2IPTL 5CGTA 3PNWB 1IKFL 3G5XB 2AJYL 4JFDD 5BO1H 1KEML 4UAOC 4K7FA 1UC6A 3HS0A 5D7JD 1HH6A 4YAQB 5D8JH 2EDFA 1A4KA 5IMOA 4ERSH 3F7RA 2V9QA 2VMFA 4MB3A 3GMNB 4Y5XB 3UTOA 2F54A 5JHDB 2D4FA 5DHYB 3LRSA 1IFHH 4KPHL 5E8NB 5GSVA 3UTPE 4GKOA 3K46A 5DA0B 4PRHA 1MHHA 1S7RA 3QWOB 4QRUA 3KLHD 4OI7A 3S34H 4JO4L 1UKTA 1T04B 1FHGA 3V5DA 5ICZB 5FA4A 1AGEA 4EUPA 1J5OH 2J8UE 5HSFA 4IRJC 4U1GB 1QFUL 1JGUL 1OP9A 4ONOA 5HYSG 5EA0H 4XVTH 3HPLB 2MHAB 3SCMA 3IB4A 4OZ4A 3Q3GA 4XNZB 2DQCL 3U2SB 1FNFA 5C0BD 4CVXA 2ZCKL 4JR9L 4PRIB 3PGDB 1ZGLM 1CT8A 4NCC2 4GMSH 3AXLA 1J1XH 4Y4KD 1AGDB 3W0WA 4XCCH 1XCQB 4E5XB 2IGFL 3T4YA 5ICXA 3KYNA 4YZFE 5ID0A 5I1IL 3ESUF 4OLYL 4KDWA 5C6WH 3O9WD 1JYWA 3U46B 2AEQH 3PHSA 1ND0B 2FGWL 1BZQK 3NOIA 3V5HB 3DUUB 2DMKA 5DMYA 2CKNA 5DT1H 1I3RB 1OD7A 3TP4A 5DS8B 2D7NA 4I18C 1YEFL 1FORL 5J0BA 5JOPD 4F15C 1OTUC 2VWEC 5B8CA 3QUXB 4UINL 2F9BT 5HYJD 2NY5L 2Z31C 1EXUA 3B5HA 3FN9A 5JOFA 3QO0A 4CW1A 3WSQL 3P9MB 4IMLB 1AGCA 1FE8H 1CI5A 1IM9B 5DJZB 2F5BL 4S1DD 4M8VA 2YOCA 4KHXH 1QBAA 3AB0B 1SJEB 3QUYB 2OSLA 3D2UA 4X7SH 3B43A 1AGBA 4MA7H 3WIIH 1WZMA 2OTUA 3VXSA 2XA8L 4HWEL 4Q9BA 3BWAA 4JO2L 2EDEA 1N4XL 5LGKA 2D31B 3M8OH 1R3JA 2AS5M 4MHHG 2P5ED 5EWIL 2VAJA 3GM8A 3OZ9H 2I26N 5F7DB 2EE6A 4Z76A 4G6KL 4MS8C 2BVUA 3DO7A 1GYAA 1CFTA 4KKCD 3T0EC 1X5KA 2E6QA 4PRNA 4ZYKB 3WJJA 2DI9A 3AROA 3STZA 2YA0A 4Z7OF 1L6XA 2IG2L 4NQDB 5F88B 4P9MH 4YHIA 4AH2A 3ARWA 4PJDE 4LFHG 3UJJH 5MEPA 3ARBB 5KW9L 1NCUA 2X6MA 4PLKC 2IPUG 5T3ZE 1FPTL 3GSNB 4QXWA 4P9HL 4I1NB 4JY6B 5I1CL 1AO7D 5SV4A 3LKOB 1YEHL 3DETD 3CXDL 4BJLA 2HVKA 3QXAA 1MCKA 3MCG1 2N1KA 2ZP0T 4HXBL 3WHE0 2PCPA 5C0ND 1XR9B 1JIBA 3TO4C 4NNPH 1ZA6B 3BO8A 4P2RA 3GEWB 3HA0A 3KPRD 2XRAH 1EO5A 3KPPB 4WHDA 5J6HB 1DQQA 1MREL 1LWRA 4QXTA 3IJYA 4P2OB 3MR9A 5F21B 2Z91B 5GS0H 5LG1A 4WHYH 4GLRI 3RL2B 5CBAB 1AFVH 5IQ9A 3OKKB 3PV7A 3GK8H 3ARUA 1W8NA 2FX8H 5EOCH 2ERJC 3G04B 3H2WA 1CLZH 1HSAB 2VXVH 3FMGH 2R29L 3E6FB 3BT2H 3P73B 1A7PL 4MWFB 4ZUWB 3HFMH 1Q0XH 2UWEA 1EGJA 2AJSH 4NKIL 5CZXC 8FABB 2LTQC 1DANT 2PR4L 4I48A 1IGFL 5DURD 1MNUL 2H9GB 3S35X 3LEYH 5I8CB 5CEYB 1YECH 4FMKA 1OTSD 5LAXB 3FJTA 2CRIA 5C71A 1IGCL 3QULA 3O4OC 2HP4A 3WIFB 1L9MA 3SBWA 4XAWH 1VEMA 5I76B 5HVWA 4OI9A 1ZHKB 3P30L 2XZQH 4XVJL 1WAAF 4J6RL 1ACYH 2RCSL 2NY4C 3U0WL 3CVHH 4JM2B 4NM4L 3SO3C 3K2MC 1I85C 3RGVC 1S5HA 4QHLA 4QWWC 3KS0H 3T2PA 3GBMH 1EEYB 4LHQB 4ZQKB 4PJ9D 1VFMA 5DWUL 1NJ9A 3MRGA 4JO1H 4ZO7A 5F9WC 1JE6A 2A6IA 4YDVB 3SQBA 4D9RD 1R3IH 4MQ7A 1HKLL 4WTWA 4KQ4H 3EOAB 1JI2A 4EXPX 1QBBA 2GSIA 4IMKA 2QSTA 2J8UB 3G6DH 2IADB 2BVQA 1QQDB 3EFDL 3IDMB 2QSVA 3VXPB 4PG2A 1NLDH 3X13A 4F7EB 3O2WL 3BPOC 1Y18B 4GBXC 2QHRL 1FFNA 3S5LA 1QSEB 2OL3H 3CU7A 1MRFL 2EXYD 5GISH 1TZIA 3C5JB 1EERB 12E8H 3EZJB 1DZBA 2XQYK 2J12B 4S10A 1LILA 4JGUA 3KXFE 3I84A 4YDKH 1JWSB 3T4AB 1IKFH 4NQVA 4G8GD 5KSUB 2AJYH 1B9ZA 1KEMH 4H25B 2Q86B 5J1AB 3FQNA 5CEXB 2FO4B 3CJJA 4F7MA 3VE0B 5IB3A 1I7UA 1JN6B 3VDBA 5K9QG 1H3XA 1O5DT 2IPKB 5F7FA 4Q6IB 3BDYL 1QBLH 3OG6B 3GSRA 4KPHH 5TGBB 4P46A 3NZHH 1I7RB 2AQ1A 1A02N 3MUGA 1FDLL 3AREA 2NY3B 2MQCA 2G75B 3MV9A 4Q2ZA 4PJGA 4RZCA 1FCCA 5C07E 4KDTA 4X6BB 5CJ8A 5D70H 4X5XB 3ESVF 1XGPA 2X1QA 4G8FB 3P77B 2JB6A 3MLSH 1ZMYA 4M5ZL 4N9GA 1X4XA 3UTTD 4MA1C 3ZHDA 5IHZA 2LE9A 5F7LB 2JCCA 3KPLA 1BFSA 1KN4L 4XHQA 3U30C 4JR9H 5TDOB 4YXLL 5C2BL 1QBMH 2ZUYA 1HOCA 1YYLL 4FFWD 5CAYB 5TE4H 3QUZA 3CH1A 2FHBA 3WLWD 3JV0A 3CX5K 3NCYS 2CMRH 3SJVA 4MX7A 4RX4A 4PS4L 3GMLA 5T33H 2IGFH 5F7KC 1ZEAL 5CKGA 3SO5A 15C8L 3WNPA 7CGTA 4L4TA 4GRLD 3QEQA 4NC0B 3VRIA 4J7RA 3L3OB 1XH3B 3UPRB 4K7PL 4LQ1A 4WU5A 3VA2C 3T2QA 3QWQB 1CCZA 2X9YA 4GRWF 2CLVA 4PJDB 5ANME 5D9SA 5IB5B 4Z9KB 1YEFH 1FORH 1HEZA 4LEOB 4NWTL 5J11B 1CFNA 1D7FA 1U3HA 4JZJB 5J9PB 1KJ2L 1OAUH 3RWIB 4L29A 4IOFD 1L6ZA 3C8KB 2XFXA 3PL6A 2F5BH 3KPNB 3O2VH 1KB9K 2CKBH 4LKXA 4PY7A 2OJEA 4MA8L 3CDGA 2Q76A 3NAAH 3D1MC 5F7EL 2XA8H 4MNHA 5LGJA 3V0AC 1CFVH 4BK5A 4JO2H 3RX8A 2AGJL 1BECA 4YIQB 1WAAE 4OLXH 1N4XH 3MUY1 3SKOB 3WE6A 1D5MB 3P2TA 5EWIH 3S88L 4G6KH 2NY1D 1RJZB 1KIQB 2R23B 1FL6A 1CVRA 3QI9D 2D9CA 2W0FA 5CJQH 3QQ9C 2AJXL 4I3GA 2IG2H 3CPLA 2E9IA 1VFBA 5KVEL 1M7IA 3LSOA 5KW9H 4E9LA 1VFAA 3QFJA 4XC3L 2F53E 1G9EA 2FBJH 1YNTA 2IH3A 4G5ZL 5DC0A 2HJKB 3ARDA 4M02A 3MODH 4LSPH 1YEHH 4JAMB 2GI7A 4LQFL 5DRNB 3WEXB 1XF5B 1BBDH 4Y1AA 3LIZH 4HXBH 1TIUA 2YXMA 4JDZA 4W4OC 4TSAH 3HE6A 5DSCA 4JZOB 4JDTL 2CLRB 3NABH 5I8EB 1P5UA 1G9ML 4W4NA 1HYSC 1MREH 2EEAA 1T2JA 1CLYL 1FRGH 4X9BA 1UXWA 2B2XL 2I9TA 3O8XC 2DTML 3DHJA 2VISA 4XP5L 4B7IA 4AEIH 3DOSA 5BRZD 1G0DA 2FX7H 3CVHB 1OAQL 1EGJL 4IRSB 4GAYA 3MCKB 2RFXA 5B4MC 1L9NA 2AV7A 4N8VB 3BZFA 1CXKA 1VKXA 4GS7C 4BH7B 2LFGA 5D6DA 3X3GL 1TITA 2MMXA 1A7PH 3IETA 2VXTL 4NQCB 2BDNH 1MCQA 4HV8A 1YDPA 3VFRA 2Q7YA 2HFGL 4NKIH 1SHMA 3LRGA 1IGFH 3UTZA 1F02I 2OR9H 1DQJB 1MNUH 4X83A 1NBZA 3BESR 4L3CB 1IGCH 1NMBH 5B39G 3NVQA 1TZGH 4U1KB 5IG7B 2ZNXA 4OFYD 2Q7NA 2V17L 3IGAB 5DMJB 5I15H 3VWKC 3MOQA 3ECBB 1UEYA 2JJVA 4LLMB 1S7XA 2ZWLT 3Q1SH 1JRHL 4RWYL 2VDLL 2XZAL 3S36X 3AU1B 2ITDB 3UC0H 4NDMA 5AZ2L 4NM4H 3GJFA 3DVIA 4NRYA 3THMH 3MJ7A 3WN5A 4CRPA 3DVNA 4ACPA 5DWUH 4GW1A 2OMNA 4UOW1 1OTUD 5E2WL 4QNPE 1EVTC 3UO1H 5BJTB 2Z31D 3BPLC 4HHAB 1HKLH 3B4NA 4NKOA 4YUEL 3H3KA 3MSPA 1T66D 4XCYB 1S9VB 4HKBB 4LLVA 3TN0A 5I73B 3UTSE 1HK6A 3HE7A 4CN1A 2E8ZA 3FT3B 4GRWE 1QG3A 2NZIA 1T0MA 3DX9A 5AWNL 1MJ7L 1JGEA 3F7YA 4GQ9H 2G5BA 1U42A 1IQWL 4KUCD 1TJIL 4FQHA 4DN3H 1XF3A 1MRFH 3W11D 1OGAA 1RZJL 1ZGLB 4RAUB 2XKUA 2XIDA 1JNLL 2OMBA 4OGXL 4Y5XC 3MJ8A 1KPRA 4Y8AA 3WHXB 5A16A 1I8MA 1AD9A 2KL6A 1Q8MA 4MS8D 3G5VB 2CXGA 3BQUA 3T0ED 5I75B 1U8KA 4S1SH 3IDIA 3VXNA 5KTEL 1KTLB 4EQ3A 4U1GC 3JVGC 4PRBA 1K8DA 1XMWA 1PZ5A 4OB5H 1RUQL 2C3HA 2HJLA 3RIAF 1JF5A 3MJ9A 3BDYH 4NHUB 2GTWA 4HW6A 2F54E 4XNZC 1F4XL 1QVOB 4CAGA 2YZ1A 3FFCE 3QIBA 1ZHLB 1JNNH 1XIWA 5FB8B 4X9GA 5ANMB 4QTHA 2UWEF 5DMKA 1X4YA 3QRFM 5E4EB 3FFDA 5FO8B 4ETQB 1CWVA 2AP2A 1F3DH 2EYRA 3H9HA 4M5ZH 5HHNB 1YA5A 4PB9L 1UVQA 4XZUB 3KPSA 4PD4K 3TO4D 3BZEA 4NC1E 4F7PB 4KJYB 1UZ8A 4MAUL 4O51A 4OLVL 4RGOL 4Z5RA 4V1DD 5E2VL 5C2BH 1BPVA 1YYLH 1ZT7A 2LU7A 4H5SB 4C58B 4U7SA 5HYQB 2CUIA 2GFBB 1CR9L 2JE8A 1SQ2N 2ADJA 3W0WE 2Z92A 4UT7L 4HPOL 1ZWIB 3X12B 2UZIL 1ZEAH 15C8H 2D0GA 5DJYA 1LEGB 2WBKA 4OIIL 3EYFB 4NNYB 3LOWA 3N1QC 1RJYB 4TOYL 5DHVA 4K7PH 4UT6H 4ZFZA 3MRNB 3KHOA 1K2DB 3AS3A 1HDMB 2DDQH 5FYKD 3MLVH 5EU5B 1A3QA 5ISZD 5ESQA 3AB0C 2JK5A 3QUYC 1Y6MR 2YUXA 4MDJB 2A9MH 4MGXA 2LQRA 3EYQC 1H3GA 5I9QB 3T1FB 1DQML 1DUZB 4PJFA 5GJTL 3T77A 4XBGA 4ZUSA 2F53B 3HAEH 1IEHA 1KJ2H 3R1GL 4WW1A 4LGPB 3TCLA 4R90L 3PXJA 3D3VB 4OKVA 4R26L 2NY4D 4NUJB 4LOUC 3BP4B 1UCTA 4L9DA 4PYHA 1MRDL 1PAMA 2X4TB 3VXMA 4OUUA 2IAMB 3RGVD 2BMKB 2FWOB 4MA8H 4QWWD 1HKFA 2X41A 1JMZA 1JTPA 5F7EH 5ENWA 1LO2H 3VDCA 2UZYB 5DRWB 3IFLL 3VXSE 4JHWH 2V9TA 1Y0LB 4UZGA 3ARBC 3VH8A 3QRGH 5T5NG 1E4XH 2Z8RA 4J1UA 2W60B 3P0VH 4G8EA 5F7NC 3TPUB 1WCBB 4N0CC 2H6PB 5FO9B 2VXUL 3QH3B 1HSBA 2VABA 4GBXD 43C9A 1A3LL 2ICWA 3SDAA 3O11A 5HPMB 4FXGA 3WXVH 5FOBB 5J57B 2BOCB 3PUCA 4OD1L 5KANI 2Z8WC 1A4JA 4LAJH 1QSFA 2DQHL 4DQOL 4XC3H 4FFVC 3D85B 4EI6B 1IEBA 3U0TB 4P2OC 4G5ZH 1CYGA 3UYPA 1EVUA 5C0CD 3EO1A 1A1NB 3P4OA 3IF1A 4AIZA 2H32A 4YFLF 4PRPA 5CSZB 4PV9B 7FABL 4PRDA 4JDTH 4RBPH 1HQ4A 4G7YL 2CO7B 4RMRA 4EN3B 2J4WL 4FQXC 4F8TA 4K3EL 1CLYH 1S5IL 1T22B 2ATKA 3FO9A 2XZZA 4CVZB 5KZCB 4KQ3L 4Y5YA 2MSPA 5EBLB 1FNGB 1HYRC 2DTMH 4XP5H 3O45B 3LS5L 4NYLA 3UPCA 3EW3B 3MV7A 4J8RB 1P5VA 4DKDC 3WLBB 5LQBL 4OIBA 1JPGA 1RI8A 2ENSA 2A1WL 4DJMA 2PUQT 5IMLA 4JQVA 4N0FB 3ZT7A 2QKIA 3LY6A 1N5YH 4M7KL 2YUZA 4GRWB 3QXUA 2VXTH 2PXYB 2LAGB 4KDVA 4C57C 5A2IH 2KQMA 4WV1B 2UWEE 1J11A 4BQCA 1NDGA 4JM2C 3LKPB 5DJCA 1TNMA 4MAYB 1P7KA 1BZ7B 1E0OB 4XVSL 3RX5A 1MLBA 3TZVB 1WBZA 4ZXBB 5FV2A 5L2KD 3UPAA 5DD3L 1A1MB 1LO4L 2V17H 5DUBB 2E7LA 3QJHA 5DHXB 3JZ7A 3RY6A 4K9EL 1VGKA 1RK0A 3H3PL 1JRHH 4BSWB 3IT8D 2DWDA 4LBEB 2GEEA 5AZ2H 1F4WH 2P7TB 1HH6B 1U3YA 1LK2A 2FDBP 5FYLD 4CJ1A 2DQGL 3W2DL 3ARFD 4N0UE 5C1MB 4APQA 5GSVB 5I1JH 5JQ6L 2BY3A 5E2WH 3FFCB 1CXFA 5CP3H 3ULUL 3C08H 2GJZA 2DLEA 3JBG7 5IEKA 1IAIL 4PUBL 4YUEH 3CFEA 1AKJB 4BK4A 5HI4C 4O2CA 3V5DB 5M7QA 5FGCE 2VLRD 3EOTL 4YX2L 1D3CA 1DDHA 1VESA 2HG5A 2VL5A 3FO1A 3VXQA 4BA8A 1T83C 3MBED 3NCMA 3MRKA 2R2BA 1T1ZB 4WEMB 1IQWH 2OTWA 4G9FA 3GMMA 1IAIM 5IR1A 5KS9A 1CXHA 1DBAL 3SCMB 3TESA 4KVCH 1ZANH 1RZJH 1ORQA 5CD3A 4OGXH 1JNLH 5DUML 1A47A 4Q6IC 1GSMA 2VAAA 1B4JL 3K4AA 1EFXD 3K8LA 1KXVC 5C0BA 2XKSA 1TVDA 3AXLB 3BIAX 2NY3C 1UKSA 4HF5L 3W0WB 5IV2A 1QD0A 4HUXA 3U4EA 2X7LA 1UA6L 3BISA 4OBRA 3QQ9D 4NQED 3ZDZE 2OJZL 1KIRB 5ICXB 2EYTB 3ZKNC 2XG4A 5ID0B 3RNKA 1FIEA 2DN7A 3HG1D 5B22A 4ENED 1RUQH 3PWUA 3MYJA 1YJDL 2FEEL 5HHVH 3RVVC 3OAZH 1CTOA 1A7NL 4H1LH 5JXEC 4XNXL 1YMHB 1BLNA 3MV9E 1KB5L 1TQCB 4PJGE 4CDGC 3JWOL 1PG7X 5B8CB 4Y88A 1RZIA 4PB9H 1CN4A 1EXUB 3EO9L 4M9PA 1N5AA 3TWCH 3PXHA 3QO0B 1OAKL 1AGCB 3JTSB 1FBIH 1MH5A 1A6ZA 1FP5A 1ED3B 5HYJA 4YHLL 4OLVH 3HAEB 2NW2A 3VFTB 3RI5K 5E2VH 5DQJA 4HEPG 4GAJH 4Q0XH 1E4JA 5E8EA 5GZOC 4JFFB 3VXSB 1CR9H 3BWAB 1VGEL 4P2QD 3OF6A 4AL8H 1UB5A 2DM4A 3NBNA 5CBEB 3AS2A 3EDJA 5GRUH 5J11C 4LPYA 1R3JB 5B4MD 2YD4A 4JZJC 5MEQA 4Z76B 5IROA 2FX9H 4L4TE 1DFBL 3IU4L 3ZO0A 4TOYH 3DO7B 2E9BA 3FB7B 1CFTB 2B1HL 4PRNB 1TDQA 4OF3A 1HINL 3GIZL 2GSGA 1SYSA 5IW1A 3ULUF 4AH2B 1DQMH 1SM3L 1B0GA 1WWWX 3HC0A 1KCKA 1YEJH 4AEEA 3VWKD 3R1GH 4CMHB 1KT2A 2Z8SA 4PREB 5GGVL 4Z7UA 5CINL 4R26H 4K23L 1S8DA 1U41A 4PYGA 5GGRA 1AO7A 5IB4A 4NZUL 3ZKXB 5JMOC 4ZUVB 5HPOA 2XY1A 5CZVH 5EO9B 5AUMB 4NQTA 1A2YA 3V0VB 4ZFFA 1IVLA 3IFLH 5KVFL 4RQQA 1J05B 4LSRL 3UBXA 1DQQB 3IJYB 4EI5B 3MR9B 4Y2DD 2D9QB 5IEHA 2V6HA 1JNHA 3QDGD 1T5WA 2AAVA 3WFZA 4XXDA 3Q48A 4DOHE 1XGUA 3FRUB 1A3LH 3TBSA 3WO4B 4ODUB 4YFEA 1PG7W 2Y36L 2DQIL 4OD1H 3HN3A 3RJDA 3U79A 1TCMA 2YBRB 4FQ2L 4JFXA 5H35A 2F19L 5JHDD 2UWEB 1Q0YL 2P5WE 2ITCA 3R8QA 4U1MB 4B53A 4HIEA 1X3DA 4NZJA 4OCXL 1R3HA 3UTQB 2VDRL 4HH9B 4M7JL 5GHWL 3QULB 4IS6A 5GGRY 1JPSH 4MLSA 4D0CA 5B3JF 2AV1B 4GH7B 1ZT4A 4HSQA 3RWDA 2OTPA 4KUZL 4IRSC 1KG0A 5CILL 3TNMA 5K9JH 3NTCL 4Y1AE 7FABH 4DUVA 1OT1A 4G7YH 3NIFF 2HLAA 4JHBA 1F00I 1E4XI 4HFWA 3AUVA 4PRID 1NCWL 4O02L 4X6EB 1G6VK 4M7LL 3F58H 1NAMA 1AQDA 2Y72A 4KTEL 4QHLB 1JVKA 2CPCA 4N0UB 3LS5H 5J3HC 1MPAH 2AEWA 3S4SG 5ACLA 1NJ9B 3MRGB 2FBOJ 1HHHB 2A6IB 2D03L 5J06A 1B3JA 3LCYA 4OLWL 4MQ7B 4PJ9A 3PWPA 3U48A 1YEKL 4PJFF 5CEZL 5FGCB 4Y16A 3GRWA 2GSIB 4HUUA 4M7KH 5DJ8A 2V5YA 3DMMA 2BVQB 4WWID 4U6TA 2EICA 1F13A 5IVXA 3QEHA 3ULVD 3X13B 4KVNH 2CK0L 1FN4B 2NY7H 2ZKHL 1FFNB 2HFFA 3P11L 1JFQH 3JXAA 3CSPA 3S5LB 2XQYG 1N0XL 4EIZC 3ZSSA 1T6VN 3H3BC 1N7MH 1KPVA 3BPCA 1OARH 4P4RA 1YC8A 1LO4H 2GCYA 3TYGL 3QUXD 4ZMAT 3OHXA 1VPOL 4NNXA 4YHPA 4RBPK 1CDUA 4ODTL 1E4WH 3WNMA 4NQVB 1TLKA 1IM9D 2NX5B 5E9DA 4P5TA 5I73C 3FQNB 5F7YC 3MROA 5JIKA 2ICCA 1J88A 2YPKB 3QUYD 4F7MB 5IB3B 1MHPH 3KR3L 1I7UB 4MJ2A 3EYQD 5IGXH 4XPGL 2Y5TA 2NR6C 4X9FA 4CUCA 2BOBB 4XBEL 3BP5A 5I66B 3AREB 4ZNCD 3DPBA 1IAIH 1W0VB 1PY9A 3INUL 4LIQE 2UY6A 4PUBH 3MV9B 3OKMB 4Q2ZB 5GRVL 5ITBL 4XPTH 4OLUL 3DUHA 1MCEA 2EDHA 4RZCB 5FGBA 5BS0A 1W72H 2EIDA 3QNYA 3L7EA 3L3JB 1SEBA 3L95B 1FO0H 4YX2H 2JB6B 3ULUE 5I75C 3NFSH 3OXSB 5F71A 2NQCA 2V2TB 2YPLB 5C0DB 1YQVH 1DBAH 3MRCA 4NQDD 3KPLB 3IDXH 3SDXA 2OS7A 1OGAE 2CUMA 3ARBD 2KZWA 1HOCB 1A6VL 4Z18A 4OFPA 1OLZA 1XF2A 3QUZB 5AYUH 1K6QL 2CK2A 1BVKB 1JRHI 3C2AH 4N0CD 3KPOA 4KKBC 5CMAB 1KNOA 4XP4L 3RWJA 5LBSL 1CD1B 3O4LA 5EFIB 4MX7B 3RHWF 1HH9B 5E4EC 2OJZH 4LMQE 2A6DA 2DTSA 3BZ4A 5F6HJ 5SWZA 5BQ7B 4QY8B 1A3RL 5EDXA 1NAKH 4JCLA 3VRIB 4O58L 4P99A 3E6HA 1ZSDB 1UT9A 4X7TB 2B20A 3ZSTA 4BFEA 3DX6A 4JG0L 4WU5B 3KAAA 5EC1A 4FFVD 1E28A 5CCKL 5IWLC 1A7NH 4FA8A 5FUCC 5HGBA 3Q5TA 2NY5C 3PP4H 4XNXH 5KOVC 4NBZB 4DZBA 4DGYH 4AG4H 1HEZB 3CFBB 4F9LC 4G43A 2DQEH 1UB6A 2X5PA 3EO9H 1OAKH 1K3IA 3H9YA 1YN6A 3KPSE 3WHE1 1DVFA 4YHLH 3PL6B 1QSZA 1K5NB 2WINA 3U6RB 2ZCHH 5TQ0L 2FJFA 3CX5J 3FQUB 3GMOB 4NT6A 2OJEB 4N5EC 1NMCB 5LXGL 3CDGB 1JHTA 4LARH 2DL9A 2R2CA 1IC5L 3I6LD 5TDPB 5B3JE 2DLIA 5LGJB 1VGEH 3NH7L 5I9QC 1D6EB 2VDQL 3OL2A 5EU6E 3QO1A 1VCAA 5J1TC 1IGTA 1FLRL 3NIFE 1CDCA 1JPST 5SWSD 3MJ6A 2JTDA 1Q94A 5FHAH 1PQZA 4DOHB 1OAYL 5IBUB 2A9NL 4X7CC 5DK2A 1FL6B 2R1YA 3OAZK 4IIQB 1I8IA 4DTGL 3GIZH 3D18B 4MD4B 4JM2D 3KJ4B 3S3SA 5TFSL 3RVTC 2IAMC 1B2WL 4P9HC 1RMFL 3CPLB 4OCWL 4Y19A 1M7IB 3UTPD 3L6FA 2P5WB 1SM3H 2FYYA 3EYOA 3LPGA 3LSOB 4NQXA 5FK9B 3ZTJH 4PJFE 3ZL4L 1M1SA 1VFAB 3K7UA 3T0AA 1YNTB 1CVSC 3QNZA 2C4FT 4QGTA 3DBXA 4XPBL 1N6QL 3ARDB 4K23H 4I2XE 3IYLW 4PGDB 3RWHA 5IB1A 3PWLA 4J4PC 3MGOA 4NZUH 4Y1AB 3CMOH 4JDZB 5DSCB 3K80A 1QSED 1R0AL 3WL9A 3P9WB 5F1IA 5D72H 4LSRH 3HC4H 3MV8B 3SKUD 3U9UB 1CQYA 1UXWB 5HI4D 2DKMA 5KSBF 2I9TB 2GITB 1BQHA 1WIOA 1UWXK 5H94A 4D0BA 4GAYB 4BSJA 2RFXB 1G84A 2YD3A 4QGYA 1SVCP 4OQTA 2A73A 2AV7B 4IRJA 3BZFB 5IKCA 1VKXB 4NN7B 1I3GH 2Y36H 2DQIH 3CCHA 1MWAL 2YC1B 4HK3N 5FYJH 2F19H 1LNUB 4HV8B 4RMQA 3VFRB 5CJXA 2QSQA 4EN3C 3F7VA 4M61B 1CTNA 1QSFE 4YGVB 4U7MA 5DMIH 5TF1L 3WFHB 3UTZB 2NY3D 3KPTA 3ULSB 1JGVL 2VDRH 2FR4A 1NBZB 1IARB 4M7JH 3KNBA 4LLWA 3FB6A 5F89A 3ZKND 4KUZH 3ZE1F 2ID5A 5CILH 3TT1L 1AE6L 4UOJA 1QEWA 3HCVA 1S7XB 3NTCH 4S1RH 2FIKA 3C6SB 4OFYA 2E7CA 4PRPE 4OD2B 2CRZA 3SE3C 3BEVB 3RVVD 2QQKL 4XB8A 2PXYC 1NCWH 4O02H 1MY7A 1SYVB 2AJ3A 4M7LH 3GJFB 4NRYB 4WV1C 3NGBB 3LHPL 2YD5A 2Z93A 5HHXL 3MJ7B 3MUHL 4X7DC 4FQ1L 5GGQL 3GRWL 1JF1A 4GW1B 5JW5A 2FZ3B 2V7NA 4FQCL 4MAYC 3QNXA 3EJYC 3RZCB 2D03H 3MV7E 3TZVC 4OLWH 4GO6B 5D7LA 4ZXBC 1GZQB 1A21A 5INDA 1CBVH 5GZNC 1FJ1B 4NKOB 1NCCH 1YEKH 1ZLSL 5CEZH 1RAMA 4LLVB 1MAMH 2NMSA 1BWMA 5F7HA 4O9HL 2EEBA 2E7BA 3DGCR 1AR1C 2X70A 2BRRL 1VSCA 3F7YB 5L8LB 2K7QA 2ZKHH 4MYWB 4HMCA 5GZOD 2W0KA 1N0XH 3NCFB 3OB0H 1H0DA 3QUMA 5JLZA 5DJXA 3MJ8B 4TNVF 5E8PA 3SKNA 5T3ZD 1MCRA 3GSXB 4U6XB 5A16B 1I8MB 3GKWL 3H42L 5HTSA 3RPKA 1VPOH 3GNML 4L4VA 4POUB 1H3PL 1WTGT 4ODTH 4BUHA 5KVGL 4XNQB 5I1GH 5MHSE 3BQUB 3AAZA 1FG9C 1U8KB 2R69L 3VXNB 1WFNA 4K2UL 1K8DB 4K8RH 3T8XA 3IVKA 2HJLB 4A2LA 4TTGA 4YHML 4XPGH 1J1PH 1NGXA 3SCMC 4XBEH 3QJFA 1XIWB 3GI9L 1SJHB 4HUMB 4D0DA 1PVHA 4OLUH 5DMKB 3NFPA 1CFSA 2X09A 1LQSR 3FFDB 5B39A 5EUKA 1T03H 4KC3B 3TIDA 2EYRB 1RVFH 3H9HB 3ORJA 1P4LA 1UVQB 2VLME 3KPSB 1QR1A 3BZEB 1KB5B 4G9FE 5EUOA 2VDPL 5DK3A 4ALAL 3FQXA 3TO4A 4Z5RB 2P44B 4TSCL 1A6VH 1ZT7B 1AQKL 3QAZB 1K6QH 3X14A 5TH2A 4F2MA 2APFA 2VB5A 4V1DA 5DVMA 3DECA 3QIUA 4OFIA 3P0GB 5EU6B 2VIRB 1HHKA 1NEUA 4KKAC 2ADJB 3D39B 5F97E 4BH8B 1URLA 2Z92B 1RUMH 5ACMA 2FSEA 1TQCC 1ZE3C 3IRZA 3DHMA 4TNWF 1ITCA 4MNQA 2W9EL 5DJYB 5TE7L 1K4CA 5B8CC 1PZUB 3QFDB 4BFIB 1A3RH 2EC9T 3VCLB 5GJSH 4O58H 1JWMB 4HJJL 1FZOA 1ROWA 1IAII 3TNNA 3PV6A 3C5SA 4JG0H 2C26A 5CCKH 4PGJA 4ISVA 4WJ5B 2JK5B 3WJLA 4WI9A 4PJFB 2NY6B 5ISZA 1NBVL 1XGTB 2LV4A 5FECA 3NZ8A 4PD4J 5E94A 3T77B 4ZUSB 5DJ6B 1U8QA 3N50A 4IRSD 1QLFA 3TCLB 3V6OC 3ZTNL 2VRAA 3VA6A 1G6RA 4YE4L 2BY1A 4I2XB 2QL1A 5EOTA 3BGMB 1JHKH 5B38G 3KYOA 5ESAB 5D7KE 4WI6A 4OUUB 5TQ0H 4PP2A 4ZPTA 1IC5H 1AIFA 4QHUA 5I1EH 3VXOA 2UYLB 3NH7H 3O0RL 1PBYA 1K4DA 3ZE1E 3MZTA 3ZKQD 1IAKA 1B88A 1MLCB 1U2CA 3KXFD 4J1UB 2DOCA 2UUDH 3G9AB 2G60L 4CMHC 4XWGL 1BIIA 1OAYH 1PDKA 2YN5A 3O6KL 4KK9C 1HSBB 2VABB 5BV7L 1J8HB 43C9B 5EORL 1S9XB 5I16A 2ICWB 3SDAB 2JKXA 4ZD3L 1HI6B 4FXGB 3ZKXC 1RMFH 1BM3L 1UGNA 1MFAL 1NQBA 2R4SL 4WFFE 1M6OB 2EKSA 3TBYA 4MD5A 2PNDA 1QSFB 3L5HA 3O81A 3ZL4H 2J8OA 4EI5C 5B3NA 1LEIB 5C07D 5SX5H 1FVEA 4Z7UE 1N6QH 3EO1B 1LO0L 5IMMB 5GIRB 1G9MC 3H9SA 3LEXA 4DKEL 2ARJQ 3DO3A 5HGAA 1AO7E 1GZPB 4KKLD 4NUGL 3WO4C 2O5XL 1C5DA 2QSCL 4PRPB 4PRDB 1BAFL 4AK1A 2NR6D 1S9KC 1R0AH 2NYYC 1S7TA 5CP7A 4ONFH 5E5MB 3WYRA 1QP1A 1MCWW 5IUSA 5DI8A 2ATKB 1WBXB 2HFEB 3EJJX 4MXWL 1ZKAA 1UM5L 1DEEA 4ELMA 4NFDA 3MV7B 3LKRA 4F7CB 1MHCA 4TPRL 4DZ8B 1JPGB 3DTXA 3SY0B 4HKJA 1CGSL 1MWAH 2QKIB 4R4FL 3NACH 4BYHA 3QPXL 1BX2A 1Z6JT 3DV6B 3RWFA 5JUEL 1E4KA 1EJOL 1NDGB 5SWQA 1YYML 4WGVB 4KKBD 5DJCB 1P7KB 3DI3B 4PB0L 1MLBB 1WBZB 5ADPL 2PTTA 1LE9B 4H8WH 3I6GA 3WNLA 4GW4A 2FL5A 3TT1H 5T1MB 1XGYH 1VGKB 2NTSP 2HT3C 1DQLL 3L3DB 3OJDB 2SEBB 4WI7A 4IMKC 5C2UB 3LD8B 2QQKH 2HMID 3ARRA 2HVJA 4JB9H 3D9AL 1U95A 5KG9A 1LK2B 4MZ2A 4L8BA 2Y25A 3GBNH 5HHXH 1RHFA 1EX0A 3OGOE 4FQ1H 35C8L 3I3BA 1WITA 3ARXA 3K74B 4ZFOL 5A40E 2C1OB 1MCNA 3HNVL 1QOKA 4U0RB 4KRMB 1WWCA 3T65B 1ZLSH 3PWPE 1INQB 1YN7B 4R4NC 1RZJC 3KJ6L 1WC7A 4NJ9L 4YH6A 1AY1L 1A7QH 2VL5B 4N5ED 2VZTA 2BRRH 2Z8VC 4XGZA 3MRKB 2G9HB 1UWGH 3DVGA 3Q6GH 3HZMA 1KIUA 2OTWB 2X1WL 4G9FB 4ZO9A 1IEAA 5IR1B 2BVPB 1CL7H 3KPQB 1ORQB 5CD3B 5CD5C 4R7NA 1DLHA 2VAAB 3GKWH 2F53D 4WO4A 4DVRL 2JELL 1A7OL 3TBWB 5EZJA 3HNTH 3AREC 4HBCH 3V79C 4K94H 5IV2B 3U4EB 5D7SH 3B9KA 1IGML 4KDTC 2R69H 4Z7NF 3P4NA 1I1AB 5E9DE 4BQBA 1ACZA 1NUFA 4K2UH 4HDIA 3RVTD 3RNKB 2FRGP 4NP4H 4NQEA 1EK3A 2W91A 3MYJB 4YHMH 5KSBB 5DLMH 5DJAA 3SGJA 1PD6A 4UDTA 4XMPH 4J3XA 1V7ML 4XI5D 4JANA 2YD8A 3I50H 3QUZC 3NCJL 1BLNB 4RIRA 1MEXL 3DRTA 3GO1H 3T08A 5BS0E 4HH8A 5E08L 4J4PD 1NMAL 3ZHLA 1N5AB 3QQNA 4D9QE 5I1KH 1A6ZB 2LVEA 2Q8BL 2VDPH 4W4OA 5TF0A 4QHMA 1EIBA 5DQJB 5HGDA 5JW4R 2R2HB 4TQEL 4LCUB 1WICA 5ADOL 1IBGL 1KPUB 3MNZB 1KLGB 2CRYA 1QKZL 4LEXH 4HKXA 4HT1H 3O8XA 3MNVA 3O4LE 5IT2L 5HHQB 4OAWA 5C6TL 3VXRA 3LPFA 3BMWA 3OXRB 2V7HA 5SWZE 5MEQB 1ZVSB 4EN3D 3PL6C 2R0WL 1CE1H 3MLYL 3PQYA 1BFTA 1SYSB 1T4KA 5GRVK 4QRSA 3RAJH 3CC5A 5HVHC 1LP9A 3C8HA 3CXHJ 1ES0A 1NMCC 3PGCA 2IBGA 5KZCD 3ELAT 1G6RL 3WD5L 1EZVY 1NBVH 1B0GB 4JZNA 1Z9OA 3MRFA 5T5FH 1O0VA 3HC0B 2A6JA 3BKCL 4H0GA 3VXUE 3ZTNH 4MDIA 1P69B 5IIEB 5CWSA 1T1YB 3UTSD 1EAJA 1S8DB 2YSSA 3VWKA 2VOTA 5D1QD 4FFYH 2PXYD 4XP9H 2EDDA 4L4JA 1HHJA 3IFNL 2PW1A 1LDSA 4ODHL 4C56A 4IIQC 4YQXL 2QADC 4XNMB 4MMXC 1UXSA 3OR7A 2V2WB 4MAYD 3O0RH 2XICA 4RQQB 2Z4QA 2E6JA 3TZVD 4ZXBD 4X0KA 2J8HA 5GZND 4HG4J 4PJ5A 3QDMB 1JNHB 4NO5A 2A6KB 4WEBL 2R0KL 2G60H 2YRZA 1ZTXH 4XXDB 2EDNA 3LDBB 2ZPKL 3O6KH 4I3SH 4NQUA 3B2VL 3ARDC 4U4BA 1AR1D 3QDGA 1XGUB 5BV7H 2ADGA 3PNWA 4ZD3H 1F3DJ 3RTQB 1MFAH 4JFXB 3FO2A 2F54D 2C7UB 3ARSA 4NO2B 4YAQA 1QO3B 4Y19E 1KTRL 2EZ0C 2X2YA 3FFCD 3GMNA 1P6AB 4Y5XA 2MKWA 4HIEB 5JHDA 5EUOF 4CN4A 5DHYA 5E8NA 1SY6L 4P0DA 4PJAF 1CICB 5J13B 3CUPB 3LH2H 1W2KT 3QWOA 3FRPA 4D0CB 1T04A 4DKEH 1ZT4B 5LGHH 5ICZA 3RWDB 2BHZA 1KG0B 3TNMB 2I9LA 2O5XH 2P43B 1RZ7H 3JVGA 3SCMD 4KAQL 4NN7C 5ID1A 4OQ1A 4AEFA 3HPLA 2MPAH 5I8KL 5T3XL 4U6HA 5JDJA 4P4KB 2XYCA 1NAMB 1G1YA 2J88H 4Z7NE 4PRIA 4Y4FB 1T7XA 2RIKA 3RKPA 3PGDA 3W0WD 2IFFL 1F8TL 4OT1H 5IFAL 4TVPE 5TPWH 3ZE2E 3VG0L 4Z0XB 5E6YA 3D0VA 4Y16B 4HUUB 4E5XA 3VGEA 3L3HB 5DJ8B 3DMMB 4RMUA 1TETL 2NY2D 3U46A 4UQ2A 5JUEH 1EJOH 2HFFB 2PYEB 1ND0A 1YYMH 4GFTB 3DVFA 25C8L 4K9EC 5SX5K 3L9RB 3V5HA 1QFHA 3NGBC 3LRHA 4O2EA 1KPVB 3BPCB 4LP4A 4PB0H 5ADPH 4P4RB 1I3RA 3K8MA 5LWYH 1MJJB 4RGMB 4YHZH 3RZCC 4F80A 3OHXB 2P1YA 4YHPB 3O6ML 4ORGB 4V2CB 4P5TB 5FAAA 5IESH 4IMLA 3VD3A 3ULUC 1IAMA 5L8KB 3D2UD 1LO3L 5DJZA 2BVOB 2AKRB 35C8H 4JFFD 5LCVH 3VXSD 1QA9A 4JO3L 2DM2A 1JV5A 3BP5B 1VADB 2DL2A 4Y89A 1KENL 5D7LE 4CJ0A 5EO1B 5FKAB 5BS0B 3QNYB 2D31A 2J1KA 2YR3A 4NSKB 3KJ6H 1AY1H 2F74B 2N7AA 2X4SB 3BQUC 5H37H 4MHHI 1J18A 1KSRA 1DQDH 1TJGL 2B0SL 3MNWA 4U1JA 2NPLX 3RX7A 2VDKH 4LLDB 3RUGB 3FB8B 4XCFH 2FIRT 4DVRH 5F88A 1XF2B 2JELH 1A7OH 5FV1L 4M1GH 3ARBA 1LE5A 2XZCH 5I74B 1XIWC 4UTAH 3KPOB 4M5YH 1KNOB 3RWJB 1N3NB 3O4LB 4KK9D 4L4VE 3GSNA 5C70A 2DIAA 1YJDC 2KDGA 4CGTA 3DGGA 4JY6A 4YDJA 4YHNA 5SWZB 4FQIL 5DQDL 2R39A 2K9UA 2HAZA 5EOQH 4OM1L 2WBWB 3JWOC 1INDH 3VGAC 4X5WA 5EC1B 1V7MH 3FAXA 4EI5D 1ZA6A 3QAZC 4R8WH 3KPPA 2BSED 1MEXH 2QLVB 4M00A 4P2OA 4NPYB 3EOBB 3RL2A 4TUOA 1NCTA 4G43B 3VXUB 1UB6B 1MCPL 3OKKA 1CL7I 1T20B 3TVMA 1OT2A 3V5KA 1YN6B 2NYYD 2I07A 3NCBB 1NKRA 2Q8BH 1DVFB 2EDXA 3G04A 2W9DH 3BWUC 5EUOE 2WINB 4WI4A 3QIWC 4NT6B 3UDWC 3E6FA 4LSQL 5DZNA 4FQXA 4MWFA 4ZUWA 2ZUQB 2GTZB 4LCWB 5ADOH 1IBGH 4Q7DA 4CBPA 1NDMB 3MRHA 1KCUH 4JKPL 1QKZH 4LDLB 4ZNEA 4CNIA 3QO1B 2H9GA 5I8CA 2NY6C 5CEYA 3AC0A 4RA0C 4MNQE 1BVZA 2YEZB 2G5RA 1ZLUH 4H1LG 2A38A 3WIFA 3VD5A 1ZHKA 5F3BA 2ILLA 4Q6YA 5F96H 5ESVB 4I4WB 2B7DT 4Y19B 3ZT5A 1CXLA 1AXTL 3L6FB 5FYKE 3EYOB 3UJIL 5BV7B 3RU8L 4LDEB 3STBA 4UTBL 3CFIC 1EEYA 1L7IL 4FXLA 2B1AH 2DQUH 4OZHA 1L7TH 2HT3D 3DBXB 4YDVA 4LCIL 2RQ8A 5D1XB 4AENA 5IB1B 4OCSH 5EC2A 2DI8A 3WUWG 3SDAC 3ILQC 1NGWB 1QQDA 4N0YL 4RDQF 1Z9MA 3WL9B 1CD8A 4H0IA 1Y18A 3ZHKA 5ICYB 5I1AA 1A6PA 1QSEA 3QHFL 4GUPA 4XCEB 3TBTB 3TV3L 5L7XH 1FNSH 1BQHB 4WEBH 2R0KH 4HCRL 2KZ1B 1UJ3B 2DICA 2ZPKH 4YBQD 3B2VH 5H94B 4D0BB 3MGTA 1JWSA 5EBGA 3UJTL 5DD6B 3MLXL 4IRJB 2Y06H 5IKCB 4H25A 4YHOL 4ODSL 5T1KA 2B4CC 3CCHB 1QUNA 1T83A 4HUNB 4P3DA 3WFCH 1KEGH 1GPOH 2EDBA 3GMQB 1A5FL 1JN6A 3JSSA 1OWRM 3TEUA 4KRLB 5L88L 1MIEL 3ARED 5K9QI 2GT9A 1WT5A 1B0RB 1FZJA 3MV9D 1SY6H 2FR4B 1FGNL 3KNBB 5F89B 2G75A 5CGMA 1HZHH 1WEJL 3H9SE 4X6BA 5IW3A 3LQMA 4G8FA 1GCFA 2FIKB 2YPLD 3GGWA 2QBWA 3RRQA 4KAQH 4G3YL 2BCKA 3CLFH 5I8KH 4OF7A 5JR1L 3ZDYF 5F7MC 3CZFA 3FONB 4B41A 3SOBL 3QUZD 3VFPA 5EN2B 5JXEA 1EUUA 1JF1B 1F8TH 4RX4D 4XMKL 1LP9F 2GJJA 5T3XE 5D7LB 3X3FL 5INDB 4LVHB 1I1CA 1HHIA 4LPTA 4L4TD 4NWUL 2A77L 4UIKL 4ZFOB 4AT6A 1QPPA 1DL7L 3SDYH 1TETH 3NMEA 1XGQB 5D2LF 5FM5M 3QHZH 3LD8C 2X70B 3L3OA 1XH3A 3UPRA 2NW3B 3D0LA 3FOMB 1YEIH 5DJDA 3LEVL 3VDAA 1H0DB 4HJGB 5DJXB 1M7DA 3MV11 5E8PB 3SKNB 1LVEA 4PJDA 5J7CC 4OGAC 1CGXA 1U3HD 5IB5A 3MJ9H 3ES6B 4U0RC 3O6MH 1KBGL 4LEOA 1JZ3A 1QLEL 1A1OB 3PL6D 3WIHL 4E0RA 4KROB 5T1LB 1JZ7A 3C8KA 5IB2B 5D2NA 4YGAB 2X4UB 4GMTH 4U1IB 4LDOB 3T8XB 3IVKB 1D6VL 2P8LA 1UM6H 4G7VL 4LLYB 2DD8L 4MXQC 3X17A 2AK4A 3PWNB 3QJFB 1NLBL 3F7PC 1KENH 2AEPL 2BFVL 4JGJA 1M71B 3NFPB 1CFSB 1CS6A 3SKOA 4DW2H 5B39B 1D5MA 3TIDB 1GHFL 3BUTA 1I1AC 2AJVH 2X44D 1KIQA 3TT3H 1TJGH 5FGSA 2B0SH 1GGCL 5EUOB 1S7UA 4ZODA 4PJAB 5ALCL 4LASL 4WNQA 2P5WD 3QSKB 3RP1A 2JF1A 4OTXL 2NLJA 5DR5L 5MI0B 2WWKT 3REVB 3X14B 4NIKB 5TH2B 4F2MB 4PY8J 1G7IA 3QIUB 1HHKB 1ZS8A 3ARDD 1VERA 5BOZG 4F9PA 1QFWH 4NKDA 1AI1L 2HJKA 5IJVA 5E00B 5DQDH 1A6UH 2H2PC 4Y1AD 3J8F7 3DX8A 3ZYIA 4NQEE 3H7BB 1P2CB 2EC9U 2EZ0D 1FZOB 4GAFB 5DRNA 2X4QA 4DGVL 3WEXA 3TNNB 4L1HA 3PV6B 2HJFA 1R3KA 3RPIA 3RBSA 4JRWA 4JZOA 4AQOA 2CLRA 5I8EA 2IEPA 2BY0A 4FABL 2C3XA 4U0QB 3GSWA 1S7WB 4M3KB 3NZ8B 5E94B 2ICEA 1U8QB 4TTDC 5JA8B 1MCPH 1HXMB 1QLFB 4KZDH 1CGVA 3CVHA 4NM8L 4JLRB 1G6RB 3O3AB 3K8KA 3KYOB 5IROC 5GS2H 4IEFB 4BH7A 2UZXB 4LSQH 3Q2CA 4XMLL 4ZPTB 5M95B 4NQCA 3BKJL 2MKLC 4PJ8A 4QHUB 3VXOB 4C54A 4X80L 4UIMA 2D0FA 4YPGB 1DQJA 5L2JB 1LO5A 5DVKA 4L3CA 1ODAA 1H8OA 4U1KA 3VXRE 1G7MB 3ZDYE 4YHKL 5DF0A 1V8HA 2OL3A 4BKLA 3V7MA 4LLMA 5I16B 1FH5L 1KCSH 3ZDXF 3PQYE 1F11A 4KI1A 5E24E 3AU1A 1LP9E 3K0WA 2VQTA 1OAZL 3UJIH 4MD5B 4P23A 5D8JL 4ERSL 3GSUB 2H32H 4OBSA 4UTBH 3RZCD 2I24N 1L7IH 2HH0L 1YNLL 4Q74A 3NIGF 1J12A 5D2LE 4JKLA 2KKQA 4LCIH 4XNUH 3HE7D 4KMLB 3LDBC 3CVIH 3ULUD 3MLRH 4P2CG 4WI3A 5HGAB 3CAFA 1S9VA 1NUGA 4HKBA 5H2BA 3SQOH 3IRPX 1C5DB 4C56E 4YNYA 4N0YH 1S7TB 1OGAD 4XVTL 3RTQC 1MOEA 4BQ6A 2EDLA 4DVBA 5KAQG 5DI8B 1NEZG 3BXNA 1ZGLA 5AEAA 4G6FB 4PJ5E 4JN1H 4Y5VB 4HCRH 4K3JL 4LHUG 1RJCA 3MREB 1CICC 5J13C 3BQUD 1S7VB 1LMKA 1DQTA 3LKRB 4CKVX 5EH1A 1YPZA 1J1XL 3O2DL 5CKAA 3LN9A 2EDJA 3G5VA 2XA3A 3QDGE 1WIUA 3UJTH 3ZTJG 4X4XA 1G9NL 3FO0H 4LVEA 5EO0A 3RFZC 4YHOH 2ZUUA 4ODSH 3SN6N 1GRWA 1CLOL 3PWJA 3MOBL 5BW7C 4NOFA 5HYIA 4YFDB 5D4QA 3TYFA 1P4IH 2AEQL 5L88H 5SWQB 1MIEH 3U30B 4WWKB 1K9TA 1XIWD 1PYWA 3QT2A 4P4KC 1QVOA 2MJWA 1FGNH 3JV6A 2CUHA 4HLZH 4Y4FC 5DT1L 1ZHLA 3DSFH 4NO3B 2PTTB 5ANMA 3I6GB 5TQ2H 4PPTA 1WEJH 2FL5B 4HC1L 4RSVA 1MFEH 4ETQA 3KPSD 4N8VG 2PN5A 4Y16C 2NXYB 3IDNB 3VW3L 2BSRB 4XZUA 1GVIA 5JR1H 3C09C 1U95B 5E8DH 4KJYA 5DQ9A 1KGCD 4X6FA 1U36A 5FO7B 5EU6D 4H5SA 4AEHH 1ONQA 4XMKH 5HYQA 3WIIL 2HTLC 4F9LA 1EFQA 4F3FA 4RGMC 1ZHBB 1JPFB 3X12A 2A77H 1KC5H 3VWJA 3M8OL 3HI6H 2EECA 3VMPA 1DL7H 1BBJB 1WC7B 1JJUA 3EYFA 2VITB 2C5DC 3OZ9L 1MIML 4P5TC 4OZHF 4WGWB 3W82A 3DVGB 3QA3B 1E6JL 1NBYA 1K2DA 4U49A 1HDMA 4Y0GA 3QCVL 5EU5A 2NY6D 1J7VR 4DKAA 4WO4B 1YEEL 2W9LA 4P9ML 3T1FA 5EZJB 1TCRA 1DUZA 4W6WB 2PO6A 4D3CL 5L9DL 4ORZC 3B9KB 4Z95H 5FGBC 3WIHH 2DAVA 3P4NB 2DIJA 4HK0B 1MAJA 3D3VA 5FCUL 4HDIB 4ONGL 3BP4A 3PJSA 1D6VH 4WU7B 2IAMA 5DJAB 2FWOA 3V95A 3O3UN 1Q72L 4NNPL 4FTVA 5BXFA 1CXIA 5DRWA 2BFVH 1N64H 5I74C 5GS0L 1EBAA 2QQLH 3PABB 3ZDXE 1GHFH 1C1EL 3TPUA 1WCBA 1J8HD 4P59L 3SDAD 3ILQD 3FOLB 3QH3A 5EOCL 1GGCH 4NCC1 4ODVH 3HI5L 4S2SA 2VXSL 4QHMB 5ALCH 1CLZL 4LASH 5KOMC 2Y23A 4OTXH 3CK0H 4UV4H 2FGZA 4X6DF 1QSFD 5DR5H 4PGEB 5HGDB 5HPMA 3GKZA 3TJHC 3BT2L 3VGFA 2XOTA 3HFML 2AJSL 3CX2A 3IU3A 4U1HA 4FG6C 4EOWL 1CDJA 3D85A 3O8XB 4Y4HA 3LEYL 1EH9A 5JXAH 1YECL 4N8PA 3C6LB 1T2QH 1DBJH 4OAWB 3VXRB 2V7HB 5FCSH 4PRPD 1WJ3A 4MZ3A 1MCOH 5FF6B 4XAWL 3RDTB 3CDCA 1RIHH 2JJTA 4XX1G 4PV9A 2V9RA 4X4YB 4Z8FH 3MJGX 5DFVD 3CC5B 4EN3A 2QQQA 1G0YR 3PGCB 4I77H 1YY9C 3MMEA 4FABH 3TM6A 4LLQA 1YMMA 3N1GC 5C09A 1CXEA 2ZUQC 5IJKA 5KVDL 32C2B 1A0QH 5EG6C 1WZLA 4JZNB 3MV7D 4P5KA 3VU2A 1MFDL 1FNGA 5I71B 5D2LB 4MDIB 4J8RA 4JO1L 5C0RH 2VH5H 4KRPB 3WLBA 5FUZH 4U31A 1FFPA 4KQ4L 3X11B 1U6AH 2PYFB 2PW1B 4ZTOH 4C56B 3MUZ1 4C59B 1UM4L 1VENA 4XMLH 4CVUA 3G6DL 2C3VA 1D9KA 3BKJH 1CQKA 4PR5A 1QFWI 1NLDL 4CADB 3EYVA 5D96B 5E8OA 3EFFA 2W1NA 2H1PL 3KPMB 3UAJC 4Q9RL 5BV7C 5GISL 4PJ5B 1DN0A 4JM4H 1U58B 1BZ7A 1EHNA 3GMPB 3ARZA 12E8L 1UACL 5J56B 3BIKB 5MHSD 1A1MA 4YHKH 1X5IA 4IOSD 1UQSB 2MCPL 4YDKL 1NSNH 3VRLF 1WIPA 5D1XC 1FH5H 4BSWA 1B6UA 4HIHA 4LBEA 1OAZH 3T3ME 3MA7A 3FO2B 2P7TA 1U93A 3WFBL 1MCDA 1U8MB 4APQD 4LCCA 4JN2B 4OGAD 2AW2A 2BNRB 2HH0H 1YNLH 1FZMB 1QBLL 4QYOB 5DJ0A 1EMTH 1UJTA 2VDNH 3NZHL 3FFCA 1F3JB 3SDDA 4OZHE 1I1FB 3CSGA 1UJ3C 2NXZD 2RJMA 5HHME 1AKJA 4N68A 3OV6A 2VLMD 5D70L 1FLTX 2I9LB 2BERA 1K8IB 4G9FD 1RZGA 1EHLH 1GGUA 3MLSL 5ID1B 4JFDB 4MXQD 1QRKA 2YMXH 1T1ZA 5ELIA 4U6HB 5CJXC 5AD0A 1QSEE 1Q9WA 3O3DA 5CUSH 1T80A 1QBML 3ARVA 4K3JH 3UZEA 4CMMA 3VFVB 5TE4L 2VE6A 3MCLH 1MSPA 4KFZC 4E42A 4UILL 3O2DH 1I1AD 5IK3A 2CMRL 4XPAL 4MQTB 1G9NH 2R1XB 3D0VB 3PP3H 5GSRB 1CLOH 1ORSA 1BJ1J 1KIRA 2VN7A 5T33L 3MOBH 3VGGA 4NQSA 2EYTA 1DUYA 3NA9H 1EEZA 4UQ2B 4OM0H 2ZG3A 1S7SB 3IFPB 3OTTA 1RY7B 1A6WL 1X5GA 5D71L 2R4RH 4O2EB 2J6EH 4ZDHB 1DLFH 4TSBL 1IZKA 2H2PD 3QP3A 5A43C 1YMHA 1RHHA 5EBWB 4HC1H 2XNAB 5B21A 4LVHC 4X6DE 3SGEH 2D7TH 3DXAA 3LVEA 5D7KD 3VW3H 1OAUL 4PJEF 1U91A 3ZT6A 1U3ZA 1FVCB 2VERN 3JTSA 2Q3ZA 1ED3A 5CFHA 5HDBF 1CFQB 5E4IA 2RHEA 3O2VL 3HAEA 3VFTA 4KTDL 2CKBL 1KJ2A 1QA9B 3OF6D 2QQNL 3EGSB 1JV5B 4TTDD 3NAAL 1ZA3A 4JFFA 3BJLA 5C0JB 2W38A 1CFVL 3U4AA 2OZ4L 1NBQA 2N4IA 5CBEA 1C7SA 4EKXA 4OLXL 4YBLB 2P24A 1T7YA 3V6OA 3TFKD 3T0WA 5I0DA 2GUOA 1MIMH 3S35L 1IM3B 4KROC 4X4ZA 5JORB 2EDKA 4JG1L 1E6JH 3MNWB 4U1JB 5CJQL 3FB7A 3PGFH 4WFFD 1WZKA 1MFCL 3LAFA 5EPMB 2J7LA 1NCBL 3QCVH 5DZOA 5AG9A 3GI8L 1JP5A 4K7PY 2AXFB 4EQ2A 1YEEH 2IFGA 1LE5B 4D3CH 1S9YB 2VZOA 1NC2A 3HHRB 3WFDL 5L9DH 3S4SB 2FBJL 4EUPG 4PREA 3DGGB 4YDJB 5FCUH 4YHNB 4ONGH 3RIFK 3MODL 4LSPL 5D2NE 1I9IL 4NKMA 5A3IC 1YPZF 4WW2A 1I8KB 1BBDL 3RZWA 3LIZL 2B5IB 5KSVA 1C8PA 4ZUVA 4TSAL 4X5WB 4G6AC 1Q72H 5EO9A 5AUMA 3NABL 1I7TA 4I0KA 2AK4E 2OYPA 3V0VA 5MI0C 2D4DA 4BFGA 3U7YL 1E27A 1J05A