4WV4B

Heterodimer of taf8/taf10
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
b'NYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription initiation factor TFIID subunit 10
publication title Cytoplasmic TAF2-TAF8-TAF10 complex provides evidence for nuclear holo-TFIID assembly from preformed submodules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 31
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07524 Bromo_TP Bromodomain associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wv4B00
3NQUA 4G91B 5AV6C 3MGRB 1P3OD 5CPJB 2CV5B 3KSYA 5C3IC 1M1AC 3AZLB 4E44A 2PYOC 4R8PD 5AY8B 5CPKC 3O62D 2NQBD 4QLCB 3MGQD 5F99A 1P3PA 1P3FD 1M18C 3UT9B 3REID 4H9NB 1P3IB 3KUYC 4Z66B 3LZ1B 1U35D 3W97A 1S32C 1HQ3A 3REHD 3B6FC 3WKJD 3C1BB 3AZMA 5GXQD 4X23D 5B24D 5GT0D 4J8XD 3UTAC 5B2JC 5GSUA 3AZID 4YM6A 1P3AB 4H9RA 3REKD 3AZKA 4LD9B 1F66C 2HIOB 5AV6B 5AV5A 3UTBB 1HTAA 5BNVB 5JRGC 5B0YA 3VH6A 4CAYB 3X1TA 3X1SA 3WTPC 5F99D 1P3PD 5B32C 3B0CT 2PYOB 3WA9B 3V9RA 3AYWB 1ID3C 1P3BB 5CPIC 5DNMD 1HQ3D 4NE3A 1M18B 4J8WD 3RELA 1KU5A 1TAFA 1S32B 5AVBA 3AZMD 5B31A 3B6FB 3KXBA 3W98D 1B6WA 1JFIB 3AZJA 3UTAB 5GSUD 3MGPC 2RVQC 2FJ7A 5B2JB 3B6GA 4YM6D 5B31G 4XUJB 3AZGB 3W99B 4WNNB 3B0CW 3AZKD 3W96D 3AZFC 4XZQC 5AV5D 1P34C 4J8UC 5B33A 1F66B 1P3KA 5B0YD 5B1LA 3X1TD 5BT1C 5JRGB 3AV2D 1A7WA 3WTPB 3AZIA 5B32B 4WU9A 1M19C 5GT3A 3MVDA 5AV9D 1BH8B 3RELD 1ID3B 4XZQA 2YFWA 5CPIB 5AVBD 4WU8C 4M6BA 1ULYA 4KUDD 3MGSC 1TZYC 3AFAA 1KX3B 2AROA 3AN2A 5E5AA 5DNNC 2FJ7D 5JA4A 2NZDA 5B0ZC 3MGPB 4CSRB 3VH6W 3LELA 4H9PA 5B1MA 5B33D 3LJAA 3AZFB 1P3KD 5B1LD 1P34B 4KGCA 3UT9C 4J8UB 5B40A 1P3MB 3WAAA 1P3IC 2F8NA 2IO5C 4Z66C 3LZ1C 3MGRA 1P3LC 3A6NA 5AVCA 4R8PC 5B2IB 5CPJA 2CV5A 4WU9D 3MGQC 5GT3D 3C1BC 3MVDD 3AZHC 3MNNC 2BYKB 3REIC 3AZLA 5AY8A 3VH5T 3REJC 4QLCA 1EQZB 4JJNC 3AFAD 3UT9A 4WU8B 2AROD 4H9NA 3AN2D 4Z66A 3MGSB 5GXQC 4X23C 1F1EA 4NE6A 2HIOC 1KX5B 2NZDD 3TU4C 5DNNB 3UTBC 3LELD 5AV8C 5B0ZB 2BYMB 3LJAD 4ZBJC 5G49A 3AV1C 3REKC 1N1JB 3WA9C 4KGCD 1P3OB 5B40D 1P3GD 4YS3C 3AYWC 1AOID 3VH5W 2F8ND 3WAAD 2F8NH 1P3BC 3A6ND 1P3AA 5AVCD 4LD9A 1KX4C 2HIOA 2CV5D 2IO5B 5AV6A 3KWQC 3UTBA 3NQJB 1P3LB 5BNVA 4R8PB 2NQBB 5CP6C 3MGQB 4CAYA 2LY8A 5AY8D 5DNMC 3AZHB 3MNNB 1M1AA 3REIB 4J8WC 2PYOA 4WZSB 5CPKA 1U35B 5FUGB 3REJB 3C1CD 4XUJC 1Q9CA 3AZGC 3W99C 4JJNB 4E45A 1M18A 3REHB 3WKJB 3W98C 3X1VC 3KUYA 5GXQB 4X23B 4NFTA 1S32A 5KDMB 4UUZB 3TU4B 3AZNC 3B6FA 3AZIB 1JFIA 5AV8B 3UTAA 4ZBJB 3AV1B 3REKB 1WWSA 5B2JA 4XUJA 1P3AD 4WNNA 4YS3B 5AV6D 3W97D 1KX4B 1F66A 3KWQB 3AZEC 1KX3C 4DRAA 1M1AD 5JRGA 5CP6B 2PYOD 5CPKD 5DNMB 1HQ3B 3WTPA 4J8WB 5B32A 4KUDC 5BS7C 1BH8A 3KUYD 1ID3A 4H9QB 1BH9B 5CPIA 1S32D 2F8NK 1ZLAC 3W98B 3X1VB 5B32G 1P3MC 3LZ0C 4YM6B 3UTAD 3AZNB 3X1SD 5B2IC 3W96B 4G92C 1H3OB 3AZKB 4ZUXC 3MGPA 4CSRA 3VH5A 3AZFA 4Z5TC 1F66D 1EQZC 4J8VC 1P34A 4J8UA 5JRGD 5B31D 3AV2B 4H9SC 3KXBD 4HGAC 3AZEB 5BNXA 3WTPD 3AZJD 5AV9B 1KX5C 3RELB 5B32D 1TAFB 3B0DB 4H9OB 5AVBB 3B6GD 2BYKA 1M19A 3X1UC 4KUDB 1P3OC 4WU8A 1ZLAB 4AWLC 3MGSA 1TZYA 3LZ0B 5DNNA 5B33B 3O62C 2RVQD 4G92B 1P3GC 2NQBC 1AOIC 5B1LB 4ZUXB 5B0ZA 2BYMA 1P3FC 4Z2MG 4XZQD 1N1JA 1P34D 1U35C 4Z5TB 4J8VB 3REHC 3WKJC 5E5AD 1P3IA 3LZ1A 4HGAB 3NQJA 5GT0C 5B24C 4J8XC 1P3LA 4R8PA 3B0BA 3MGQA 1M19D 3C1BA 3AFAB 3AZIC 3AZHA 2AROB 3MNNA 3REIA 4KHAB 5B1MD 3X1UB 4WU8D 3REJA 2YFVB 2NZDB 3MGSD 2L5AA 5BO0B 1TZYD 3R45B 4JJNA 3REHA 4AWLB 3MGRD 5DNND 5GXQA 4X23A 5CPJD 4UUZA 3TU4A 5B0ZD 5F99C 1P3PC 4WV4B 3O62B 1P3GB 3AZLD 1AOIB 3WAAB 5AV8A 1P3FB 3A6NB 3W97C 1HQ3C 5AVCB 4QLCD 3REKA 3AV1A 3WA9A 3UT9D 4YS3A 3AYWA 1P3ID 3AZMC 4Z66D 3LZ1D 1P3BA 1P3LD 1KX4A 3KWQA 5GT0B 5B24B 5GSUC 3C1BD 4J8XB 3AZHD 4EO5C 3MNND 3C1CB 5CP6A 4YM6C 5DNMA 3W96C 3REJD 3AZKC 3NQUB 5AV5C 4JJND 4J8WA 5B0YC 4H9QA 3AZGA 3W99A 1BH9A 3X1TC 4LD9D 5G49B 3X1SC 2HIOD 3X1VA 3W98A 3TU4D 3UTBD 3AV2C 5AV8D 5F99B 1P3PB 3AZNA 3AV1D 3W96A 1H3OA 5AV9C 3RELC 3WA9D 3W97B 4YS3D 3B0DC 3AYWD 5AVBC 5B31C 1P3BD 1M18D 3KXBC 5C3IB 1KX4D 3AZMB 1M1AB 3AZJC 3KWQD 5CPKB 3AV2A 2FJ7C 3B6GC 5CP6D 3B6FD 3AZEA 5GSUB 1KX3A 2HUEC 4EO5B 5AV9A 3KUYB 4H9RB 5B33C 4H9OA 5B2JD 1P3KC 4XUJD 3AZGD 5AV5B 3W99D 5B1LC 4KUDA 3X1VD 5BS7A 5B0YB 3X1TB 3X1SB 1ZLAA 3AZND 4WU9C 5GT3C 1P3MA 3MVDC 3V9RB 3LZ0A 5B2IA 4ZUXA 3AFAC 2AROC 1ID3D 5B31B 3AN2C 5E5AC 5CPID 3KXBB 4Z5TA 2CWEA 3VH6T 3AZJB 1EQZA 4J8VA 2NZDC 3AZED 1KX3D 2FJ7B 3B6GB 3LELC 4H9SA 5B1MC 3LJAC 2HUEB 1KX5A 4KGCC 3MGPD 5B40C 3WAAC 1P3KB 4G91C 4KHAA 3MGRC 3A6NC 3X1UA 3AZFD 5AVCC 1ZLAD 2YFVA 5CPJC 2CV5C 4J8UD 5BO0A 1P3OA 3R45A 1P3MD 3LZ0D 3AZLC 4DRBA 4WU9B 5BT1D 5AY8C 5GT3B 5B2ID 3MVDB 4QLCC 4XZQB 2YFWB 4ZUXD 3O62A 1P3GA 2NQBA 1AOIA 3C1CC 1R4VA 1P3FA 5BNXB 4Z5TD 1EQZD 3AN2B 5E5AB 4J8VD 1U35A 5FUGA 5JA4B 2JSSA 2F8NG 1M19B 3WKJA 4NE5A 4Z2MH 1KX5D 3LELB 4H9PB 5B1MB 5CHLB 5GT0A 5B24A 3WTPE 1B67A 5KDMA 1WWIA 3LJAB 4J8XA 3C1CA 1BFMA 4KGCB 3X1UD 1P3AC 1TZYB 5B40B 4LD9C 2F8NB
chains in the Genus database with same CATH superfamily
3NQUA 4G91B 5AV6C 3MGRB 1P3OD 1T3UA 5CPJB 2CV5B 3KSYA 5C3IC 1M1AC 3AZLB 4E44A 2PYOC 4R8PD 5AY8B 5CPKC 3O62D 2Y2MA 2NQBD 4QLCB 3MGQD 5F99A 1P3PA 1P3FD 1M18C 3A1KA 3UT9B 3REID 4H9NB 2DF4C 1P3IB 3KUYC 4Z66B 3LZ1B 1U35D 3W97A 2ZM5A 1HQ3A 1S32C 2G5HC 3REHD 3B6FC 3WKJD 3C1BB 3AZMA 5GXQD 4X23D 5B24D 5GT0D 4J8XD 3UTAC 5B2JC 5GSUA 3AZID 2XD5A 4YM6A 1P3AB 4H9RA 3REKD 3AZKA 4LD9B 1F66C 2HIOB 5AV6B 5AV5A 3UTBB 1HTAA 5BNVB 2W8SA 5JRGC 5B0YA 3VH6A 4CAYB 3X1TA 3X1SA 1Z2CB 3WTPC 5F99D 1P3PD 5B32C 3B0CT 2PYOB 3WA9B 3V9RA 3AYWB 1ID3C 2ZY2A 1P3BB 5CPIC 5DNMD 1HQ3D 4NE3A 1M18B 4J8WD 3RELA 1KU5A 1TAFA 1S32B 5AVBA 3AZMD 5B31A 3B6FB 3KXBA 3W98D 1B6WA 1JFIB 3AZJA 3UTAB 5GSUD 3MGPC 2RVQC 2FJ7A 5B2JB 3B6GA 4YM6D 5B31G 4XUJB 3AZGB 3W99B 2G5IC 2RIQA 3B0CW 4WNNB 3AZKD 3W96D 3AZFC 4XZQC 5AV5D 1P34C 4J8UC 5B33A 1F66B 1P3KA 5B0YD 5B1LA 3X1TD 5BT1C 5JRGB 3H0RC 3AV2D 1A7WA 2Y2OA 3WTPB 3AZIA 5B32B 4WU9A 1M19C 5GT3A 3MVDA 5AV9D 1BH8B 3RELD 1ID3B 4XZQA 2Y2JA 2YFWA 5CPIB 5AVBD 4WU8C 3KFUG 4M6BA 1ULYA 4KUDD 3MGSC 1TZYC 2UWXA 3AFAA 1KX3B 2AROA 3AN2A 5E5AA 5DNNC 2FJ7D 5JA4A 2NZDA 5B0ZC 3MGPB 4CSRB 3VH6W 3LELA 4H9PA 5B1MA 5B33D 3LJAA 3AZFB 1P3KD 5B1LD 1P34B 4KGCA 3UT9C 4J8UB 5B40A 1P3MB 3WAAA 1P3IC 2F8NA 2IO5C 4Z66C 3LZ1C 3MGRA 1P3LC 3A6NA 5AVCA 4R8PC 5B2IB 5CPJA 2CV5A 4WU9D 3MGQC 5GT3D 3C1BC 3MVDD 3AZHC 3MNNC 2BYKB 2Y2NA 3REIC 3AZLA 5AY8A 3VH5T 3REJC 4QLCA 1EQZB 4JJNC 2JCHA 3AFAD 4WU8B 2AROD 3UT9A 4H9NA 3AN2D 4Z66A 3MGSB 5GXQC 4X23C 1F1EA 4NE6A 2HIOC 1KX5B 2NZDD 3TU4C 5DNNB 3UTBC 3IP4C 3LELD 5AV8C 5B0ZB 2BYMB 3LJAD 4ZBJC 5G49A 3AV1C 3P5JB 3REKC 1N1JB 2ZY4A 3WA9C 4KGCD 2Y2QA 1P3OB 5B40D 1P3GD 4YS3C 3AYWC 1AOID 3VH5W 2F8ND 3WAAD 2F8NH 1P3BC 3A6ND 1P3AA 5AVCD 4LD9A 1KX4C 2HIOA 2CV5D 2IO5B 5AV6A 3KWQC 3UTBA 3NQJB 1P3LB 5BNVA 4R8PB 2NQBB 5CP6C 3MGQB 4CAYA 2LY8A 5AY8D 5DNMC 3AZHB 3MNNB 1M1AA 3REIB 2JE5A 4J8WC 2PYOA 4WZSB 5CPKA 1U35B 5FUGB 3REJB 3C1CD 4XUJC 1Q9CA 2F2AC 3W99C 4JJNB 3AZGC 4E45A 1M18A 3REHB 3WKJB 3W98C 3X1VC 3KUYA 5GXQB 4X23B 4NFTA 1S32A 5KDMB 4UUZB 3TU4B 3AZNC 3B6FA 3AZIB 1JFIA 5AV8B 3UTAA 4ZBJB 3AV1B 3REKB 2J8PA 1WWSA 5B2JA 4XUJA 1P3AD 4WNNA 4YS3B 5AV6D 3W97D 1KX4B 1F66A 3KWQB 3AZEC 1KX3C 4DRAA 1M1AD 5JRGA 5CP6B 2PYOD 5CPKD 5DNMB 1HQ3B 3WTPA 4J8WB 5B32A 4KUDC 5BS7C 1BH8A 3KUYD 1ID3A 4H9QB 3H0LC 1BH9B 5CPIA 1S32D 2F8NK 1ZLAC 3W98B 3X1VB 3AL0C 5B32G 1P3MC 3LZ0C 4YM6B 3UTAD 3AZNB 3X1SD 5B2IC 3W96B 1W2EA 1H3OB 4G92C 3AZKB 4ZUXC 4DQYB 3MGPA 4CSRA 3VH5A 3AZFA 4Z5TC 1F66D 1EQZC 4J8VC 1P34A 3EPHA 4J8UA 5JRGD 5B31D 3AV2B 4H9SC 3KXBD 4HGAC 3AZEB 5BNXA 3WTPD 3AZJD 5AV9B 1KX5C 3RELB 5B32D 2ZY3A 1TAFB 3B0DB 4H9OB 5AVBB 3B6GD 2BYKA 1M19A 3X1UC 4KUDB 1P3OC 4WU8A 1ZLAB 4AWLC 2VQRA 3MGSA 1TZYA 3LZ0B 5DNNA 5B33B 3O62C 2RVQD 4G92B 1P3GC 2NQBC 1AOIC 5B1LB 4ZUXB 5B0ZA 2BYMA 1P3FC 4Z2MG 4XZQD 1N1JA 1P34D 1U35C 4Z5TB 4J8VB 3REHC 2ZY5A 3WKJC 5E5AD 1P3IA 3LZ1A 4HGAB 3NQJA 5GT0C 5B24C 4J8XC 1P3LA 4R8PA 3B0BA 3MGQA 1M19D 3C1BA 3AFAB 3AZIC 3AZHA 2AROB 3MNNA 3REIA 2DQNC 4KHAB 5B1MD 3EPJA 3X1UB 4WU8D 3REJA 2YFVB 2Y2LA 2NZDB 3MGSD 2L5AA 5BO0B 1TZYD 3R45B 4JJNA 3REHA 4AWLB 3MGRD 5DNND 2FFFB 5GXQA 4X23A 3F6TA 5CPJD 4UUZA 3TU4A 5B0ZD 5F99C 1P3PC 4WV4B 3O62B 1P3GB 3AZLD 1AOIB 3WAAB 5AV8A 1P3FB 3A6NB 3W97C 1HQ3C 5AVCB 4QLCD 3REKA 3AV1A 3WA9A 3UT9D 2BG1A 3EG5B 4YS3A 3AYWA 1P3ID 3AZMC 4Z66D 3LZ1D 1P3BA 1P3LD 1KX4A 3A1IA 3KWQA 5GT0B 5B24B 5GSUC 3C1BD 4J8XB 3AZHD 4EO5C 3MNND 3C1CB 5CP6A 4YM6C 3FDDA 5DNMA 3W96C 3REJD 3AZKC 3NQUB 5AV5C 4JJND 4J8WA 5B0YC 4H9QA 3AZGA 3W99A 1BH9A 3X1TC 4LD9D 5G49B 3X1SC 2HIOD 3X1VA 3W98A 3TU4D 3UTBD 3AV2C 5AV8D 5F99B 1P3PB 3AZNA 3AV1D 3W96A 1H3OA 5AV9C 3RELC 3WA9D 3W97B 4YS3D 3B0DC 3AYWD 5AVBC 5B31C 1P3BD 1M18D 4UPKA 3KXBC 5C3IB 1KX4D 3AZMB 1M1AB 3AZJC 3KWQD 5CPKB 3AV2A 2FJ7C 3B6GC 5CP6D 3B6FD 3AZEA 5GSUB 1KX3A 2HUEC 4EO5B 5AV9A 3KUYB 4H9RB 5B33C 4H9OA 5B2JD 2Y2KA 4XUJD 3AZGD 5AV5B 3W99D 5B1LC 1P3KC 4KUDA 3X1VD 1PZRA 5BS7A 5B0YB 3X1TB 3X1SB 1ZLAA 3EPLA 3AZND 4WU9C 5GT3C 1P3MA 3MVDC 3V9RB 3LZ0A 2Y2GA 5B2IA 4WJ3C 4ZUXA 3AFAC 2AROC 1ID3D 5B31B 3AN2C 5E5AC 5CPID 3KXBB 4Z5TA 2CWEA 3VH6T 3AZJB 1EQZA 4J8VA 2NZDC 3AZED 1KX3D 2FJ7B 3B6GB 3LELC 4H9SA 5B1MC 3LJAC 2HUEB 1KX5A 4KGCC 3MGPD 5B40C 3WAAC 1P3KB 4G91C 4KHAA 3MGRC 3A6NC 3X1UA 3AZFD 5AVCC 1ZLAD 2YFVA 5CPJC 2CV5C 2Y2HA 4J8UD 5BO0A 1P3OA 3R45A 1P3MD 3LZ0D 3AZLC 4DRBA 4WU9B 5BT1D 5AY8C 5GT3B 5B2ID 3MVDB 4QLCC 4XZQB 2YFWB 4ZUXD 3O62A 1P3GA 2NQBA 1AOIA 2Y2IA 1R4VA 3H0MC 3C1CC 1P3FA 5BNXB 4Z5TD 3EPKA 1EQZD 3AN2B 5E5AB 2Y2PA 4J8VD 1U35A 5FUGA 5JA4B 2JSSA 2F8NG 1M19B 3WKJA 4NE5A 4Z2MH 1KX5D 3LELB 4H9PB 5B1MB 5CHLB 5GT0A 5B24A 3WTPE 1B67A 5KDMA 1WWIA 3LJAB 4J8XA 2XD1A 3C1CA 1BFMA 4KGCB 3X1UD 1P3AC 1TZYB 5B40B 4LD9C 2F8NB
chains in the Genus database with same CATH topology
3NQUA 4G91B 5AV6C 3MGRB 1P3OD 1T3UA 5CPJB 2CV5B 3KSYA 5C3IC 1M1AC 3AZLB 4E44A 2PYOC 4R8PD 5AY8B 5CPKC 3O62D 2Y2MA 2NQBD 4QLCB 3MGQD 5F99A 1P3PA 1P3FD 1M18C 3A1KA 3UT9B 3REID 4H9NB 2DF4C 1P3IB 3KUYC 4Z66B 3LZ1B 1U35D 3W97A 2ZM5A 1HQ3A 1S32C 2G5HC 3REHD 3B6FC 3WKJD 3C1BB 3AZMA 5GXQD 4X23D 5B24D 5GT0D 4J8XD 3UTAC 5B2JC 5GSUA 3AZID 2XD5A 4YM6A 1P3AB 4H9RA 3REKD 3AZKA 4LD9B 1F66C 2HIOB 5AV6B 5AV5A 3UTBB 1HTAA 5BNVB 2W8SA 5JRGC 5B0YA 3VH6A 4CAYB 3X1TA 3X1SA 1Z2CB 3WTPC 5F99D 1P3PD 5B32C 3B0CT 2PYOB 3WA9B 3V9RA 3AYWB 1ID3C 2ZY2A 1P3BB 5CPIC 5DNMD 1HQ3D 4NE3A 1M18B 4J8WD 3RELA 1KU5A 1TAFA 1S32B 5AVBA 3AZMD 5B31A 3B6FB 3KXBA 3W98D 1B6WA 1JFIB 3AZJA 3UTAB 5GSUD 3MGPC 2RVQC 2FJ7A 5B2JB 3B6GA 4YM6D 5B31G 4XUJB 3AZGB 3W99B 2G5IC 2RIQA 3B0CW 4WNNB 3AZKD 3W96D 3AZFC 4XZQC 5AV5D 1P34C 4J8UC 5B33A 1F66B 1P3KA 5B0YD 5B1LA 3X1TD 5BT1C 5JRGB 3H0RC 3AV2D 1A7WA 2Y2OA 3WTPB 3AZIA 5B32B 4WU9A 1M19C 5GT3A 3MVDA 5AV9D 1BH8B 3RELD 1ID3B 4XZQA 2Y2JA 2YFWA 5CPIB 5AVBD 4WU8C 3KFUG 4M6BA 1ULYA 4KUDD 3MGSC 1TZYC 2UWXA 3AFAA 1KX3B 2AROA 3AN2A 5E5AA 5DNNC 2FJ7D 5JA4A 2NZDA 5B0ZC 3MGPB 4CSRB 3VH6W 3LELA 4H9PA 5B1MA 5B33D 3LJAA 3AZFB 1P3KD 5B1LD 1P34B 4KGCA 3UT9C 4J8UB 5B40A 1P3MB 3WAAA 1P3IC 2F8NA 2IO5C 4Z66C 3LZ1C 3MGRA 1P3LC 3A6NA 5AVCA 4R8PC 5B2IB 5CPJA 2CV5A 4WU9D 3MGQC 5GT3D 3C1BC 3MVDD 3AZHC 3MNNC 2BYKB 2Y2NA 3REIC 3AZLA 5AY8A 3VH5T 3REJC 4QLCA 1EQZB 4JJNC 2JCHA 3AFAD 4WU8B 2AROD 3UT9A 4H9NA 3AN2D 4Z66A 3MGSB 5GXQC 4X23C 1F1EA 4NE6A 2HIOC 1KX5B 2NZDD 3TU4C 5DNNB 3UTBC 3IP4C 3LELD 5AV8C 5B0ZB 2BYMB 3LJAD 4ZBJC 5G49A 3AV1C 3P5JB 3REKC 1N1JB 2ZY4A 3WA9C 4KGCD 2Y2QA 1P3OB 5B40D 1P3GD 4YS3C 3AYWC 1AOID 3VH5W 2F8ND 3WAAD 2F8NH 1P3BC 3A6ND 1P3AA 5AVCD 4LD9A 1KX4C 2HIOA 2CV5D 2IO5B 5AV6A 3KWQC 3UTBA 3NQJB 1P3LB 5BNVA 4R8PB 2NQBB 5CP6C 3MGQB 4CAYA 2LY8A 5AY8D 5DNMC 3AZHB 3MNNB 1M1AA 3REIB 2JE5A 4J8WC 2PYOA 4WZSB 5CPKA 1U35B 5FUGB 3REJB 3C1CD 4XUJC 1Q9CA 2F2AC 3W99C 4JJNB 3AZGC 4E45A 1M18A 3REHB 3WKJB 3W98C 3X1VC 3KUYA 5GXQB 4X23B 4NFTA 1S32A 5KDMB 4UUZB 3TU4B 3AZNC 3B6FA 3AZIB 1JFIA 5AV8B 3UTAA 4ZBJB 3AV1B 3REKB 2J8PA 1WWSA 5B2JA 4XUJA 1P3AD 4WNNA 4YS3B 5AV6D 3W97D 1KX4B 1F66A 3KWQB 3AZEC 1KX3C 4DRAA 1M1AD 5JRGA 5CP6B 2PYOD 5CPKD 5DNMB 1HQ3B 3WTPA 4J8WB 5B32A 4KUDC 5BS7C 1BH8A 3KUYD 1ID3A 4H9QB 3H0LC 1BH9B 5CPIA 1S32D 2F8NK 1ZLAC 3W98B 3X1VB 3AL0C 5B32G 1P3MC 3LZ0C 4YM6B 3UTAD 3AZNB 3X1SD 5B2IC 3W96B 1W2EA 1H3OB 4G92C 3AZKB 4ZUXC 4DQYB 3MGPA 4CSRA 3VH5A 3AZFA 4Z5TC 1F66D 1EQZC 4J8VC 1P34A 3EPHA 4J8UA 5JRGD 5B31D 3AV2B 4H9SC 3KXBD 4HGAC 3AZEB 5BNXA 3WTPD 3AZJD 5AV9B 1KX5C 3RELB 5B32D 2ZY3A 1TAFB 3B0DB 4H9OB 5AVBB 3B6GD 2BYKA 1M19A 3X1UC 4KUDB 1P3OC 4WU8A 1ZLAB 4AWLC 2VQRA 3MGSA 1TZYA 3LZ0B 5DNNA 5B33B 3O62C 2RVQD 4G92B 1P3GC 2NQBC 1AOIC 5B1LB 4ZUXB 5B0ZA 2BYMA 1P3FC 4Z2MG 4XZQD 1N1JA 1P34D 1U35C 4Z5TB 4J8VB 3REHC 2ZY5A 3WKJC 5E5AD 1P3IA 3LZ1A 4HGAB 3NQJA 5GT0C 5B24C 4J8XC 1P3LA 4R8PA 3B0BA 3MGQA 1M19D 3C1BA 3AFAB 3AZIC 3AZHA 2AROB 3MNNA 3REIA 2DQNC 4KHAB 5B1MD 3EPJA 3X1UB 4WU8D 3REJA 2YFVB 2Y2LA 2NZDB 3MGSD 2L5AA 5BO0B 1TZYD 3R45B 4JJNA 3REHA 4AWLB 3MGRD 5DNND 2FFFB 5GXQA 4X23A 3F6TA 5CPJD 4UUZA 3TU4A 5B0ZD 5F99C 1P3PC 4WV4B 3O62B 1P3GB 3AZLD 1AOIB 3WAAB 5AV8A 1P3FB 3A6NB 3W97C 1HQ3C 5AVCB 4QLCD 3REKA 3AV1A 3WA9A 3UT9D 2BG1A 3EG5B 4YS3A 3AYWA 1P3ID 3AZMC 4Z66D 3LZ1D 1P3BA 1P3LD 1KX4A 3A1IA 3KWQA 5GT0B 5B24B 5GSUC 3C1BD 4J8XB 3AZHD 4EO5C 3MNND 3C1CB 5CP6A 4YM6C 3FDDA 5DNMA 3W96C 3REJD 3AZKC 3NQUB 5AV5C 4JJND 4J8WA 5B0YC 4H9QA 3AZGA 3W99A 1BH9A 3X1TC 4LD9D 5G49B 3X1SC 2HIOD 3X1VA 3W98A 3TU4D 3UTBD 3AV2C 5AV8D 5F99B 1P3PB 3AZNA 3AV1D 3W96A 1H3OA 5AV9C 3RELC 3WA9D 3W97B 4YS3D 3B0DC 3AYWD 5AVBC 5B31C 1P3BD 1M18D 4UPKA 3KXBC 5C3IB 1KX4D 3AZMB 1M1AB 3AZJC 3KWQD 5CPKB 3AV2A 2FJ7C 3B6GC 5CP6D 3B6FD 3AZEA 5GSUB 1KX3A 2HUEC 4EO5B 5AV9A 3KUYB 4H9RB 5B33C 4H9OA 5B2JD 2Y2KA 4XUJD 3AZGD 5AV5B 3W99D 5B1LC 1P3KC 4KUDA 3X1VD 1PZRA 5BS7A 5B0YB 3X1TB 3X1SB 1ZLAA 3EPLA 3AZND 4WU9C 5GT3C 1P3MA 3MVDC 3V9RB 3LZ0A 2Y2GA 5B2IA 4WJ3C 4ZUXA 3AFAC 2AROC 1ID3D 5B31B 3AN2C 5E5AC 5CPID 3KXBB 4Z5TA 2CWEA 3VH6T 3AZJB 1EQZA 4J8VA 2NZDC 3AZED 1KX3D 2FJ7B 3B6GB 3LELC 4H9SA 5B1MC 3LJAC 2HUEB 1KX5A 4KGCC 3MGPD 5B40C 3WAAC 1P3KB 4G91C 4KHAA 3MGRC 3A6NC 3X1UA 3AZFD 5AVCC 1ZLAD 2YFVA 5CPJC 2CV5C 2Y2HA 4J8UD 5BO0A 1P3OA 3R45A 1P3MD 3LZ0D 3AZLC 4DRBA 4WU9B 5BT1D 5AY8C 5GT3B 5B2ID 3MVDB 4QLCC 4XZQB 2YFWB 4ZUXD 3O62A 1P3GA 2NQBA 1AOIA 2Y2IA 1R4VA 3H0MC 3C1CC 1P3FA 5BNXB 4Z5TD 3EPKA 1EQZD 3AN2B 5E5AB 2Y2PA 4J8VD 1U35A 5FUGA 5JA4B 2JSSA 2F8NG 1M19B 3WKJA 4NE5A 4Z2MH 1KX5D 3LELB 4H9PB 5B1MB 5CHLB 5GT0A 5B24A 3WTPE 1B67A 5KDMA 1WWIA 3LJAB 4J8XA 2XD1A 3C1CA 1BFMA 4KGCB 3X1UD 1P3AC 1TZYB 5B40B 4LD9C 2F8NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQU A;  4G91 B;  5AV6 C;  3MGR B;  1P3O D;  5CPJ B;  2CV5 B;  3KSY A;  5C3I C;  1M1A C;  3AZL B;  4E44 A;  2PYO C;  4R8P D;  5AY8 B;  5CPK C;  3O62 D;  2NQB D;  4QLC B;  3MGQ D;  5F99 A;  1P3P A;  1P3F D;  1M18 C;  3UT9 B;  3REI D;  4H9N B;  1P3I B;  3KUY C;  4Z66 B;  3LZ1 B;  1U35 D;  3W97 A;  1S32 C;  1HQ3 A;  3REH D;  3B6F C;  3WKJ D;  3C1B B;  3AZM A;  5GXQ D;  4X23 D;  5B24 D;  5GT0 D;  4J8X D;  3UTA C;  5B2J C;  5GSU A;  3AZI D;  4YM6 A;  1P3A B;  4H9R A;  3REK D;  3AZK A;  4LD9 B;  1F66 C;  2HIO B;  5AV6 B;  5AV5 A;  3UTB B;  1HTA A;  5BNV B;  5JRG C;  5B0Y A;  3VH6 A;  4CAY B;  3X1T A;  3X1S A;  3WTP C;  5F99 D;  1P3P D;  5B32 C;  3B0C T;  2PYO B;  3WA9 B;  3V9R A;  3AYW B;  1ID3 C;  1P3B B;  5CPI C;  5DNM D;  1HQ3 D;  4NE3 A;  1M18 B;  4J8W D;  3REL A;  1KU5 A;  1TAF A;  1S32 B;  5AVB A;  3AZM D;  5B31 A;  3B6F B;  3KXB A;  3W98 D;  1B6W A;  1JFI B;  3AZJ A;  3UTA B;  5GSU D;  3MGP C;  2RVQ C;  2FJ7 A;  5B2J B;  3B6G A;  4YM6 D;  5B31 G;  4XUJ B;  3AZG B;  3W99 B;  4WNN B;  3B0C W;  3AZK D;  3W96 D;  3AZF C;  4XZQ C;  5AV5 D;  1P34 C;  4J8U C;  5B33 A;  1F66 B;  1P3K A;  5B0Y D;  5B1L A;  3X1T D;  5BT1 C;  5JRG B;  3AV2 D;  1A7W A;  3WTP B;  3AZI A;  5B32 B;  4WU9 A;  1M19 C;  5GT3 A;  3MVD A;  5AV9 D;  1BH8 B;  3REL D;  1ID3 B;  4XZQ A;  2YFW A;  5CPI B;  5AVB D;  4WU8 C;  4M6B A;  1ULY A;  4KUD D;  3MGS C;  1TZY C;  3AFA A;  1KX3 B;  2ARO A;  3AN2 A;  5E5A A;  5DNN C;  2FJ7 D;  5JA4 A;  2NZD A;  5B0Z C;  3MGP B;  4CSR B;  3VH6 W;  3LEL A;  4H9P A;  5B1M A;  5B33 D;  3LJA A;  3AZF B;  1P3K D;  5B1L D;  1P34 B;  4KGC A;  3UT9 C;  4J8U B;  5B40 A;  1P3M B;  3WAA A;  1P3I C;  2F8N A;  2IO5 C;  4Z66 C;  3LZ1 C;  3MGR A;  1P3L C;  3A6N A;  5AVC A;  4R8P C;  5B2I B;  5CPJ A;  2CV5 A;  4WU9 D;  3MGQ C;  5GT3 D;  3C1B C;  3MVD D;  3AZH C;  3MNN C;  2BYK B;  3REI C;  3AZL A;  5AY8 A;  3VH5 T;  3REJ C;  4QLC A;  1EQZ B;  4JJN C;  3AFA D;  3UT9 A;  4WU8 B;  2ARO D;  4H9N A;  3AN2 D;  4Z66 A;  3MGS B;  5GXQ C;  4X23 C;  1F1E A;  4NE6 A;  2HIO C;  1KX5 B;  2NZD D;  3TU4 C;  5DNN B;  3UTB C;  3LEL D;  5AV8 C;  5B0Z B;  2BYM B;  3LJA D;  4ZBJ C;  5G49 A;  3AV1 C;  3REK C;  1N1J B;  3WA9 C;  4KGC D;  1P3O B;  5B40 D;  1P3G D;  4YS3 C;  3AYW C;  1AOI D;  3VH5 W;  2F8N D;  3WAA D;  2F8N H;  1P3B C;  3A6N D;  1P3A A;  5AVC D;  4LD9 A;  1KX4 C;  2HIO A;  2CV5 D;  2IO5 B;  5AV6 A;  3KWQ C;  3UTB A;  3NQJ B;  1P3L B;  5BNV A;  4R8P B;  2NQB B;  5CP6 C;  3MGQ B;  4CAY A;  2LY8 A;  5AY8 D;  5DNM C;  3AZH B;  3MNN B;  1M1A A;  3REI B;  4J8W C;  2PYO A;  4WZS B;  5CPK A;  1U35 B;  5FUG B;  3REJ B;  3C1C D;  4XUJ C;  1Q9C A;  3AZG C;  3W99 C;  4JJN B;  4E45 A;  1M18 A;  3REH B;  3WKJ B;  3W98 C;  3X1V C;  3KUY A;  5GXQ B;  4X23 B;  4NFT A;  1S32 A;  5KDM B;  4UUZ B;  3TU4 B;  3AZN C;  3B6F A;  3AZI B;  1JFI A;  5AV8 B;  3UTA A;  4ZBJ B;  3AV1 B;  3REK B;  1WWS A;  5B2J A;  4XUJ A;  1P3A D;  4WNN A;  4YS3 B;  5AV6 D;  3W97 D;  1KX4 B;  1F66 A;  3KWQ B;  3AZE C;  1KX3 C;  4DRA A;  1M1A D;  5JRG A;  5CP6 B;  2PYO D;  5CPK D;  5DNM B;  1HQ3 B;  3WTP A;  4J8W B;  5B32 A;  4KUD C;  5BS7 C;  1BH8 A;  3KUY D;  1ID3 A;  4H9Q B;  1BH9 B;  5CPI A;  1S32 D;  2F8N K;  1ZLA C;  3W98 B;  3X1V B;  5B32 G;  1P3M C;  3LZ0 C;  4YM6 B;  3UTA D;  3AZN B;  3X1S D;  5B2I C;  3W96 B;  4G92 C;  1H3O B;  3AZK B;  4ZUX C;  3MGP A;  4CSR A;  3VH5 A;  3AZF A;  4Z5T C;  1F66 D;  1EQZ C;  4J8V C;  1P34 A;  4J8U A;  5JRG D;  5B31 D;  3AV2 B;  4H9S C;  3KXB D;  4HGA C;  3AZE B;  5BNX A;  3WTP D;  3AZJ D;  5AV9 B;  1KX5 C;  3REL B;  5B32 D;  1TAF B;  3B0D B;  4H9O B;  5AVB B;  3B6G D;  2BYK A;  1M19 A;  3X1U C;  4KUD B;  1P3O C;  4WU8 A;  1ZLA B;  4AWL C;  3MGS A;  1TZY A;  3LZ0 B;  5DNN A;  5B33 B;  3O62 C;  2RVQ D;  4G92 B;  1P3G C;  2NQB C;  1AOI C;  5B1L B;  4ZUX B;  5B0Z A;  2BYM A;  1P3F C;  4Z2M G;  4XZQ D;  1N1J A;  1P34 D;  1U35 C;  4Z5T B;  4J8V B;  3REH C;  3WKJ C;  5E5A D;  1P3I A;  3LZ1 A;  4HGA B;  3NQJ A;  5GT0 C;  5B24 C;  4J8X C;  1P3L A;  4R8P A;  3B0B A;  3MGQ A;  1M19 D;  3C1B A;  3AFA B;  3AZI C;  3AZH A;  2ARO B;  3MNN A;  3REI A;  4KHA B;  5B1M D;  3X1U B;  4WU8 D;  3REJ A;  2YFV B;  2NZD B;  3MGS D;  2L5A A;  5BO0 B;  1TZY D;  3R45 B;  4JJN A;  3REH A;  4AWL B;  3MGR D;  5DNN D;  5GXQ A;  4X23 A;  5CPJ D;  4UUZ A;  3TU4 A;  5B0Z D;  5F99 C;  1P3P C;  4WV4 B;  3O62 B;  1P3G B;  3AZL D;  1AOI B;  3WAA B;  5AV8 A;  1P3F B;  3A6N B;  3W97 C;  1HQ3 C;  5AVC B;  4QLC D;  3REK A;  3AV1 A;  3WA9 A;  3UT9 D;  4YS3 A;  3AYW A;  1P3I D;  3AZM C;  4Z66 D;  3LZ1 D;  1P3B A;  1P3L D;  1KX4 A;  3KWQ A;  5GT0 B;  5B24 B;  5GSU C;  3C1B D;  4J8X B;  3AZH D;  4EO5 C;  3MNN D;  3C1C B;  5CP6 A;  4YM6 C;  5DNM A;  3W96 C;  3REJ D;  3AZK C;  3NQU B;  5AV5 C;  4JJN D;  4J8W A;  5B0Y C;  4H9Q A;  3AZG A;  3W99 A;  1BH9 A;  3X1T C;  4LD9 D;  5G49 B;  3X1S C;  2HIO D;  3X1V A;  3W98 A;  3TU4 D;  3UTB D;  3AV2 C;  5AV8 D;  5F99 B;  1P3P B;  3AZN A;  3AV1 D;  3W96 A;  1H3O A;  5AV9 C;  3REL C;  3WA9 D;  3W97 B;  4YS3 D;  3B0D C;  3AYW D;  5AVB C;  5B31 C;  1P3B D;  1M18 D;  3KXB C;  5C3I B;  1KX4 D;  3AZM B;  1M1A B;  3AZJ C;  3KWQ D;  5CPK B;  3AV2 A;  2FJ7 C;  3B6G C;  5CP6 D;  3B6F D;  3AZE A;  5GSU B;  1KX3 A;  2HUE C;  4EO5 B;  5AV9 A;  3KUY B;  4H9R B;  5B33 C;  4H9O A;  5B2J D;  1P3K C;  4XUJ D;  3AZG D;  5AV5 B;  3W99 D;  5B1L C;  4KUD A;  3X1V D;  5BS7 A;  5B0Y B;  3X1T B;  3X1S B;  1ZLA A;  3AZN D;  4WU9 C;  5GT3 C;  1P3M A;  3MVD C;  3V9R B;  3LZ0 A;  5B2I A;  4ZUX A;  3AFA C;  2ARO C;  1ID3 D;  5B31 B;  3AN2 C;  5E5A C;  5CPI D;  3KXB B;  4Z5T A;  2CWE A;  3VH6 T;  3AZJ B;  1EQZ A;  4J8V A;  2NZD C;  3AZE D;  1KX3 D;  2FJ7 B;  3B6G B;  3LEL C;  4H9S A;  5B1M C;  3LJA C;  2HUE B;  1KX5 A;  4KGC C;  3MGP D;  5B40 C;  3WAA C;  1P3K B;  4G91 C;  4KHA A;  3MGR C;  3A6N C;  3X1U A;  3AZF D;  5AVC C;  1ZLA D;  2YFV A;  5CPJ C;  2CV5 C;  4J8U D;  5BO0 A;  1P3O A;  3R45 A;  1P3M D;  3LZ0 D;  3AZL C;  4DRB A;  4WU9 B;  5BT1 D;  5AY8 C;  5GT3 B;  5B2I D;  3MVD B;  4QLC C;  4XZQ B;  2YFW B;  4ZUX D;  3O62 A;  1P3G A;  2NQB A;  1AOI A;  3C1C C;  1R4V A;  1P3F A;  5BNX B;  4Z5T D;  1EQZ D;  3AN2 B;  5E5A B;  4J8V D;  1U35 A;  5FUG A;  5JA4 B;  2JSS A;  2F8N G;  1M19 B;  3WKJ A;  4NE5 A;  4Z2M H;  1KX5 D;  3LEL B;  4H9P B;  5B1M B;  5CHL B;  5GT0 A;  5B24 A;  3WTP E;  1B67 A;  5KDM A;  1WWI A;  3LJA B;  4J8X A;  3C1C A;  1BFM A;  4KGC B;  3X1U D;  1P3A C;  1TZY B;  5B40 B;  4LD9 C;  2F8N B; 
#chains in the Genus database with same CATH topology
 3NQU A;  4G91 B;  5AV6 C;  3MGR B;  1P3O D;  1T3U A;  5CPJ B;  2CV5 B;  3KSY A;  5C3I C;  1M1A C;  3AZL B;  4E44 A;  2PYO C;  4R8P D;  5AY8 B;  5CPK C;  3O62 D;  2Y2M A;  2NQB D;  4QLC B;  3MGQ D;  5F99 A;  1P3P A;  1P3F D;  1M18 C;  3A1K A;  3UT9 B;  3REI D;  4H9N B;  2DF4 C;  1P3I B;  3KUY C;  4Z66 B;  3LZ1 B;  1U35 D;  3W97 A;  2ZM5 A;  1HQ3 A;  1S32 C;  2G5H C;  3REH D;  3B6F C;  3WKJ D;  3C1B B;  3AZM A;  5GXQ D;  4X23 D;  5B24 D;  5GT0 D;  4J8X D;  3UTA C;  5B2J C;  5GSU A;  3AZI D;  2XD5 A;  4YM6 A;  1P3A B;  4H9R A;  3REK D;  3AZK A;  4LD9 B;  1F66 C;  2HIO B;  5AV6 B;  5AV5 A;  3UTB B;  1HTA A;  5BNV B;  2W8S A;  5JRG C;  5B0Y A;  3VH6 A;  4CAY B;  3X1T A;  3X1S A;  1Z2C B;  3WTP C;  5F99 D;  1P3P D;  5B32 C;  3B0C T;  2PYO B;  3WA9 B;  3V9R A;  3AYW B;  1ID3 C;  2ZY2 A;  1P3B B;  5CPI C;  5DNM D;  1HQ3 D;  4NE3 A;  1M18 B;  4J8W D;  3REL A;  1KU5 A;  1TAF A;  1S32 B;  5AVB A;  3AZM D;  5B31 A;  3B6F B;  3KXB A;  3W98 D;  1B6W A;  1JFI B;  3AZJ A;  3UTA B;  5GSU D;  3MGP C;  2RVQ C;  2FJ7 A;  5B2J B;  3B6G A;  4YM6 D;  5B31 G;  4XUJ B;  3AZG B;  3W99 B;  2G5I C;  2RIQ A;  3B0C W;  4WNN B;  3AZK D;  3W96 D;  3AZF C;  4XZQ C;  5AV5 D;  1P34 C;  4J8U C;  5B33 A;  1F66 B;  1P3K A;  5B0Y D;  5B1L A;  3X1T D;  5BT1 C;  5JRG B;  3H0R C;  3AV2 D;  1A7W A;  2Y2O A;  3WTP B;  3AZI A;  5B32 B;  4WU9 A;  1M19 C;  5GT3 A;  3MVD A;  5AV9 D;  1BH8 B;  3REL D;  1ID3 B;  4XZQ A;  2Y2J A;  2YFW A;  5CPI B;  5AVB D;  4WU8 C;  3KFU G;  4M6B A;  1ULY A;  4KUD D;  3MGS C;  1TZY C;  2UWX A;  3AFA A;  1KX3 B;  2ARO A;  3AN2 A;  5E5A A;  5DNN C;  2FJ7 D;  5JA4 A;  2NZD A;  5B0Z C;  3MGP B;  4CSR B;  3VH6 W;  3LEL A;  4H9P A;  5B1M A;  5B33 D;  3LJA A;  3AZF B;  1P3K D;  5B1L D;  1P34 B;  4KGC A;  3UT9 C;  4J8U B;  5B40 A;  1P3M B;  3WAA A;  1P3I C;  2F8N A;  2IO5 C;  4Z66 C;  3LZ1 C;  3MGR A;  1P3L C;  3A6N A;  5AVC A;  4R8P C;  5B2I B;  5CPJ A;  2CV5 A;  4WU9 D;  3MGQ C;  5GT3 D;  3C1B C;  3MVD D;  3AZH C;  3MNN C;  2BYK B;  2Y2N A;  3REI C;  3AZL A;  5AY8 A;  3VH5 T;  3REJ C;  4QLC A;  1EQZ B;  4JJN C;  2JCH A;  3AFA D;  4WU8 B;  2ARO D;  3UT9 A;  4H9N A;  3AN2 D;  4Z66 A;  3MGS B;  5GXQ C;  4X23 C;  1F1E A;  4NE6 A;  2HIO C;  1KX5 B;  2NZD D;  3TU4 C;  5DNN B;  3UTB C;  3IP4 C;  3LEL D;  5AV8 C;  5B0Z B;  2BYM B;  3LJA D;  4ZBJ C;  5G49 A;  3AV1 C;  3P5J B;  3REK C;  1N1J B;  2ZY4 A;  3WA9 C;  4KGC D;  2Y2Q A;  1P3O B;  5B40 D;  1P3G D;  4YS3 C;  3AYW C;  1AOI D;  3VH5 W;  2F8N D;  3WAA D;  2F8N H;  1P3B C;  3A6N D;  1P3A A;  5AVC D;  4LD9 A;  1KX4 C;  2HIO A;  2CV5 D;  2IO5 B;  5AV6 A;  3KWQ C;  3UTB A;  3NQJ B;  1P3L B;  5BNV A;  4R8P B;  2NQB B;  5CP6 C;  3MGQ B;  4CAY A;  2LY8 A;  5AY8 D;  5DNM C;  3AZH B;  3MNN B;  1M1A A;  3REI B;  2JE5 A;  4J8W C;  2PYO A;  4WZS B;  5CPK A;  1U35 B;  5FUG B;  3REJ B;  3C1C D;  4XUJ C;  1Q9C A;  2F2A C;  3W99 C;  4JJN B;  3AZG C;  4E45 A;  1M18 A;  3REH B;  3WKJ B;  3W98 C;  3X1V C;  3KUY A;  5GXQ B;  4X23 B;  4NFT A;  1S32 A;  5KDM B;  4UUZ B;  3TU4 B;  3AZN C;  3B6F A;  3AZI B;  1JFI A;  5AV8 B;  3UTA A;  4ZBJ B;  3AV1 B;  3REK B;  2J8P A;  1WWS A;  5B2J A;  4XUJ A;  1P3A D;  4WNN A;  4YS3 B;  5AV6 D;  3W97 D;  1KX4 B;  1F66 A;  3KWQ B;  3AZE C;  1KX3 C;  4DRA A;  1M1A D;  5JRG A;  5CP6 B;  2PYO D;  5CPK D;  5DNM B;  1HQ3 B;  3WTP A;  4J8W B;  5B32 A;  4KUD C;  5BS7 C;  1BH8 A;  3KUY D;  1ID3 A;  4H9Q B;  3H0L C;  1BH9 B;  5CPI A;  1S32 D;  2F8N K;  1ZLA C;  3W98 B;  3X1V B;  3AL0 C;  5B32 G;  1P3M C;  3LZ0 C;  4YM6 B;  3UTA D;  3AZN B;  3X1S D;  5B2I C;  3W96 B;  1W2E A;  1H3O B;  4G92 C;  3AZK B;  4ZUX C;  4DQY B;  3MGP A;  4CSR A;  3VH5 A;  3AZF A;  4Z5T C;  1F66 D;  1EQZ C;  4J8V C;  1P34 A;  3EPH A;  4J8U A;  5JRG D;  5B31 D;  3AV2 B;  4H9S C;  3KXB D;  4HGA C;  3AZE B;  5BNX A;  3WTP D;  3AZJ D;  5AV9 B;  1KX5 C;  3REL B;  5B32 D;  2ZY3 A;  1TAF B;  3B0D B;  4H9O B;  5AVB B;  3B6G D;  2BYK A;  1M19 A;  3X1U C;  4KUD B;  1P3O C;  4WU8 A;  1ZLA B;  4AWL C;  2VQR A;  3MGS A;  1TZY A;  3LZ0 B;  5DNN A;  5B33 B;  3O62 C;  2RVQ D;  4G92 B;  1P3G C;  2NQB C;  1AOI C;  5B1L B;  4ZUX B;  5B0Z A;  2BYM A;  1P3F C;  4Z2M G;  4XZQ D;  1N1J A;  1P34 D;  1U35 C;  4Z5T B;  4J8V B;  3REH C;  2ZY5 A;  3WKJ C;  5E5A D;  1P3I A;  3LZ1 A;  4HGA B;  3NQJ A;  5GT0 C;  5B24 C;  4J8X C;  1P3L A;  4R8P A;  3B0B A;  3MGQ A;  1M19 D;  3C1B A;  3AFA B;  3AZI C;  3AZH A;  2ARO B;  3MNN A;  3REI A;  2DQN C;  4KHA B;  5B1M D;  3EPJ A;  3X1U B;  4WU8 D;  3REJ A;  2YFV B;  2Y2L A;  2NZD B;  3MGS D;  2L5A A;  5BO0 B;  1TZY D;  3R45 B;  4JJN A;  3REH A;  4AWL B;  3MGR D;  5DNN D;  2FFF B;  5GXQ A;  4X23 A;  3F6T A;  5CPJ D;  4UUZ A;  3TU4 A;  5B0Z D;  5F99 C;  1P3P C;  4WV4 B;  3O62 B;  1P3G B;  3AZL D;  1AOI B;  3WAA B;  5AV8 A;  1P3F B;  3A6N B;  3W97 C;  1HQ3 C;  5AVC B;  4QLC D;  3REK A;  3AV1 A;  3WA9 A;  3UT9 D;  2BG1 A;  3EG5 B;  4YS3 A;  3AYW A;  1P3I D;  3AZM C;  4Z66 D;  3LZ1 D;  1P3B A;  1P3L D;  1KX4 A;  3A1I A;  3KWQ A;  5GT0 B;  5B24 B;  5GSU C;  3C1B D;  4J8X B;  3AZH D;  4EO5 C;  3MNN D;  3C1C B;  5CP6 A;  4YM6 C;  3FDD A;  5DNM A;  3W96 C;  3REJ D;  3AZK C;  3NQU B;  5AV5 C;  4JJN D;  4J8W A;  5B0Y C;  4H9Q A;  3AZG A;  3W99 A;  1BH9 A;  3X1T C;  4LD9 D;  5G49 B;  3X1S C;  2HIO D;  3X1V A;  3W98 A;  3TU4 D;  3UTB D;  3AV2 C;  5AV8 D;  5F99 B;  1P3P B;  3AZN A;  3AV1 D;  3W96 A;  1H3O A;  5AV9 C;  3REL C;  3WA9 D;  3W97 B;  4YS3 D;  3B0D C;  3AYW D;  5AVB C;  5B31 C;  1P3B D;  1M18 D;  4UPK A;  3KXB C;  5C3I B;  1KX4 D;  3AZM B;  1M1A B;  3AZJ C;  3KWQ D;  5CPK B;  3AV2 A;  2FJ7 C;  3B6G C;  5CP6 D;  3B6F D;  3AZE A;  5GSU B;  1KX3 A;  2HUE C;  4EO5 B;  5AV9 A;  3KUY B;  4H9R B;  5B33 C;  4H9O A;  5B2J D;  2Y2K A;  4XUJ D;  3AZG D;  5AV5 B;  3W99 D;  5B1L C;  1P3K C;  4KUD A;  3X1V D;  1PZR A;  5BS7 A;  5B0Y B;  3X1T B;  3X1S B;  1ZLA A;  3EPL A;  3AZN D;  4WU9 C;  5GT3 C;  1P3M A;  3MVD C;  3V9R B;  3LZ0 A;  2Y2G A;  5B2I A;  4WJ3 C;  4ZUX A;  3AFA C;  2ARO C;  1ID3 D;  5B31 B;  3AN2 C;  5E5A C;  5CPI D;  3KXB B;  4Z5T A;  2CWE A;  3VH6 T;  3AZJ B;  1EQZ A;  4J8V A;  2NZD C;  3AZE D;  1KX3 D;  2FJ7 B;  3B6G B;  3LEL C;  4H9S A;  5B1M C;  3LJA C;  2HUE B;  1KX5 A;  4KGC C;  3MGP D;  5B40 C;  3WAA C;  1P3K B;  4G91 C;  4KHA A;  3MGR C;  3A6N C;  3X1U A;  3AZF D;  5AVC C;  1ZLA D;  2YFV A;  5CPJ C;  2CV5 C;  2Y2H A;  4J8U D;  5BO0 A;  1P3O A;  3R45 A;  1P3M D;  3LZ0 D;  3AZL C;  4DRB A;  4WU9 B;  5BT1 D;  5AY8 C;  5GT3 B;  5B2I D;  3MVD B;  4QLC C;  4XZQ B;  2YFW B;  4ZUX D;  3O62 A;  1P3G A;  2NQB A;  1AOI A;  2Y2I A;  1R4V A;  3H0M C;  3C1C C;  1P3F A;  5BNX B;  4Z5T D;  3EPK A;  1EQZ D;  3AN2 B;  5E5A B;  2Y2P A;  4J8V D;  1U35 A;  5FUG A;  5JA4 B;  2JSS A;  2F8N G;  1M19 B;  3WKJ A;  4NE5 A;  4Z2M H;  1KX5 D;  3LEL B;  4H9P B;  5B1M B;  5CHL B;  5GT0 A;  5B24 A;  3WTP E;  1B67 A;  5KDM A;  1WWI A;  3LJA B;  4J8X A;  2XD1 A;  3C1C A;  1BFM A;  4KGC B;  3X1U D;  1P3A C;  1TZY B;  5B40 B;  4LD9 C;  2F8N B; 
#chains in the Genus database with same CATH homology
 3NQU A;  4G91 B;  5AV6 C;  3MGR B;  1P3O D;  1T3U A;  5CPJ B;  2CV5 B;  3KSY A;  5C3I C;  1M1A C;  3AZL B;  4E44 A;  2PYO C;  4R8P D;  5AY8 B;  5CPK C;  3O62 D;  2Y2M A;  2NQB D;  4QLC B;  3MGQ D;  5F99 A;  1P3P A;  1P3F D;  1M18 C;  3A1K A;  3UT9 B;  3REI D;  4H9N B;  2DF4 C;  1P3I B;  3KUY C;  4Z66 B;  3LZ1 B;  1U35 D;  3W97 A;  2ZM5 A;  1HQ3 A;  1S32 C;  2G5H C;  3REH D;  3B6F C;  3WKJ D;  3C1B B;  3AZM A;  5GXQ D;  4X23 D;  5B24 D;  5GT0 D;  4J8X D;  3UTA C;  5B2J C;  5GSU A;  3AZI D;  2XD5 A;  4YM6 A;  1P3A B;  4H9R A;  3REK D;  3AZK A;  4LD9 B;  1F66 C;  2HIO B;  5AV6 B;  5AV5 A;  3UTB B;  1HTA A;  5BNV B;  2W8S A;  5JRG C;  5B0Y A;  3VH6 A;  4CAY B;  3X1T A;  3X1S A;  1Z2C B;  3WTP C;  5F99 D;  1P3P D;  5B32 C;  3B0C T;  2PYO B;  3WA9 B;  3V9R A;  3AYW B;  1ID3 C;  2ZY2 A;  1P3B B;  5CPI C;  5DNM D;  1HQ3 D;  4NE3 A;  1M18 B;  4J8W D;  3REL A;  1KU5 A;  1TAF A;  1S32 B;  5AVB A;  3AZM D;  5B31 A;  3B6F B;  3KXB A;  3W98 D;  1B6W A;  1JFI B;  3AZJ A;  3UTA B;  5GSU D;  3MGP C;  2RVQ C;  2FJ7 A;  5B2J B;  3B6G A;  4YM6 D;  5B31 G;  4XUJ B;  3AZG B;  3W99 B;  2G5I C;  2RIQ A;  3B0C W;  4WNN B;  3AZK D;  3W96 D;  3AZF C;  4XZQ C;  5AV5 D;  1P34 C;  4J8U C;  5B33 A;  1F66 B;  1P3K A;  5B0Y D;  5B1L A;  3X1T D;  5BT1 C;  5JRG B;  3H0R C;  3AV2 D;  1A7W A;  2Y2O A;  3WTP B;  3AZI A;  5B32 B;  4WU9 A;  1M19 C;  5GT3 A;  3MVD A;  5AV9 D;  1BH8 B;  3REL D;  1ID3 B;  4XZQ A;  2Y2J A;  2YFW A;  5CPI B;  5AVB D;  4WU8 C;  3KFU G;  4M6B A;  1ULY A;  4KUD D;  3MGS C;  1TZY C;  2UWX A;  3AFA A;  1KX3 B;  2ARO A;  3AN2 A;  5E5A A;  5DNN C;  2FJ7 D;  5JA4 A;  2NZD A;  5B0Z C;  3MGP B;  4CSR B;  3VH6 W;  3LEL A;  4H9P A;  5B1M A;  5B33 D;  3LJA A;  3AZF B;  1P3K D;  5B1L D;  1P34 B;  4KGC A;  3UT9 C;  4J8U B;  5B40 A;  1P3M B;  3WAA A;  1P3I C;  2F8N A;  2IO5 C;  4Z66 C;  3LZ1 C;  3MGR A;  1P3L C;  3A6N A;  5AVC A;  4R8P C;  5B2I B;  5CPJ A;  2CV5 A;  4WU9 D;  3MGQ C;  5GT3 D;  3C1B C;  3MVD D;  3AZH C;  3MNN C;  2BYK B;  2Y2N A;  3REI C;  3AZL A;  5AY8 A;  3VH5 T;  3REJ C;  4QLC A;  1EQZ B;  4JJN C;  2JCH A;  3AFA D;  4WU8 B;  2ARO D;  3UT9 A;  4H9N A;  3AN2 D;  4Z66 A;  3MGS B;  5GXQ C;  4X23 C;  1F1E A;  4NE6 A;  2HIO C;  1KX5 B;  2NZD D;  3TU4 C;  5DNN B;  3UTB C;  3IP4 C;  3LEL D;  5AV8 C;  5B0Z B;  2BYM B;  3LJA D;  4ZBJ C;  5G49 A;  3AV1 C;  3P5J B;  3REK C;  1N1J B;  2ZY4 A;  3WA9 C;  4KGC D;  2Y2Q A;  1P3O B;  5B40 D;  1P3G D;  4YS3 C;  3AYW C;  1AOI D;  3VH5 W;  2F8N D;  3WAA D;  2F8N H;  1P3B C;  3A6N D;  1P3A A;  5AVC D;  4LD9 A;  1KX4 C;  2HIO A;  2CV5 D;  2IO5 B;  5AV6 A;  3KWQ C;  3UTB A;  3NQJ B;  1P3L B;  5BNV A;  4R8P B;  2NQB B;  5CP6 C;  3MGQ B;  4CAY A;  2LY8 A;  5AY8 D;  5DNM C;  3AZH B;  3MNN B;  1M1A A;  3REI B;  2JE5 A;  4J8W C;  2PYO A;  4WZS B;  5CPK A;  1U35 B;  5FUG B;  3REJ B;  3C1C D;  4XUJ C;  1Q9C A;  2F2A C;  3W99 C;  4JJN B;  3AZG C;  4E45 A;  1M18 A;  3REH B;  3WKJ B;  3W98 C;  3X1V C;  3KUY A;  5GXQ B;  4X23 B;  4NFT A;  1S32 A;  5KDM B;  4UUZ B;  3TU4 B;  3AZN C;  3B6F A;  3AZI B;  1JFI A;  5AV8 B;  3UTA A;  4ZBJ B;  3AV1 B;  3REK B;  2J8P A;  1WWS A;  5B2J A;  4XUJ A;  1P3A D;  4WNN A;  4YS3 B;  5AV6 D;  3W97 D;  1KX4 B;  1F66 A;  3KWQ B;  3AZE C;  1KX3 C;  4DRA A;  1M1A D;  5JRG A;  5CP6 B;  2PYO D;  5CPK D;  5DNM B;  1HQ3 B;  3WTP A;  4J8W B;  5B32 A;  4KUD C;  5BS7 C;  1BH8 A;  3KUY D;  1ID3 A;  4H9Q B;  3H0L C;  1BH9 B;  5CPI A;  1S32 D;  2F8N K;  1ZLA C;  3W98 B;  3X1V B;  3AL0 C;  5B32 G;  1P3M C;  3LZ0 C;  4YM6 B;  3UTA D;  3AZN B;  3X1S D;  5B2I C;  3W96 B;  1W2E A;  1H3O B;  4G92 C;  3AZK B;  4ZUX C;  4DQY B;  3MGP A;  4CSR A;  3VH5 A;  3AZF A;  4Z5T C;  1F66 D;  1EQZ C;  4J8V C;  1P34 A;  3EPH A;  4J8U A;  5JRG D;  5B31 D;  3AV2 B;  4H9S C;  3KXB D;  4HGA C;  3AZE B;  5BNX A;  3WTP D;  3AZJ D;  5AV9 B;  1KX5 C;  3REL B;  5B32 D;  2ZY3 A;  1TAF B;  3B0D B;  4H9O B;  5AVB B;  3B6G D;  2BYK A;  1M19 A;  3X1U C;  4KUD B;  1P3O C;  4WU8 A;  1ZLA B;  4AWL C;  2VQR A;  3MGS A;  1TZY A;  3LZ0 B;  5DNN A;  5B33 B;  3O62 C;  2RVQ D;  4G92 B;  1P3G C;  2NQB C;  1AOI C;  5B1L B;  4ZUX B;  5B0Z A;  2BYM A;  1P3F C;  4Z2M G;  4XZQ D;  1N1J A;  1P34 D;  1U35 C;  4Z5T B;  4J8V B;  3REH C;  2ZY5 A;  3WKJ C;  5E5A D;  1P3I A;  3LZ1 A;  4HGA B;  3NQJ A;  5GT0 C;  5B24 C;  4J8X C;  1P3L A;  4R8P A;  3B0B A;  3MGQ A;  1M19 D;  3C1B A;  3AFA B;  3AZI C;  3AZH A;  2ARO B;  3MNN A;  3REI A;  2DQN C;  4KHA B;  5B1M D;  3EPJ A;  3X1U B;  4WU8 D;  3REJ A;  2YFV B;  2Y2L A;  2NZD B;  3MGS D;  2L5A A;  5BO0 B;  1TZY D;  3R45 B;  4JJN A;  3REH A;  4AWL B;  3MGR D;  5DNN D;  2FFF B;  5GXQ A;  4X23 A;  3F6T A;  5CPJ D;  4UUZ A;  3TU4 A;  5B0Z D;  5F99 C;  1P3P C;  4WV4 B;  3O62 B;  1P3G B;  3AZL D;  1AOI B;  3WAA B;  5AV8 A;  1P3F B;  3A6N B;  3W97 C;  1HQ3 C;  5AVC B;  4QLC D;  3REK A;  3AV1 A;  3WA9 A;  3UT9 D;  2BG1 A;  3EG5 B;  4YS3 A;  3AYW A;  1P3I D;  3AZM C;  4Z66 D;  3LZ1 D;  1P3B A;  1P3L D;  1KX4 A;  3A1I A;  3KWQ A;  5GT0 B;  5B24 B;  5GSU C;  3C1B D;  4J8X B;  3AZH D;  4EO5 C;  3MNN D;  3C1C B;  5CP6 A;  4YM6 C;  3FDD A;  5DNM A;  3W96 C;  3REJ D;  3AZK C;  3NQU B;  5AV5 C;  4JJN D;  4J8W A;  5B0Y C;  4H9Q A;  3AZG A;  3W99 A;  1BH9 A;  3X1T C;  4LD9 D;  5G49 B;  3X1S C;  2HIO D;  3X1V A;  3W98 A;  3TU4 D;  3UTB D;  3AV2 C;  5AV8 D;  5F99 B;  1P3P B;  3AZN A;  3AV1 D;  3W96 A;  1H3O A;  5AV9 C;  3REL C;  3WA9 D;  3W97 B;  4YS3 D;  3B0D C;  3AYW D;  5AVB C;  5B31 C;  1P3B D;  1M18 D;  4UPK A;  3KXB C;  5C3I B;  1KX4 D;  3AZM B;  1M1A B;  3AZJ C;  3KWQ D;  5CPK B;  3AV2 A;  2FJ7 C;  3B6G C;  5CP6 D;  3B6F D;  3AZE A;  5GSU B;  1KX3 A;  2HUE C;  4EO5 B;  5AV9 A;  3KUY B;  4H9R B;  5B33 C;  4H9O A;  5B2J D;  2Y2K A;  4XUJ D;  3AZG D;  5AV5 B;  3W99 D;  5B1L C;  1P3K C;  4KUD A;  3X1V D;  1PZR A;  5BS7 A;  5B0Y B;  3X1T B;  3X1S B;  1ZLA A;  3EPL A;  3AZN D;  4WU9 C;  5GT3 C;  1P3M A;  3MVD C;  3V9R B;  3LZ0 A;  2Y2G A;  5B2I A;  4WJ3 C;  4ZUX A;  3AFA C;  2ARO C;  1ID3 D;  5B31 B;  3AN2 C;  5E5A C;  5CPI D;  3KXB B;  4Z5T A;  2CWE A;  3VH6 T;  3AZJ B;  1EQZ A;  4J8V A;  2NZD C;  3AZE D;  1KX3 D;  2FJ7 B;  3B6G B;  3LEL C;  4H9S A;  5B1M C;  3LJA C;  2HUE B;  1KX5 A;  4KGC C;  3MGP D;  5B40 C;  3WAA C;  1P3K B;  4G91 C;  4KHA A;  3MGR C;  3A6N C;  3X1U A;  3AZF D;  5AVC C;  1ZLA D;  2YFV A;  5CPJ C;  2CV5 C;  2Y2H A;  4J8U D;  5BO0 A;  1P3O A;  3R45 A;  1P3M D;  3LZ0 D;  3AZL C;  4DRB A;  4WU9 B;  5BT1 D;  5AY8 C;  5GT3 B;  5B2I D;  3MVD B;  4QLC C;  4XZQ B;  2YFW B;  4ZUX D;  3O62 A;  1P3G A;  2NQB A;  1AOI A;  2Y2I A;  1R4V A;  3H0M C;  3C1C C;  1P3F A;  5BNX B;  4Z5T D;  3EPK A;  1EQZ D;  3AN2 B;  5E5A B;  2Y2P A;  4J8V D;  1U35 A;  5FUG A;  5JA4 B;  2JSS A;  2F8N G;  1M19 B;  3WKJ A;  4NE5 A;  4Z2M H;  1KX5 D;  3LEL B;  4H9P B;  5B1M B;  5CHL B;  5GT0 A;  5B24 A;  3WTP E;  1B67 A;  5KDM A;  1WWI A;  3LJA B;  4J8X A;  2XD1 A;  3C1C A;  1BFM A;  4KGC B;  3X1U D;  1P3A C;  1TZY B;  5B40 B;  4LD9 C;  2F8N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...