4WV4B

Heterodimer of taf8/taf10
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
NYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cytoplasmic TAF2-TAF8-TAF10 complex provides evidence for nuclear holo-TFIID assembly from preformed submodules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Transcription initiation factor TFIID subunit 10
total genus 31
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07524 Bromo_TP Bromodomain associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wv4B00
5CPJB 3B6FB 3C1BB 4HGAC 5DNMA 5AY8C 3KXBB 1KX5B 3WAAC 1EQZB 5B1MB 4G91B 3REHD 3LZ0B 4J8VB 1M1AD 4WU8B 1P3OA 1P3BA 4Z66C 5GT0A 3WTPC 3X1VD 5C3IB 4J8UA 3REID 3X1SD 3MNNB 3MGPD 4KGCB 2FJ7B 4WU9B 1AOIC 3MNNC 5B1LC 5AVCD 5E5AD 3AFAD 5CPIA 2HIOA 3AN2D 3TU4C 3UTAD 1P3MB 5CPKC 4H9NB 1F66D 3X1SB 3AZHD 5CPKB 3KSYA 3AYWC 4ZUXD 1P3IA 1S32A 4KGCD 1P3PB 2NQBA 3X1UD 3B6GD 2RVQC 4J8WD 4QLCD 5B33D 5B31A 1WWIA 4R8PD 3V9RA 4WV4B 1P3OD 5JA4A 5B0YA 1M19B 3W98C 4ZBJC 3X1VA 3REIA 1P3AC 3AZND 1M19C 2CV5D 5B31B 3X1UB 3AZGC 5DNMC 2BYKA 1P3AB 2BYMA 1P3FA 3W96D 3AN2A 3B0BA 4YS3C 3UT9B 5AV9A 1P3BC 3UT9C 5F99B 3KWQD 4JJNB 1P3FB 3C1BA 1U35D 1P3BB 3O62A 3AV2C 4KGCA 1TZYB 5AV9B 5B1MA 3MNNA 2NQBD 3WKJD 5CP6C 5AV6C 1KX3C 5BT1C 4Z5TA 3MGQD 5GSUD 5JRGC 1JFIB 5B0YD 3AZMD 5B0ZA 1S32C 3W99A 5GT0D 2NQBB 3AZNA 4J8UD 4WU9C 3UTBC 1KX5A 3MGQB 5B31C 3REHB 5BO0B 1P3IB 3REHC 4UUZB 4CAYA 1ID3D 4NE3A 3AZKB 3VH5T 4CSRB 4J8XD 5BS7C 1P34C 5B2ID 3AZFD 1P3FC 4X23B 3X1TC 2NZDC 3AYWB 1AOID 4H9RA 3LELA 5B1LD 5AVCC 3AFAC 4Z5TD 3UT9A 3UTAB 3LJAB 4QLCA 3TU4D 1P3LC 1ZLAD 2IO5C 2BYKB 3UTAC 3WA9A 3A6ND 3AZHB 5CPKD 5AVBB 5B1MC 5BNXB 4ZBJB 3KXBD 1M18C 2HUEB 1H3OB 5GT3B 4J8WB 2AROD 3VH6T 3V9RB 2CWEA 2PYOD 3W99C 5B0ZC 3KWQA 4Z2MG 3MGSA 1P3OC 1P3GB 3UTBA 2F8NH 3W98D 5AV6B 4J8XA 1P3GC 1HQ3B 3AZEA 2CV5C 1KX5C 5G49A 1AOIA 1EQZC 4XUJD 4H9QB 3W96C 5AV5C 3AZIC 5AV8B 4JJNA 3RELA 3WA9D 5CPKA 1TZYA 1P3LB 3AYWA 5CPJD 3RELB 3B6FD 4LD9D 3W97A 4QLCB 3AZLD 4KUDC 3NQUB 4XZQC 1P3LA 3AZKA 5B40A 1P3MC 4NE5A 3NQJA 5JA4B 5B32D 2HUEC 5GT3C 1F66A 3MGSD 5JRGD 5B0YC 3REKD 2JSSA 1S32D 5GT0C 2F8ND 3AZED 4J8UC 3AV2B 5B2JA 4J8WA 5B32B 5B33A 3AZGA 5B31D 4R8PA 3TU4A 3KWQB 4JJND 4G92C 1F66B 3KUYD 3A6NA 3WAAB 1TZYD 4NFTA 4G92B 1KX4C 2CV5A 2YFVB 1P3KC 3W97D 4YS3B 3WTPB 4Z66B 5AY8D 5AV9D 3RELC 4Z5TC 4YM6C 5B24A 4WU8A 1ZLAC 4AWLC 2F8NA 4H9PA 1P3AA 3MGPC 3MVDD 3W96B 3LZ0A 4J8VA 3AZKC 4E45A 4XUJA 3REJC 5E5AC 4EO5C 3MGQA 2AROC 4WNNB 1P3PC 3REJB 5F99D 4H9SC 4CSRA 3LJAC 3AZJA 3UTBB 3AYWD 4KGCC 4H9NA 1N1JB 1KX4B 3B0DB 1KX5D 1WWSA 3C1CC 4DRBA 5BS7A 1P34A 3X1SA 2RVQD 4NE6A 5B40D 3WA9B 4QLCC 5GXQD 3LELC 5AVCA 3AFAA 5JRGA 1ID3A 3AZNB 4H9RB 1P3KA 1P3AD 4WU9A 5DNMD 5AVCB 3AFAB 1F1EA 1M18A 2LY8A 5B2JD 5B24C 5AVBA 3MGPB 1P3ID 1ULYA 2CV5B 3LZ1C 5F99A 5B24B 3AV1A 1U35B 1P3BD 5B32C 3X1UA 1KX3B 3KWQC 3MGSC 1HQ3A 3REKC 3AZEB 1P3KB 3KXBA 5DNMB 3LZ0C 4J8VC 4X23D 3AZEC 5E5AA 5CP6D 2HIOD 1B67A 1P3GA 5GSUB 4R8PB 1JFIA 4WU8D 4JJNC 5GSUC 5DNNA 3MGRA 2F8NK 3W96A 4DRAA 3REIB 5B32G 1R4VA 4ZUXA 3AZMC 1M1AC 5CP6B 4WU9D 2FJ7A 3WTPD 4Z66D 1M1AB 4EO5B 1KU5A 3WTPE 3X1SC 2AROB 4E44A 5GT0B 5AV8C 4G91C 3MNND 3AV1D 3X1TB 2NZDB 4KUDA 4XZQA 1S32B 1A7WA 3AZJD 4H9PB 1F66C 3B0DC 4X23A 4J8XC 3AZHC 5B2IC 3AZFC 1P3FD 4XZQB 3MVDC 5AVBC 3O62B 1EQZA 3REJD 5B32A 3X1UC 3KUYB 3AZGB 1P3PD 3B6GC 5GXQA 4H9QA 3C1BD 4J8WC 3A6NC 5B33C 4WZSB 4R8PC 2YFVA 4KHAA 5B1MD 3WKJA 5B33B 1KX4A 1M18D 3X1VB 3C1CD 3NQJB 5GSUA 5DNNC 3MGRC 5BNXA 5B40C 1P3MA 4YS3D 5GT3A 5E5AB 3W99D 1Q9CA 5DNNB 5B0ZD 3MGRB 3LELD 5FUGA 5AV5B 1H3OA 3AZIB 1HQ3D 3WKJB 1ZLAA 4H9OB 2PYOB 1M18B 4XUJB 5BNVA 3AV2D 1EQZD 4XUJC 2NQBC 3REJA 5C3IC 5AV6D 5B2JC 3MGPA 5B24D 4H9OA 3LZ1D 1KX3D 3WAAA 4KUDB 5G49B 3MGQC 4H9SA 5FUGB 2AROA 3MVDA 2PYOA 2FJ7D 4Z2MH 4Z66A 3WTPA 5CPJC 3B6FC 4LD9C 5B0YB 1N1JA 1M19A 5AY8B 3UTBD 2HIOC 4M6BA 1P34B 1P3MD 5CPIC 1BH9A 2YFWA 5GT3D 4YM6A 4WU8C 1B6WA 5B40B 1BFMA 3MVDB 2IO5B 1ID3C 3O62C 3AV2A 3W98B 3REKB 1P34D 4WNNA 4KHAB 3VH5A 5AV8D 3X1TD 2NZDD 3VH6A 1KX3A 1P3PA 3WAAD 3AV1C 3AZLA 3KUYC 1P3LD 3B6GB 3LJAA 3AZJC 1ZLAB 3X1VC 3REIC 1U35A 1P3OB 3REKA 5AVBD 4HGAB 3KXBC 3C1CA 3B0CT 5BO0A 5AV9C 3RELD 4YM6D 3AN2C 3MGSB 4YS3A 3VH6W 2BYMB 3C1BC 3AN2B 2L5AA 2PYOC 1M1AA 5CPJA 3B6FA 4LD9A 5CP6A 5JRGB 4ZUXC 3AZMA 1BH8A 3AZKD 1P3GD 5AV8A 1BH9B 2YFWB 4ZUXB 5AV6A 4YM6B 4J8XB 2F8NG 1TAFA 5DNND 5B0ZB 3LZ1A 3MGRD 3W99B 5F99C 1AOIB 5AV5D 3AZID 5AY8A 3LJAD 3UTAA 3TU4B 5B31G 3WA9C 3AV1B 1HQ3C 4LD9B 1TAFB 3NQUA 2HIOB 3W97B 3AZHA 3AZNC 1M19D 1BH8B 3AZGD 5GXQB 4J8UB 3R45B 5B2IA 3AZFA 3AZLC 4KUDD 3KUYA 4XZQD 3B6GA 5GXQC 5B1LA 3AZLB 3UT9D 5CPIB 2F8NB 3REHA 3R45A 5B2IB 3AZFB 1U35C 4UUZA 4CAYB 2FJ7C 3C1CB 5B1LB 3WKJC 1ID3B 3X1TA 1P3IC 2NZDA 3LELB 5BT1D 3A6NB 5CPID 5AV5A 3AZIA 3AZJB 5CHLB 5B2JB 4Z5TB 3B0CW 5BNVB 5KDMA 1HTAA 1TZYC 3LZ0D 4J8VD 4X23C 1KX4D 3O62D 3VH5W 3AZMB 3W98A 4AWLB 3LZ1B 1P3KD 3W97C 5KDMB
chains in the Genus database with same CATH superfamily
5CPJB 3B6FB 3C1BB 4HGAC 5DNMA 5AY8C 3KXBB 1KX5B 3WAAC 1EQZB 5B1MB 4G91B 3REHD 3LZ0B 4J8VB 1M1AD 4WU8B 1P3OA 1P3BA 4Z66C 5GT0A 3WTPC 2ZM5A 5C3IB 3EPJA 4J8UA 3REID 3X1SD 2UWXA 3MNNB 3X1VD 3MGPD 2Y2GA 2FJ7B 4WU9B 1AOIC 4KGCB 3MNNC 5B1LC 5AVCD 5E5AD 3AFAD 5CPIA 2HIOA 3AN2D 3TU4C 3UTAD 1P3MB 5CPKC 4H9NB 1F66D 2ZY4A 3X1SB 3AZHD 5CPKB 2Y2IA 3KSYA 3AYWC 4ZUXD 1P3IA 1S32A 4KGCD 1P3PB 2NQBA 2Y2NA 3X1UD 3B6GD 2RVQC 4J8WD 4QLCD 5B33D 5B31A 1WWIA 4R8PD 3V9RA 4WV4B 1P3OD 5JA4A 5B0YA 1M19B 3W98C 4ZBJC 3X1VA 3REIA 1P3AC 3AZND 1M19C 2CV5D 2Y2MA 5B31B 3X1UB 3AZGC 5DNMC 2BYKA 1P3AB 2BYMA 1P3FA 3W96D 3AN2A 3B0BA 4YS3C 3UT9B 5AV9A 2VQRA 1P3BC 3UT9C 5F99B 3KWQD 4JJNB 1P3FB 3C1BA 1U35D 1P3BB 3O62A 3AV2C 4KGCA 1TZYB 5AV9B 5B1MA 3MNNA 2NQBD 3WKJD 5CP6C 5AV6C 1KX3C 3H0MC 5BT1C 4Z5TA 2XD5A 3MGQD 5GSUD 5JRGC 1JFIB 5B0YD 3AZMD 5B0ZA 1S32C 3W99A 5GT0D 2NQBB 3AZNA 4J8UD 4WU9C 3UTBC 2DF4C 1KX5A 3MGQB 5B31C 3REHB 5BO0B 4WJ3C 1P3IB 2DQNC 3REHC 4UUZB 4CAYA 1ID3D 4NE3A 3AZKB 3VH5T 4CSRB 4J8XD 5BS7C 1P34C 5B2ID 3AZFD 1P3FC 4X23B 3X1TC 2NZDC 3AYWB 1AOID 4H9RA 3LELA 5B1LD 5AVCC 3AFAC 4Z5TD 3UT9A 3UTAB 3LJAB 4QLCA 3TU4D 1P3LC 1ZLAD 2IO5C 2BYKB 3UTAC 3WA9A 3A6ND 3AZHB 5CPKD 5AVBB 5B1MC 4UPKA 5BNXB 3F6TA 1PZRA 4ZBJB 3KXBD 1M18C 2HUEB 1H3OB 5GT3B 4J8WB 2AROD 3VH6T 3V9RB 2CWEA 3P5JB 2PYOD 3W99C 5B0ZC 3KWQA 4Z2MG 3MGSA 1P3OC 1P3GB 3UTBA 2F8NH 3W98D 5AV6B 4J8XA 1P3GC 1HQ3B 3AZEA 2CV5C 1KX5C 5G49A 1AOIA 1EQZC 4XUJD 4H9QB 3W96C 5AV5C 3AZIC 5AV8B 4JJNA 3RELA 3WA9D 5CPKA 1TZYA 1P3LB 3AYWA 5CPJD 3RELB 3B6FD 4LD9D 3W97A 4QLCB 3AZLD 4KUDC 3NQUB 4XZQC 1P3LA 3AZKA 5B40A 1P3MC 4NE5A 3NQJA 5JA4B 5B32D 2HUEC 5GT3C 1F66A 3A1KA 3MGSD 3EPKA 5JRGD 5B0YC 3REKD 2JSSA 1S32D 5GT0C 2F8ND 3AZED 4J8UC 3AV2B 5B2JA 4J8WA 5B32B 5B33A 3AZGA 5B31D 4R8PA 3TU4A 3KWQB 4JJND 4G92C 1F66B 3KUYD 3A6NA 3WAAB 1TZYD 4NFTA 4G92B 3A1IA 1KX4C 2CV5A 2YFVB 1P3KC 3W97D 4YS3B 3WTPB 4Z66B 5AY8D 5AV9D 3RELC 2W8SA 4Z5TC 4YM6C 5B24A 4WU8A 2F2AC 1ZLAC 4AWLC 2F8NA 4H9PA 3EPHA 1P3AA 3MGPC 2G5HC 3MVDD 3W96B 3LZ0A 4J8VA 3AZKC 4E45A 4XUJA 3REJC 5E5AC 4EO5C 3MGQA 2AROC 4WNNB 1P3PC 3REJB 5F99D 4H9SC 4CSRA 3LJAC 3AZJA 3UTBB 3AYWD 4KGCC 4H9NA 1N1JB 1KX4B 3B0DB 1KX5D 1WWSA 3C1CC 4DRBA 5BS7A 1P34A 3X1SA 2RVQD 4NE6A 5B40D 3WA9B 4QLCC 2FFFB 5GXQD 3LELC 5AVCA 3AFAA 5JRGA 1ID3A 3AZNB 4H9RB 3H0LC 1P3KA 1P3AD 4WU9A 5DNMD 5AVCB 3AFAB 1F1EA 2Y2JA 1M18A 2LY8A 5B2JD 5B24C 5AVBA 3MGPB 1P3ID 1ULYA 2CV5B 3LZ1C 5F99A 5B24B 3AV1A 1U35B 1P3BD 5B32C 3X1UA 1KX3B 3KWQC 3MGSC 1HQ3A 3REKC 3AZEB 1P3KB 2G5IC 3KXBA 5DNMB 3LZ0C 4J8VC 3H0RC 4X23D 3AZEC 5E5AA 5CP6D 2HIOD 1B67A 1P3GA 5GSUB 4R8PB 1JFIA 4WU8D 4JJNC 5GSUC 5DNNA 3MGRA 2F8NK 3W96A 4DRAA 3REIB 5B32G 1R4VA 2XD1A 4ZUXA 3AZMC 1M1AC 5CP6B 4WU9D 2FJ7A 1T3UA 4Z66D 3WTPD 1M1AB 4EO5B 1KU5A 3WTPE 3X1SC 2AROB 4E44A 3FDDA 5GT0B 5AV8C 4G91C 3MNND 3AV1D 3X1TB 2NZDB 4KUDA 4XZQA 2JE5A 1S32B 1A7WA 3AZJD 4H9PB 1F66C 2Y2KA 3B0DC 4X23A 4J8XC 3AZHC 3AL0C 5B2IC 3AZFC 1P3FD 4XZQB 3MVDC 5AVBC 3O62B 1EQZA 3REJD 5B32A 3X1UC 3KUYB 3AZGB 1P3PD 3B6GC 5GXQA 4H9QA 3C1BD 4J8WC 3A6NC 5B33C 4WZSB 4R8PC 2YFVA 4KHAA 5B1MD 3WKJA 5B33B 2Y2OA 1KX4A 1M18D 3X1VB 3C1CD 3IP4C 3NQJB 5GSUA 5DNNC 3MGRC 5BNXA 5B40C 1P3MA 4YS3D 5GT3A 5E5AB 3W99D 1Q9CA 5DNNB 5B0ZD 3MGRB 3LELD 5FUGA 5AV5B 1H3OA 3AZIB 1HQ3D 3WKJB 1ZLAA 4H9OB 2PYOB 3EPLA 4XUJB 5BNVA 1M18B 3AV2D 1EQZD 4XUJC 2NQBC 3REJA 5C3IC 5AV6D 5B2JC 3MGPA 5B24D 4H9OA 2ZY3A 3LZ1D 1KX3D 1W2EA 3WAAA 4KUDB 5G49B 3MGQC 4H9SA 5FUGB 2AROA 4DQYB 3MVDA 2PYOA 2FJ7D 4Z2MH 4Z66A 3WTPA 5CPJC 3B6FC 4LD9C 2ZY2A 1N1JA 5B0YB 1M19A 5AY8B 3UTBD 2HIOC 4M6BA 1P34B 1P3MD 5CPIC 1BH9A 2YFWA 5GT3D 4YM6A 4WU8C 1B6WA 5B40B 1BFMA 2BG1A 3MVDB 2IO5B 1ID3C 3O62C 3AV2A 3W98B 3REKB 1P34D 4WNNA 4KHAB 3VH5A 5AV8D 3X1TD 2ZY5A 2NZDD 3VH6A 1KX3A 1P3PA 3WAAD 3AV1C 3AZLA 3KUYC 2J8PA 1P3LD 3B6GB 3LJAA 3AZJC 1ZLAB 3X1VC 3REIC 1U35A 1P3OB 2Y2LA 3REKA 5AVBD 4HGAB 3KXBC 3C1CA 3B0CT 5BO0A 5AV9C 3RELD 4YM6D 3AN2C 3MGSB 4YS3A 3VH6W 2BYMB 3C1BC 3KFUG 3AN2B 2L5AA 2PYOC 1M1AA 5CPJA 3B6FA 4LD9A 5CP6A 5JRGB 2Y2HA 4ZUXC 3AZMA 1BH8A 3AZKD 1P3GD 5AV8A 1BH9B 2YFWB 4ZUXB 5AV6A 4YM6B 4J8XB 2F8NG 1TAFA 5DNND 5B0ZB 3LZ1A 3MGRD 3W99B 5F99C 1AOIB 5AV5D 3AZID 5AY8A 1Z2CB 3LJAD 3UTAA 3TU4B 5B31G 3WA9C 3AV1B 1HQ3C 4LD9B 1TAFB 3NQUA 2HIOB 3W97B 3AZHA 3AZNC 1M19D 1BH8B 2JCHA 3AZGD 5GXQB 4J8UB 3R45B 5B2IA 3AZFA 3AZLC 4KUDD 3KUYA 4XZQD 3B6GA 5GXQC 5B1LA 3AZLB 3UT9D 5CPIB 2F8NB 3REHA 3R45A 5B2IB 3AZFB 1U35C 4UUZA 4CAYB 3EG5B 3C1CB 2FJ7C 5B1LB 3WKJC 1ID3B 3X1TA 1P3IC 2NZDA 3LELB 5BT1D 3A6NB 5CPID 5AV5A 3AZIA 3AZJB 2Y2PA 5CHLB 5B2JB 4Z5TB 3B0CW 5BNVB 5KDMA 1HTAA 1TZYC 3LZ0D 4J8VD 4X23C 1KX4D 3O62D 2Y2QA 3VH5W 3AZMB 3W98A 4AWLB 3LZ1B 1P3KD 2RIQA 3W97C 5KDMB
chains in the Genus database with same CATH topology
5CPJB 3B6FB 3C1BB 4HGAC 5DNMA 5AY8C 3KXBB 1KX5B 3WAAC 1EQZB 5B1MB 4G91B 3REHD 3LZ0B 4J8VB 1M1AD 4WU8B 1P3OA 1P3BA 4Z66C 5GT0A 3WTPC 2ZM5A 5C3IB 3EPJA 4J8UA 3REID 3X1SD 2UWXA 3MNNB 3X1VD 3MGPD 2Y2GA 2FJ7B 4WU9B 1AOIC 4KGCB 3MNNC 5B1LC 5AVCD 5E5AD 3AFAD 5CPIA 2HIOA 3AN2D 3TU4C 3UTAD 1P3MB 5CPKC 4H9NB 1F66D 2ZY4A 3X1SB 3AZHD 5CPKB 2Y2IA 3KSYA 3AYWC 4ZUXD 1P3IA 1S32A 4KGCD 1P3PB 2NQBA 2Y2NA 3X1UD 3B6GD 2RVQC 4J8WD 4QLCD 5B33D 5B31A 1WWIA 4R8PD 3V9RA 4WV4B 1P3OD 5JA4A 5B0YA 1M19B 3W98C 4ZBJC 3X1VA 3REIA 1P3AC 3AZND 1M19C 2CV5D 2Y2MA 5B31B 3X1UB 3AZGC 5DNMC 2BYKA 1P3AB 2BYMA 1P3FA 3W96D 3AN2A 3B0BA 4YS3C 3UT9B 5AV9A 2VQRA 1P3BC 3UT9C 5F99B 3KWQD 4JJNB 1P3FB 3C1BA 1U35D 1P3BB 3O62A 3AV2C 4KGCA 1TZYB 5AV9B 5B1MA 3MNNA 2NQBD 3WKJD 5CP6C 5AV6C 1KX3C 3H0MC 5BT1C 4Z5TA 2XD5A 3MGQD 5GSUD 5JRGC 1JFIB 5B0YD 3AZMD 5B0ZA 1S32C 3W99A 5GT0D 2NQBB 3AZNA 4J8UD 4WU9C 3UTBC 2DF4C 1KX5A 3MGQB 5B31C 3REHB 5BO0B 4WJ3C 1P3IB 2DQNC 3REHC 4UUZB 4CAYA 1ID3D 4NE3A 3AZKB 3VH5T 4CSRB 4J8XD 5BS7C 1P34C 5B2ID 3AZFD 1P3FC 4X23B 3X1TC 2NZDC 3AYWB 1AOID 4H9RA 3LELA 5B1LD 5AVCC 3AFAC 4Z5TD 3UT9A 3UTAB 3LJAB 4QLCA 3TU4D 1P3LC 1ZLAD 2IO5C 2BYKB 3UTAC 3WA9A 3A6ND 3AZHB 5CPKD 5AVBB 5B1MC 4UPKA 5BNXB 3F6TA 1PZRA 4ZBJB 3KXBD 1M18C 2HUEB 1H3OB 5GT3B 4J8WB 2AROD 3VH6T 3V9RB 2CWEA 3P5JB 2PYOD 3W99C 5B0ZC 3KWQA 4Z2MG 3MGSA 1P3OC 1P3GB 3UTBA 2F8NH 3W98D 5AV6B 4J8XA 1P3GC 1HQ3B 3AZEA 2CV5C 1KX5C 5G49A 1AOIA 1EQZC 4XUJD 4H9QB 3W96C 5AV5C 3AZIC 5AV8B 4JJNA 3RELA 3WA9D 5CPKA 1TZYA 1P3LB 3AYWA 5CPJD 3RELB 3B6FD 4LD9D 3W97A 4QLCB 3AZLD 4KUDC 3NQUB 4XZQC 1P3LA 3AZKA 5B40A 1P3MC 4NE5A 3NQJA 5JA4B 5B32D 2HUEC 5GT3C 1F66A 3A1KA 3MGSD 3EPKA 5JRGD 5B0YC 3REKD 2JSSA 1S32D 5GT0C 2F8ND 3AZED 4J8UC 3AV2B 5B2JA 4J8WA 5B32B 5B33A 3AZGA 5B31D 4R8PA 3TU4A 3KWQB 4JJND 4G92C 1F66B 3KUYD 3A6NA 3WAAB 1TZYD 4NFTA 4G92B 3A1IA 1KX4C 2CV5A 2YFVB 1P3KC 3W97D 4YS3B 3WTPB 4Z66B 5AY8D 5AV9D 3RELC 2W8SA 4Z5TC 4YM6C 5B24A 4WU8A 2F2AC 1ZLAC 4AWLC 2F8NA 4H9PA 3EPHA 1P3AA 3MGPC 2G5HC 3MVDD 3W96B 3LZ0A 4J8VA 3AZKC 4E45A 4XUJA 3REJC 5E5AC 4EO5C 3MGQA 2AROC 4WNNB 1P3PC 3REJB 5F99D 4H9SC 4CSRA 3LJAC 3AZJA 3UTBB 3AYWD 4KGCC 4H9NA 1N1JB 1KX4B 3B0DB 1KX5D 1WWSA 3C1CC 4DRBA 5BS7A 1P34A 3X1SA 2RVQD 4NE6A 5B40D 3WA9B 4QLCC 2FFFB 5GXQD 3LELC 5AVCA 3AFAA 5JRGA 1ID3A 3AZNB 4H9RB 3H0LC 1P3KA 1P3AD 4WU9A 5DNMD 5AVCB 3AFAB 1F1EA 2Y2JA 1M18A 2LY8A 5B2JD 5B24C 5AVBA 3MGPB 1P3ID 1ULYA 2CV5B 3LZ1C 5F99A 5B24B 3AV1A 1U35B 1P3BD 5B32C 3X1UA 1KX3B 3KWQC 3MGSC 1HQ3A 3REKC 3AZEB 1P3KB 2G5IC 3KXBA 5DNMB 3LZ0C 4J8VC 3H0RC 4X23D 3AZEC 5E5AA 5CP6D 2HIOD 1B67A 1P3GA 5GSUB 4R8PB 1JFIA 4WU8D 4JJNC 5GSUC 5DNNA 3MGRA 2F8NK 3W96A 4DRAA 3REIB 5B32G 1R4VA 2XD1A 4ZUXA 3AZMC 1M1AC 5CP6B 4WU9D 2FJ7A 1T3UA 4Z66D 3WTPD 1M1AB 4EO5B 1KU5A 3WTPE 3X1SC 2AROB 4E44A 3FDDA 5GT0B 5AV8C 4G91C 3MNND 3AV1D 3X1TB 2NZDB 4KUDA 4XZQA 2JE5A 1S32B 1A7WA 3AZJD 4H9PB 1F66C 2Y2KA 3B0DC 4X23A 4J8XC 3AZHC 3AL0C 5B2IC 3AZFC 1P3FD 4XZQB 3MVDC 5AVBC 3O62B 1EQZA 3REJD 5B32A 3X1UC 3KUYB 3AZGB 1P3PD 3B6GC 5GXQA 4H9QA 3C1BD 4J8WC 3A6NC 5B33C 4WZSB 4R8PC 2YFVA 4KHAA 5B1MD 3WKJA 5B33B 2Y2OA 1KX4A 1M18D 3X1VB 3C1CD 3IP4C 3NQJB 5GSUA 5DNNC 3MGRC 5BNXA 5B40C 1P3MA 4YS3D 5GT3A 5E5AB 3W99D 1Q9CA 5DNNB 5B0ZD 3MGRB 3LELD 5FUGA 5AV5B 1H3OA 3AZIB 1HQ3D 3WKJB 1ZLAA 4H9OB 2PYOB 3EPLA 4XUJB 5BNVA 1M18B 3AV2D 1EQZD 4XUJC 2NQBC 3REJA 5C3IC 5AV6D 5B2JC 3MGPA 5B24D 4H9OA 2ZY3A 3LZ1D 1KX3D 1W2EA 3WAAA 4KUDB 5G49B 3MGQC 4H9SA 5FUGB 2AROA 4DQYB 3MVDA 2PYOA 2FJ7D 4Z2MH 4Z66A 3WTPA 5CPJC 3B6FC 4LD9C 2ZY2A 1N1JA 5B0YB 1M19A 5AY8B 3UTBD 2HIOC 4M6BA 1P34B 1P3MD 5CPIC 1BH9A 2YFWA 5GT3D 4YM6A 4WU8C 1B6WA 5B40B 1BFMA 2BG1A 3MVDB 2IO5B 1ID3C 3O62C 3AV2A 3W98B 3REKB 1P34D 4WNNA 4KHAB 3VH5A 5AV8D 3X1TD 2ZY5A 2NZDD 3VH6A 1KX3A 1P3PA 3WAAD 3AV1C 3AZLA 3KUYC 2J8PA 1P3LD 3B6GB 3LJAA 3AZJC 1ZLAB 3X1VC 3REIC 1U35A 1P3OB 2Y2LA 3REKA 5AVBD 4HGAB 3KXBC 3C1CA 3B0CT 5BO0A 5AV9C 3RELD 4YM6D 3AN2C 3MGSB 4YS3A 3VH6W 2BYMB 3C1BC 3KFUG 3AN2B 2L5AA 2PYOC 1M1AA 5CPJA 3B6FA 4LD9A 5CP6A 5JRGB 2Y2HA 4ZUXC 3AZMA 1BH8A 3AZKD 1P3GD 5AV8A 1BH9B 2YFWB 4ZUXB 5AV6A 4YM6B 4J8XB 2F8NG 1TAFA 5DNND 5B0ZB 3LZ1A 3MGRD 3W99B 5F99C 1AOIB 5AV5D 3AZID 5AY8A 1Z2CB 3LJAD 3UTAA 3TU4B 5B31G 3WA9C 3AV1B 1HQ3C 4LD9B 1TAFB 3NQUA 2HIOB 3W97B 3AZHA 3AZNC 1M19D 1BH8B 2JCHA 3AZGD 5GXQB 4J8UB 3R45B 5B2IA 3AZFA 3AZLC 4KUDD 3KUYA 4XZQD 3B6GA 5GXQC 5B1LA 3AZLB 3UT9D 5CPIB 2F8NB 3REHA 3R45A 5B2IB 3AZFB 1U35C 4UUZA 4CAYB 3EG5B 3C1CB 2FJ7C 5B1LB 3WKJC 1ID3B 3X1TA 1P3IC 2NZDA 3LELB 5BT1D 3A6NB 5CPID 5AV5A 3AZIA 3AZJB 2Y2PA 5CHLB 5B2JB 4Z5TB 3B0CW 5BNVB 5KDMA 1HTAA 1TZYC 3LZ0D 4J8VD 4X23C 1KX4D 3O62D 2Y2QA 3VH5W 3AZMB 3W98A 4AWLB 3LZ1B 1P3KD 2RIQA 3W97C 5KDMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPJ B;  3B6F B;  3C1B B;  4HGA C;  5DNM A;  5AY8 C;  3KXB B;  1KX5 B;  3WAA C;  1EQZ B;  5B1M B;  4G91 B;  3REH D;  3LZ0 B;  4J8V B;  1M1A D;  4WU8 B;  1P3O A;  1P3B A;  4Z66 C;  5GT0 A;  3WTP C;  3X1V D;  5C3I B;  4J8U A;  3REI D;  3X1S D;  3MNN B;  3MGP D;  4KGC B;  2FJ7 B;  4WU9 B;  1AOI C;  3MNN C;  5B1L C;  5AVC D;  5E5A D;  3AFA D;  5CPI A;  2HIO A;  3AN2 D;  3TU4 C;  3UTA D;  1P3M B;  5CPK C;  4H9N B;  1F66 D;  3X1S B;  3AZH D;  5CPK B;  3KSY A;  3AYW C;  4ZUX D;  1P3I A;  1S32 A;  4KGC D;  1P3P B;  2NQB A;  3X1U D;  3B6G D;  2RVQ C;  4J8W D;  4QLC D;  5B33 D;  5B31 A;  1WWI A;  4R8P D;  3V9R A;  4WV4 B;  1P3O D;  5JA4 A;  5B0Y A;  1M19 B;  3W98 C;  4ZBJ C;  3X1V A;  3REI A;  1P3A C;  3AZN D;  1M19 C;  2CV5 D;  5B31 B;  3X1U B;  3AZG C;  5DNM C;  2BYK A;  1P3A B;  2BYM A;  1P3F A;  3W96 D;  3AN2 A;  3B0B A;  4YS3 C;  3UT9 B;  5AV9 A;  1P3B C;  3UT9 C;  5F99 B;  3KWQ D;  4JJN B;  1P3F B;  3C1B A;  1U35 D;  1P3B B;  3O62 A;  3AV2 C;  4KGC A;  1TZY B;  5AV9 B;  5B1M A;  3MNN A;  2NQB D;  3WKJ D;  5CP6 C;  5AV6 C;  1KX3 C;  5BT1 C;  4Z5T A;  3MGQ D;  5GSU D;  5JRG C;  1JFI B;  5B0Y D;  3AZM D;  5B0Z A;  1S32 C;  3W99 A;  5GT0 D;  2NQB B;  3AZN A;  4J8U D;  4WU9 C;  3UTB C;  1KX5 A;  3MGQ B;  5B31 C;  3REH B;  5BO0 B;  1P3I B;  3REH C;  4UUZ B;  4CAY A;  1ID3 D;  4NE3 A;  3AZK B;  3VH5 T;  4CSR B;  4J8X D;  5BS7 C;  1P34 C;  5B2I D;  3AZF D;  1P3F C;  4X23 B;  3X1T C;  2NZD C;  3AYW B;  1AOI D;  4H9R A;  3LEL A;  5B1L D;  5AVC C;  3AFA C;  4Z5T D;  3UT9 A;  3UTA B;  3LJA B;  4QLC A;  3TU4 D;  1P3L C;  1ZLA D;  2IO5 C;  2BYK B;  3UTA C;  3WA9 A;  3A6N D;  3AZH B;  5CPK D;  5AVB B;  5B1M C;  5BNX B;  4ZBJ B;  3KXB D;  1M18 C;  2HUE B;  1H3O B;  5GT3 B;  4J8W B;  2ARO D;  3VH6 T;  3V9R B;  2CWE A;  2PYO D;  3W99 C;  5B0Z C;  3KWQ A;  4Z2M G;  3MGS A;  1P3O C;  1P3G B;  3UTB A;  2F8N H;  3W98 D;  5AV6 B;  4J8X A;  1P3G C;  1HQ3 B;  3AZE A;  2CV5 C;  1KX5 C;  5G49 A;  1AOI A;  1EQZ C;  4XUJ D;  4H9Q B;  3W96 C;  5AV5 C;  3AZI C;  5AV8 B;  4JJN A;  3REL A;  3WA9 D;  5CPK A;  1TZY A;  1P3L B;  3AYW A;  5CPJ D;  3REL B;  3B6F D;  4LD9 D;  3W97 A;  4QLC B;  3AZL D;  4KUD C;  3NQU B;  4XZQ C;  1P3L A;  3AZK A;  5B40 A;  1P3M C;  4NE5 A;  3NQJ A;  5JA4 B;  5B32 D;  2HUE C;  5GT3 C;  1F66 A;  3MGS D;  5JRG D;  5B0Y C;  3REK D;  2JSS A;  1S32 D;  5GT0 C;  2F8N D;  3AZE D;  4J8U C;  3AV2 B;  5B2J A;  4J8W A;  5B32 B;  5B33 A;  3AZG A;  5B31 D;  4R8P A;  3TU4 A;  3KWQ B;  4JJN D;  4G92 C;  1F66 B;  3KUY D;  3A6N A;  3WAA B;  1TZY D;  4NFT A;  4G92 B;  1KX4 C;  2CV5 A;  2YFV B;  1P3K C;  3W97 D;  4YS3 B;  3WTP B;  4Z66 B;  5AY8 D;  5AV9 D;  3REL C;  4Z5T C;  4YM6 C;  5B24 A;  4WU8 A;  1ZLA C;  4AWL C;  2F8N A;  4H9P A;  1P3A A;  3MGP C;  3MVD D;  3W96 B;  3LZ0 A;  4J8V A;  3AZK C;  4E45 A;  4XUJ A;  3REJ C;  5E5A C;  4EO5 C;  3MGQ A;  2ARO C;  4WNN B;  1P3P C;  3REJ B;  5F99 D;  4H9S C;  4CSR A;  3LJA C;  3AZJ A;  3UTB B;  3AYW D;  4KGC C;  4H9N A;  1N1J B;  1KX4 B;  3B0D B;  1KX5 D;  1WWS A;  3C1C C;  4DRB A;  5BS7 A;  1P34 A;  3X1S A;  2RVQ D;  4NE6 A;  5B40 D;  3WA9 B;  4QLC C;  5GXQ D;  3LEL C;  5AVC A;  3AFA A;  5JRG A;  1ID3 A;  3AZN B;  4H9R B;  1P3K A;  1P3A D;  4WU9 A;  5DNM D;  5AVC B;  3AFA B;  1F1E A;  1M18 A;  2LY8 A;  5B2J D;  5B24 C;  5AVB A;  3MGP B;  1P3I D;  1ULY A;  2CV5 B;  3LZ1 C;  5F99 A;  5B24 B;  3AV1 A;  1U35 B;  1P3B D;  5B32 C;  3X1U A;  1KX3 B;  3KWQ C;  3MGS C;  1HQ3 A;  3REK C;  3AZE B;  1P3K B;  3KXB A;  5DNM B;  3LZ0 C;  4J8V C;  4X23 D;  3AZE C;  5E5A A;  5CP6 D;  2HIO D;  1B67 A;  1P3G A;  5GSU B;  4R8P B;  1JFI A;  4WU8 D;  4JJN C;  5GSU C;  5DNN A;  3MGR A;  2F8N K;  3W96 A;  4DRA A;  3REI B;  5B32 G;  1R4V A;  4ZUX A;  3AZM C;  1M1A C;  5CP6 B;  4WU9 D;  2FJ7 A;  3WTP D;  4Z66 D;  1M1A B;  4EO5 B;  1KU5 A;  3WTP E;  3X1S C;  2ARO B;  4E44 A;  5GT0 B;  5AV8 C;  4G91 C;  3MNN D;  3AV1 D;  3X1T B;  2NZD B;  4KUD A;  4XZQ A;  1S32 B;  1A7W A;  3AZJ D;  4H9P B;  1F66 C;  3B0D C;  4X23 A;  4J8X C;  3AZH C;  5B2I C;  3AZF C;  1P3F D;  4XZQ B;  3MVD C;  5AVB C;  3O62 B;  1EQZ A;  3REJ D;  5B32 A;  3X1U C;  3KUY B;  3AZG B;  1P3P D;  3B6G C;  5GXQ A;  4H9Q A;  3C1B D;  4J8W C;  3A6N C;  5B33 C;  4WZS B;  4R8P C;  2YFV A;  4KHA A;  5B1M D;  3WKJ A;  5B33 B;  1KX4 A;  1M18 D;  3X1V B;  3C1C D;  3NQJ B;  5GSU A;  5DNN C;  3MGR C;  5BNX A;  5B40 C;  1P3M A;  4YS3 D;  5GT3 A;  5E5A B;  3W99 D;  1Q9C A;  5DNN B;  5B0Z D;  3MGR B;  3LEL D;  5FUG A;  5AV5 B;  1H3O A;  3AZI B;  1HQ3 D;  3WKJ B;  1ZLA A;  4H9O B;  2PYO B;  1M18 B;  4XUJ B;  5BNV A;  3AV2 D;  1EQZ D;  4XUJ C;  2NQB C;  3REJ A;  5C3I C;  5AV6 D;  5B2J C;  3MGP A;  5B24 D;  4H9O A;  3LZ1 D;  1KX3 D;  3WAA A;  4KUD B;  5G49 B;  3MGQ C;  4H9S A;  5FUG B;  2ARO A;  3MVD A;  2PYO A;  2FJ7 D;  4Z2M H;  4Z66 A;  3WTP A;  5CPJ C;  3B6F C;  4LD9 C;  5B0Y B;  1N1J A;  1M19 A;  5AY8 B;  3UTB D;  2HIO C;  4M6B A;  1P34 B;  1P3M D;  5CPI C;  1BH9 A;  2YFW A;  5GT3 D;  4YM6 A;  4WU8 C;  1B6W A;  5B40 B;  1BFM A;  3MVD B;  2IO5 B;  1ID3 C;  3O62 C;  3AV2 A;  3W98 B;  3REK B;  1P34 D;  4WNN A;  4KHA B;  3VH5 A;  5AV8 D;  3X1T D;  2NZD D;  3VH6 A;  1KX3 A;  1P3P A;  3WAA D;  3AV1 C;  3AZL A;  3KUY C;  1P3L D;  3B6G B;  3LJA A;  3AZJ C;  1ZLA B;  3X1V C;  3REI C;  1U35 A;  1P3O B;  3REK A;  5AVB D;  4HGA B;  3KXB C;  3C1C A;  3B0C T;  5BO0 A;  5AV9 C;  3REL D;  4YM6 D;  3AN2 C;  3MGS B;  4YS3 A;  3VH6 W;  2BYM B;  3C1B C;  3AN2 B;  2L5A A;  2PYO C;  1M1A A;  5CPJ A;  3B6F A;  4LD9 A;  5CP6 A;  5JRG B;  4ZUX C;  3AZM A;  1BH8 A;  3AZK D;  1P3G D;  5AV8 A;  1BH9 B;  2YFW B;  4ZUX B;  5AV6 A;  4YM6 B;  4J8X B;  2F8N G;  1TAF A;  5DNN D;  5B0Z B;  3LZ1 A;  3MGR D;  3W99 B;  5F99 C;  1AOI B;  5AV5 D;  3AZI D;  5AY8 A;  3LJA D;  3UTA A;  3TU4 B;  5B31 G;  3WA9 C;  3AV1 B;  1HQ3 C;  4LD9 B;  1TAF B;  3NQU A;  2HIO B;  3W97 B;  3AZH A;  3AZN C;  1M19 D;  1BH8 B;  3AZG D;  5GXQ B;  4J8U B;  3R45 B;  5B2I A;  3AZF A;  3AZL C;  4KUD D;  3KUY A;  4XZQ D;  3B6G A;  5GXQ C;  5B1L A;  3AZL B;  3UT9 D;  5CPI B;  2F8N B;  3REH A;  3R45 A;  5B2I B;  3AZF B;  1U35 C;  4UUZ A;  4CAY B;  2FJ7 C;  3C1C B;  5B1L B;  3WKJ C;  1ID3 B;  3X1T A;  1P3I C;  2NZD A;  3LEL B;  5BT1 D;  3A6N B;  5CPI D;  5AV5 A;  3AZI A;  3AZJ B;  5CHL B;  5B2J B;  4Z5T B;  3B0C W;  5BNV B;  5KDM A;  1HTA A;  1TZY C;  3LZ0 D;  4J8V D;  4X23 C;  1KX4 D;  3O62 D;  3VH5 W;  3AZM B;  3W98 A;  4AWL B;  3LZ1 B;  1P3K D;  3W97 C;  5KDM B; 
#chains in the Genus database with same CATH topology
 5CPJ B;  3B6F B;  3C1B B;  4HGA C;  5DNM A;  5AY8 C;  3KXB B;  1KX5 B;  3WAA C;  1EQZ B;  5B1M B;  4G91 B;  3REH D;  3LZ0 B;  4J8V B;  1M1A D;  4WU8 B;  1P3O A;  1P3B A;  4Z66 C;  5GT0 A;  3WTP C;  2ZM5 A;  5C3I B;  3EPJ A;  4J8U A;  3REI D;  3X1S D;  2UWX A;  3MNN B;  3X1V D;  3MGP D;  2Y2G A;  2FJ7 B;  4WU9 B;  1AOI C;  4KGC B;  3MNN C;  5B1L C;  5AVC D;  5E5A D;  3AFA D;  5CPI A;  2HIO A;  3AN2 D;  3TU4 C;  3UTA D;  1P3M B;  5CPK C;  4H9N B;  1F66 D;  2ZY4 A;  3X1S B;  3AZH D;  5CPK B;  2Y2I A;  3KSY A;  3AYW C;  4ZUX D;  1P3I A;  1S32 A;  4KGC D;  1P3P B;  2NQB A;  2Y2N A;  3X1U D;  3B6G D;  2RVQ C;  4J8W D;  4QLC D;  5B33 D;  5B31 A;  1WWI A;  4R8P D;  3V9R A;  4WV4 B;  1P3O D;  5JA4 A;  5B0Y A;  1M19 B;  3W98 C;  4ZBJ C;  3X1V A;  3REI A;  1P3A C;  3AZN D;  1M19 C;  2CV5 D;  2Y2M A;  5B31 B;  3X1U B;  3AZG C;  5DNM C;  2BYK A;  1P3A B;  2BYM A;  1P3F A;  3W96 D;  3AN2 A;  3B0B A;  4YS3 C;  3UT9 B;  5AV9 A;  2VQR A;  1P3B C;  3UT9 C;  5F99 B;  3KWQ D;  4JJN B;  1P3F B;  3C1B A;  1U35 D;  1P3B B;  3O62 A;  3AV2 C;  4KGC A;  1TZY B;  5AV9 B;  5B1M A;  3MNN A;  2NQB D;  3WKJ D;  5CP6 C;  5AV6 C;  1KX3 C;  3H0M C;  5BT1 C;  4Z5T A;  2XD5 A;  3MGQ D;  5GSU D;  5JRG C;  1JFI B;  5B0Y D;  3AZM D;  5B0Z A;  1S32 C;  3W99 A;  5GT0 D;  2NQB B;  3AZN A;  4J8U D;  4WU9 C;  3UTB C;  2DF4 C;  1KX5 A;  3MGQ B;  5B31 C;  3REH B;  5BO0 B;  4WJ3 C;  1P3I B;  2DQN C;  3REH C;  4UUZ B;  4CAY A;  1ID3 D;  4NE3 A;  3AZK B;  3VH5 T;  4CSR B;  4J8X D;  5BS7 C;  1P34 C;  5B2I D;  3AZF D;  1P3F C;  4X23 B;  3X1T C;  2NZD C;  3AYW B;  1AOI D;  4H9R A;  3LEL A;  5B1L D;  5AVC C;  3AFA C;  4Z5T D;  3UT9 A;  3UTA B;  3LJA B;  4QLC A;  3TU4 D;  1P3L C;  1ZLA D;  2IO5 C;  2BYK B;  3UTA C;  3WA9 A;  3A6N D;  3AZH B;  5CPK D;  5AVB B;  5B1M C;  4UPK A;  5BNX B;  3F6T A;  1PZR A;  4ZBJ B;  3KXB D;  1M18 C;  2HUE B;  1H3O B;  5GT3 B;  4J8W B;  2ARO D;  3VH6 T;  3V9R B;  2CWE A;  3P5J B;  2PYO D;  3W99 C;  5B0Z C;  3KWQ A;  4Z2M G;  3MGS A;  1P3O C;  1P3G B;  3UTB A;  2F8N H;  3W98 D;  5AV6 B;  4J8X A;  1P3G C;  1HQ3 B;  3AZE A;  2CV5 C;  1KX5 C;  5G49 A;  1AOI A;  1EQZ C;  4XUJ D;  4H9Q B;  3W96 C;  5AV5 C;  3AZI C;  5AV8 B;  4JJN A;  3REL A;  3WA9 D;  5CPK A;  1TZY A;  1P3L B;  3AYW A;  5CPJ D;  3REL B;  3B6F D;  4LD9 D;  3W97 A;  4QLC B;  3AZL D;  4KUD C;  3NQU B;  4XZQ C;  1P3L A;  3AZK A;  5B40 A;  1P3M C;  4NE5 A;  3NQJ A;  5JA4 B;  5B32 D;  2HUE C;  5GT3 C;  1F66 A;  3A1K A;  3MGS D;  3EPK A;  5JRG D;  5B0Y C;  3REK D;  2JSS A;  1S32 D;  5GT0 C;  2F8N D;  3AZE D;  4J8U C;  3AV2 B;  5B2J A;  4J8W A;  5B32 B;  5B33 A;  3AZG A;  5B31 D;  4R8P A;  3TU4 A;  3KWQ B;  4JJN D;  4G92 C;  1F66 B;  3KUY D;  3A6N A;  3WAA B;  1TZY D;  4NFT A;  4G92 B;  3A1I A;  1KX4 C;  2CV5 A;  2YFV B;  1P3K C;  3W97 D;  4YS3 B;  3WTP B;  4Z66 B;  5AY8 D;  5AV9 D;  3REL C;  2W8S A;  4Z5T C;  4YM6 C;  5B24 A;  4WU8 A;  2F2A C;  1ZLA C;  4AWL C;  2F8N A;  4H9P A;  3EPH A;  1P3A A;  3MGP C;  2G5H C;  3MVD D;  3W96 B;  3LZ0 A;  4J8V A;  3AZK C;  4E45 A;  4XUJ A;  3REJ C;  5E5A C;  4EO5 C;  3MGQ A;  2ARO C;  4WNN B;  1P3P C;  3REJ B;  5F99 D;  4H9S C;  4CSR A;  3LJA C;  3AZJ A;  3UTB B;  3AYW D;  4KGC C;  4H9N A;  1N1J B;  1KX4 B;  3B0D B;  1KX5 D;  1WWS A;  3C1C C;  4DRB A;  5BS7 A;  1P34 A;  3X1S A;  2RVQ D;  4NE6 A;  5B40 D;  3WA9 B;  4QLC C;  2FFF B;  5GXQ D;  3LEL C;  5AVC A;  3AFA A;  5JRG A;  1ID3 A;  3AZN B;  4H9R B;  3H0L C;  1P3K A;  1P3A D;  4WU9 A;  5DNM D;  5AVC B;  3AFA B;  1F1E A;  2Y2J A;  1M18 A;  2LY8 A;  5B2J D;  5B24 C;  5AVB A;  3MGP B;  1P3I D;  1ULY A;  2CV5 B;  3LZ1 C;  5F99 A;  5B24 B;  3AV1 A;  1U35 B;  1P3B D;  5B32 C;  3X1U A;  1KX3 B;  3KWQ C;  3MGS C;  1HQ3 A;  3REK C;  3AZE B;  1P3K B;  2G5I C;  3KXB A;  5DNM B;  3LZ0 C;  4J8V C;  3H0R C;  4X23 D;  3AZE C;  5E5A A;  5CP6 D;  2HIO D;  1B67 A;  1P3G A;  5GSU B;  4R8P B;  1JFI A;  4WU8 D;  4JJN C;  5GSU C;  5DNN A;  3MGR A;  2F8N K;  3W96 A;  4DRA A;  3REI B;  5B32 G;  1R4V A;  2XD1 A;  4ZUX A;  3AZM C;  1M1A C;  5CP6 B;  4WU9 D;  2FJ7 A;  1T3U A;  4Z66 D;  3WTP D;  1M1A B;  4EO5 B;  1KU5 A;  3WTP E;  3X1S C;  2ARO B;  4E44 A;  3FDD A;  5GT0 B;  5AV8 C;  4G91 C;  3MNN D;  3AV1 D;  3X1T B;  2NZD B;  4KUD A;  4XZQ A;  2JE5 A;  1S32 B;  1A7W A;  3AZJ D;  4H9P B;  1F66 C;  2Y2K A;  3B0D C;  4X23 A;  4J8X C;  3AZH C;  3AL0 C;  5B2I C;  3AZF C;  1P3F D;  4XZQ B;  3MVD C;  5AVB C;  3O62 B;  1EQZ A;  3REJ D;  5B32 A;  3X1U C;  3KUY B;  3AZG B;  1P3P D;  3B6G C;  5GXQ A;  4H9Q A;  3C1B D;  4J8W C;  3A6N C;  5B33 C;  4WZS B;  4R8P C;  2YFV A;  4KHA A;  5B1M D;  3WKJ A;  5B33 B;  2Y2O A;  1KX4 A;  1M18 D;  3X1V B;  3C1C D;  3IP4 C;  3NQJ B;  5GSU A;  5DNN C;  3MGR C;  5BNX A;  5B40 C;  1P3M A;  4YS3 D;  5GT3 A;  5E5A B;  3W99 D;  1Q9C A;  5DNN B;  5B0Z D;  3MGR B;  3LEL D;  5FUG A;  5AV5 B;  1H3O A;  3AZI B;  1HQ3 D;  3WKJ B;  1ZLA A;  4H9O B;  2PYO B;  3EPL A;  4XUJ B;  5BNV A;  1M18 B;  3AV2 D;  1EQZ D;  4XUJ C;  2NQB C;  3REJ A;  5C3I C;  5AV6 D;  5B2J C;  3MGP A;  5B24 D;  4H9O A;  2ZY3 A;  3LZ1 D;  1KX3 D;  1W2E A;  3WAA A;  4KUD B;  5G49 B;  3MGQ C;  4H9S A;  5FUG B;  2ARO A;  4DQY B;  3MVD A;  2PYO A;  2FJ7 D;  4Z2M H;  4Z66 A;  3WTP A;  5CPJ C;  3B6F C;  4LD9 C;  2ZY2 A;  1N1J A;  5B0Y B;  1M19 A;  5AY8 B;  3UTB D;  2HIO C;  4M6B A;  1P34 B;  1P3M D;  5CPI C;  1BH9 A;  2YFW A;  5GT3 D;  4YM6 A;  4WU8 C;  1B6W A;  5B40 B;  1BFM A;  2BG1 A;  3MVD B;  2IO5 B;  1ID3 C;  3O62 C;  3AV2 A;  3W98 B;  3REK B;  1P34 D;  4WNN A;  4KHA B;  3VH5 A;  5AV8 D;  3X1T D;  2ZY5 A;  2NZD D;  3VH6 A;  1KX3 A;  1P3P A;  3WAA D;  3AV1 C;  3AZL A;  3KUY C;  2J8P A;  1P3L D;  3B6G B;  3LJA A;  3AZJ C;  1ZLA B;  3X1V C;  3REI C;  1U35 A;  1P3O B;  2Y2L A;  3REK A;  5AVB D;  4HGA B;  3KXB C;  3C1C A;  3B0C T;  5BO0 A;  5AV9 C;  3REL D;  4YM6 D;  3AN2 C;  3MGS B;  4YS3 A;  3VH6 W;  2BYM B;  3C1B C;  3KFU G;  3AN2 B;  2L5A A;  2PYO C;  1M1A A;  5CPJ A;  3B6F A;  4LD9 A;  5CP6 A;  5JRG B;  2Y2H A;  4ZUX C;  3AZM A;  1BH8 A;  3AZK D;  1P3G D;  5AV8 A;  1BH9 B;  2YFW B;  4ZUX B;  5AV6 A;  4YM6 B;  4J8X B;  2F8N G;  1TAF A;  5DNN D;  5B0Z B;  3LZ1 A;  3MGR D;  3W99 B;  5F99 C;  1AOI B;  5AV5 D;  3AZI D;  5AY8 A;  1Z2C B;  3LJA D;  3UTA A;  3TU4 B;  5B31 G;  3WA9 C;  3AV1 B;  1HQ3 C;  4LD9 B;  1TAF B;  3NQU A;  2HIO B;  3W97 B;  3AZH A;  3AZN C;  1M19 D;  1BH8 B;  2JCH A;  3AZG D;  5GXQ B;  4J8U B;  3R45 B;  5B2I A;  3AZF A;  3AZL C;  4KUD D;  3KUY A;  4XZQ D;  3B6G A;  5GXQ C;  5B1L A;  3AZL B;  3UT9 D;  5CPI B;  2F8N B;  3REH A;  3R45 A;  5B2I B;  3AZF B;  1U35 C;  4UUZ A;  4CAY B;  3EG5 B;  3C1C B;  2FJ7 C;  5B1L B;  3WKJ C;  1ID3 B;  3X1T A;  1P3I C;  2NZD A;  3LEL B;  5BT1 D;  3A6N B;  5CPI D;  5AV5 A;  3AZI A;  3AZJ B;  2Y2P A;  5CHL B;  5B2J B;  4Z5T B;  3B0C W;  5BNV B;  5KDM A;  1HTA A;  1TZY C;  3LZ0 D;  4J8V D;  4X23 C;  1KX4 D;  3O62 D;  2Y2Q A;  3VH5 W;  3AZM B;  3W98 A;  4AWL B;  3LZ1 B;  1P3K D;  2RIQ A;  3W97 C;  5KDM B; 
#chains in the Genus database with same CATH homology
 5CPJ B;  3B6F B;  3C1B B;  4HGA C;  5DNM A;  5AY8 C;  3KXB B;  1KX5 B;  3WAA C;  1EQZ B;  5B1M B;  4G91 B;  3REH D;  3LZ0 B;  4J8V B;  1M1A D;  4WU8 B;  1P3O A;  1P3B A;  4Z66 C;  5GT0 A;  3WTP C;  2ZM5 A;  5C3I B;  3EPJ A;  4J8U A;  3REI D;  3X1S D;  2UWX A;  3MNN B;  3X1V D;  3MGP D;  2Y2G A;  2FJ7 B;  4WU9 B;  1AOI C;  4KGC B;  3MNN C;  5B1L C;  5AVC D;  5E5A D;  3AFA D;  5CPI A;  2HIO A;  3AN2 D;  3TU4 C;  3UTA D;  1P3M B;  5CPK C;  4H9N B;  1F66 D;  2ZY4 A;  3X1S B;  3AZH D;  5CPK B;  2Y2I A;  3KSY A;  3AYW C;  4ZUX D;  1P3I A;  1S32 A;  4KGC D;  1P3P B;  2NQB A;  2Y2N A;  3X1U D;  3B6G D;  2RVQ C;  4J8W D;  4QLC D;  5B33 D;  5B31 A;  1WWI A;  4R8P D;  3V9R A;  4WV4 B;  1P3O D;  5JA4 A;  5B0Y A;  1M19 B;  3W98 C;  4ZBJ C;  3X1V A;  3REI A;  1P3A C;  3AZN D;  1M19 C;  2CV5 D;  2Y2M A;  5B31 B;  3X1U B;  3AZG C;  5DNM C;  2BYK A;  1P3A B;  2BYM A;  1P3F A;  3W96 D;  3AN2 A;  3B0B A;  4YS3 C;  3UT9 B;  5AV9 A;  2VQR A;  1P3B C;  3UT9 C;  5F99 B;  3KWQ D;  4JJN B;  1P3F B;  3C1B A;  1U35 D;  1P3B B;  3O62 A;  3AV2 C;  4KGC A;  1TZY B;  5AV9 B;  5B1M A;  3MNN A;  2NQB D;  3WKJ D;  5CP6 C;  5AV6 C;  1KX3 C;  3H0M C;  5BT1 C;  4Z5T A;  2XD5 A;  3MGQ D;  5GSU D;  5JRG C;  1JFI B;  5B0Y D;  3AZM D;  5B0Z A;  1S32 C;  3W99 A;  5GT0 D;  2NQB B;  3AZN A;  4J8U D;  4WU9 C;  3UTB C;  2DF4 C;  1KX5 A;  3MGQ B;  5B31 C;  3REH B;  5BO0 B;  4WJ3 C;  1P3I B;  2DQN C;  3REH C;  4UUZ B;  4CAY A;  1ID3 D;  4NE3 A;  3AZK B;  3VH5 T;  4CSR B;  4J8X D;  5BS7 C;  1P34 C;  5B2I D;  3AZF D;  1P3F C;  4X23 B;  3X1T C;  2NZD C;  3AYW B;  1AOI D;  4H9R A;  3LEL A;  5B1L D;  5AVC C;  3AFA C;  4Z5T D;  3UT9 A;  3UTA B;  3LJA B;  4QLC A;  3TU4 D;  1P3L C;  1ZLA D;  2IO5 C;  2BYK B;  3UTA C;  3WA9 A;  3A6N D;  3AZH B;  5CPK D;  5AVB B;  5B1M C;  4UPK A;  5BNX B;  3F6T A;  1PZR A;  4ZBJ B;  3KXB D;  1M18 C;  2HUE B;  1H3O B;  5GT3 B;  4J8W B;  2ARO D;  3VH6 T;  3V9R B;  2CWE A;  3P5J B;  2PYO D;  3W99 C;  5B0Z C;  3KWQ A;  4Z2M G;  3MGS A;  1P3O C;  1P3G B;  3UTB A;  2F8N H;  3W98 D;  5AV6 B;  4J8X A;  1P3G C;  1HQ3 B;  3AZE A;  2CV5 C;  1KX5 C;  5G49 A;  1AOI A;  1EQZ C;  4XUJ D;  4H9Q B;  3W96 C;  5AV5 C;  3AZI C;  5AV8 B;  4JJN A;  3REL A;  3WA9 D;  5CPK A;  1TZY A;  1P3L B;  3AYW A;  5CPJ D;  3REL B;  3B6F D;  4LD9 D;  3W97 A;  4QLC B;  3AZL D;  4KUD C;  3NQU B;  4XZQ C;  1P3L A;  3AZK A;  5B40 A;  1P3M C;  4NE5 A;  3NQJ A;  5JA4 B;  5B32 D;  2HUE C;  5GT3 C;  1F66 A;  3A1K A;  3MGS D;  3EPK A;  5JRG D;  5B0Y C;  3REK D;  2JSS A;  1S32 D;  5GT0 C;  2F8N D;  3AZE D;  4J8U C;  3AV2 B;  5B2J A;  4J8W A;  5B32 B;  5B33 A;  3AZG A;  5B31 D;  4R8P A;  3TU4 A;  3KWQ B;  4JJN D;  4G92 C;  1F66 B;  3KUY D;  3A6N A;  3WAA B;  1TZY D;  4NFT A;  4G92 B;  3A1I A;  1KX4 C;  2CV5 A;  2YFV B;  1P3K C;  3W97 D;  4YS3 B;  3WTP B;  4Z66 B;  5AY8 D;  5AV9 D;  3REL C;  2W8S A;  4Z5T C;  4YM6 C;  5B24 A;  4WU8 A;  2F2A C;  1ZLA C;  4AWL C;  2F8N A;  4H9P A;  3EPH A;  1P3A A;  3MGP C;  2G5H C;  3MVD D;  3W96 B;  3LZ0 A;  4J8V A;  3AZK C;  4E45 A;  4XUJ A;  3REJ C;  5E5A C;  4EO5 C;  3MGQ A;  2ARO C;  4WNN B;  1P3P C;  3REJ B;  5F99 D;  4H9S C;  4CSR A;  3LJA C;  3AZJ A;  3UTB B;  3AYW D;  4KGC C;  4H9N A;  1N1J B;  1KX4 B;  3B0D B;  1KX5 D;  1WWS A;  3C1C C;  4DRB A;  5BS7 A;  1P34 A;  3X1S A;  2RVQ D;  4NE6 A;  5B40 D;  3WA9 B;  4QLC C;  2FFF B;  5GXQ D;  3LEL C;  5AVC A;  3AFA A;  5JRG A;  1ID3 A;  3AZN B;  4H9R B;  3H0L C;  1P3K A;  1P3A D;  4WU9 A;  5DNM D;  5AVC B;  3AFA B;  1F1E A;  2Y2J A;  1M18 A;  2LY8 A;  5B2J D;  5B24 C;  5AVB A;  3MGP B;  1P3I D;  1ULY A;  2CV5 B;  3LZ1 C;  5F99 A;  5B24 B;  3AV1 A;  1U35 B;  1P3B D;  5B32 C;  3X1U A;  1KX3 B;  3KWQ C;  3MGS C;  1HQ3 A;  3REK C;  3AZE B;  1P3K B;  2G5I C;  3KXB A;  5DNM B;  3LZ0 C;  4J8V C;  3H0R C;  4X23 D;  3AZE C;  5E5A A;  5CP6 D;  2HIO D;  1B67 A;  1P3G A;  5GSU B;  4R8P B;  1JFI A;  4WU8 D;  4JJN C;  5GSU C;  5DNN A;  3MGR A;  2F8N K;  3W96 A;  4DRA A;  3REI B;  5B32 G;  1R4V A;  2XD1 A;  4ZUX A;  3AZM C;  1M1A C;  5CP6 B;  4WU9 D;  2FJ7 A;  1T3U A;  4Z66 D;  3WTP D;  1M1A B;  4EO5 B;  1KU5 A;  3WTP E;  3X1S C;  2ARO B;  4E44 A;  3FDD A;  5GT0 B;  5AV8 C;  4G91 C;  3MNN D;  3AV1 D;  3X1T B;  2NZD B;  4KUD A;  4XZQ A;  2JE5 A;  1S32 B;  1A7W A;  3AZJ D;  4H9P B;  1F66 C;  2Y2K A;  3B0D C;  4X23 A;  4J8X C;  3AZH C;  3AL0 C;  5B2I C;  3AZF C;  1P3F D;  4XZQ B;  3MVD C;  5AVB C;  3O62 B;  1EQZ A;  3REJ D;  5B32 A;  3X1U C;  3KUY B;  3AZG B;  1P3P D;  3B6G C;  5GXQ A;  4H9Q A;  3C1B D;  4J8W C;  3A6N C;  5B33 C;  4WZS B;  4R8P C;  2YFV A;  4KHA A;  5B1M D;  3WKJ A;  5B33 B;  2Y2O A;  1KX4 A;  1M18 D;  3X1V B;  3C1C D;  3IP4 C;  3NQJ B;  5GSU A;  5DNN C;  3MGR C;  5BNX A;  5B40 C;  1P3M A;  4YS3 D;  5GT3 A;  5E5A B;  3W99 D;  1Q9C A;  5DNN B;  5B0Z D;  3MGR B;  3LEL D;  5FUG A;  5AV5 B;  1H3O A;  3AZI B;  1HQ3 D;  3WKJ B;  1ZLA A;  4H9O B;  2PYO B;  3EPL A;  4XUJ B;  5BNV A;  1M18 B;  3AV2 D;  1EQZ D;  4XUJ C;  2NQB C;  3REJ A;  5C3I C;  5AV6 D;  5B2J C;  3MGP A;  5B24 D;  4H9O A;  2ZY3 A;  3LZ1 D;  1KX3 D;  1W2E A;  3WAA A;  4KUD B;  5G49 B;  3MGQ C;  4H9S A;  5FUG B;  2ARO A;  4DQY B;  3MVD A;  2PYO A;  2FJ7 D;  4Z2M H;  4Z66 A;  3WTP A;  5CPJ C;  3B6F C;  4LD9 C;  2ZY2 A;  1N1J A;  5B0Y B;  1M19 A;  5AY8 B;  3UTB D;  2HIO C;  4M6B A;  1P34 B;  1P3M D;  5CPI C;  1BH9 A;  2YFW A;  5GT3 D;  4YM6 A;  4WU8 C;  1B6W A;  5B40 B;  1BFM A;  2BG1 A;  3MVD B;  2IO5 B;  1ID3 C;  3O62 C;  3AV2 A;  3W98 B;  3REK B;  1P34 D;  4WNN A;  4KHA B;  3VH5 A;  5AV8 D;  3X1T D;  2ZY5 A;  2NZD D;  3VH6 A;  1KX3 A;  1P3P A;  3WAA D;  3AV1 C;  3AZL A;  3KUY C;  2J8P A;  1P3L D;  3B6G B;  3LJA A;  3AZJ C;  1ZLA B;  3X1V C;  3REI C;  1U35 A;  1P3O B;  2Y2L A;  3REK A;  5AVB D;  4HGA B;  3KXB C;  3C1C A;  3B0C T;  5BO0 A;  5AV9 C;  3REL D;  4YM6 D;  3AN2 C;  3MGS B;  4YS3 A;  3VH6 W;  2BYM B;  3C1B C;  3KFU G;  3AN2 B;  2L5A A;  2PYO C;  1M1A A;  5CPJ A;  3B6F A;  4LD9 A;  5CP6 A;  5JRG B;  2Y2H A;  4ZUX C;  3AZM A;  1BH8 A;  3AZK D;  1P3G D;  5AV8 A;  1BH9 B;  2YFW B;  4ZUX B;  5AV6 A;  4YM6 B;  4J8X B;  2F8N G;  1TAF A;  5DNN D;  5B0Z B;  3LZ1 A;  3MGR D;  3W99 B;  5F99 C;  1AOI B;  5AV5 D;  3AZI D;  5AY8 A;  1Z2C B;  3LJA D;  3UTA A;  3TU4 B;  5B31 G;  3WA9 C;  3AV1 B;  1HQ3 C;  4LD9 B;  1TAF B;  3NQU A;  2HIO B;  3W97 B;  3AZH A;  3AZN C;  1M19 D;  1BH8 B;  2JCH A;  3AZG D;  5GXQ B;  4J8U B;  3R45 B;  5B2I A;  3AZF A;  3AZL C;  4KUD D;  3KUY A;  4XZQ D;  3B6G A;  5GXQ C;  5B1L A;  3AZL B;  3UT9 D;  5CPI B;  2F8N B;  3REH A;  3R45 A;  5B2I B;  3AZF B;  1U35 C;  4UUZ A;  4CAY B;  3EG5 B;  3C1C B;  2FJ7 C;  5B1L B;  3WKJ C;  1ID3 B;  3X1T A;  1P3I C;  2NZD A;  3LEL B;  5BT1 D;  3A6N B;  5CPI D;  5AV5 A;  3AZI A;  3AZJ B;  2Y2P A;  5CHL B;  5B2J B;  4Z5T B;  3B0C W;  5BNV B;  5KDM A;  1HTA A;  1TZY C;  3LZ0 D;  4J8V D;  4X23 C;  1KX4 D;  3O62 D;  2Y2Q A;  3VH5 W;  3AZM B;  3W98 A;  4AWL B;  3LZ1 B;  1P3K D;  2RIQ A;  3W97 C;  5KDM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...