4WV5A

Heat shock protein 70 substrate binding domain
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
149
structure length
144
Chain Sequence
DVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDLSKEEIERMVQEAEKYKAEDEVQRERVKNALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock 70 kDa protein 1A/1B
publication title The novolactone natural product disrupts the allosteric regulation of hsp70.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 36
structure length 144
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4wv5A00
1YUWA 3DPPA 4E81A 4R5GA 3QNJA 3H0XA 5E84A 4R5LA 4PO2A 4EZYA 1Q5LA 3C7NA 3DOBA 3C7NB 1DKYA 1DKZA 1DG4A 4EZNA 4F00A 4EZWA 4WV7A 3D2FA 3DQGA 4EZUA 4JWIA 4EZZA 4EZRA 1CKRA 2V7YA 4B9QA 4JNEA 4JNFA 4R5KA 4HY9A 7HSCA 2OP6A 3D2EA 4R5JA 4JWEA 3DPQA 4WV5A 4EZTA 2KHOA 4EZXA 3DPOA 4HYBA 1DKXA 2QXLA 5TKYA 4EZOA 2BPRA 4JWDA 4EZQA 4EZSA 4EZPA 1U00A 3N8EA 4FL9A 4JN4A 4JWCA 4F01A 1BPRA 4EZVA 4R5IA
chains in the Genus database with same CATH superfamily
1YUWA 3DPPA 4E81A 4R5GA 3QNJA 3H0XA 5E84A 4R5LA 4PO2A 4EZYA 4ILHB 1Q5LA 3ZEFA 3C7NA 3DOBA 3C7NB 1DKYA 4I43A 1DKZA 1DG4A 4EZNA 4F00A 4EZWA 4WV7A 3D2FA 3DQGA 4EZUA 4JWIA 4EZZA 4EZRA 1CKRA 2V7YA 4B9QA 4JNEA 4JNFA 4R5KA 4HY9A 7HSCA 2OP6A 3D2EA 4R5JA 4ILIA 4JWEA 3DPQA 4WV5A 4EZTA 2KHOA 4EZXA 3DPOA 4HYBA 1DKXA 2QXLA 5TKYA 4EZOA 2BPRA 4JWDA 4EZQA 4EZSA 4ILGA 4EZPA 1U00A 3N8EA 4FL9A 4JN4A 3SBSA 4JWCA 4F01A 1BPRA 4EZVA 4MQDA 4R5IA 3SBTB
chains in the Genus database with same CATH topology
1YUWA 3DPPA 4E81A 4R5GA 3QNJA 3H0XA 5E84A 4R5LA 4PO2A 4EZYA 4ILHB 1Q5LA 3ZEFA 3C7NA 3DOBA 3C7NB 1DKYA 4I43A 1DKZA 1DG4A 4EZNA 4F00A 4EZWA 4WV7A 3D2FA 3DQGA 4EZUA 4JWIA 4EZZA 4EZRA 1CKRA 2V7YA 4B9QA 4JNEA 4JNFA 4R5KA 4HY9A 7HSCA 2OP6A 3D2EA 4R5JA 4ILIA 4JWEA 3DPQA 4WV5A 4EZTA 2KHOA 4EZXA 3DPOA 4HYBA 1DKXA 2QXLA 5TKYA 4EZOA 2BPRA 4JWDA 4EZQA 4EZSA 4ILGA 4EZPA 1U00A 3N8EA 4FL9A 4JN4A 3SBSA 4JWCA 4F01A 1BPRA 4EZVA 4MQDA 4R5IA 3SBTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUW A;  3DPP A;  4E81 A;  4R5G A;  3QNJ A;  3H0X A;  5E84 A;  4R5L A;  4PO2 A;  4EZY A;  1Q5L A;  3C7N A;  3DOB A;  3C7N B;  1DKY A;  1DKZ A;  1DG4 A;  4EZN A;  4F00 A;  4EZW A;  4WV7 A;  3D2F A;  3DQG A;  4EZU A;  4JWI A;  4EZZ A;  4EZR A;  1CKR A;  2V7Y A;  4B9Q A;  4JNE A;  4JNF A;  4R5K A;  4HY9 A;  7HSC A;  2OP6 A;  3D2E A;  4R5J A;  4JWE A;  3DPQ A;  4WV5 A;  4EZT A;  2KHO A;  4EZX A;  3DPO A;  4HYB A;  1DKX A;  2QXL A;  5TKY A;  4EZO A;  2BPR A;  4JWD A;  4EZQ A;  4EZS A;  4EZP A;  1U00 A;  3N8E A;  4FL9 A;  4JN4 A;  4JWC A;  4F01 A;  1BPR A;  4EZV A;  4R5I A; 
#chains in the Genus database with same CATH topology
 1YUW A;  3DPP A;  4E81 A;  4R5G A;  3QNJ A;  3H0X A;  5E84 A;  4R5L A;  4PO2 A;  4EZY A;  4ILH B;  1Q5L A;  3ZEF A;  3C7N A;  3DOB A;  3C7N B;  1DKY A;  4I43 A;  1DKZ A;  1DG4 A;  4EZN A;  4F00 A;  4EZW A;  4WV7 A;  3D2F A;  3DQG A;  4EZU A;  4JWI A;  4EZZ A;  4EZR A;  1CKR A;  2V7Y A;  4B9Q A;  4JNE A;  4JNF A;  4R5K A;  4HY9 A;  7HSC A;  2OP6 A;  3D2E A;  4R5J A;  4ILI A;  4JWE A;  3DPQ A;  4WV5 A;  4EZT A;  2KHO A;  4EZX A;  3DPO A;  4HYB A;  1DKX A;  2QXL A;  5TKY A;  4EZO A;  2BPR A;  4JWD A;  4EZQ A;  4EZS A;  4ILG A;  4EZP A;  1U00 A;  3N8E A;  4FL9 A;  4JN4 A;  3SBS A;  4JWC A;  4F01 A;  1BPR A;  4EZV A;  4MQD A;  4R5I A;  3SBT B; 
#chains in the Genus database with same CATH homology
 1YUW A;  3DPP A;  4E81 A;  4R5G A;  3QNJ A;  3H0X A;  5E84 A;  4R5L A;  4PO2 A;  4EZY A;  4ILH B;  1Q5L A;  3ZEF A;  3C7N A;  3DOB A;  3C7N B;  1DKY A;  4I43 A;  1DKZ A;  1DG4 A;  4EZN A;  4F00 A;  4EZW A;  4WV7 A;  3D2F A;  3DQG A;  4EZU A;  4JWI A;  4EZZ A;  4EZR A;  1CKR A;  2V7Y A;  4B9Q A;  4JNE A;  4JNF A;  4R5K A;  4HY9 A;  7HSC A;  2OP6 A;  3D2E A;  4R5J A;  4ILI A;  4JWE A;  3DPQ A;  4WV5 A;  4EZT A;  2KHO A;  4EZX A;  3DPO A;  4HYB A;  1DKX A;  2QXL A;  5TKY A;  4EZO A;  2BPR A;  4JWD A;  4EZQ A;  4EZS A;  4ILG A;  4EZP A;  1U00 A;  3N8E A;  4FL9 A;  4JN4 A;  3SBS A;  4JWC A;  4F01 A;  1BPR A;  4EZV A;  4MQD A;  4R5I A;  3SBT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...