4WVRA

Crystal structure of dscam1 ig7 domain, isoform 5
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
SVPPSIAPFSFGDDPVNTGENAGVQCMVQKGDVPITIKWTLNSRPIINGEEGITILKLSPKTSVLNIAAVEQDHRGVFKCIAENKAGSSFTTSELKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Down syndrome cell adhesion molecule, isoform AK
publication title Structural basis of Dscam1 homodimerization: Insights into context constraint for protein recognition
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell adhesion
total genus 21
structure length 98
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wvrA00
2BMKA 5FHAL 2W0PA 4XMLL 5INDA 5TFSL 1NLBL 1BFVH 3OKDA 1NC2D 5IMLB 4S1DD 1XIWB 1MUJA 4KKBC 1KULA 4MJ4A 1OT2A 5FO9A 3HNTH 5CHNB 2YR3A 2EDTA 4GRWH 2CMRL 5EO9B 3CSBA 3JV0A 2LTQB 4I9WD 4U0QB 1J1PL 2ID5A 4XPTL 1SJHB 1UZ6F 3UTZB 2EYSB 1UWGL 4LPTA 3ET9F 4W4NA 1MI5B 1JVKA 1EEZB 4J4PA 5HHNA 3RZWA 3QDGE 5E70A 3AU1A 4IHOB 2AK1H 4G7YL 1QQDA 1MQ8A 4I3GA 3FQWA 5CD5C 1MCIA 5DEFB 5DD5H 2OK0H 2QSVA 4YNYA 4NQCB 3H9SA 3FHQA 3QO0A 2E7LC 2EEDA 5F9AC 4GXVL 4OF8A 5SWZA 1N59A 3FO2A 3X3FL 3P9MB 1D5XB 2RQ8A 4OZIB 5CIPH 2D4DA 3DIFA 2AK1L 3OR7B 1MJ7H 4WW1B 4ZSOA 2FX7H 2ED8A 3BQUC 4QOKA 1RZFL 4UQ3B 5H35B 1OM3L 5L88H 2OK0L 3QCVH 4MB5A 4JRWA 1WF5A 2F54B 1E6JH 4RSVA 5D1XD 2IAMB 1P6FA 4MHHG 3O45A 1SM3L 3G5YA 4MXVE 3NCJH 3MRCB 3GSQA 3FHAA 1CXLA 3NAAL 4H0IA 3QNXA 1PG7H 3EFDH 2J8UE 1X5ZA 2QBWA 4NN7B 2OXHA 5DJYB 1YZZA 2X7LA 3RZCA 2ZCLL 1Y6MR 3MUGA 3OKOA 3ARBC 3CMOH 3RTQC 5EIVA 4PJGA 2CDFB 2G9HB 1CICA 4G6FB 3N9GL 4L8SA 1YDPB 5EZOL 4KI5E 1PG7L 3EFDL 2VERN 3GIVB 4U1GC 2W0KA 1KIRB 1ZE3C 2IADB 1T6WA 5GGVY 1QSEA 1KFAH 9CGTA 4KZDH 4P2QD 4U1IA 3IGAA 2P43B 3MLPA 3OHXA 5EA0H 3NZ8B 4JDTH 1FNEB 1E4XL 4ONFH 1M6OA 2FR4B 2XTJB 1NBZB 3B4NA 5C0ND 1LE9B 4AH2B 3IJYA 5ECJE 1HNFA 1KFAL 3O4LA 3LEYL 4FNLL 4KZDL 5CZVL 2UWEB 4U1KA 4H25B 4XH2B 3U46B 1A64A 4Y5YC 3C6LB 1CGWA 2VAAB 4P2RE 1TCRA 4JDTL 3WNLA 1TTFA 3TFKD 4HUMB 4ONFL 4WEUD 2ADFH 2OQJB 1TFHA 2R4SH 2XNAB 2VDQH 3VXRA 3I02B 4W68A 4HUWB 5IIEB 2FLBT 3MLWL 3QUXD 1HHKA 1EMTH 4X5WA 1ETZB 3P9WB 5DQ9A 4X6CB 2P5WA 1GHFH 5ALCH 5DVOA 4OSUL 4PJ5D 4C4KT 2Z31C 4DGYL 3R4DA 1X7QA 4GUPA 5EOTB 4YHML 3G5XA 3PDOB 4Y4KD 2R4SL 2VDQL 1EIBA 3MCKA 4PJXB 1H0DA 3JV6A 2MPAH 4JY5L 1BPVA 3K46A 4Y89A 1F3DJ 3GMPB 5ALCL 3UTPD 5F44A 1IFHH 3MBEC 2I07B 3LEXA 1IAIM 1NDMA 4C56B 3BI9X 4LAQL 4GBXD 1QYGL 1TLKA 2E7MA 3P2TA 1NQBA 4JDVB 2XI9A 3SKJH 1OP5H 1DBAL 4Z9KB 2Z93A 1QFOA 5HYJA 4X8XA 3C6SB 1R0AL 1XGPB 3IXAA 3TBYA 4Q9BA 3CDGB 1QFHA 5KSUA 3D9AL 2ZCHL 5DR5H 1J10A 5ISZA 2VISA 3TM6A 5JW4M 4R0LC 3RVUD 5M7QA 1CBVH 3ARRA 5DZOA 3C5ZD 1NFDB 4QTHA 1BAFH 4ELKA 1J8HA 1S9WB 4PRBB 4J3UA 5L0QB 5IR1A 1H3UA 4P9HH 1L7IL 1WBYA 4PJDF 5F9JB 4FQCL 1KLFA 4RRPG 1YEJL 4Y1AB 5AZEH 5CLTA 3MLYH 15C8H 5SWQB 4KRLB 1UXWB 3X13A 2HT4C 3WLBA 4PRHE 1CBVL 3O3BB 2R9HC 1O7SA 1BAFL 2JIXD 1NEZG 3HZKA 1HZHH 5FV2A 4K23L 1BD2B 3TNNB 4U3XA 2GYSA 3WFBL 3BRDA 3OXSB 1DL7H 3LKNA 1ZHNA 4C59B 3AAZB 3FCTA 1QNZH 4EKXA 5FM5O 15C8L 43C9B 5I74B 3BWAA 2VLKB 3LS5L 1I8KA 4AENB 3MXWH 4KKLD 3MOQA 1TMCB 4BZ2H 3L5WB 2NW3B 1HZHL 4X98B 1OP3H 1VFBB 4KV5E 5DJDA 6FABH 1DBML 1DL7L 2ZG3A 1Z9MA 4ISVB 5JW4Q 3B2UD 5J9PA 4HAFA 3VA2C 1CS6A 4PRNA 1T7WA 4H26B 1RJYA 3NN8A 4RMUA 3W11D 4JJ5A 4EN3B 4EUPA 1S7QA 3UTSB 1KJVA 2KDGA 1T1YB 5T3ZD 1T89A 3MXWL 2J8HA 5EUOF 3MRMB 4X6EB 4BZ2L 5BOZG 5HHMB 1LEGB 3KPRB 6FABL 1C5BH 4IIQB 3HE7A 4UAOB 3QQ4A 1Q1JH 4MNGA 2OMBA 3IDYC 5BJTB 3MJ9L 4HFWB 3L3IA 1IE5A 3SOBL 3O6FB 1UVQA 4OFVA 2UUDH 4NO3A 4IOIA 3D25A 5MI0B 1MLBA 1KCSL 4DUVA 1IGYB 3RIFF 1BX2B 4PJHE 1NC2B 2DJSA 4GXUN 4ZAKA 2HJLA 1W72L 2FNBA 1AD0A 1OVZA 3L1OL 2JJTA 4Y88A 3RDTA 4PRPB 3VWJD 3SO3B 4H1LB 1EFXA 5FUOH 1E28B 5IW3A 1W0VB 4WHDA 4YXLH 3RAJH 1IC7H 1AY1H 3TCLA 5HTSA 1OTSC 2X5PA 4XCYA 3ARGB 5J6HB 2DQUL 2NY0D 1ZGLP 3PWLA 3MNVB 1AP2B 4PV8A 5TQ0H 4TUJB 4M6ML 1WFNA 1WIPA 3GMQA 1DEEB 1XMWA 3KYKH 1AGBB 1OF2B 4X6DE 4U2ZA 3RWDB 3SCMB 5GGSB 4QHNA 5FKPB 5JDSB 3D39D 1P5VA 3ELAT 3DWTA 4LLVB 3STLB 3DVGA 3W9EB 3ZKNC 1ZTXH 5ERWA 1IC7L 3RAJL 5FOBA 4ERSH 5FIEA 1RHHA 4JKLA 2ARJB 2Y6SC 2D7TL 2VZOA 3QWOB 5DRNA 1MHHB 2B0SH 4K7FA 4GW5B 4R8WH 5J1AB 5TQ0L 1WBZB 5F88B 4NN5C 3KYKL 3SDCC 4JZNB 5ESVA 4PJIE 1XZ0B 1XR9B 4HW6A 1UA6L 1G7HB 1G7IA 5I73B 4DUWA 1URLA 2IBZX 4YHNA 1UENA 1ZTXL 4L8BA 5FDWA 4ERSL 4KUZH 3QEQB 3QUKA 3LN4A 1QUNA 5D2LE 1XF5B 3PJSB 4KKBD 5DRXB 2NTFB 3O2DL 2B0SL 3O3DB 4R8WL 5ILTH 1HNGA 1OQXA 2KKQA 4E41A 4KY1H 1LP9E 1HXYB 1EAPA 5GHWL 3FOLA 1W2KT 3F6IA 4F33A 5E9DE 4NRYA 2AXHA 2W92A 2V5MA 4HKBA 2RFXB 4MLIA 2R23B 4LL9A 4XGZA 5ILTL 5SWZD 1PAMA 4HJGA 5ID0B 1FO0B 1F4XL 4MAYA 2ZP0T 4Z0BL 1PY9A 2VN7A 4XNZC 2P42B 5GIRA 4JFHE 3CU1A 3E8UL 3LQMA 4KQ4L 3QA3B 1CDHA 4QRPB 5CD5D 3HE6C 3TZVA 2G60H 1JV5B 4F58L 4NWTH 4N1CA 5ITFA 4AMKH 2V9QA 1PBYA 3MZTA 4JPVL 5C0DA 5EU4A 1HYSC 1AFVH 1ZAGA 4WI2A 5E2VH 3QXTA 4K2UH 4HZLB 3MNWA 3RNQB 3DX9B 5ALBL 4WTZA 1N5AB 3BQUD 4OD3H 2DQFB 3EKCA 2FGWH 2Q76B 5IV2B 3MV8D 1ZSDA 4MDIA 4MHHI 4AMKL 1S7SA 4YHKH 1Y6KR 3TYFA 5C6TL 5JR1H 2EE9A 5FGBC 5JIKA 3V4VH 1AXSA 4NQCE 4K2UL 3BO8A 4F7PB 3C9NB 2D7PA 4FHBD 3TVMA 4OD3L 3RGVC 4PTUA 3GIZH 4O51A 3O6MH 4OZIE 1MHCA 5EIIA 3JSSA 5IG7B 1RZ8B 4G9DB 3TH4T 3RX5A 3QUXB 3DI2B 2OTUB 3QQ9C 2J7LA 1JN6B 5T3XE 3OF6D 3ARSA 4YHKL 4ZOAA 5C6PB 2XV6B 3FL7A 3GJFK 4HC1A 2IFGA 3RTQD 5K9JH 4HH8A 1HQRA 4NQDB 4ZS7H 3V4VL 1ITCA 1YMMD 5BV7C 3VXOA 3QHZL 3HZVA 5C07B 4NT6A 4O2FA 1UB6B 2Q6WA 2E3VA 4N0FB 4P23C 2K3TA 5E24E 2OS7A 4ZFOA 1F3DH 3T0ED 3F6LA 4ALAH 6CGTA 4GKZB 4V1DB 3KXFD 4R2GB 5IVNA 2BXYA 5CGYC 1JNLL 2BNRD 2VH5L 3VXUA 3VU2A 1B6UA 5K9JL 1CGSL 4XT1C 4KJWD 2GSGB 1F90L 1MCDA 1LWRA 3FZUC 4PS4H 5CZKA 2N7BA 1P84K 2MJWA 2RB8A 3T8XA 3GMOA 5CEYA 3CVHA 4EDWH 1CFTA 1DVFA 4JPKH 3QEGH 4HBCL 3PQYA 3VFVA 2JF1A 4JFED 4ALAL 4NQUA 5FF6B 4Q6YA 5EOCJ 3Q6GL 2WLZA 4TNVF 3BPOB 1JTPA 5EO9A 4FQXC 1C16B 5TF0A 1W72B 4PS4L 4YZFE 1SBSH 3AB0C 2NZIA 5H2BB 4PIRF 4XX1E 2OL3L 2PKDA 1Z5LA 3C5ZB 1MCFA 2XTJE 1G6RH 2NY6C 3TWCH 2BOCB 2FECI 5I75C 4E5XB 4GG6A 2VDPH 1CFSB 5EG6C 4PJ9C 3MRDB 3KPSB 1J1XH 4G5ZH 2Z31D 3MRIB 4NZUH 2UWEE 4ZUWA 2IPUG 3REWB 2X09A 4YFEA 1VHPA 1KPUB 4NBZB 1HH9B 1QO3B 4L3EB 1ULVA 3LZFL 4X7DC 2A6IB 2FH6A 4P5TA 2BVPB 2VE6A 1S9YB 4FQQB 1A6AA 3TWCL 4PG9B 1BLNB 3BKYH 4PRIB 2VDPL 4IRSC 1D5XA 3FRPA 5JW5B 4LDEB 3MJ7A 1J1XL 2ICWJ 3OR7A 1Z0NA 3NFNA 4N0YH 3OXRB 4X6CE 3MBED 5DMKB 5EFIB 4G9FD 4NKQB 5HVGB 5CEZE 3NIDF 4E42B 1B3JA 1FG2A 3RJDA 4PJXE 4U1JA 4LLQB 4Q6IC 4R4NC 5EB9A 4R96A 3WDHA 4AM0A 1Q8MA 1U36A 4ZS6C 3MRCA 3ZKQD 1CFNA 1K6QH 4HKJA 5GZNC 2X4PB 1J05A 4EOWH 3QXDA 2JJVA 1VCAA 3S37H 2FLRT 2V7HB 2C1PA 5GRXG 2CLZA 5F3HB 2DDQH 4P4KC 4K55A 5GZOC 5TDPB 2AXGA 4OKDA 1BF8A 4J3OC 4PY8J 2QKIA 1H3VA 4C56E 3BH8A 25C8H 5DJAA 1RU9H 5E2UH 1K6QL 5B8CC 4LU5L 1A1MA 1MAMH 5E03A 1MFEL 4IMLB 3IF1A 3S37L 2HT4D 2IADA 4TPRL 5CUSH 1UQSB 5TJWK 3V6BR 3X11B 3OR6B 5DK0B 1NFDE 1IVLA 1RU9L 5DSCB 3UTTB 4V2BA 3A6BH 4UIMA 1AC0A 3GBMH 3KPMB 1KJMB 1NJ9A 3ZDYF 4MSWA 4QNPF 4OJFH 4Y1AE 2YC1A 3ZTJG 2G2RB 1ZS8B 4TVPH 1U8JA 1NFKA 5J12C 1HOCA 3IJSA 1SJEA 2ZPKL 3MV11 4S2SB 2NY0B 4JVUA 5SWSA 1V7MH 3LH2L 1B0RB 1CLOL 1QD0A 3A6BL 1BD2E 1FNSH 3GSWB 3DUHA 4XPHH 5MHSD 1I7UB 2E9JA 4RZCB 5IVZA 1BHGA 5DI8A 1VEPA 1A6ZB 2ZWLT 2VLKE 1EZVY 3BIAX 5D2NC 3I6LD 1Z9OA 5HHOD 1AHWB 5GS2H 1V7ML 3HUJA 1K2DA 2ORBH 3PV6A 5IUSA 1I9JL 1FNSL 1JZ2A 1G0DA 2PO6C 3GSOB 1M05A 3VD7A 4MA1C 3RWHB 3KNBA 2V6HA 3FN0H 4DEPC 3UTSE 2D0HA 2R15A 3JTTA 4QXTB 1AGEA 3MRGB 5BVPH 2Y72A 1MVFA 5KVFH 3MLTA 3IFOA 3QYCA 3EO1B 2ORBL 5LVEA 2EE3A 1ZLUK 1BFSA 4N0UA 3KPRE 2E9WA 4Y8AA 5GSVA 4YIQA 4LLMA 3VCLB 1XH3B 1KV3A 1QBLH 3LMJL 4RDQG 5I1CH 4HT1H 1Q0YH 1PY4A 4EBQL 1T0MA 4TSAH 2D9QB 3P4NB 3L3GA 1OTSD 3WEXB 4Q9QL 5KVFL 1DN0B 3P0GB 4HQQH 4X4MA 4W6XB 3QWQB 3AUVA 1KB9K 1M7IA 2O5ZH 3W0WD 3LN5A 5LCVL 5I1CL 1XF3B 1GGCH 4PRPE 2Q8AH 3ZKND 4TSAL 4BKLA 2HN7A 5IB2B 3PWJB 1YUHB 3EYOA 5HDBF 2VZVA 1NGWB 3E6FB 1S7WA 2ZUSA 2FHCA 2O61B 4GAYB 4UU9A 2KZWA 4EEEA 2ICWI 1DSFH 4Z95L 4Z8FL 3IDIA 4GRWF 1MVUA 3RNKB 4PJDB 5IESH 2O5ZL 1CIUA 1G7PA 2HVKA 1ZHBA 3PHQB 3GNML 3QHFL 5IROA 3SDCD 4NGHH 3WNPA 5D96B 1OAKH 3MV9D 5B38B 4J3SA 3MRPB 4XCCH 3QIWD 3F58L 4BZ1H 4YK4B 3V8CA 1MHEB 2HFEB 3L5JA 3K2MC 4WTZG 1NL0H 2W38A 4D8PB 2HJKB 4LCWB 4LMQE 1YY9C 3DRQA 1HIML 1O7VA 2MOVA 4GRLC 4HKZA 1BBDL 3TO4B 1C1EH 1T5XA 1OAKL 2NLJA 4JR9L 2LFGA 4P9HC 1XR8B 4NO2A 5HGAA 4I18B 4XP4H 3VGDA 3QEQE 1ONQA 4EN3A 5KN5B 2WZPD 3JV4A 5GGRA 3SKMA 1C1EL 1X4ZA 3LHPH 3D3VB 4XNUL 5CJQL 2A6JB 4M4PA 3GKZA 5JLZA 1IGCL 2K7QA 1LEGA 5ELIA 4U1HB 4YX2L 4OF5A 5HGBB 4FFVD 3QCUL 2EEBA 2B1AL 3VI4E 5SX5K 3BPLB 1CFVL 3TV3H 3HE6D 4XP4L 2VDRH 4UNTA 3T0EB 5EU6A 1D5ZB 2Q1EA 3LIZL 5C0AE 1HYSD 3H3BC 3ULUE 3L3DB 3HKFA 2BY1A 5JXAH 3BGAA 5D93C 1NCDH 1AQKL 1IGYA 4I4WB 3S4SA 1NC2A 3TV3L 3QNZA 4F7TA 5EOCH 1EXUB 5FUCE 2GJ6D 2VDRL 3LB6C 1R3IH 5FB8B 3MRNB 1AO7E 1X4XA 4QRPE 4UNVA 2F5AH 1BECA 4HUKB 4WI5A 2NY1C 2AK4E 4EI5D 4JRXB 1FZMB 4I0PC 4OM0L 5I1IL 1WCBA 3GEWB 4JFPB 2DTMH 4LLWB 1ZLVK 3RGVD 5I17A 3MNVA 4U6YA 2HRPH 4PJFF 3ALXA 1OAUH 3QQ9D 5C92A 4MAUH 1AGBA 2XN9D 4KVCH 2HT2C 1T1ZA 5DMYA 4YFLF 2CDGA 3TP4A 3SGEI 5GJSL 4LSPH 4JQVA 2CO6B 4GW4A 2CXKA 2ZUTA 2Y36H 4OQTA 4MA3B 4F9LA 3BFOA 4P23D 2DTML 4BSWB 2M8XA 4KKAC 1VPOL 4M8QA 4M48L 4XP5L 5I76A 1U8NB 1WZLA 4WU5B 3DTXB 5CGYD 3LKPA 4ZXBC 1A0QH 3KYOB 4M61B 5AWNL 4EXPX 2FBJL 2GITB 5BMFL 4U7SA 3VFMA 3FZUD 3FRPG 4LSPL 1SYVA 1ZT1A 4WO4B 2DQJH 4X4XB 3HNVH 4LRIC 5JIHA 4NQDE 5H8DA 1WFOA 1A5FH 5C07E 1OD9A 4WI8A 3WL9B 3CSPA 4U05A 3LS4H 5D1XA 2W60B 3LPGA 2JJSC 2DWDB 4OQ1A 3SPVB 2C7UB 3WUZA 3FB7B 1EJOL 4M3JA 4V1DE 4FQXD 5I1JH 4GS7B 2BNUB 4XRCB 1UT9A 3TH2T 3HNVL 4X6FB 3VA6A 2A1WL 5HY9B 3KPNA 5D7KE 4RMRA 1BQUA 4R7DA 4G8EB 3LS4L 1KLGB 3OKMA 4KKCC 2NY6D 3MRKB 3D87B 3GHBL 2XZCL 3MOBL 4PJ9D 4D9RD 5KOMC 2H26A 4GKNB 1QLRB 4D0CA 3BDXA 5I1JL 3I75B 3J8F7 4PD4J 4KGLA 1IL1A 3R06A 4MQXC 2LVCA 2VXVH 1KG0A 3GRWL 1FFNA 1RMFL 4P2QA 2PCPA 5C0FB 5BXFB 1I8IB 1OARL 1UZ6E 4F7MA 1HILA 4IRSD 1KIQB 1R5VB 2ZUYA 5LGJA 3EZ8A 4AEIH 1N6VA 4BFEA 2IBGA 3KPSE 5DGQA 1QSFD 3BW9B 4JRYD 3IDGA 4H8WH 2FEEL 4HG4K 4WUUB 1OAZL 3EDDA 2EKSB 4TSCH 4R4ND 5F89A 4CW1A 1D9KA 2D7QA 4L3EE 3X3GH 1AKJB 5IT2L 2NX5D 5GZND 5B4MD 3IAPA 1UG9A 3BDYH 4PRIE 2BDNH 4J3VA 2VJXA 1A1NB 2V7NB 1ZT7B 2WQ8A 5JOFA 1K4CA 4H8WL 2DD8L 1GGIL 5FECA 4WDIA 1B6DA 1KB5B 2VZUA 1WISA 5GZOD 1J1OL 1EHXA 2VR5A 3UYRH 3V8OA 1U91B 5CSGA 1T7YA 4PJ5A 1I3GH 5DD3L 3D0LA 1FC1A 1UB6A 4Y4KA 4HUVA 3SGEH 2BDNL 1MRCL 3EJYC 1RJZA 1DQQA 1JRHH 4IRZH 4HX1B 4WFFD 3CMGA 2R0WH 3IDUA 1TZIB 1UWXK 1KCVL 1BEYH 4U3HA 2AV1A 2FATH 3I6KA 3UYRL 2IFFL 4NCC2 3V0VB 3FFCB 1DLFL 4BH7B 1AR1D 4Q74A 5C0BB 3BPCB 1CDJA 2AJUH 1HCVA 1JRHL 5JO5B 2R0WL 4GBXA 1I4FA 5DT1H 1AGCB 1LDPH 1ORSB 3HTLX 5EBLB 7CGTA 2YA2A 1U8HB 4KVNH 2Y7QB 1JNHA 1UYWL 4GMTH 5GS0L 1HEZA 1ZGLA 3UTTE 1FHGA 1WZKA 3C5ZA 3RRQA 1J11A 1BF2A 1GGBH 1UWEH 1LK2B 4RAVB 3DYOA 3VXQA 1AXIB 3MGTA 5DJCA 3HPLB 1U95B 1NBQA 4PUBH 5C2BL 3QG7L 4WI7A 4YBHA 1PVHA 4KTDL 5TH2A 4F3FB 4XVJH 5I15H 4GMTL 1AIFB 1ZKAA 4LCIH 2H2SC 5HHPB 5DC9B 4HXBL 4R90H 4HHAA 3SDCB 4RMVA 1AD9B 3D2UB 5IB3A 4K94H 1UWEL 2JIXA 2DQIH 3BZFB 3FRUA 2YUXA 3T77B 2E8YA 3QIWB 2ZSVB 4PUBL 1FFQA 4UQ2A 5LG1A 1DR9A 4XVJL 1TJGH 4YHLH 5I15L 5FDYA 2CLRA 4I2XE 4NYLA 5AUMA 4JO1H 4M7KL 1BZQK 1P4IH 2P1YA 2Z91B 3REVB 4R90L 4NM4H 3LN9A 4HWNA 3EFFB 2FDBP 4LVNC 4RFEA 2Y25A 1ADQL 4XBPA 2CJUH 5IFHH 3L3HA 1HKLH 1MJJB 2X4PA 5I8OH 4NPYA 1P2CA 1TJGL 2OI9C 2VDOH 5L6YL 2P24A 4DQOH 2YPKA 4NJAH 3GMMA 1JTOA 5ESAA 2X2YA 4NM4L 1I1AB 3VFPB 1UH4A 2ERJC 4MD0B 1D6EB 1PEZA 4JPIB 4NRZA 2VL5B 4PBWD 5GXBB 3Q3GA 2ZOLB 4OCRH 1R5IA 2CIIA 4BZYA 2Z8WC 1HKLL 1U8IB 3OKKB 4WNQA 5F96H 4AEHL 2VUYA 4HGMA 2VDOL 3MNZA 1CZ8L 3E6HB 4DQOL 4YDLC 4XC3H 2MCPH 4N5EC 3C5SA 2CIKB 3MBXL 3S37X 2IEPA 4OCRL 3ALPA 3OSKA 1R3JA 5DC0A 2VLRE 3UBXA 1NCWH 3BUYB 2IAND 3K7UA 5F96L 4BSVB 4JN2B 2YMXH 3D18B 5IF0B 3IXTA 2YD8A 2DLTA 1YY9D 3VWJA 3WKNA 1MCJA 4GRLD 3UPCA 1S9XB 2KQNA 2P47B 2YN3A 4XC3L 4XP6H 4YE4H 5IEKB 1FNLA 4H1LG 4Y4HC 4EJ1C 3HRZB 4M5YH 4WFHD 4EVNB 2Q20A 4PJDE 4EI5B 43CAA 4JB9H 4MX7B 1CFQA 3PWPB 5D72H 3QI9C 1I85A 5F1IA 1NCWL 1FNFA 3H2WA 2YMXL 1I7UA 1QFWI 2NY2B 4XPFL 2BSTA 2QQNH 4ZTOH 5D6DA 1F58L 1W8OA 3D39A 4LPVA 4OKVA 3T65B 4LCWE 5HYSB 1P9MA 3NABH 3GSNA 1U8LB 3DBXA 3NOIA 4JB9L 3FFDB 1P7QD 4QWWC 1ZA6A 5DJ6B 1VADA 4F7EB 3RL1A 2FX8H 4JHBA 5LQBL 1QFWM 2QQNL 3C8HA 4KJPC 3VFNA 5E8PB 1HHHB 4GAGL 5I2IB 1EHNA 1NBYA 2A77L 4WU7B 4HULB 2AVGA 4AG4H 3E0GA 1F4YL 3WN5C 2RJMA 5K9OA 4FRWA 1T0NA 2W65B 4FQHA 3D3VE 4LARH 1AH1A 2XWBA 3KLAB 4LIQH 1NMAL 1DCLA 4D9QD 2FX8L 3LB6D 3EGSB 2IH1A 5EUOE 5I1HH 2NY1D 4AJ0A 4XC1H 2WANA 4NKDB 1KT2B 2BNQE 3CVIL 4B7IA 4UNUA 4QRRE 3JV5A 3JTSA 2OMNA 4I0PD 3O0RL 4KC3B 3I84A 4M43H 3OX8A 3N85L 2P8LA 2HH0H 1RIVL 1A4JA 3Q0HA 1U8PB 2YRPA 5I1HL 3BP4B 2HT2D 5I75B 2EC8A 1AE6L 4UTAL 3IJHB 1TVBB 5GGTL 3VFOA 5DUBA 4BFIA 5I16A 2VB5A 4NN6C 2IQ9L 1CD0A 2DJ4A 3T2QA 5I9QB 4M43L 4JRXE 3DX8B 1RZ7H 1NC4D 4KKAD 4KZEL 5CFHA 4OGXH 2CKBH 5HGDB 1J7VR 1INQB 3W9DA 1TJIH 4ZXBD 4GRWB 3P4OA 1S3KL 4IRSB 3T2OA 3MRPA 1FRGL 1C5CL 1TZHA 4R9HA 3QQ3B 2QR0A 3BEVB 3BQUA 4ENEC 2ENSA 2BVUA 3BHBA 4DN3L 1RZ7L 2X1QA 4JRYB 1EVTC 2ZUUA 2EH7H 3MV8A 2VDMH 1ZHKA 1KPVB 3BKJH 2R56L 4OGXL 2CKBL 5D1QB 2VSCA 1WLHA 4KK6C 3T2NH 4OCYL 2AEIT 1VGKA 4MZ2A 2ZUQC 4DOHE 4FMFA 3WHXA 4ODXA 5IMMB 3CZFA 5D7JD 4MNHB 1YEKH 3ZKXC 1EO5A 3NPSC 4L4VE 3QDMD 3IDJA 1MCOH 2UZIL 4CVZA 2E9IA 5KN5A 3OF6A 3R0MA 4IJ3B 3S98A 3ARBA 3H6JA 4KKCD 3RTQA 1FFOB 1YMMA 1VERA 5F7YC 4BJLA 3O2WH 4GQ9H 4M7ZC 1HHGA 5FFLA 4U3CA 4QTIH 5C0GB 1S5HB 4LNVA 3QEUB 1YPZE 5T33H 4MQXD 4KK5C 1LO5B 4XBEH 2Q8BH 1BFOA 1ORQB 3EJZC 3RY4A 3KXFA 4PGBA 4LAJH 4LCCB 2BNRA 4MXQC 4OLUH 3KPTA 1UM6L 1P4BH 4M5ZL 4LQFH 2XYCA 2HKFH 4GQ9L 3VD4A 1OW0C 1LD9B 2DQCH 4L3CB 5FKAB 2P8PB 5T33L 1T83C 4K8RH 4PJBF 1KGCD 3VRJA 1FVDA 2Q8BL 4J6RL 2CGRL 4JFEA 1MCWM 2YD6A 4X80H 1RJCA 2XICA 5IHUH 3F7YA 5A16B 3B5GA 1MNUH 3CVHH 4IRJC 1YEFL 3VFRA 4OLUL 3VG0H 1P4BL 4Y5YA 2EKJA 1N6QH 3QPXH 1IAIL 3J7HA 4LQFL 1UJ3B 2HKFL 1U9KA 4I3SL 3FT2A 4K8RL 4PTTB 4IOSD 3MYJA 4MNQD 4NDMB 4U1NA 4X80L 2ED7A 2A73B 1MNUL 1I7ZA 3F7VB 5FAAA 1Z0MA 4PJFB 3VG0L 4FZ8H 3C8DA 4WUUE 2Z31A 4EIGB 1ND0A 3FT3A 3JZ7A 1F00I 3ROLB 3RPIA 5TDOA 3EJYD 1MJ8L 3M1BA 4P5MA 5TE7L 5HHXL 4QRTB 3OB0K 2R1YA 3KYOA 5KVEL 2F58L 1A22B 3FB5A 3DVNB 5FEBA 2Y07L 2CLVB 1EAJA 3NFPA 3GB7A 1LO0H 2Z35B 4O2EA 3MBEA 5KAQG 4IBLT 3QDJE 1C08A 2ITDA 4AK1A 3QZWA 4BSWA 4G9FA 2CRMA 5JHDD 1FL6A 3D85D 2IGFL 4LPCA 2QSCH 4MA7H 3QR2A 3ULSA 3MC0A 4W81A 2W60A 1CD9B 3SPVA 5EWIH 2DL9A 4Z5RB 1D5IH 3MX0A 3TIEB 2W9DH 4X4ZA 5EC2A 2I60H 3BEWB 5FYKH 4JFXA 3TEUA 1KEMH 3V5KB 3BSZH 4J8RB 3WV0A 3FFCE 4YC2B 4R0LA 2YOCA 1M7DB 3RWEB 5HVWA 3L6FB 4QHLA 2GFBA 5EOQH 5C0BE 4OLXL 4Z6AT 2QSCL 4MA7L 1JHLH 1PFCA 2AJYH 4GLRI 2YHGA 3SGKC 4YJZL 4OZGA 4UDTA 4F8TA 4PJHA 2FO1A 4YXHH 1C8PA 2I60L 4NFBA 1KIPA 2XKNA 1KEML 2H2SD 2AGJL 3BVNA 4QT5A 1MIEH 3V6OC 2JCCA 5EOQL 4XZUB 4LKXB 4OD2A 5HGHB 4K3DH 5C0FA 1CTOA 3HZMB 2BVEA 4FMKA 2AJXL 3O9WB 4ZOEA 4M6OL 3WS3A 4FABL 4GMSH 5JOPD 3DI3B 2DMKA 3PGCA 5D9SB 4OIAA 3VGGA 2FWOB 4X6DA 5H37H 4DW2H 5CBAB 1QR1A 1A3LH 1FZOA 1FYTD 1MIEL 2WP3T 1A7RL 1T0PB 4K3DL 1S78C 5DXWA 3S88H 1UFUA 5DO2D 2R1WB 3NCMA 1RHFA 2IG2H 5I1LB 2EEAA 1NCNA 5IKCB 4X7EC 4X7TA 4NKMA 5JW3H 4UUJB 4GMSL 3DOSA 1SEQH 1L9NA 2R2BB 4ZUSA 4L8SC 4LDOB 2VITA 1XEDA 1A3LL 4HGWB 4KTEH 1T2JA 1Q94A 4NOFA 3LEVL 1LE5B 3LKRA 2A83A 4LNRA 1UKSA 1GAFL 5HD8C 2XA3A 4BFBD 3PL6D 5D2LA 5HHOA 3V5HA 4Z7VA 3NIDE 1SEQL 5FK9A 4A6YL 3VD9A 5C0CD 3VE0B 3MREA 2WAHA 4YFDB 4H8WC 1XGQB 4N5ED 1LP9A 3MROB 1MRFH 1KN4H 5C09B 2B5IB 1K4DA 1M1SA 5FYLL 2PYED 4I5BA 3GK8H 3V7AE 3ULVF 2BSSA 2HAZA 3IDNB 3G6JF 1PQZA 4DTGL 5BW7A 4K9EH 3V6OE 3UXFA 3EYUL 3NCYP 2FZ3A 4L8DB 1MRFL 1KN4L 2LAAA 2LV4A 4Y4HD 2H9GB 4XPBL 4X6BA 3MRHB 4JDZA 4Z7UF 5FA4B 2WP3O 4Z78A 5MEND 3QI9D 3HI6H 5DHXB 4GAFB 1VFAB 3W0WA 4QYOA 4JGUA 5JW4R 1BZ7A 3NVQA 4HFUH 3W82A 3QXVA 1U58A 4PP2B 3QRGL 4ORGA 3ZDXF 4RAVA 5B3JE 4N8CL 2E7CA 2D7NA 3LRSA 3O11A 1N2RB 3VXSB 1JF1A 1AQDB 4LASL 4QWWD 3PABB 3ZDYE 3CD4A 4JPWH 1TQCC 4QNPE 4QO1A 1AIFA 3NIGF 3PWPE 4QHUA 3KS0J 3SDCA 4HFUL 5DJXA 1I1FA 2G75A 3HMWH 3TBTA 4UT6H 4ZXBB 3TBSA 3MV9A 4TVPD 4CUCA 4NZRH 1T5WA 3MLSH 2FD6L 5BZDB 1JE6A 4NM8H 4L8CA 4PGZA 2W07A 3U2SA 4HKXB 2VLJD 2C3HA 2GW5A 4JKPH 4M7LH 1CVRA 1ED3A 4LSVL 3HC0B 2YN5A 1E4KC 4M03A 5FO7B 5TGBB 5FHBL 3HMWL 2D31B 4LF3A 2EIZB 2FCBA 5E8NB 5FA3A 5D7JB 3W2DL 4FXKB 4NM8L 3MJ8B 1MJJA 4ODHH 1H8OA 4ZUVA 5GS2D 4JKPL 5FO8A 5L9DH 1GSMA 3B9VA 4M62H 2EXWD 4HWEL 3EO0B 5E1AB 3KG5A 5ETUB 5LGKA 1JPFB 3EBAA 5I1EL 4OGYL 1ZANH 3MRBB 1H9VA 4CNIA 4JFDA 4QHMB 3DSNA 3G5ZB 3SE9H 3KPQA 4UV4H 3DO7A 1NBVH 1MCEA 3HE6A 2PR4L 4L29A 4N9GA 3OAUH 5L9DL 1WFTA 5IEHB 4M62L 3WIFB 4ZFGH 1IM9B 1KB9J 2PTUA 5DUML 1IT9H 5F1OB 1SY6A 1ZANL 4OCWH 1VFUA 2RHEA 4MA8L 4YBQC 2F8OA 3PIQA 2ADIA 3HZYB 4UV4L 4ENED 3HI1B 2YPLE 4CN1A 2ADGB 3DO3A 2GJ6A 3D18A 1SVCP 3HHRB 4CVXB 4ZFGL 3TN0B 4KK6D 1IT9L 5FGBA 5HDBE 3SDDB 5TDNA 4OCWL 3H0TA 2AS5M 3T4YB 3JUZA 3DMMC 3H42L 1WBXB 4AL8L 5CINL 4MX7A 4F80A 4K3EH 1KN2L 1ZWIB 4GRWE 4PGCB 3BXNB 2DWEA 3RGVA 1TNMA 2P5ED 2VZTA 1FZKA 5I1DB 1A47A 1KENL 2XN9A 3B8SA 3VW3L 4RWYL 1MFCH 3AMKA 4JRYE 4PREA 1FNAA 4HIEB 4C83B 2OLDA 2F74A 4O2CB 5GRUL 3OAZH 3QFJB 4P23A 3CXDL 4RFNB 4KK5D 1DUZA 4F7EA 3EOBA 2X4TA 3O81A 4M1CD 3HG1E 3RU8H 1I9EA 3QNYA 4R97B 5IHZA 4MXQD 3PXJA 3EYQC 4GG8B 1WSST 1I8MA 2NXYD 3WFHB 5I66A 4YO0A 3Q6FB 1KUMA 1IM3B 4NJ9H 4OF6A 1A6VH 1TVHB 2NW2B 5BZWA 3KLAA 4NHUB 1CGXA 1FGVL 5I1GH 2FIKA 3QG6B 1Q0XH 3ECBB 5A40E 5KOVC 2NQCA 1JHTB 3RU8L 4B50A 2XKUA 3VXMD 3VG9B 4FQXA 1MEXH 4PRDB 3DUUB 3UAJC 4NJ9L 2UVEA 1A6VL 3QJFB 4YUEH 1YYML 4LVHB 4YHIB 5MEOB 1CLCA 1BQLH 1D5MA 5KVGH 1EO8H 1LVEA 4DJMA 2XRAL 5INCA 1JGUH 3SJVB 2C1OA 1Q0XL 4NZTL 5HVHC 4FQPA 1YEHH 2PTVA 1C5DA 3GMLA 5TPWH 3CXHJ 4PJ9A 1W8NA 4G42A 4FFYH 2X4RB 1MEXL 4OT1H 3ARUA 2IPTH 5DC4B 3AXLB 3QULB 1IAKA 1QHOA 3ARFC 2VXSL 5C08B 1BQLL 4J7RA 1ZGLM 5BO1H 3PHOA 3VDAA 3VXTB 2G5BA 4Y4FC 3BZEB 5D8JH 1INQA 1XGRA 2NR6C 3F7PC 1RK0A 1CI5A 1YEHL 3TA3C 3IRPX 5TPWL 1FC2D 1FNGA 4PR5B 4FFYL 1AGFA 4HCRH 2EYRB 2GCYB 3BEVA 4PJFE 3OKNB 2BVOA 4PGEB 1MCWW 2VAJA 2WIIB 1QSFA 1FIGH 1XGYH 3WHE1 1PYWA 4GKSB 1AGDA 1G6RB 3NGBC 4Q6IA 2V2TA 2DIAA 3QUZB 4BH8B 1T1WB 2B20A 2NX5A 4F15C 1FLRH 2AKRB 4HCRL 3D69B 3NPZB 4PJEA 2FJGA 5IVXB 2EIBA 2Z92A 1J18A 4NQEB 5D6CB 4MJ6A 1TCMA 2ERJB 2YD7A 4P4KA 1YNTB 5DJ8B 3V0AC 3RJQB 3AY4C 4YHOH 5I1KH 4WTXA 5CIPA 3H9SD 5GQBA 3DARA 5B8CA 3PL6B 3P30L 1NH6A 1IEAA 3FTGB 1I7RA 5C0CB 2W91A 2DM7A 1ORQA 4FQJH 3IRZA 1EEYB 5SX4I 3ULVL 4GW1B 3GM8A 2EDQA 3GSRB 3VWKC 2IMMA 4YHOL 2V5YA 4KMTL 3T0XA 3CFEB 2YZ8A 5IJKC 3UBXI 4TSBL 1KCRL 2NY4B 4L3CA 5EBWB 2NMSA 5ABDE 4H0HB 3S5LA 2NXZC 1IQDA 3FO0H 5E6IC 4EI6B 1HH6A 1B2WL 1G9MH 4FQJL 4Y4HB 3BIKB 4S1QH 2FHBA 4L5FH 1S78D 4XI5C 3CIQA 1SYSA 3CFDA 3WMSA 5MENB 4YHPA 4HJ0C 3QI9B 1KTKE 4ETQA 5D71L 3H7BA 4MVBC 4N90E 1NDGB 1UGNA 2DMBA 2VWEE 5D7LE 4HG4J 4S1QL 4L5FL 2MHAB 5D2NA 5BCAA 4M6NH 2JELH 1U6AH 4U1MB 5HD8D 3KS0H 3HN3A 4F2MA 4K8RC 4H20H 4LSSH 2PO6A 4HLZH 1FE8H 4JY6B 3EHBC 3DSFH 5IFAL 1G9NH 1MWAH 4L4TB 2PYFA 1OT1A 4U6VH 1EFQA 3WN5B 3G6AB 3U9PL 4W6YB 2DQTH 1IGFH 1U6AL 2VLJB 1HHIB 5K59F 5JA9A 4H20L 4LSSL 4P2OC 2P45B 3V6ZA 4UILH 4JG1H 3B9KB 4IDJH 5K9KA 3L3JB 2K1MA 4U0RB 3SKNA 5LBSH 3VXRD 4UINH 2DQTL 3T1FB 2AEQL 2MSPA 5C09E 2ZOKA 1KELL 1KJ2B 3GJFB 3RWJB 1F3RB 3NFSH 4AIZA 4E0RB 2P5WD 1F4WH 3QIBC 1RIHL 2WBJC 2UZXB 1IZJA 2DQGL 4HV8B 3AM8C 1M4KA 2OJZH 4JG1L 4UILL 3SKUD 1UB5B 2CH8A 2RCSH 3KPPA 3L7FB 5I18H 4YBLB 1MLCB 5JPMA 3S6CA 5HHQB 4HJJL 2LU3A 5EO1A 3ARDB 1BOGB 1PDKA 5J11B 2GY7B 1E27A 1F6AB 4N8PA 3QXWA 5E1HB 5FV1L 1AO7A 1FN4A 2ADJA 1JK8A 2A6DA 1A6WH 5IFJA 2X40A 4RDQF 2AJ3A 2AK4A 1JGEB 2GJZA 2OJZL 3DLQR 5FGCB 5FGRA 4DVRH 3L3KA 4XNYL 1MH5B 4HS6B 2AQ3A 1G7MB 3U6RB 4UV7H 3CU7A 3TO2B 1QLEH 4JFZH 1DFBL 2EO1A 4ZO7A 4Z77B 2IANA 4LP5A 3FQNA 2VN4A 3VXSE 4L9LC 2BRRH 4ZYKB 5T1LD 1OLZA 3BH9A 1C7SA 4GRLA 4NFDA 4YDIH 3IU3B 3JWOH 4J3XA 1A6WL 4XCNA 3BRGC 5D7SH 4FFZH 4XXDA 2VKXA 5I8EB 2WINA 2CSPA 3I3DA 4NO5B 1AI1H 1B0GB 2A9MH 2VXQH 4OZFH 2EDNA 2J5LC 3ZKXB 2HKHL 3DXAE 1H3PL 3IB4A 2Q86B 2AJVL 3DYPA 3L5XH 3OGCB 4Y2DC 3S8WA 1YY8B 2BRRL 4FQ2L 3P4MA 4WV1B 4QXGH 4TYUA 4MWFA 4YDIL 1NAMB 1MCBA 2B1HH 1S7VB 4ZUTA 5EZJB 2EICA 5D7SL 4X9IA 4DFHA 4FFZL 2PW2B 5HYSG 2MFNA 3HMXL 2VXQL 1H15A 1MFDL 2FJFA 1P7QA 2DYPD 4CMHB 5DRWB 1DEDA 4LLUB 3RWGB 3L5XL 4M6AA 4NC1C 4JFYB 1NGXB 2WUBL 5GRJL 3CCHA 4QXGL 2VLMD 4WY7L 2B1HL 5DJ0A 1ZVSB 3PWVB 2NXYB 4RIRB 1YN6A 5IBTH 2XA8H 4MDJB 1F8TH 4XCEA 4YBQD 3EDFA 1FL3A 3UPRA 4WHTB 1UKTA 3QAZC 4ODSH 3G6JB 5JTWA 3GSXB 1YEEL 2PXYB 3A0OA 3ZZ1A 2E7HA 3KJ6H 3E1F1 3D1MC 3VGBA 3KWWB 2ZNWA 5IBTL 3DMMD 1G7JB 3JWDH 4KQ3H 4I0PA 3K4ZA 5TQ2L 1M71A 3LSOB 1U3HC 3VFWB 1LMKA 4ONHB 4Z7UB 5ANMA 4K7PL 3M45A 1BQHA 1YMHA 1I3VA 1WC7B 1I7TA 5ICZA 3GI8H 4X99A 5L2KD 1J0YA 5JORA 1T7VA 1HSAB 4YDJB 1ZLVH 1N2RA 3ARQA 3JWDL 4JQIH 1QBBA 1FYHB 3VFUB 2L4OA 3FAWA 1HHJB 5HI3C 2BMKB 2FSEA 1NC4A 5GRVK 5INDB 1JGVL 3OKDB 5ESQA 3FMGL 1MUJB 4URTB 4OGZA 5EO0A 2H1PH 4K9EC 2YD5A 5FO9B 1R5WA 3EYQD 3KVQA 5GJTL 1MHPH 1EFXD 4LRIA 2V5RA 4ESKA 5MP6L 2AXJA 1S5IH 4OB5H 3MLZH 1OB1A 3QFJE 2ZJSL 5E2TL 3UMTA 5ICYA 3F12A 5ACLA 2H1PL 5HHVH 4GG6F 4S10A 3MQIA 1HQ4A 2O5XL 1MHPL 4RISH 3P0VH 5HHNB 3UAJD 3IDXH 3AU1B 3MJ8A 1H3GA 4XVTH 3QDMA 2D7MA 4FG6D 3C2SA 3O2DA 2C4FT 3OZ9H 2AABH 5GRYA 4RGMB 1QQDB 1UC6A 2EH8L 2JJUA 3MCLH 2Y5TA 3I2CH 4NWUH 1JPFA 1IGJA 1MIMH 2ICWB 1NUFA 3FB6A 3ZYIA 4YNYB 4HXAL 4MQ7A 5IMOA 4ZQKA 3H9SB 3PF2A 3QO0B 4OV5A 5FYLE 4JG0L 4IMKC 2VXUH 4RISL 1U3YA 3LKQA 5SWZB 4GT7A 1MCQA 1N59B 3FO2B 3IDXL 4LFHD 1TQBC 2R29H 4IS6A 4HWZA 4Z7OF 3DIFB 3OZ9L 2AABL 4ZSOB 4QOKB 2D0FA 2NCMA 2ZUWA 3I2CL 4Y4FD 1MIML 2WMPA 2NR6D 1QA9A 3OV6A 3SJVE 3TA3D 5ID1A 4E41D 3O45B 3G5YB 4HAGA 1TZGH 3GSQB 5GGUA 1VKXA 2R29L 4PG2C 3MJGX 2I5YH 3SE8L 2H32H 5EN2A 3QNXB 1DTUA 4IOFC 5C08E 3WBDA 5BRZE 2N7AA 5KS9A 2YSSA 3S7GA 2X7LB 3RZCB 1LNUA 1YJDH 2VDNL 5E4EC 5AZ2H 3MUGB 3OKOB 1JFQH 2YPVH 1IC5L 1RZJL 4PJGB 4TNVK 3ZTJH 5EORL 4ZOCA 4HBQA 4GAJL 5JMOC 1CICB 1JPTH 3BP5A 4L8SB 4ODVL 2I5YL 5D5MB 4MNQA 5J06A 5F7DB 5DD0H 3TCXA 1EGJH 5AYUH 3MO1A 4R26H 1NPUA 5DMGC 2IWGA 3QUML 4J2XA 3V2AR 1QSEB 4NUJA 4WI3A 1G84A 2M2DA 4U1IB 1A3RH 3QB7C 3IGAB 3ZKMC 5C8JB 2YPVL 5C0EA 3OHXB 4I2XA 2BVTA 4CMMA 1MCHA 3O4OB 4TNWK 1MCSA 1HYRC 1OP9A 5E08H 1M6OB 3OGOE 2YZ1A 1CLZH 1X5GA 4R26L 5KSAC 4NQEE 3RQ3A 1WTLA 3KPOA 4XNMA 3VWKD 2GY5A 2BFVL 3O4LB 3GHEH 2MMXA 3U4BL 1ZVHA 3C5JA 4LHJB 5GGRY 4U1KB 3NCBB 5GPRA 1EHAA 5JHDA 2NXZD 3DPBA 3D85A 5E6ID 3ECBA 4G7VH 5I19H 5DHYA 2BY2A 1N64H 3C2AH 4P9MH 3TVMD 4KJYA 3VXRB 3O3UN 1K3IA 1GC1H 2D2OA 4XI5D 1QPPA 1JGLH 1HHKB 4DFIA 3F62A 3GHEL 3PP3H 1NMCB 4X5WB 2H6PA 1N4XH 4G8GE 5DQ9B 2P5WB 3HUJF 4PPTA 2NTSP 1RUAL 4XAKE 4MVBD 1X7QB 2X42A 4GUPB 1DUYA 3G5XB 1IZKA 4G7VL 5I19L 5DD1H 1N64L 4NNXA 5D70L 3MCKB 1H0DB 3P0YH 4JFFD 2QQLH 3JV6B 1GC1L 4QHKI 3WXVL 2VLRA 4PJBE 2F19L 3QULA 1N4XL 4JE4B 4K8RD 1D6VH 3PE9A 3UPAA 3SE4C 2HRLA 5C2UB 3EHBD 1R3KA 5DD1L 3RIAF 4PJ8C 3SDXB 3M8OH 3LEXB 3P0YL 1NDMB 5C9KA 3U48A 5HYEA 4Z0XA 3WXWH 4WJ5A 3WLWD 2EYRA 5ICXA 2Z93B 5HYJB 5B39A 1U2CA 4PGEA 2X70A 1JCKA 3IXAB 3TBYB 1FYTA 3RI5K 5KSUB 5ISZB 5ADPH 2VISB 1VFMA 4NKOA 2ILLA 4XPAL 2VXTH 4QCIA 5I8CA 5DVLA 1QEWA 1KEGL 4DK3A 4QTHB 4ELKB 1J8HB 3FQXA 4KUCF 4L4TE 5IR1B 4AIOA 2ZUXA 4RGNC 4LSQL 3IYLW 3QEHA 2B39A 1F11A 3QIBD 4MLSA 1WBYB 3GKWL 3MLRL 2WBJD 5E99H 4WUKH 1YNTA 1CFBA 5F6HJ 4L1HA 3AS2A 4G80A 3X13B 2VXTL 3WLBB 5TE4L 3DYMA 4OFYD 3DHJA 3ARXA 3HZKB 8FABA 1KACB 1FCGA 1BIIA 3LKNB 5EUOA 1ZHNB 1Z3GH 3FCTB 4OZHA 4WUKL 4Z76A 4XP9L 4UIKH 3BWAB 1ZK9A 4QRRA 3RY5A 2PYEA 4Y19D 1I8KB 5FYKD 5J0BA 5TF1H 4HLJA 4NIKB 1IBGL 3VGFA 4HC1L 4LOUC 5DJDB 4XAWL 1BBJA 1U42A 2F53D 5DTFA 4EI6A 5J9PB 4P5KB 4Y4HA 1JZ4A 4PRNB 2Q7YA 4L1DA 1RJYB 3NN8B 4EUPB 4JJ5B 1LO4H 1X5HA 1S7QB 1KJVB 4O4YH 2A38A 3M07A 1WEJH 1Z9LA 1IEHA 3MLUH 2J3SA 1YNLH 3ARYA 3RHWK 4Y2DD 4Y5XC 4NNYA 4N8VA 2CXGA 3HE7B 3SN6N 4CRPA 5L2KB 3QQ4B 4MNGB 3ZT6A 5FGSA 2VR4A 3UTQA 1LO4L 3L3IB 3QP3A 3UC0H 2XG5A 5HI4C 1UVQB 4NO3B 2W9EH 2XFXA 3D25B 1YC8A 4HS8L 5T1DH 1R3HA 2VIRB 3FN9A 1I1CA 1G0XA 2HJLB 1FAKT 3LY6A 2ICEA 1AD0B 5KANG 3RDTB 4X5XA 3O6LL 3UC0L 3WN5A 2E27L 1CGTA 5AG9A 1EFXB 5FM5M 3DV6A 4L4VA 2W9EL 4LSRH 5E2WL 5JIIA 3GMRB 3HPJA 3TCLB 4AEFA 2HLFC 4R4FH 4G3YH 4XCYB 3D48R 5B21A 5FCSH 4OV6F 2F5BH 5JQ6L 4PV8B 5T3XH 3GMQB 3R0NA 1H3XA 1D5BA 3AVEA 4LPXA 3SDYH 5KSVA 3BGFC 1YPZA 4QHNB 1K5NA 5E6ZA 3T1FA 1DBBH 5FUZH 1U3HD 3DVGB 4LSRL 5ERWB 5FOBB 3IFLH 1MELA 2QHRH 1RHHB 4R4FL 4C54A 5JPNA 4JKMA 4Q9RH 5DRNB 5E8EA 4K7FB 5A2IH 1IKNC 3ULVE 5T3XL 1RPQA 4RMSA 3G6JE 5ESVB 5DHVA 4G43A 1NCBL 1HI6A 4M93C 3V9FA 1G7IB 5HI3D 4R4BA 4YHNB 2WNGA 1I3RA 5FDWB 3BZ4B 2QHRL 4OFKA 5IM7A 3QUKB 3LN4B 2J8OA 4NKIH 2BHYA 4Q9RL 3N1FC 5L8JB 4Z7UE 5C0JA 4JM2C 1CK0L 2C4FU 1UH3A 1P69B 5J3HC 4C57C 2AAVA 4E41B 1RAMA 4I0CC 1EAPB 1A9BA 4MJID 1CLYH 1VESA 3FOLB 3K0WA 1HXMA 3SQOH 3UCRA 1QFUH 1N0LA 1J0ZA 4PB0H 2VSDA 4OLVH 1LDSA 4FQ1L 3ZDXE 4F33B 5ADOH 4NRYB 4CN4A 4XWGL 1KLUB 4NKIL 4HKBB 2EDRA 1IEBA 2XOTA 4XGZB 4HJGB 1KNOA 3ZYJA 1IKFH 1B0GA 4MAYB 4F15B 2I26N 2E5EA 3ILQC 3TT3H 5L8KB 5GIRB 2P5EA 3MLVL 1BWWA 3STBA 4PB0L 4PB9L 3QCTH 4WW2C 3TZVB 4OI7A 1GXEA 5KSBE 1W0WA 4RWHA 5HPMA 1KCUH 1ODAA 1G0YR 5ITFB 1I8LC 5C0DB 5EU4B 3QDJA 5KZCB 3U0WH 3EOAA 5DRWA 4LLUA 3MNWB 2EDOA 4XCFH 4UTBL 1N0XL 2QADC 3JWOC 3AFLA 3CSGA 1CXIA 4PBXA 2FEDC 3TPUA 3EIFA 1TPXB 5CEZH 4OTXH 1ZSDB 1FVEA 1KCUL 2HP4A 4MDIB 1S7SB 1RI8A 4QRSA 4MDJA 3TYFB 1OW0A 5A2JH 2R2HA 2Z4QA 5E5RB 1AXSB 1T83A 3CFCL 1ZLWH 1FV1A 3BO8B 5SWZE 1U93A 4JO2L 5CJXC 3TVMB 5ACZB 4IOFD 4PJ7A 4O51B 1MHCB 5EIIB 4IRJA 1KPRA 3VXMA 5DQJA 4LEXL 5CEZL 4QOKE 4OTXL 4DGVH 5DQDL 1E4XI 2LVEA 1UM5H 4JEGB 3AS3A 4OZ4A 1P9MC 1HQRB 1G9EA 3VXOB 3ZE2F 5FHAH 3GI9H 5HYQA 3HZVB 4NCC1 4ELMB 4NT6B 4XMLH 2Q6WB 1VB9A 3O3EA 3W81A 1JBJA 4OLWL 2K7PA 3P11L 3NTCH 2HJFA 2AI0L 5DMGD 3UJTL 5AD0A 4ZFOB 2AV7A 4Q97A 3KR3L 3O8XC 3CH1B 5F1KC 5EU6D 4U1SA 4R3SA 5K9QI 3ZKMD 3BGMA 3STZA 3VXUB 1JMZA 1UM5L 2CMRH 4WFED 1F97A 4XPTH 1J1PH 3GI9L 3T8XB 3TH3T 3GMOB 2GT9A 5CEYB 1OP5K 1UWGH 2R2EB 3NTCL 3VFSA 3CVHB 3IFPA 4J23A 1CFTB 1DVFB 5KSAD 3PQYB 5BS0E 3VFVB 3R8BB 4NO0A 3JWDC 3TYGL 1CXEA 2NY3B 1QSEE 3MRFA 1GZQA 5B39G 7FABL 4KI5C 4G7YH 1QRND 3FONA 5E00A 3DVFA 4JQXC 1V3KA 3MA7A 4XTRC 1Z5LB 4TULL 3ZHKA 3KJ4C 5MEQA 3W39A 1T2QL 4GXVH 4ORZC 4GG6B 3RVTC 3X3FH 3WE6B 5DZLA 3O4LE 4TUKL 5IW6A 3MSPA 4ZUWB 1RZFH 1WTGT 4JFQA 2ICWA 1S9KC 1OM3H 1B4RA 3SGKA 4KROB 4QF1B 4N1HB 4P5TB 2VE6B 1XGTA 1GZPA 1SM3H 1A6AB 1J0IA 5KAQF 2AP2A 3B2VL 3T09A 3ESVF 4YPGB 1CCZA 2BJMH 3MJ7B 2CDEA 1ACYH 3NAAH 2YXFA 3IAQA 3NFNB 3V6OA 3FN3A 4KAQL 3CLEH 3EDEA 4I77L 4PJ8D 2ZCLH 3T1WA 2B4CL 1FG2B 2CKNA 4U1JB 2XY1A 4HIXH 4R96B 3L5IA 2DF3A 4AM0B 3EOTL 4U6XA 3N9GH 1CFNB 3AREC 4HKJB 3GRWA 5EZOH 2BJML 4TTGA 1V3JA 1ACYL 1J05B 3UJJH 3GGWA 3O3AA 3CLEL 3QXDB 2C1PB 2CLZB 4JO4H 4PLOB 1OWRM 4HK3N 3PXHA 2DQEH 2X4OA 3S35X 2AXGB 4NQXA 3C60C 3MGOA 3NIFF 2QKIB 4HIXL 3V0WL 4Y2DB 2GIYA 3BH8B 5DJAB 4RGND 4WFGE 2R69L 5D5MA 1E4XH 5F7DA 2IALA 1A1MB 2UUDK 4FZEL 5HYJE 3UJJL 2JB6A 4QRQA 3IF1B 4JO4L 2UY6A 4RGOH 4RAUA 3LEYH 4FNLH 5ISZE 2DQEL 3HC3L 5CZVH 5C8JA 1RZJC 2V9TA 1U3ZA 3ISWA 5FYJU 1T20A 3MUJA 1J8HE 1H8NA 2B2XL 1LEKB 4UIMB 4XPGL 2Z9TA 4P3DA 4WWID 2QHLA 1NJ9B 4GXUM 4MSWB 2DBLL 3MLWH 4OIBA 1YJDC 2C3VA 1S8DA 2YC1B 4RGOL 1U8JB 4ZO9A 3UO1L 4LDLB 5B3NA 1OAXH 3GJEB 1HOCB 4RA3A 3IJSB 1D9KD 2YRZA 5J56B 3LDBB 3BKCL 4OSUH 1SJEB 5DFWH 3QAZB 4DGYH 4XNQA 4P3CL 4YHMH 5E8OA 5SWSB 3ILPA 3TF7C 3MV7D 3QO1A 4JREB 5IVZB 4JY5H 5DI8B 3B83A 5FYJE 1OAXL 1OPGH 3CFJA 4XMKH 5GRWA 2FYYA 1U92A 1K8DA 3HUJB 4Y16C 1K2DB 3PV6B 2BOBA 2R0LL 4M7JH 3C8KA 2BSED 4CU8A 3FQUA 1M05B 2VDLH 4LAQH 1QYGH 3G6DH 1RUMH 4C55A 3KNBB 3ULUH 1DBAH 1NGYA 1FO0H 1OPGL 1F4HA 3JTTB 4KKNA 4XMKL 1AGEB 1K8IA 3LQZA 1NANH 2Y06L 2KQMA 1R0AH 1PKQA 4XB8A 3MLTB 2EDXA 3D9AH 2ZCHH 3IFOB 4LBEA 5KANI 2BRQA 5E2JA 4FTVD 3SDXA 4M7JL 4N0UB 3VGAB 1S7RA 5GSVB 4YIQB 3G08A 4LLMB 3HCVA 1GC1C 4FA8A 1GYAA 3DX6A 2X6MA 2VDLL 3TBVA 4MNGE 3G6DL 1KYOJ 1RUML 4MJIB 1ERNA 3ULUL 3FO9B 1OWWA 2OSLA 1YQVL 1T0MB 1FO0L 3CGTA 3VH8A 1VACB 2BHZA 4DKDC 3L3GB 5T1LA 2HLFD 1R6VA 1E4KA 3P3YA 1L7IH 4KRMB 4FQCH 1B88A 1YEJH 4X8JB 4D2NA 1G7QA 1M7IB 5DS8A 5F9WB 3C09B 3LN5B 2IH3A 1SEBA 2ESVE 2DTSA 4CVUA 3BOVA 2PETA 4K23H 4BKLB 1ZV5A 4P46A 2HN7B 3WFBH 3EYOB 3LPFA 1S7WB 3HG1A 3U30C 2RIKA 4UU9B 3DETC 4MB3A 1SHMA 4RFOL 3IDIB 1T21A 4YEEA 3IKCA 1MVUB 2QSTA 2A2QT 1FORH 1ADQA 4C4KO 3LS5H 1OGAD 1G7PB 1XT5A 2HVKB 1ZHBB 1INEH 4D0DA 2DYPA 5K59E 1BZ9A 4PGDA 1BWMA 4ODBD 1JF6A 3GZKA 1LQSR 1IAOA 4WENB 1DBMH 1BFTA 1Q9WA 3DVIA 2ZNXA 4PJAA 4AIXA 3DRQB 1MFBH 4JM2D 2H8PA 1FORL 4HKZB 5JHLH 1KTDA 1WUNT 1INEL 1T5XB 1XCQB 4LVOC 1WV7T 2NLJB 1RIUL 1BOYA 5CJOL 4ODUA 2R0ZL 5HGAB 1Z9SA 4NO2B 5D7IA 4LIQE 3KYMA 2XPGA 4P5KA 3MJ9H 5E4EB 1MFBL 1ONQB 4I1NB 3SOBH 3JV4B 2YUWA 3DMMA 5GGRB 3SKMB 5JHLL 1DE4A 3V95A 4KK9C 2ATKA 3PWUA 3ILQD 3IKKA 5EBMA 1KCSH 1CU4L 5JLZB 3WO4B 5DD6A 3PDGA 2ZZUT 5GS1C 5T5FL 5L2KA 1W72H 5GS3A 2BY3A 1PLGL 2GI7A 3L1OH 1OTUC 5EU6B 5T1MA 3SDAC 1NGZA 1ZEAL 2C3GA 1GGTA 3WIIH 4LRNH 2VIRA 1A9EA 4TRPH 3S4SB 1VEMA 4KRPC 2DQUH 4K07A 3S3JA 2QADD 3QNZB 4F7TB 4YDKL 2FEDD 4M6MH 5BW7C 5HYIA 4MS8C 5F7HA 3O2VL 1XIWC 4H88H 1HWGB 1WWWX 2VRAA 2OTWA 2GSIA 3QDGD 4POYA 2FJHA 3FAXA 5KTEL 3GMRA 3WIIL 1SMAA 4LRNL 4TRPL 1WCBB 2D7TH 5C3LD 3O41A 5I17B 4POUB 2LTQC 4U6YB 1WFUA 2MQCA 2Y23A 4ZOBA 2UYLA 1EERB 1UJTA 4H88L 4P57B 1T1ZB 2CDGB 1UA6H 5I1AA 4Y5VA 3OG4B 5EC1A 2P8MA 5DRZA 4GW4B 4YHYB 1RZKL 3NCYS 2GAZA 1P4LA 3O2DH 3L9RA 1F2XK 3LAFA 4M8QB 1JPGA 5I76B 4Z7QE 5B22A 3LKPB 4K71B 3ARFA 3ZE0F 5GHWH 3ARZA 2XIDA 2JE8A 3VFMB 1P1ZA 4M9OA 1SYVB 1ZT1B 3EJJX 3BZ4A 3WD5L 4Y4FA 4RAHA 3TA3A 5D1XB 1F4XH 3CJJA 4Z0BH 3S97C 4DKFL 3RP1A 2EE2A 1J8KA 5HPOA 2IAMC 2Y9RT 2X1PA 2QQKH 3E8UH 4KI5D 4KQ4H 3VXUE 3KLSA 2BCKB 5D7LA 1ZLSL 1TJHH 4NC2B 1KLUA 2UV3A 4F58H 1A1OA 4HDIA 4XTRD 2QSQA 3KPNB 2JK5A 5CP7A 4OZGF 4R7DB 3ZTNL 4PJHF 2Q87A 2R8SH 2OR8A 3OKMB 4JPVH 1PG7W 1ACZA 8CGTA 3PQYE 1A14L 1HSBA 4PY7A 4PRAA 4D0CB 2H26B 5JA8B 1U8OA 32C2A 2QQKL 5ALBH 2SEBA 1IL1B 2JCCF 3R06B 2CKBA 5E5UB 1TJHL 3RKDC 1KG0B 2MNUA 3BDBA 3AY4A 1FFNB 3EAKA 1FJ1A 3ZHDA 3GSVA 4I48A 3IDMA 4Z7WA 4P2QB 2PCPB 2R8SL 4XBGA 5C6TH 3RGHA 1T04A 1CD8A 4YR6A 1MI5E 1A21A 3G04A 4F7MB 1EUTA 1HILB 3ME0A 5IQ9A 2BERA 3IAGC 2ZCKL 4MCYA 5LGJB 4GG6E 2HFFA 4APQA 1JYXA 3VWKA 3IDGB 2XTJC 5IW1A 5IJKA 3MFGB 1P7KA 3KYNA 1Z6JT 5DVMA 4DKAA 1XF2A 3CFBA 4LHUA 5F89B 4CW1B 1D9KB 4PLJC 4B41A 3QHZH 2VDKL 4S1RH 3RUGA 3ARED 3C87A 2GHWB 4WHYH 3V6FB 5E6IA 5DK3A 2A9NL 1FIEA 2OYPA 3C6LC 5ACZA 3WFDH 4EQ2A 5JOFB 5F9OH 1K4CB 1I1RA 5FECB 4WDIB 1RSFA 2DM4A 4GSDL 1JNLH 1T1XA 3ARBD 4Z7OE 2VH5H 3D6GA 5D2LF 3C60D 4DAGL 3MRQA 4Z7VF 1CGSH 4KFZC 4EZMA 1F90H 2F54E 4PJ5B 4S1RL 3D0LB 4ELMA 3U7WH 5CCKH 4Y4KB 1JF5A 1LP9F 3TJHC 4HUVB 1RJZB 3WFDL 1DQQB 4JFFA 4HBCH 3H9HA 5F9OL 1MPAH 5KW9L 3JXAA 1MCNA 3CH1A 2AV1B 1J0KA 5IB4A 3Q6GH 2UVFA 3I6KB 2WWKT 4YXKL 5IGXH 4D9LL 1KTLA 3HR5A 3U7AA 2FO4B 3IT8D 3U7WL 5CCKL 2OL3H 2R2EA 4TOYH 5DJ2A 1MPAL 4GBXB 4HPOH 1I4FB 1V7NH 4HIJA 4G6KL 2HA1A 2ICES 5IGXL 3VH8G 4LLDA 1JI1A 4KRNA 4P2OA 3H9ZA 4O00A 3WCYA 3B9DA 1JNHB 1HN1A 1HEZB 1ZGLB 4TOYL 2ATPA 4KGJA 4PRHD 4WHCA 3LZFH 3QFDA 4CADA 4HPOL 5KBNC 1V7NL 4PP1C 5EU7E 3VXQB 3CK0H 3MGTB 5DJCB 1IC4H 1RURH 1F3JA 3WE6A 4QXUH 3L95A 3QIBA 5I71B 5DYOA 4V2CB 5TH2B 5CILL 1OOAA 2WBJA 5L0QC 2APXA 4TNWF 4MCZA 3AM8A 2DI7A 1IGTB 4I8DA 4LSDA 4Y16D 3AS0A 4MD4A 1DQJA 3EYSL 5C70A 5CD3A 5FM4A 4HHAB 5SWSE 4QF1A 1RJLA 5IB3B 4OFYA 4WIQA 2JIXB 3CK0L 5MEPA 1IC4L 3FRUB 1PZ5A 1CD1A 1RURL 4YPGA 4UQ2B 4QXUL 1UEYA 2Z8RA 2HYMA 5FM8A 2P7TB 2WWKO 1KCKA 2CLRB 4NYLB 5AUMB 3VJ6A 2NY7H 4Y19A 1T4KA 2BC4A 3HUJE 5I74C 5IK3A 1MAJA 2J2ZA 3QXAA 4RFEB 5F3BA 4QEGA 4XBPB 3EYFA 4L9LA 4P59H 3L3HB 3QQNA 4OFIA 3FO1A 1LK3H 1H3WM 2F53A 4HUXA 4LU5H 4L3AA 1P2CB 4NPYB 4OAWA 4L9DA 4TUOA 3RVVC 1LGVA 3K1KC 2P24B 1MFEH 5CGMA 3ARVA 1RZIA 2MTPA 2XWJA 3DGGA 4HWUA 4EUPG 1OAQH 2YPKB 2NY7L 3GMMB 4TPRH 5ESAB 2B4CC 4ODWA 1J12A 4OBSA 2I27N 4N0UE 2R2CA 1VDGA 4NRZB 1MFNA 1U8KA 4Y2DA 3Q3GB 2IC2A 4LPUA 1R5IB 4P59L 2O93L 2E7BA 2CIIB 2AQ2A 3NA9H 1LK3L 4WW2B 1UM4H 4WNQB 1AC6A 1OGTA 5I6XB 2HT3C 1EZVX 1RVFH 4HUUA 3ZE1F 2OJEA 3EYVA 3MNZB 4IIQC 4UAOC 2R1XA 1OAQL 2LU7A 3C5SB 3GO1L 4X4ME 3X12A 1PG7X 5EPMA 2R9HD 4F7CA 1KC5L 2FB4L 2OP4H 4P2YA 1CG9A 4QRUA 3O6FC 2ZPKH 1R3JB 2HLAA 1F5WA 3D0VA 4YQXL 5MI0C 3NA9L 1OQOA 1QLFA 3LH2H 1CLOH 1UM4L 1LEKA 3UBXB 3RI5F 1RVFL 3IXTB 3VWJB 2JB5L 1X5AA 2OP4L 3CDYA 3GJEA 3SO3C 4X9BA 43CAB 4A6YA 3CPLA 1FAIH 5J13B 1AR2A 1CFQB 5F1IB 1I9JH 3SBWC 3T0BA 3ARGC 4NOBA 2BSTB 4NUGL 1DDHA 3D39B 4OKVB 3WUWA 3I50H 4KDTC 4KK9D 1U3HA 5C9JA 3HAEA 1JGDA 3GSNB 5CGTA 5I0DA 3SCMC 3DBXB 1FAIL 1BP3B 4JKWA 3I9GL 1ZA6B 3PWNB 3U0PA 1VADB 5JNYA 3K4AA 1CF8L 1BJMA 3RL1B 2VQTA 3K1DA 2YD1A 3LMJH 3VFNB 1HCFX 1EUUA 1NBYB 3I50L 1F6FB 4EBQH 1ZA3A 3K80A 4HWBL 5K9OB 5DHVH 1T0NB 5E9DD 3KGRA 1NAKL 5BRZA 4FQHB 4Q9QH 5I73C 2XWBB 3OL2A 4MGXA 5H94A 1FNHA 1MFAL 5HHME 4G6MH 1NFIA 4JM4L 2IH1B 4PV9A 4M1DH 5LCVH 2FH8A 4MJIA 3FO9A 1LO2L 5K33A 2PTTA 4JFHD 4I3RH 2ZG1A 1VACA 4PJCA 2YWZA 3JTSB 3RHWF 2VO5A 1N3NA 4Z95H 4X8JA 1DZBA 3OX8B 4Z8FH 4ONGL 3T0AA 2P8LB 4KMQA 1HDMA 3THML 4G6ML 1A4JB 3GNMH 3QHFH 4M1DL 3VRIA 4YGVA 3WFCH 3RWCB 3ULUC 4OI8A 5GRVL 4J3WA 1PSKL 4I3RL 3TGXA 5DUBB 3F58H 3VFOB 4BFIB 1UKQA 1MRDH 5I16B 2Y6SD 1YEGH 5T1KA 3CDFA 5FUCC 4I9WE 2GTZB 1HIMH 3KDMA 1BBDH 5E7FA 3E2HC 3KYAA 1JHKL 4IMKA 3W9DB 5FCUL 4EXKA 4LSUL 3WFCL 3PV7A 5IJVA 1FZJA 3P4OB 4JR9H 4DCQA 1KB5H 2JTDA 4NQCD 4ETYA 1TZHB 3HFML 2QR0B 3B8YA 3ZT7A 1MRDL 3BQUB 4KHXL 4ODTL 1I1YA 1YEGL 3BHBB 2D4FA 4KK8C 3MV8B 1ZHKB 5T3XD 1WZ1H 3H7LA 4G8GA 1XCQA 1VGKB 4XNUH 5CJQH 1CE6B 1II4E 4OCSL 2APWA 4PG2A 4ODXB 1KB5L 4PJEF 3WHXB 2IAMD 3CZFB 2OTPA 2GKIA 1IGCH 3QH3B 4PY8I 5A2FA 4YX2H 5IBLC 2DS4A 3QCUH 2B1AH 1CFVH 3IDJB 3EDKA 3H8NA 4R7NA 1YN7A 4CVZB 5CZXC 4JHAL 5F1NA 4PJBA 1WZ1L 3ARBB 2V2WA 5DJZA 3LIZH 3RTQB 3QUXC 1MJUL 2XWTA 1U8QA 1YMMB 2HFGL 4JFDD 2VC2L 2C5DC 1IGML 1HHGB 1AQKH 4Q7DA 2FEEI 2R4RH 4F37K 3MYZA 4U1GB 4DZBB 2KH2B 1CL7L 3RKDD 1BFOB 3DURA 4QY8B 3KXFB 4PGBB 1IILE 2BNRB 2C26A 2OZ4H 1RK1A 1T80A 4R2GC 3RKPA 3NBNA 5DUPH 4OM0H 5I1IH 2R4RL 1MCPH 3WHE0 5DLML 4RNRA 2V9RA 3VRJB 5KSAA 1FVDB 2BX5A 4JFEB 2XTJD 1A6TA 3F7YB 2OZ4L 5LWYL 3VFRB 2IMNA 2N56A 4QKXB 4PLJD 4M8VA 5E94A 4Y5YB 5GJSH 4P2QE 1QRNA 5DUPL 5IQ7H 4O5LH 3BPOC 1JWSA 1MCPL 3FT2B 3C6LD 3SHSA 5HBBA 1VPOH 1BVKA 3MYJB 4M48H 4XP5H 2ED9A 2LABA 4U1NB 4KTYA 4P57A 1I7ZB 1H5BC 3PGFL 5AWNH 1Y18A 2FBJH 5BMFH 4YDVA 3VFGL 1JRHI 2Z31B 2IPUK 1ND0B 3FT3B 5IQ7L 4O5LL 3RPIB 3TJHD 5TDOB 5CEZD 1UXSA 3H3KA 3M1BB 4P5MB 3VXNA 5BQ7A 3PP4H 5L2JA 2R1YB 2HWZH 5CEXA 3FB5B 1EJOH 3GSUA 3RBGA 3UP1A 3NFPB 3GB7B 4NSKA 4O2EB 3SE4A 3MBEB 1C08B 2ITDB 4PJ5E 2YA0A 3QZWB 4G9FB 1O5DT 3BIBX 4PJ8A 2A1WH 4XNXL 5LGHH 1FL6B 1BVLA 2XG4A 1QOKA 3ULSB 3PP4L 3ZE2E 3GHBH 5E4IA 2YA1A 1S7TA 2HWZL 2XZCH 3MOBH 4C56D 4AQ1B 4G8IA 1XGUA 5EC2B 1QACA 1UH2A 4JFXB 1INDL 1NLDL 5C0RH 4U1LA 1DBKL 2BCKA 4R0LB 3UTPE 3GRWH 5LGHL 4U7KA 2IPKA 3U36A 4QHLB 2GFBB 1EJ6A 1RMFH 4U49A 4PP1D 1OARH 3U1SL 4OZGB 4UDTB 3W5MA 4PJHB 1KIPB 4G6JH 2XKNB 5C0RL 3G9VA 1CQKA 4H0GA 2DIBA 4XP1L 3BVNB 4FP8H 4QT5B 1JYWA 4G8FA 4Y1AD 4OCMC 1WGOA 2JCCB 4OD2B 1OAZH 4HCRA 5TE6H 2XXMB 3U9UA 1A6UH 1BIHA 1LEIA 1NEZA 3WS3B 5IT2H 3B5TA 2X4QB 4G6JL 5H37G 4EDXA 1BD2D 5CWSA 3DECA 3PGCB 5IHLB 4X6DB 1QR1B 1FZOB 1T7XA 3OAYH 4FP8L 2DD8H 3DRTA 1GGIH 4NQSA 1J1OH 5CMAA 2VLKD 5TE6L 1A6UL 3MZGB 4ZS6D 4OFPA 4X9FA 5DD3H 4GH7B 3V6FA 4X7TB 4NKMB 1NUNB 5BV7L 5JQHC 4TQEL 3ARTA 4QLRA 3MV7A 1MRCH 4ZUSB 2NY0C 2VITB 4PJIB 4CJ0A 1KCVH 1QZ1A 1FFPA 3LCYA 4P4KD 1QKZL 1Q94B 3ZKSD 2IFFH 3MR9A 4LPYA 1NGQL 3LKRB 3UTSD 4DGIL 5ITBH 2BSRA 2A83B 2GUOA 1DLFH 4LNRB 3PNWB 4Y5XA 3FB8A 1Y0LA 4JY4A 1RUQH 1OY3B 5D2LB 5HHOB 3V5HB 4Z7VB 2HT3D 5FK9B 1R24A 3S34L 1J0HA 3IDYB 3KPRD 1JP5A 3V4PL 2DQDH 1U8MA 3MREB 2NNAA 4OD1H 1AHWC 2YEZA 1LP9B 5E6YA 4AT6A 1CDCA 1QSZA 2XTLA 1K4DB 3FOMA 4I5BB 5ITBL 4NP4H 4YFLI 3O6FD 5T3ZE 4HK0A 4U6TA 4LEOA 3OJ2C 2BSSB 2FO4A 1FQ9C 1RUQL 1UYWH 1PQZB 5GS0H 2DBJA 4FTVA 4HIHA 2DQDL 4OD1L 3NIFE 2O5YL 1X5KA 2FZ3B 2QJDA 3NZHH 1Q9LA 3MGAA 3QRFM 4PRPD 5F6IC 5I30H 4X6BB 1YNKL 5C2BH 1MQKL 3QG7H 4NP4L 4JDZB 4KTDH 4Z78B 1FSKC 2EECA 3O6KH 4PD4K 2DB8A 5SV4A 5IOPA 1P5UA 5KSBA 1CGVA 3OKEA 5EUKA 3W0WB 4QYOB 4HXBH 3ARGD 1BFVL 3CFKA 1BZ7B 3SY0A 1U58B 2XQYG 1X9QA 4ORGB 3N1GC 4N0RA 3BJLA 3NZHL 1YYLH 4KMLB 3HNTL 3H3PH 5I30L 3LRSB 3O11B 4CDHA 3SCMD 1JF1B 2QEJA 3LKOA 5BOPA 2VZ1A 3TIDA 3O6KL 3NMEA 1IGTA 3QHTC 1MWAA 1IKNA 4M7KH 4QHUB 2PO6D 1OGAA 2FL5A 4OIIH 4NN5B 4ZFZA 3ZSSA 1I9IH 5DJXB 1I1FB 2G75B 3TBSB 3P73B 3TBTB 1V05A 3U0TB 3MV9B 3OTTA 4XB7A 1T5WB 1ADQH 1YYLL 1NKOA 3H3PL 3M17A 4KU1A 2AJSH 5D96C 3CFIC 4L8CB 3D39E 2YKLH 1ROWA 3U2SB 1X3DA 2P7TA 1R3LA 5L6YH 4F9PC 1AJ7H 1ED3B 4YK4C 1XAUA 3QEQD 4JM2A 4OIIL 5DD5L 3FT4A 1I9IL 2BVQA 1A2YA 4LF3B 2EDDA 1N8ZA 5FA3B 3TO4C 2AJSL 3RY6C 3TPKA 2YKLL 4AEHH 1S9VA 4JFOA 2X4NA 4ZUVB 5FO8B 3ZYOA 3GMNA 1MJ7L 1AJ7L 2FX7L 4I18C 1CZ8H 2VABA 3OJDA 5DK2A 5L88L 1RV6X 5C0AD 4KH2A 4XNZB 3QCVL 4X9HA 4LLYA 3ULUD 3MBXH 1E6JL 4JFDB 4CNIB 3NCJL 2DQHH 3KPQB 1Q9KA 4ZNEE 3DO7B 2VLLA 4WW2A 1OHQA 4KPHH 3FKUS 3HE6B 4L29B 4N9GB 5BS0A 3BPLC 1AO7D 4QRPD 3QJHB 3T0EC 1I8LA 2AK4D 5BVJA 1RD6A 3CMOL 1YA5A 1C12A 4KJWC 2DQHL 2ADIB 3PIQB 3S4SG 4KPHL 5KS9F 2GJ6B 3CDCA 3HLAA 4KK8D 4XPFH 5HXMA 3HMXA 4BQ8A 1T2XA 2ITCA 3B3IA 4JKKA 1X6NA 4HD9A 4OZFA 1F58H 3QDGA 3L3OA 1OSZA 4Z7NF 5TDNB 3RA7H 1JYNA 3H0TB 1F02I 3MV01 4GRMA 5J89A 3BP7A 5IBLD 2DWEB 5CJXA 5EA0L 1VA9A 3RGVB 3RL2A 1FZKB 2XN9B 5LQBH 3CSYA 5CZXD 5CJBA 1DLHA 4GAGH 4UDUA 2A77H 3MV8E 4BUGA 4PREB 5CAYB 3RA7L 5BV7B 3X14A 1F4YH 2F74B 1Z2KA 1OL0A 1GIGH 4DVBA 3DUSA 4NQDD 4P23B 1NMAH 2GTWA 3PWNA 1DUZB 1JJUA 5C07D 3EOBB 1FVCA 2X4TB 2F15A 2ADFL 5F71A 3O8XA 4EQ3A 1IAII 5F7UA 2KPNA 3QNYB 5IMKA 5IHZB 3CVIH 1I8MB 4V1DD 4R2GD 1EMTL 1A7NH 3OB8A 3WFZA 4YO0B 5I66B 3G9AB 1PW3A 3O0RH 2J8UA 1GIGL 1ITBB 1GHFL 5BZWB 1YMME 3P9LA 1GRWA 3WYRA 3N85H 4WO4C 1RUKH 2FIKB 4RMQA 4ZPVA 2E6PA 4HIIA 5D7KD 1RIVH 1CVSC 1T22A 3L5HA 2A0LC 3QIUA 3GUTA 1AE6H 2MPAL 1T3FA 3T0EE 4UTAH 3DV4A 1RULH 1ZHLA 3KXFE 2V2XA 3LKSA 4FQXB 4P4RA 5GGTH 1A7NL 1PX3A 2BNRE 1KSRA 1WZMA 3AB0B 2IQ9H 5J1SC 4JQXA 4GS7C 1D5MB 3R1GH 5INCB 4Z18A 1RUKL 1IFHL 3MFFA 4B0MM 2C1OB 4LKCA 4KZEH 3B6SA 1IGIH 2LU4A 2D0GA 2NY6B 1WT5C 1C5DB 3GMLB 3RWCA 4JFEE 1S3KH 1GOHA 4PJ9B 1FRGH 1C5CH 1RULL 4G42B 4OUUA 4HPYH 3SKJL 1JUFA 1IAKB 3KHQA 5EZLA 1EHLH 5HGGS 4S0SD 4DN3H 3KPSD 2GTZA 3R1GL 3PHOB 2RBLA 5DR5L 1MAKA 3ESUF 2R56H 3I6GA 2G5BB 1IGIL 3VFTA 1GH7A 4OCYH 1XGRB 1LO3H 1RK0B 4L3ED 4P2RA 1UEMA 1FNGB 1AGFB 4HPYL 1REIA 5CKAA 3W5NA 4PRID 3BUTA 1EHLL 4P9HL 2BVOB 5F9DC 2VQ1A 1A4KA 1QSFB 4TVSa 2E6JA 2UZIH 5AZEL 1TVDA 3MLYL 5EU3A 1PYWB 1AGDB 4Q6IB 4HS3A 1LO3L 2VZ3A 3DROA 4X0KA 4Y7MA 1Q9OB 2V2TB 1CE6A 2M1KA 4JANA 3AREA 3MRRA 2NX5B 5IVXF 3QH3A 4PJEB 2FJGB 3MRLA 4ZPTA 2Z92B 1QNZL 3G5VA 4MJ6B 3ZE0E 4P4KB 4G9FE 3C60A 4RQQA 4JZOA 3BN3B 3CH8A 1UM6H 4M5ZH 4HUNB 5CIPB 5B8CB 4EIZC 5J57B 2DOCA 4ACPA 1IEAB 2WM0A 4NQVA 3IETB 4OZHF 1I7RB 1UZ8A 4DZBA 4JAMA 4J6RH 2CGRH 5J8OA 4QY8A 5C3TA 1TNNA 1YEFH 2A74B 3ARWA 2D3VA 2D7OA 3K4DA 1IAIH 2EYTB 2QTEA 4NRXA 4I3SH 2H32A 5HJ3A 1VGEH 4MD5A 4OZGE 3MMEA 3S5LB 4ZUUA 2PNDA 3QUMA 3UTTD 1IQDB 5KG9A 1C5BL 3NCFB 2ESVA 3HR6A 1Q1JL 1HH6B 1A6PA 3RIAK 5J12B 1MCCA 1SYSB 2JCCE 1L0XA 3CFDB 4YHPB 5DEGA 3CUPA 4ETQB 1EGJA 3H7BB 1VGEL 4CGTA 1BGXH 2XQYK 4PRHA 4H5SA 1MJ8H 3RFZC 4W6WB 5TE7H 5HHXH 4Q2ZB 2GJJA 3L7EA 5KVEH 2F58H 2X9WA 5D2NB 2FBOJ 5FUOL 5J4MA 4JLRA 2Y07H 5A1AA 1CT8A 4HLZG 4YXLL 4BSJA 1AY1L 1NUGA 4F2MB 2HVJA 4Y16A 3PGDA 4BUHA 2JLLA 1BGXL 1MCKA 2PO6B 2VR9A 1NGPH 1J87A 1YEDA 2IGFH 5MHSE 4MA1B 2PYFB 5E5MA 4DEPB 1X5XA 3BT2H 2CR6A 3BYTA 5GSRA 3QIWC 3S96B 2C9AA 3UDWC 4D3CH 2HMIC 3I6LE 3V5DA 2YUZA 3V6ZB 5HHOE 1NGPL 3OKLA 4X5LA 4Z7VE 4OLXH 4UT9H 5J6GA 1YPZF 3QUYC 5K9KB 3CC5A 3SKNB 2HG5B 4I13B 5IB1A 2IQAA 3BT2L 2ZOKB 4LCUA 5A43C 4AIZB 1DQTA 1P84J 4D3CL 2NY5H 4KUZL 5HI5C 2AGJH 5JW4N 5C0AB 4UT9L 4YAQA 3HS0B 3KPPB 1XF1A 1KTRL 2DKUA 1I1AC 2DLHA 3VXPA 4KY1L 2AJXH 5JPMB 4M6OH 4FABH 3RWFA 2VLRD 4LPWA 4IDLA 5EO1B 5A2KH 1E27B 3FQRA 4FFVC 1WAAF 4GO6B 4X83A 2NY5L 2V5SA 4F57H 1AO7B 1FN4B 2ADJB 1JK8B 3E2HB 2A6DB 5DDHA 5IHBA 5IFJB 2AJ3B 2AK4B 2GJZB 1A7RH 3L3KB 2IBZY 3W0WE 4UBDC 1VFOA 3AROA 4WVRA 4UOW0 4ZDHA 2PW1A 5ENWA 3SGDI 4J1UA 1JTTA 2IANB 2X4QA 3FQNB 3OBAA 5F7MC 5CBEA 3UBXG 4O9HH 2X4UA 4N0CC 3BH9B 4GRLB 4F57L 2Q3ZA 5C0IB 2G60L 4XCNB 4NWTL 3LV3A 4LCWD 4OZFG 5C71A 4XXDB 2AJZA 2WINB 3LEVH 4OCXH 2AXFA 3TO4D 1GAFH 1AFVL 3MV9E 5E2VL 3ZT5A 4EI5C 1A7PH 3WS6C 1I9RH 4A6YH 5KVMC 4O9HL 3SKOA 3P4MB 2F8XC 4MWFB 4PJIA 1NCAH 2FGWL 2E8ZA 4ZUTB 2NY2C 3OAZK 1G7LB