4WVRA

Crystal structure of dscam1 ig7 domain, isoform 5
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
b'SVPPSIAPFSFGDDPVNTGENAGVQCMVQKGDVPITIKWTLNSRPIINGEEGITILKLSPKTSVLNIAAVEQDHRGVFKCIAENKAGSSFTTSELKVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Down syndrome cell adhesion molecule, isoform AK
publication title Structural basis of Dscam1 homodimerization: Insights into context constraint for protein recognition
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell adhesion
total genus 21
structure length 98
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wvrA00
3LZFL 5FCUH 1NCWH 3QDJB 1U8KA 1QP1A 4OM1L 1X5JA 3QG6B 1A6UH 3AUVA 4OI9A 4RA0C 4KTYA 3UJIL 2XWTA 3ARXA 3FOLA 1MJ8H 5J12B 2IBZY 5MI0B 1OT1A 4LSTL 3VFSB 3UJTL 2ZCLH 3QFJD 3QEQD 1LEKB 4JAMB 5FK9A 3X3FL 4YEEA 5F1NA 4UNUA 1CLYH 2EH8L 1CFVH 3A0OA 1U8HB 3MJ7B 4LGSB 1CFQB 4HUXB 3O4OB 4YFLI 1WC7A 5HVGB 3H42L 4PYGA 2PNDA 1CFTB 2GJZB 1ADQL 4WWKA 3VD4A 1DVFC 3SDXE 1UENA 2GJ6E 4TTGA 3BZDA 4LLYB 1F4XH 4PP2A 5C7XL 3NFSH 3AU1A 2CDEA 3CLFL 1VACB 4UIKH 1OQXA 3HNTL 1JWMA 4PJEA 4GRLD 1JIBA 5CS7A 4IRSB 3DSNA 4PGEB 5CJ8A 3IXAA 4N5EC 3IDIB 3H9SD 1Y18B 1IAIL 3MV7A 3LQMA 4NZUL 3P0VL 3BZEA 5AG8A 2DQUH 4Y19B 1JTOA 5EIQA 3SO3B 2ADIB 4EI5A 1YQ2A 1CZ8H 1L6XA 1LO3L 2I60L 4JR9L 4XTRD 3C5ZD 1H3UA 1NGXB 4HS6A 4K94C 4ORZC 3F5WB 4QCIA 5BMFL 1A6ZB 4WENB 4N8VG 4P5MB 2QSCL 4CW1A 1LGVA 4Q0XH 3UYOD 4TVPD 1NJ9A 4MA3A 4P9HL 3R4DA 2VZ3A 3QDJD 1RUQL 2G75B 3CAFA 2FX9H 2J88H 3RHWF 2VNCA 4MA8H 1PEZA 3UROR 1IBGL 1QBLL 3FB6A 3PF2A 3V6ZA 4QHLA 3MLYH 1OTTD 2HJKB 3QNXA 1PLGL 4NQCA 5DK3A 5DJ0B 4QGTA 1ACZA 1UKTA 1JF5A 5JPMB 2Z35B 1KLUB 1H3GA 3GSQA 4LCYB 4P3DB 4YUEL 5AD0A 1BFTA 3O6FB 3WFCL 2BERA 1GZPA 4XNYH 3EO9L 5KANG 2M8XA 3MGTA 4Y8DC 5I17A 4M5ZL 4EBQH 1DBML 4RX4A 4NP4H 3MRPB 4JKLA 3HB3C 2AJSL 1DQJA 3B43A 4XNXL 5HHME 1C5CL 1F2XK 1CVSC 1P7KB 3G6JA 3HUJA 5E2TH 4HFUH 5KW9L 5GS0L 4RAVB 4WFHD 2R29L 3C08H 2XXCB 3T2NL 2DIAA 3WLBB 5EZJB 4IRSD 1KEGH 4OIBA 3VFTB 3K8MA 1EUUA 2R23B 4Z7NE 1RSFA 3Q1SL 5F97E 4G6MH 3RDTB 3DUHA 4Y19D 3ESVF 1I3GH 1J1XH 4JLRB 5ITBL 3NFPA 1BWMA 3VXPB 3UTTB 5TGBA 1FQ9C 2WQRA 1BBJA 5HDBF 5T3ZH 2XFXB 4Z7WA 5BRZA 4E41B 3MFGB 2X40A 4MVBD 5EIVA 3SGKA 4FQLL 2ICWI 4R7NB 3ARDB 1GGBL 1I7UA 2VSCA 1GC1L 3MMEB 4CAGA 1EDQA 5ANMB 3DO7B 2DQHL 3EYFA 4Y16C 5FO8A 3U9UB 1VFUA 1IEAB 4GW4B 3QCTL 2P7TA 4ZO8A 3O3AA 2WLYA 4IIQC 1XFPA 4B53A 4N8PA 1TZHB 2AEIT 4RMWA 1NCBL 3DI3B 3IDXH 5EOCH 2GKIA 2ZUSA 1N7ML 4OLZH 4ONFH 1Q0YH 4F37K 3ULSA 4PJHB 5E2VH 1AY1L 1YEJH 3VWJB 1E4XL 3HG1B 3O6FD 3MGOB 2OJEA 3BN9D 4DFHA 2ZCHH 2P49B 4UU9A 5D72H 5IF0A 4OZFG 3FFDB 5J57B 4J12A 3CZFA 4L4VB 2R0ZL 1SJEB 4YHPB 1RJYA 3ELAT 3AREC 3EZ8A 3KS0J 3ZZ1A 2MKLC 1T5WB 4OLUH 5IB5B 3BP6B 4HF5H 1OL0A 5FM5M 3OAZK 3TJHD 1I7TA 3O45B 6CGTA 3G6DL 3UBXB 1XIWB 1ZSDA 3BT2H 5I74B 1KTLA 1IE5A 5AWNH 3RDTD 1LMKA 4M5YL 1SQ2N 2NY2C 4X6CB 2VDRL 3O6LL 3FQNA 4NWUL 3UTTD 5INDB 1WBZA 3IDYB 3AY4A 5IW6B 3I6GB 4HIHA 2Q20A 1HXYB 1KPUB 3REVA 1C08A 1S7QA 2XY2A 5E2JA 4M8QA 2VAAB 4E41D 2FLRT 4MQ7A 4Q9QL 4XCEB 4U0RC 4KXZI 1VFAB 3P77B 4AQ1B 3ARDD 1BVLA 5HYSG 4PTTB 1XGYL 1DDHB 3MGAA 1JPGA 5CJQL 4KTDL 2B0SL 4PJHF 5IBTL 5DK2A 1AE6L 1SEQH 1MRFL 5HGAA 5I2IB 3VFMB 2DLGA 2RFXB 5H2BB 2RCSH 3BPLC 1BGXL 4J3UA 4R7DA 2JF1A 5IB2A 5HPMA 3VDCA 5EUOA 5IESL 2EC9U 4UNTA 2Q76A 3RWJA 5IBLC 3RVXD 1PKQB 1FIGH 1G7JA 4YBQC 3ZTJG 5GRXG 3MLSL 5HGHA 1I1YB 3QXDA 1FSKC 2AK4E 5DURB 1QOKA 3TBVA 3HG1D 1BZ7A 3WIHL 4QO1A 3CPLA 3CXHJ 4B41A 1UACL 3DVIA 1RK0A 1A6VH 1QPXA 3B5HA 4IIQA 1X5ZA 1I1AB 1ZVHA 4L4VD 4EI6B 4XHJC 3U9PL 1DUYB 4WTZG 3WKMH 4C59B 4KJPD 1RZIA 2YXMA 1MCNA 2F53B 3N1FC 3BKJH 5B8CC 3P3YA 5FGRA 4ELKB 1XIWD 4KI5E 4PJFE 4X6DA 3QIUB 1NGQH 2CPCA 4R4FH 3ROLB 1LWRA 3TNMA 3UO1H 1A8JH 2IG2L 4QHUB 3GMNA 4NJ9L 1P84K 3BIKB 3LVEA 1FJ1A 5GRUL 3KLHC 1G7MB 2DQGH 5JLZA 1EHLL 1NUNB 2FEDD 1YY8A 4MAUH 5SX5K 1IGFL 1J1OH 2EDYA 2CIKA 3ECBB 4P46B 4Z8FL 3ZDYE 4X9FA 5DUBB 5KSAC 4NWTH 1N6QH 3CFDB 3LN4B 4KKLC 4J2XA 5IVXE 3QUXB 3L3GA 4ZFOL 1BIIA 1KPRB 4AIZB 3TH4T 5I6XC 4D0BB 2IJ0C 1EGJA 1ERNA 4TSCL 1T1WA 4F9LC 5IHUH 3SDXB 3THML 5HYQA 2GJ6B 3MJ9L 4RISH 5DURD 5IFHH 4TSAL 4WEBL 4B50A 3BDXA 1NAKL 3LRSA 4LFHD 3IS1X 4LHJB 5IB1B 3QQ4B 4RFNB 4TRPL 4WGVB 2UVFA 5ELIA 3NCYS 2GT9A 4M7JL 5HJ3A 5BW7C 1I1AD 5BVJA 1KJ2A 4GW1B 3OAZH 1NAMB 1E6OL 2C3HA 3SE8H 4GG8A 2XQYG 4KKCC 3G5VA 4EDXB 2F53D 2M1KA 2O5XL 1NBYA 1A7OL 3EOAA 3DOSA 4UV4H 3QIUD 1QLFB 3VDAA 5JOPE 1RULH 4ERSL 1W72H 1FNGA 3PUCA 5EOTA 1GGYA 4H25A 3B5TA 4JG1L 5T1KA 1HHHB 4OI8A 5F1IA 3RPIA 4QRSA 1EK3A 1LO5B 5DA4A 3LPGA 3GO1H 5D7IE 2B7DT 3U7YL 3ZDXE 4KY1L 2GUOB 4P5TC 4U1SA 2JCCA 2MCPH 4NNXA 3MNZB 4OD3H 3ZL4L 1QLEL 1H3PL 4NN5B 2AJYL 2IQAA 3NCJH 3DROA 2X1WL 5HYIA 1AD0A 1MJ7L 5IV2A 5KVGL 3KYMB 4P46D 1F3DH 5DTFA 4YHKL 3I02A 4DKFH 3S98A 4PJCF 2BP3A 1F4WH 2ICEB 5DWUH 5E8DL 5ITFA 3QUXD 5AZ2L 3JXAA 4V1DE 2DTMH 4NQTA 4LLMA 5ESQA 2Z0BA 4I5BA 3ULVH 1WJ3A 2AQ2A 32C2A 3V7AE 4UINH 2XT1B 1R3JA 1T1XB 2GJ6D 1SJVA 4ZQKB 3VXME 4ETQB 5JMOC 4OLYH 2R4RL 3SKNB 1L0QA 4OZ4A 5HHMB 1IGMH 2FGZA 1AC6A 2GK2A 1ZGLP 3O8XA 3O3UN 5E00B 1R3IH 3IU4L 5ICXA 1FDLL 4FTVE 2OLDA 1S9YA 2Y36H 4C83A 2AV1A 1YQVL 1FGVH 1D9KA 3RWFB 3S36H 5I15L 4WCYL 1QR1B 1CGUA 1EMTL 4Z5RB 1NFIA 1SMAA 4BKLB 4BZ1H 4J7RA 4M4PA 3C2AL 1ZWIB 1U3ZA 2YOCA 2BZDA 4KZEL 3KLDA 3WL9A 1A0QL 4NKDB 5DD6A 5IMKA 2J4WH 3IF1A 1BFOA 1VGKB 4OFYD 4PRAB 1B2WL 5I19H 2F58L 4L9LC 1N4XH 3QXWA 1CDYA 3LRHA 4HK0B 3OJDA 5EUKA 5B39A 3ZT5A 4HXBL 4JPVH 5FYKU 3TBWB 4MLIA 5DSCB 3KPNA 5MENB 3KPOA 2UY6A 2HMIC 5DHVH 4ZXBB 2BSRB 3RKDD 3BEVA 3FTGB 3IVKB 1N5AB 5HD8D 4G8GE 3TN0A 1DUZB 3I3DA 1HINL 3NOIA 1G0XA 4P4RB 5TFSH 4LAQL 2Y25A 4KK6C 3KGRA 5DRNB 3SE4A 1LNUA 4JB9L 1F6LL 4EJ1C 1PDKA 3PQYE 2DICA 3QNYA 1RUAL 1BD2A 2OTWB 4NO3B 5MERB 5DJYB 4Z7NF 1SJHA 4KJYB 4JFQB 1H3WM 4RFEA 5CLWA 2D0HA 3RWGB 2AJVL 5HHMD 1RJCA 3MV8E 4JZOB 4GUPB 2FZ3B 3L95B 4DGYL 4NQDE 5TPWL 2E6JA 5I1DB 3VXOB 1IQDB 1I8IA 4PJ7A 2C4XA 5JXEA 4M3KB 1WZMA 4LMQE 1YY9C 1X44A 2ARJB 3VD3A 4GRWE 4YHOH 1ZHKA 1J0ZA 1T22A 5DVLA 1U8PB 2A9ML 2VQTA 1U8OB 1TITA 4QHMB 5B4MD 1JHLL 4HS3A 4ZUUB 4RIRA 1GXEA 3GSWA 4LLQA 4I3RH 3MO1B 3MPCA 2O5ZL 2C1OA 1GGIL 5EBMA 2BOBA 3GSOA 5A16A 2IADB 4UQ3A 3RVUC 4BQBA 4XPAH 5CSGA 1DQDL 3B9EA 3LKRB 4YDJB 3MCKB 3SKOB 1S9VA 1XZ0A 3HRZB 3D85B 2A6JA 3BGMB 5EBLB 2H1PH 1HYRC 1QRKA 3ZE2E 3O6KL 3MBEA 4AH2B 2J8UE 4LSDA 4ZXBD 4QKXB 4I1NB 2VJXA 3BP7B 3T2PA 5SWSE 3GDBA 4PJXE 2DBLL 1INDL 1T03L 4MMZC 1FRGH 5EIIA 5IEHA 3S34L 4IHOA 3SKJH 2YN3A 1MPAH 4S1RH 4J3XA 3L5XH 1JCKA 3MODL 5JQ6L 4CVUA 2AK4B 1OGTA 1QBAA 1AIFA 5DS8A 5F88A 3RU8L 3NACH 4CN6A 4KK9C 4YDLC 3GSVA 3L7EA 1GYAA 4JGUA 5BS0E 3BD5A 1L7IH 3GSRA 2WWMD 2P44B 5I1HL 2GCYA 1WAAF 2NY4C 1X5XA 5C0RH 3TBYA 1IILE 2VDLL 5E8OA 1FC1A 4M7LL 4UTAL 2FBJH 1KV3A 2E3VA 5I1JH 1RPQA 4PJFB 3UTZA 1MCCA 3NTCL 1ORSB 1OAXL 5FHBL 4PJ8A 1BLNB 3PXJA 1FHGA 4PS4H 2QQNL 7CGTA 4JDVB 3OKOA 4YGVA 4EUPA 1B0GA 3G9AB 3O3BA 3OAUH 1ZTXL 3TIDB 5EU6A 3VD7A 4G9FA 4HCRA 4P5KB 2E6PA 1JGVL 1MHCA 2W0PA 3D85D 3HPLB 2PXYB 4PIRF 3T0ED 4LCWA 2CIIB 1MCFA 3MRBA 4ZPVA 4E42B 4LCCA 1VA9A 2HTKC 4YHIB 3VCLB 2QHRH 1KSRA 4QY8A 4XXCA 5IVXB 1XH3B 5E2UL 2QL1A 2XWBA 4GKSA 3I75B 5EN2B 3QUMH 4OCRL 4U1IA 3D25B 4GRLC 4X6FA 2EYSB 3MRLA 2IGFH 3TO4B 3B4NA 2VIRA 4AENB 2GYSA 2ZG3A 2IANE 4Y5VC 4Q9RH 2J8OA 3NIDE 1G9MH 2AK4D 4IM8A 4FQXA 1L9MA 3MV9E 3D9AH 3PWLA 2PW1B 4NO2B 5ACLA 1I7ZA 2YS4A 3L1OL 5IB3A 3A67H 3C5ZC 3N1QC 2IMMA 3QAZB 2JB6A 4KRNA 1N64H 4OSUH 5M7QA 1QBML 4G43B 4OCSL 4BZ2L 1OAKH 3QPXL 1J0JA 4G8EA 2OL3H 4UT6H 1RIUL 5HVHB 4L1HA 1G0YR 1T3FB 2VH5L 2BHYA 3SCMA 3ZDYF 1Q9OA 2J6EH 4H88H 3MLZL 4OLVL 5J12C 4G6FB 1OSPL 3SDAA 3HCVB 4QOKE 3GMQB 3BH9A 5D7IB 3E3QE 4QRTA 2H32H 3HZKA 4XVTL 3SDCA 1CGWA 1T1ZA 3H7BA 2IWGA 3L5JA 1KYOJ 2PXYD 1B4JH 1ZHBB 1JF6A 4LLVA 5FM4A 2X09A 5F8RC 1E4WH 1FFRA 5L6YH 1KFAH 5I30H 4WTWA 4PGCB 5LQBH 4MJIE 2GEEA 4FXKB 3FRPG 5ACZB 4V1DB 1GAFH 1MREL 2ATPB 3V6BR 4TYUA 1FYHB 3TP4A 4IRSC 5MEQB 4FMFA 3TO4D 1DN0B 4PGDA 1IAIM 4BH7B 2X1OA 4WW1B 1AQKL 4MAYB 4JPWH 3VXMB 3REWA 5E6IB 1FFPA 4KMQA 5C0AE 3DX9A 3SO3C 1JFQH 2V9QA 5FYJE 1ACYH 1ONQA 3C60A 4DTGL 2W9DH 3B3IA 5JA9A 2RQ8A 1XF3B 4LKCA 1AGDB 3QDHA 1Q9WB 2Z8SA 4X7TB 1XR9A 4FTVB 4MVBC 5D7IF 2A74A 3B9KB 1CTNA 4J3SA 3R1GL 3MROB 3QHZL 4PRNA 4NRYB 5H35A 4Z77A 5CLTA 5IMMB 3UPRB 3NIFE 5JOPD 4MB4A 3SDYL 1CE6A 2HG5A 2ZSWB 4QRUB 3MXVL 1Z6JT 3DI2B 1EEUA 3RWDA 2YBRA 3INUL 4G6FD 3ZKXB 4ZUSB 4X7SH 4YDKH 1YJDL 3CU7A 5D1QA 2ZNWA 1DBJH 4TPRH 3QDJA 4XMLH 3O6FC 5L7XH 3BN9C 3EIFA 2BC4A 1UB6A 4UOJA 5E4IA 2EXWD 4JVPA 4O2FA 3FAWA 3QEHA 4YWGL 1F42A 4G8GB 4LLWB 4FNLL 1OTSD 1X5AA 4NT6A 1H5BA 1NFKA 4JHAL 4ZTOH 4M00A 5F9JB 1JV5A 4V1DD 1JHTA 2XICA 4K3HA 3PQYB 1U8HA 5K9JL 1CFQA 1KIQA 5D96C 5IQ9A 4WW2F 1IEHA 1CFTA 1CGSL 1I9RH 4GKNA 3I6LE 4NM4L 1WFNA 2HKFL 4MAYD 3E6FB 3VXMD 3RDTC 5I16A 2HH0L 3QXVA 4L3CB 5BV7L 1QFWL 3BAEL 1G9NH 2D7NA 1ZGLB 3MV8B 1D5MA 2DM7A 3OX8B 1NCDH 5FV1L 4NQDB 1YEDB 2ITCB 3LQZA 1XF2B 4YBLB 1I75A 1Q94B 4FQJL 4R8WH 4U1MA 2FSEA 3KWWA 4R26H 3B9KD 4IRSA 5D4QA 3SGDH 1S9XA 3ARDC 1HE7A 4GRWB 4WHDA 3CSPA 4N9GB 4JCMA 4DWHA 1IEBA 3CUPA 3K4DA 4XBPB 1FORH 3FO1A 1TNNA 4Y19A 3L3IB 4R0LB 3KPMB 3QCUH 4LSSL 2ADIA 5EU5A 1I1FA 3SBWC 2O61A 1BQHB 2R1XB 4N8CL 3MYZA 2OK0L 1XGPA 2HLFD 2IAMB 4R6UA 2Q8BH 5F7DB 1YEGL 5DUML 1NUGA 4G42A 1A1OA 3CFKB 3RVXC 2CKNA 4KRPB 5DRXB 1NAML 3G08B 5DEGA 2HWZH 2BK8A 5L8KB 2VC2H 1G7LB 4NQSB 4KHTH 2HRPL 5FO9A 1MCOH 1UJTA 3VWJC 2J8UB 3R8BB 5SWSB 4M6NH 2PO6B 1WWWX 4N0UA 4HWBL 4TSBL 4G8GD 2VLJA 4LEOB 3GSNB 4JDZA 3S97C 3B6SB 4KJPC 5MEPA 1NCCL 1H8OA 3NGBB 4TN9A 3PQYD 2Z35A 2VZ1A 3VI4E 4LCYA 3AAZB 12E8L 4HXAL 3X12B 1XIWC 4IMLA 1NC2A 5I74C 1CU4L 1PG7X 5JIKA 4QTHB 5BS0B 1YECH 2ADFL 2FR4A 1P7KA 4W6YB 4U1GB 5C07E 3MV8D 3IDYC 1B6UA 5D7SH 4NQDD 1SJXA 3IKKA 3FAXA 3WLBA 1G6RL 3ZE0F 1EXUB 3ARUA 2EH7L 3TT3L 1FAKT 4CNIA 5T3ZE 5KBNC 1EUTA 5IG7A 2WLZA 1UEMA 1W2KT 2BSTB 2FEDC 4OLWH 2BOCB 2L0DA 5KVEH 3ZE2F 5K9OB 5IFAL 1HQRB 4JLRA 4PJXF 4WY7H 3VXPA 5FB8B 3WFBH 3QEGH 4OFDA 5TDNA 3L3KB 2IAMD 5GRJL 1J0IA 4JFPB 2HFFB 4M48H 4KRPD 1HI6A 4R7NA 5EA0L 4NHUB 5F1SA 2GJJA 1NL0L 1KENL 4KK8D 3VFOB 1EO5A 3DO7A 4K94H 1P4BL 3ZE1E 5FGCE 1T0MA 4PG9B 1FNAA 4XXDB 2B1AH 3WV0A 2ITDB 2VXSL 5SWSD 1QVOA 2PO6D 2AP2A 3VG9B 3ZTNH 5KZCB 1JZ2A 4PD4J 3EJJX 4CN1A 3QO1B 1I1AC 5JA8B 5T33L 5IHZA 1FGNL 2XV6B 4NQEE 1ND0B 1TPXB 2FEEL 3SDDB 1FBIH 5F3BA 5E56A 5I1LA 4JFEE 3WXWL 2IANB 3BQUA 2YPLE 4UDUB 3RAJL 4GT7A 1FZOA 3PDDA 3SEPA 3X13A 1KIRA 3QIUC 3MV9B 2Z4QA 3V4UL 2OP4H 5BS0D 3FFDA 1RURH 4ONGH 4L8BA 1DSFL 3S3PA 3BDYL 1PW3A 1T5WA 4MYWB 5IB5A 3BD3A 1YUHB 3K2MC 4H26A 3UBXA 4NKIH 1JUFA 5DK0B 2R56H 4DN4H 2XNAA 4RNRA 3OPZL 5BV7C 4P46C 2CK0H 5JHLH 1LHZA 4G6KL 1UJ3B 2FATL 1R3HB 4QOKB 3QUXC 4GQ9H 1T4KB 1HXYA 4K8RD 5CUSL 3DVGB 4LSVL 3PHSA 3UP1A 3MRFB 3GHBH 5E95B 3VRIA 2XTJE 1KTRL 4YAQB 1V7ML 4NZRH 5JXAL 4OGYL 3K2UL 2VXTL 4KUZH 5CP3A 3FB7A 2EYTB 4POZC 4RFNC 4MJIB 3V0VA 1LK3L 1A3RH 4O02L 5F9OH 1N6VA 1T04B 1MVFA 4NRXA 3IAPA 1FLTX 1OB1A 5IWLC 3SDDD 4HKBA 5TQ0L 3D39E 2D31B 2IAND 4X6EA 3ARRA 1IGJA 3IRPX 5EORH 4GS7B 2CMRL 3MV9D 5C0AB 1YN7B 4ODVH 2PR4H 5C86A 2FH8A 5I76B 1RZ8A 4X4XA 3V6FB 5CBEB 2ORBL 1I1AA 3J8F7 4EI6A 1KCUH 4M6MH 3V5KA 1YEEL 2XKSA 3ARGB 1DUYA 2OZ4A 1U8QA 3IYLW 3O4LE 4OTXH 1ZLUK 3U1SL 4CDGC 2CKBH 1MFDH 4PJDA 5KS9E 4M6OH 4MQTB 4MDJA 4NN5C 2OXHA 5TDOA 3RWHB 3D18B 1A2YB 1BQLH 2K3TA 5F7EH 3LHPL 3RKDC 4MNQE 5KSBF 4LASL 3CLEH 4J8RB 3M8OH 5HD8C 4DVBA 3TO2A 4QOKD 4LBEA 3CFCH 3WN5A 1G7MA 1OD7A 1WIUA 1W8NA 3FKUS 4TUOA 2ZPKH 4L8DA 4A2MA 5EC1B 2HTLD 1AHWA 1Y0LA 4JO1H 3HZYA 4NGHL 1IM9A 5F96H 4F57H 1PQZB 2OM5A 2DWDA 4PJGF 1J5OH 4GRMA 1J88A 1MCDA 1XF4A 4MJID 4ODTL 2X4RA 1QZ1A 4NUJA 1JTTA 2OJZL 3MUJA 3M07A 4XCNA 3RQ3A 4MDIB 1UM6L 4D0BA 4DVRH 1I7RB 1P9MC 2R4SH 2FWOB 4MWFA 2X7LB 2R69L 3QXUA 4X7CC 3FRUB 1KN2H 5E8NA 1WTLA 3OB0K 3I2CL 2AV7B 2N7AA 3NIFF 4WUKL 3EFDL 3WUZA 3CDCA 1KJ2H 4RBPK 5C0AD 5GGVY 4WVRA 5FYJD 4KJWD 4PJCA 4LPCA 1V7NL 1IFHL 1U42A 3C8HA 3CFBB 4G8IA 3ARGD 4K3DH 3DUUB 1N0XH 5F7YC 4EXPX 4EDXA 1G7IA 4HX1B 5DQJA 1KULA 5DD5H 5FA3A 3UTSE 2HT4D 3CZJA 3BO8A 1CDHA 4ZXBC 3T0AA 2VDOH 3U30B 3FQXB 2X4NA 5IVZB 1K85A 4UT9H 4P2OC 1QBBA 5C0DA 5IMOB 5HHNB 2VE6A 4HUWA 3GMOB 2Y07L 3SOBL 4WNQA 3BSZL 3QWOB 4GW5B 35C8L 1UQSA 5DR5L 5K59E 3F7RA 3LKNA 3UC0L 4M3JA 4Z18A 4J3OC 4ZNEE 1A7PH 1IKFL 2GAZB 1H3XA 4U1JA 2F5BH 1ZEAH 1K8IA 2XZAL 2WWMC 5BVPH 2IPKA 4HW6A 1QSEE 5I1CL 3W9DB 3S7GA 3BHBB 5GS1B 4ZPTB 5TDPA 1Q0XH 1GPOL 4AEEA 3DVFA 3GI8L 5D2NE 3I6LD 1NDGB 5JIPA 1M6OA 1W0WB 4FQ2L 3MA7B 1L0YA 1P4IL 5DJAB 4ZQKA 5FCSH 1CD1A 1ZKAA 3HTLX 3P9MB 3T0WA 4OLXL 1NGZA 1T21B 4GKZB 1IGTB 1R0AH 3RGVB 5KTEH 5C07B 3MREA 2VISA 3N85H 5GISL 1OM3H 4IBLT 4ENED 1OWWA 5KVFL 2CRYA 3W5MA 3WS3B 1I9JH 1BIHA 1JGEB 3BVNA 1AQDB 4NQVB 1WUNT 4KPHL 1HXMB 1KLGB 2WM0A 4G5ZL 4QF1B 2GW5A 5EB9A 1F4YL 4MXVE 3IAQA 5C9KA 1QR1A 4NNPL 4OFIA 1BZ9B 1BAFL 1TCRA 5HDQH 1A7RH 3BZFA 4QRPA 3ARQA 5HI3D 1BOYA 1PG7H 4IRZH 5JW5B 1K4DA 2DQDH 4HIXL 3RTQA 1J86A 1LQSR 1DLHA 3S35H 1CD9B 3EUUA 1QTYT 5GIRB 3MCLH 4HK0A 4G7VH 4MGXA 3CU1A 4ZUVA 4AJ0A 3VI4F 5T3XH 3KLAB 3T65A 1YEFH 5DZNA 3MJ8A 5FGCB 1S7SA 1A5FL 2C3WA 5ADPL 3FO9B 4APQB 5L2KE 4UZGA 4F7TB 2IFFH 1KBGL 4K9EH 3JVGA 4KDWA 3E0GA 5DRWB 2C3GA 3IDMA 2UVEA 1J10A 3NH7L 4JANB 3V5DB 2JTDA 1ODAA 1CK0H 2QQKL 4NQEB 4Y5XA 2DN7A 1HEZA 4JFEB 2YPLB 1BX2A 3K8LA 3OB0H 4FQ1L 2DI9A 1Z2KA 3L3HB 4KI5C 5C6TH 2FIKB 4QXGH 3OGOE 2MJWA 3BRDA 2ZNXA 2FGWL 2VXUL 4CKVX 4I4WB 3RGVD 5C07D 2CSPA 1NGYB 3UYRL 2A1WL 5IROC 4X4ZA 4X99B 3EDKA 2OMNA 1DFBH 1KJVA 3MRDA 1VPOH 4FQQA 1A21A 1PYWB 4XB8A 3A6BH 5CEYA 2PXYC 3BZ4B 2Q7YB 5T3ZD 2DM3A 3KPPA 4JVWA 4PREB 1YNLH 3MZTA 3ZE1F 1QLRB 2BY1A 4QHMA 4X0KA 3HC3H 3OV6A 2AJZA 3MO1A 3VE0A 1D5IL 1WAAA 5GQBA 4ISVA 2DQJH 4QXTB 2WWKT 2EIEA 4D9LH 4HFWB 1S5IL 4Q6IB 1OCWL 2D3VA 3KYOA 5DUPH 3SKOA 4ALAH 2XTJB 5JW4N 2BSED 3TO4C 1P2CB 3Q48A 3W0WE 3T0EA 5EBLA 5H37H 2XI9A 5INCB 3LIZL 4RMRA 3U2SA 1F45A 1NCUA 1L4IA 5CJXC 3LEVH 1LK2B 3BP7A 3IDJB 4K7PY 1PX3A 4APQD 1N26A 3FN0H 1TZIB 5FYLH 1JJUA 4HSQA 2Y06H 3QAZC 3P0YH 1ADQA 4JKPL 3I50L 3HNVL 5DJXA 4NQED 4Z78B 3H0TA 3FQUB 4KTEL 3IJYB 2XA3A 3D39B 4K7PL 4JFED 4XNZB 2YPLD 2AK4A 5HVHC 3V7MA 2VABA 3LEXB 2P4AB 3MACH 1LO2H 4GG6F 4AEIL 5C8JB 2E7MA 1KXTB 1T0NB 4HWEH 3PWVB 4P59H 2OR9L 3VD5A 1P6AB 4XVJL 3FT2B 4Y4FA 2C1PA 4H8WC 3EZJB 3QP3A 2P43B 3PGCA 3O4LB 5DD3H 5EOCJ 2QSTA 3MLTB 5TH2B 1KC5H 4OCWL 5HHPB 5JOFB 2EXWC 4U7KA 4MNQB 4EUPH 3LS5H 1OF2B 1BLNA 3OBAA 2BNUB 2AS5M 1OTSC 5E9DE 4YNYB 4XP5H 3UTPE 1SYSB 2OSLB 1Q9LB 3ZLQC 2W60B 3LY6A 4S1SH 3F7QA 5C0GB 5GSVA 3TIDA 3MA9H 1NEZA 2XTJD 3HPLA 2UZXB 1G84A 3VGFA 2EEAA 3WDIA 2P5EE 4ODHH 5HHQA 2PCPA 4MAYC 5HI4D 4O5LL 4MXWL 2B20A 2XZCH 5E6IC 4P2RE 2O93L 3R06A 4TNVF 2FHBA 5EZLA 1XH3A 2VDQH 4XAWH 3I75A 1P7HL 3TZVD 1FL5B 3DJ9A 3W81A 3B9KC 1WZ1L 4YXHL 3RL2A 4ZTPL 4AENA 5KS9F 3D39D 1KT2B 2JJSC 1J1PH 4CGTA 2VQ1B 4F3FB 1VADB 2PW1A 3VXTA 4GH7B 4PJAA 1KCKA 2QKIB 4G8FB 2PW2A 2UYLA 1VCAA 4OQTL 4HC1L 1Q1JH 5KOVC 2HLFC 3IDGA 3HI1A 2WUBH 3V5HA 1GGCL 3WCYA 3ZKXC 3AB0B 3EOTL 3O4LD 4ZD3H 5FUZH 1F6AB 1FV1B 3UTSB 1UXWA 2UWEE 3AS0A 1T3FA 2DJ4A 2VERN 4MNQD 3F7VB 3CC5B 3V4PL 2AXHA 5JNYB 4OJFH 4TTDD 4OZIE 5A2JH 2JKXA 1KXQE 5D7IA 4DFIA 5IW1A 3O41B 4K3EH 4HGKC 2KL6A 1Q72L 4DUXA 1EVTC 3S37X 3N1PC 1IKNA 2F19L 4MCZB 1G6VK 1QFWM 2NY7L 5SV3A 4GFTB 3TH2T 3ZSTA 4PGCA 1JNLH 4JQVA 1IQWL 1F11A 1QSEB 4V1DA 1QSVA 4YBLC 4YHYB 1X6NA 3ES6A 5D7KE 2WW8A 4O2CA 3TESA 2JIXB 2ZUUA 3BH8B 3WS6A 2P24A 4I48A 2AKRA 5D2NB 3NFNA 3C6LB 1DCLA 4BH7A 3DUSB 3MRRB 4MXQD 4HUVA 3VDBA 1EHXA 3GBNH 4N5UA 5FKPA 2XQYK 1KCVL 3FO2A 4R0LC 3DBXB 3HI6L 3VG0H 5J3HD 1CXHA 1GVIA 1XF3A 4IS6A 4GMTH 4X7TA 1YEHH 2IAMC 3HC0B 3RX7A 1AO7E 3OKDB 2JK5B 4H0HB 3JWOL 3EO1B 2UZIL 1S9WA 4KRPC 4MS8D 1CS6A 4W4NA 2X4OB 4O51B 4WW2A 4JQXC 1YDPB 2HAZA 5K59F 4ZYKB 3TBTA 4XBGA 4XPBL 4KK8C 2EIDA 2PYFA 1MWAB 5IMMA 2JJSA 1R24B 5TE4H 3TYGL 4H1LA 2J1KA 3CVHL 3UTSD 1JZ3A 4Z95L 4BA8A 4PR5B 3X11A 2VZSA 5DQ9B 2PO6C 3B9AA 4QRUA 1D5BA 5DHVB 4TVPH 4JPIB 5HHVL 3VW3H 3CXHK 3WNNA 4L8SB 1ZV5A 2VDNL 1J8HB 3N1MC 4N0RA 3DXAA 5DJ2B 2BCKB 3NGBC 3QI9B 1URLA 4NZTL 2IH3A 2NLJB 3K7UA 3D69A 2P8MB 2DS4A 3KPLA 1EO8H 2EDTA 1U3HA 3FOMB 4FN0A 5FCUL 1NCWL 2XZQH 2I26N 1Z9MA 4U1GC 1MFBH 3EOYG 1OARH 1QSED 1SVCP 1A6UL 4XB7A 1VFBB 3HKFA 3A6CH 3WIHA 4RCAA 3RX8A 5ESVA 4NKMB 1MJ8L 4OV5A 3V95A 3MSPA 2JIXD 5A3ID 1CICA 4MXVF 3MV7E 3P11H 3ZKMD 2ZCLL 1OAQH 5CKAA 1DEEA 1CLYL 1CFVL 2NY6D 1IZJA 4RDQG 3VH8A 1EERB 1OLLA 2X4TA 3ARFB 4P2YA 1DQMH 2LV4A 4K8RC 3QISA 4LVNB 2IBBA 2HVKB 3UDWC 1F4XL 1LP9F 5C6PB 4K55A 3NFSL 4WJ5A 4ORGA 1G0DA 4UIKL 4Y0GA 3HMWH 5AUMB 3L3IA 2H2PD 3ZT7A 4NO5A 5DQDH 4D0DB 2YD6A 5EOQH 3EBAA 2DQUL 4WU7B 3S96B 5ETUB 3CFKA 1R5IB 3PJSA 4PYHA 1CZ8L 3VXNB 1TPXC 3QI9D 3W0WB 4JO3H 4LGRB 4WV1B 3SDDC 1G7LA 1KIUA 5C9JB 4YFDB 2QQLH 4ZFOA 3HS0A 3P4OA 4J23A 4Q0XL 3SY0A 1IMHC 4PJXA 5L2KD 2HJFB 3G6JE 3HUJE 4KQ3H 1AGBB 3RX5A 2FX9L 4LEOA 3GSNA 1BJ8A 2J88L 1CFNB 4R9HA 4XMPH 1A6TB 4MA8L 3DX8B 4W4OA 3MJ9A 1K6QH 4MHHG 2WQ8A 1UZ8B 3HAEB 4KUCF 2J2ZA 5HXMA 3L6FB 2I9TB 2XN9A 3MLYL 3AAZA 3QG7H 5FO7B 5BQ7A 3PHQB 2E27H 5GS2D 3L5HA 4QTHA 3RVWD 4Y7MA 4WUUE 2X4UB 3ARFD 1UJ3C 4XNYL 3GJEB 3WHE1 4Z7WE 3LB6D 4EBQL 4U6HA 3E3QC 5BRZE 4HT1H 3E1F1 4KMTH 4NP4L 3MLPA 4HJGA 2BVOA 4JFZH 5E2TL 1CQKA 4HFUL 43CAB 1E0OB 1PJ9A 2BSTA 2BOCA 1CDJA 2HTLC 1F3JA 3EDJA 4PUBH 4XZUA 2Z8VC 2DYPB 2EDXA 3C08L 4W70A 4RMVA 1HHGB 3QNZB 1Z9LA 4FFVD 1KEGL 3H9HA 5E9DB 1LDPH 1M7XA 1RVFH 3VFVA 4G6ML 5C0CE 4JFPA 4PRHE 1ZHLB 2HFFA 1I3GL 1J1XL 2WIIB 4I77H 3W0WD 1T7XA 2P5EB 2XWJB 3QUMB 5T3ZL 2HN7B 3VFOA 4CADB 4AQOA 3TYFB 4P2RB 4WI5A 4GS7C 4PG9A 2BX5A 2NY0B 1J11A 4XXDA 1D5ZB 3U4EB 3ZSSA 3BESR 2ZG2A 4KJWC 4WI7A 1A22B 4U6XA 2NCMA 4Y2DA 5C2BH 3KPQA 4PY7A 1ZT7A 2CGRH 3ARGC 1MCWW 5EBGA 2DWEA 2WWKO 3I84A 4XRCB 5C2UB 4ODWB 2HT3D 3QXAB 3QIBB 4XCFH 2IANA 2HT4C 5IBUB 2AI0H 3D0VB 3BE1H 4WI3A 1BVZA 3IDXL 3RPKA 4OLZL 4ONFL 1Q0YL 1TVHB 2OCFD 4MJ5A 1YEJL 5E2VL 3PP4H 4X5XB 1ITCA 3MOAH 4Y8AA 3DTXB 4YLQT 1J18A 2ZCHL 5AZEH 4OZFA 4YFLF 4FZEH 5D72L 4S0TD 1QUNA 5AAWA 1AR1D 1WICA 3ALWA 2ENSA 5F6IB 2H32B 5BO1H 2UWEB 2P46B 3D6GA 5J6HA 4OLUL 2DYPD 4HF5L 2CUMA 4DN3H 2IBZX 5TF0A 1S7TB 4HWUA 5E9DD 3IFPA 4OZIB 1R3HA 3BT2L 3UTPD 1WK0A 1X7QB 5AWNL 1JGDA 2BY3A 4HDIA 1QFUH 2G2RB 1HWHB 3BDBA 5CP3H 1U95B 3C6SB 1HSAA 2P5ED 4EZMA 4UQ2A 4IEFB 5KSBA 4H5SA 2HYMA 4P2RD 4OB5H 2X4PB 1OSZA 2NY0D 3NIGE 3TGXA 4HS8H 3D2UB 3VI3F 4HLZH 4ENEC 5SX4I 4M9OA 1U2HA 2NTSP 1KELH 3B2VH 2YD9A 1FL3B 1SEQL 1YMHA 4PRBB 5F44A 4F7EA 1KPVB 2ZCKH 1TVBA 2RCSL 1CYGA 4J6RH 1XR8A 4M61B 1ZS8B 3E2HB 3EFFB 3QIBD 2WAHA 3EJYC 1KEML 3KHOA 5C0AA 4NJAH 2OZ4H 1M05B 1FIGL 2XQBH 3UZEA 3U30C 4PJGA 1R5VB 1RIVH 3OJMB 1J9CT 2W65A 5DHXB 4OZIF 4OM0H 3ARGA 3PWUA 2FJFA 5D9SA 1AO7B 1WCQA 3LKQB 1TIUA 5F7FA 3GGWB 1C16B 4PLKC 1A6VL 1F90H 2OTPA 3C5SA 3HE6C 1GZQA 4GBXC 3EHBD 3V52H 1UH3A 3WKML 1EEZA 3OG6B 3VMNA 3ALPA 1GCFA 3EOBA 2XWTB 1I9EA 2CUIA 3FOLB 3BKJL 2XKNA 1HYSC 5CEXA 1NGQL 5FK9B 1DZBA 4R4FL 1T83C 5F1NB 5GS1C 4JM2C 4WI8A 5DRZB 3UO1L 1WC7B 4L3AA 1P1ZA 4WWKB 4ZO7A 4YH6A 4P4KB 3OQ3B 2DQGL 1PQZA 2WBKA 1MI5E 3AU1B 2CDEB 3PG2A 3RGVC 1BQUA 5CBAA 3D2UD 3SE3C 4MAUL 1WQVT 1J1OL 1FVEA 2BVTA 2QSQA 4YDIH 4I8DA 1RMFH 2IH1A 4HEME 1JWMB 4W68A 4MDIA 5D7KD 2Q87A 4NWTL 2C9AA 4KK5C 1AGFA 2FWOA 3IXAB 2X7LA 1N6QL 2B1HH 4BFBD 4NHCH 3MV7B 2DLTA 3O3DB 4Z7VF 3BZEB 1EPFA 3H7LA 4EI5B 2APFA 2Z8WC 4HS6B 5IHUL 4QCIB 1WFUA 4FFYH 4RISL 5IFHL 3TWCH 5FA4A 1AO7D 4CW1B 3EYQD 4YPJA 2JCCE 1NJ9B 5BOPA 3DVNA 4MA3B 2ARJQ 3V4VH 4DJMA 5A2KH 2VR4A 4U2ZA 3SE8L 4YFEA 1JPTH 4APQC 1KNOA 3NCMA 1NKRA 2LU4A 3FB6B 3IT8D 3SHSA 5AYQA 4QHLB 4D94A 4ZO9A 5IVZA 4NQCB 1QHPA 4UV4L 1RULL 1LO0H 1W72L 4P2QA 3GSQB 4HBCH 4LP4A 1UCTA 3DX6B 2FJGA 2YRZA 5AD0B 3WNPA 1QA9A 4WWKD 1UWGH 3MGTB 3AS2A 4FOMA 5I17B 3GO1L 5IFJA 4P4KD 5EDXA 4NDMA 4YDVA 4F80A 5IT2H 1DQJB 2MCPL 4OD3L 3G6JB 3HUJB 1QNZH 3NCJL 3VXUE 4GMSH 3PXHA 2GTWA 4UBDC 1QFPA 1M4KA 3BHBA 2H6PB 2MHAB 3QZWB 2CR3A 4M93B 3U0TB 3KLSA 2YR3A 3UEZA 4DKFL 1F4WL 5DWUL 1NDGA 3MV7D 3EKCA 2DTML 3MA7A 5DJAA 1JVKA 1IAMA 2FIRT 3ULVL 1KYOK 1T21A 4GKZA 4EI5D 4WUUB 1WFOA 2QR0A 2R9HD 5TGBB 1BBJB 3K74B 3CMOH 1BJMA 4UINL 3RGHA 4AIOA 4Z7WB 4OLYL 5BRZB 2AJXH 3L3OA 1AQDA 4Z6AT 4ELME 5DD1H 3U0PA 1IGML 4U3CA 2XTJC 1I7UB 3BUYA 1ETZA 3GJFA 1R3IL 3VGDA 5HI4C 2XOTA 2Y36L 2JELH 5FO8B 5DMGD 1N0LA 1HH6A 1FGVL 2D4DA 2P7TB 3S36L 3O3AB 4DAGH 4F15B 1MCPH 4WGWB 5C0CB 4UILH 1GSMA 4PRHB 4BZ1L 3KHQA 3T4YB 2YD5A 1YYMH 4UTBL 3TA3B 1P69B 5GIRA 1NEUA 1BD2E 2J4WL 3OKLA 3ULSB 4XNZC 4Y4KB 4PGBA 2OJEB 4OKDA 3LD8B 4JZJA 5I19L 1TLKA 1N4XL 4RX4D 5IF0B 4APQA 2DMBA 4JPVL 1FN4B 1RJYB 4IRJD 4JANA 3V5DA 5JZ7D 2Y5EA 4PJ7E 4U1NA 1I7TB 3FL7A 1EV2E 5EPMA 5TFSL 3HZVA 1ZSDB 2D7QA 2BNRE 1E4JA 3L3HA 2FIKA 3CFEA 1KTLB 5J4MA 2NZ9D 4ODBD 5J7CC 4LPXA 4B5EA 2W91A 1TQBB 3GB7B 4TVSa 3L7FA 1QFOA 3FQNB 4WUUD 4TTDC 1WBZB 2A38A 3HNSH 1RUKL 4HIHB 5DYOA 3REVB 4HMDA 1C08B 1S7QB 4M8QB 5BRZD 1T80A 2R1YB 5CD3B 3IXTA 4X7DC 2JJUA 1BVLB 4LSQH 1PYWA 4JY6A 2Q7YA 4MD4A 1I8LC 1JPGB 1X9QA 3SGEH 2VXVH 5D7LE 4XNQA 5DK2B 3TJEH 4GG6A 5ENWA 3JV5A 4U2YA 1XEDA 5IB2B 3MLUH 5HPMB 4E0RA 4YHOL 3O0RH 1DBBH 3RWJB 5C0CD 4PRHD 4Q6IA 4HIIA 5FYLE 1LEIA 4FQCH 3TA3D 1G7JB 4I3RL 2YEZA 3CFJA 4WIQA 1EO7A 3HMXA 3QXDB 3ARYA 4MXQC 3TBVB 4MQXD 1TJHH 4Y4KD 3VGBA 1BZ7B 5BCAA 4XPAL 8CGTA 1KUMA 3T3ME 5SWQB 1D6VH 3IDJA 2B8OT 1I8MA 5J3HC 1RK0B 2H1PL 5DLMH 2N1KA 4OF8A 4XWGH 5CJOH 3TZVA 2F15A 4HKXA 1EHAA 4MS8C 1Q38A 3AB0C 4K3GA 2D7PA 1FRGL 1J87A 1OW0C 4Z0XA 4BM7A 5I9QC 1GOFA 3MRQB 3SKJL 2A6KA 3RI5K 4IMKC 1MPAL 5C8JA 4S1RL 2VN4A 3L5XL 3PWVA 4E9LA 4RMTA 1FNFA 3UZQA 1FJ1B 2IQ9H 4F7MA 1DBKH 5EU6E 5JLZB 5DC9B 1L7IL 1TNMA 2NY3C 5K33A 3CX5K 5KS9A 1F6FB 1X5HA 1YY8B 5FKAA 4LCWE 3RP1A 4BZYA 5C0RL 4YHZH 1JPFA 5I1AA 1Z5LA 5JOFA 1LEGB 2CIKB 4UIMA 3ULVC 4MNQA 1CCZA 5A2IH 5IMLA 2YUVA 5EO1A 1BOGA 2FBJL 3NIGF 5I1JL 5LJYH 3L3GB 3FQWA 3GIZH 3STBA 2OSLA 1BIIB 1Q9LA 4OGXH 2FHFA 5C0GA 1QQDA 4HAGA 4YHYC 4PS4L 3WJLC 1Q9KA 3SQOH 1T1WB 5A3IC 3ZYOA 5D2NC 3C6LC 5HYQB 3ZKMC 2WANA 4N90E 3OAUL 2EDBA 1FZKA 3LRSB 4M62H 1MI5B 4LEXH 2MKWA 5GJSH 1E4KC 4PJ5E 5HJ3B 5BVJB 5GGVH 4YBHA 3AC0A 3MR9A 1KJ2B 3DV6B 3UYPA 4CBPA 3RVTD 3G5VB 2QHRL 4HD9A 4A2LA 1NBYB 2AGJH 2X2YA 2CD0A 3EOAB 3TCXA 1KT2A 3VWKA 3QUML 5AYUH 5A2FA 2H2PC 5JR1H 2IGFL 3PNWA 4H25B 5F1IB 3RPIB 1G6RA 2BFVH 4ZFZA 4Q9RL 1G9ML 2BSSA 3ZT6A 3T3PE 1HQ4A 5L2JA 2V2XA 4L8SC 4ZDHB 3D9AL 4C4KT 4PD4K 3QR2A 2JCCB 4NNXB 1SY6A 1HKFA 3QI9C 3A67L 4NRZA 2IQAB 1JZ8A 1TXKA 3DROB 5A2LH 1N64L 4OSUL 5HGDA 4B0MM 1VEPA 4X8XA 1TTUA 4J1UA 3FO0H 1CTOA 1FFQA 1OAKL 2WBWB 2F5AH 4Q7DA 4Q74A 2OL3L 2YPKB 3I02B 4UT6L 4Q9CA 1NMBH 5ITFB 1RZ7H 1MHPH 1MAMH 2ZKHH 3U4BH 2ID5A 3WLWD 1GOGA 3O41A 4H88L 2YUZA 5FM5O 32C2B 1DEDA 5GRYA 1R3JB 2RHEA 4ZNEA 2MTPA 5FECA 4OZ4B 2YK1H 3RVWC 1F4AA 1MI5D 4O9HH 4M7ZB 3O8XB 4BH8A 3ARFC 4ZOBA 3VXUB 1B4JL 1QSEA 4L3EE 4YE4L 1WBXA 1E4WL 3LKOB 1OGAA 3PIQA 3LB6C 4LVNC 1S9YB 4C83B 5L6YL 2AV1B 1KFAL 2E7LC 2JJTC 5I30L 3U36A 2JCCF 3FRPA 1D9KB 5CAYB 5LQBL 4PPTA 5FYKE 1WEJL 2P45B 1GAFL 1NFIB 4I3SH 4ZAKB 2DOCA 1A3QA 3WL9B 4FFVC 5J06A 1E4KA 5DD6B 5IMKB 3IF1B 1Z3GH 5FUOH 1BFOB 4JPWL 5C1MB 3N9GH 3C8KA 5GPRA 5GGTH 3OKDA 3ULUE 4YIQB 4ELMB 4G7YH 4JN2A 1JFQL 4H1LH 4YHMH 3U46B 5B39B 1IL1A 1ACYL 2X4OA 2W9DL 5I8KH 1V3MA 5F7WC 5ERWB 4LQFH 4WV1C 3KPNB 3KPOB 5C70A 3LPWA 3F65A 3M1BA 4U3HA 1P5VA 3BEVB 4IOIB 5DQ9A 3MNVA 3TN0B 2KUTA 5LBSH 4HPYH 4KVNH 1Q8MA 2NQCA 4R3SA 2I25N 1LP9A 2EC8A 1VSCA 1BGXH 2OX5A 3MUHL 3QNYB 2HT3C 1BD2B 4KU1A 5I1KH 5LVEA 2NLJA 3PDOB 1WZLA 2HFTA 1T2JA 1SJHB 4H20H 1GIGH 1QRNA 4X7SL 4EDWH 4YDKL 4KAQH 5L2KA 1DBJL 1DL7H 2EDHA 4TPRL 5B3NA 3GMRA 3FT3A 3QO0A 3O8XD 3VXUD 5FDWA 4XMLL 5L7XL 2AQ1A 2BVYA 1I8IB 1DLFH 1VFBA 1PSKH 2GITA 4PJ7B 4X80H 5B3JF 1XF5B 2BVQA 4ELMF 1T89C 1AR1C 2H45A 5T5FL 2A77H 1D9KD 4LSUH 1XT5A 1ZHKB 2BNRB 4ZTOL 1N2RA 1T22B 1TFHA 5A43C 4RGOH 4HS3B 4ZAKD 1FO0A 4QRQB 4RIRB 3GSWB 4LLQB 1UFUA 3CX2A 1I9RL 2C1OB 1G7HA 5EBMB 3U7WH 2BOBB 3GSOB 4Y5YA 4BQ9A 3BGFB 4UQ3B 3KNBB 2HVKA 3TLRA 1MCQA 1G9NL 4X8JA 3VGEA 5HBBA 2DQCH 1D5XB 4HG4J 2A6JB 1NCDL 3GRWH 4LOUD 3MBEB 4XPTH 5D7LB 3QIWB 4R8WL 1EHLH 1YEIH 1CDIA 4R26L 3SPVA 4EIGB 3ETBF 4N0UE 2HT2D 1DQQB 1G9MC 2VLJE 3TN0D 2VAJA 2EYRB 3TEUA 5IEHB 1FORL 1U8IA 2EDWA 1VERA 4IHOB 4OKVB 1R5IA 3QCUL 4NCC1 1MLCA 1KCRH 2V5TA 3VXNA 3P9LA 1BD2D 1CFBA 3W0WA 1WT5C 1OGTB 2W9EH 2Q8BL 5DS8B 3PGFH 5EU3A 3OJ2C 3RNKA 5LGJB 5IJKA 3IETB 4HQQH 4EKXA 3GSNH 3GSVB 2HWZL 2VC2L 3MJ9H 3GSRB 4KHTL 1MCOL 1NDMA 1NH6A 1TTGA 1OAUH 5D7JA 2DLEA 5E8OB 4DKEH 5JXED 4M02A 1L7TH 3NZHH 1UH2A 1EJOH 5F6IC 1UWXK 3EHBC 3UTZB 2BNRD 2EKSB 5E2WH 1M7IA 4PJ8B 3G5XB 4TUKH 2D0GA 2FL5A 4MZ2A 3OKOB 1AJ7H 4YGVB 4LKXB 3MUGB 3JV0A 1B0GB 1P5UA 1FFOB 3O3BB 1G7PA 3ZKQD 5EU6B 3WFDH 4KROB 4PLJD 5IVNA 1MHCB 1YECL 43CAA 2D7TH 4LCWB 2D0FA 3M17A 3D0LA 2X4SA 1MNUH 5D7SL 3MRBB 3MBED 5D71H 5D7LD 3HN3A 1T5XB 4ZPVB 1XMWA 3QIWD 1JE6A 1WWBX 1HHGA 4K8RH 4X4YA 1WCBA 3JTSA 1RHFA 4QY8B 3PV7A 5GGRB 4OLWL 5GXBB 5KVEL 5KVGH 2XWBB 4GKSB 3JV6B 4WI6A 4U1IB 4X6FB 2W59A 3CGTA 3LS4H 3MRLB 1MFAH 5FYLD 4WY7L 5F9WB 1UXSA 2VIRB 2VKWA 3WYRA 1FFNB 3E2HC 3JV4B 3WFBL 3QEGL 7FABH 2P5EA 4FQXB 4FQIH 4R2GB 4M48L 4XCCH 4PJBE 4XP1H 1KB5A 2WP3O 1CN4A 1I7ZB 5IB3B 4PJ5B 2I9LA 3IFOA 4YQXH 2R4RH 2D03H 3NCCB 5AEAA 2JB6B 4ODXA 2C7UA 1CD8A 4K94L 4KGLA 4Z7OF 4I0PB 2B1AL 3QHFH 4NNYA 3EYQC 3I6KA 4XRCA 4ODWA 3ZTNL 4G8EB 1U91A 3QIBA 2R15A 3F7YA 3D0VA 3SCMB 2YUWA 2R2HA 1L6ZA 4PJ8D 1Q9OB 1RFDH 3QUKA 5DVKA 2YD7A 3CVIH 1FBIL 1CG9A 3HRPA 1BZQK 5CJBA 4JDTH 3OL2A 3O11B 3SDAB 43C9B 3C2AH 3BH9B 4KDTA 4QRTB 1WGOA 4L5FH 3HZKB 3KPRE 3SDCB 2OP4L 4KC3B 5EU6D 1T1YA 3HR5B 1IC4L 1T1ZB 3H2WA 3H7BB 4KROD 4LARH 1BMGA 5LGHH 1RURL 4ONGL 1MFEH 4LLVB 4WWKC 3LKSA 1RUMH 4LCWD 4MSWA 3MRHA 4HJJH 3S4SA 4P4KC 5D1XB 4ZS6D 4NKIL 3LH2H 2R56L 4DN4L 1IM3A 4OZIA 4HV8A 4XH2B 2CK0L 5JHLL 1QHOA 2Q1EA 4XP6H 2ESVA 1F58H 2EIZA 2X9YA 3T8XB 3H3KA 4PGDB 1NGWA 3K3QA 4GQ9L 2R39A 4C58B 3REWB 1FFPB 3K80A 4N90D 3VRJA 3FN9A 3GHBL 3DX9B 1CR9H 4R2GD 4U6YA 1ONQB 3C60B 5F6HJ 5IVOA 3B3IB 4EI5C 2R9HC 5DDHA 4J3WA 4PJ5D 3RKPA 4AG4H 4LKCB 1KACB 4L3EB 2VL5A 5J1TC 4CVWA 1XR9B 2A74B 4PRBA 1CDUA 4I0PD 4XX1E 2GFBA 3NPZB 2Z31B 4PJDE 1UWXH 4HH9A 4PRNB 5FYJH 5H35B 4Z77B 1A3RL 4ACPA 1UM5H 2CDFA 5JUEH 5F9OL 1OAYH 4QXUH 4PFEA 5DMGC 1CE6B 2HG5B 2AJ3A 3RWDB 2YBRB 3SDAD 5A40E 5EORL 2ZOLA 1ZA3A 2ICWA 3WEXA 1AO7A 2Y7QA 3LKQA 1J0YA 4ODVL 2PR4L 5D1QB 3N50A 5I75B 1FCGA 2ILLA 3SDCD 5F9AC 4JGMA 3P73A 4U6VH 4Z7VA 1KCUL 4M6ML 4EQ3A 4KRMB 1HNGA 1IZKA 5AAMA 3PWJA 1QSFA 3S5LG 2BC4B 1UB6B 2FJHA 1KG0B 1YPZA 5ICYA 4O2FB 4OTXL 5F7NC 1MSPA 2R1WA 3QEHB 2CKBL 1MFDL 4BFIA 4M6OL 5D1XD 5F7MC 4NT6B 4M6AA 1H5BB 1MRCH 1JV5B 1BQLL 1JHTB 5F7EL 5JZ7C 3DX7A 3PL6A 3BN3B 5H37G 1CXKA 3CLEL 3WHE0 3OG4B 1RK1A 3M8OL 4M93C 1MCBA 5DRZA 4C4KO 1KIQB 4NBZB 5IQ9B 1RHHA 5DJCB 1JYWA 4GKNB 3B83A 1SVZA 3GZKA 3CFCL 4LIQE 4P4KA 2NZ9C 3LMJH 5I16B 1KGCE 1MCRA 3BOVA 1DQLH 3RZCB 3C60D 5LXGH 1D5MB 4PJCE 2ZPKL 1C12A 1Y6MR 4Z7UA 3VA6A 1AKJA 3LQZB 2PTTA 4L3ED 4JO1L 2I07A 3EW3B 4U1MB 5F96L 2FSEB 3KWWB 4F57L 3SGKC 3ULUF 1S9XB 2CLVA 1J5OL 1X5YA 2Z31D 3WD5H 5HGBB 5FYKD 3O3DA 4HAFA 1IEBB 1OP9A 3CUPB 3FO1B 5GHWH 3TVMB 3OJVC 5DEFA 5GRZA 5J6GA 4DVRL 1S5HA 1DN2A 2R4SL 5EU5B 1I1FB 2O61B 4KZDH 1OWRM 1H9VA 3O6MH 2HA1A 1XGPB 1OAXH 4LK4A 4F15C 1KN2L 4LDOB 1MY5A 4G42B 1A1OB 2X89A 5DC0A 1KJ2L 2DDQH 2ICES 3ULUD 1CGYA 5DEGB 5D1QD 3TA3C 4YK4B 3CDFA 2YN5A 4EUPG 4OCNC 5FO9B 4Y4KC 4K3DL 3LD8C 1I3VA 1N0XL 3FMGH 3DGCR 1AXTH 5DJDA 2M2DA 4N0UB 4GXVH 1PFCA 2VLJB 3QYCA 2ZOKA 4GAJH 5ICZA 5DD5L 3LN5B 4JDZB 1T2XA 1UCBH 1TCMA 2VDOL 1NLBH 5MEPB 3OR7A 4JRYA 4R90H 2GIYA 1JYVA 3BJLA 3ARBD 5M94B 1P4LA 3DX6A 3DLQR 1UA6H 3SN6N 4IMLB 1NC2B 4YHNA 5DFVD 2APXA 5FAAA 2FR4B 1GHFH 3RZCD 1JHKH 4IRJA 3AY4C 1A7PL 5FGSA 1PG7W 2H6PA 2V17H 2MHAA 3QZWA 3Q5YA 2F5BL 4WFGE 1ZEAL 3U0TA 3QQ9C 3TH3T 3TIEB 4BQ6A 4CNIB 4HWZA 5BVPL 1KCSH 5IG7B 2IF7A 5ESAA 4XT1C 5T5NG 2ADJA 1A14H 4OQTA 3SKUD 2YKLH 1BBDH 4HGWA 4XPFH 3TVMD 1ZA6A 1Q0XL 4F58H 4NCC2 5IEKA 4QRPE 2YUXA 4WUUA 1DANU 5JIIA 1MHHA 3RA7H 3UPCA 4FG6C 4ESKA 5TDNB 1I9IH 3GJFH 1CLZH 2EDFA 3FZUD 4LVEA 4ONOA 4YC2B 3L9RA 3UAJD 1HI6B 5KOMC 1R0AL 1TZGL 5KTEL 3N85L 4JY5H 1OM3L 2XRAH 4XVTH 5F21B 1I9JL 2H26A 1T0MB 5KAQF 1QVOB 3MUY1 3Q5TA 3NBNA 2VLJD 2JB5H 4YXLH 2VOTA 5H94B 2OBGA 5IHZB 5C0CA 1EFXA 3O2VH 4PRHA 1K2DA 5HDLA 5HDQL 1A7RL 3T4YA 3RVTC 1INEH 2VITA 3TA3A 1PY4A 1PG7L 5F3BB 2Y6SC 5I1LB 4IRZL 2DQDL 3BQUB 1Z0NA 4RMSA 4Y4KA 1FZOB 3X13B 5I0ZA 1KIRB 1NC2D 2Z4QB 3SQBA 4LHUA 4U1HA 3S35L 4A6YA 3MCLL 3MRMA 3ROOA 2VO5A 5JDSA 5T3XL 4L8BB 4MD0A 2AABH 1YEFL 1FN4A 5CINH 3NAAH 4LF3A 2IFFL 4K9EL 2LAGB 4P9MH 4H26B 4HHAA 1JUFB 4QLRA 2XNAB 4RNRB 1F2QA 5CCKH 4XNUH 3WUWB 1QYGH 4X9HA 3GB7A 1X5FA 4DCQA 4ZUTB 1WAAE 4KGJA 4P49A 1FG2A 1ORQA 5DC4B 3STZA 3DMMB 5C6TL 5LGKA 3NCFB 3FT4A 1A4JB 3O2WH 2HKHH 2R1YA 3WLWC 1ES0A 2VZVA 3CVHA 5CZVH 5BZDA 3VRIB 5CD3A 2MMXA 2NPLX 1BQSA 3T0EE 5I1EH 5CIPA 4S1QH 2CRMA 1XGTB 2BY2A 2DKUA 2PKDA 4HK3J 1D7FA 1DFBL 3FB7B 4NQXB 1G7QA 4WHCA 1VPOL 4PJBF 1BVKA 3A6BL 1IC7H 5CEZH 3V0VB 1S7UA 3GSXA 1YNLL 3HMXH 4JCLA 4CRPA 4NRXB 4LCUB 3HC3L 2Z92B 2EE3A 1OB1B 4RGNE 2VR5A 4HKBB 4CU7A 1NSNH 3EYOA 1JZ6A 3BQUD 4JM4H 4X6EB 2ADGA 1KJMA 2DQJL 1IGJB 4MD5A 2I27N 3B9VA 4D9LL 4P57B 4Y4HA 3BP4B 5SWQA 5DUPL 4ALAL 1HHKA 1HHIA 1RZ8B 4PJ9B 4X4XB 1ZOXA 3V5KB 5L9DH 1U8QB 2E9BA 3LEVL 2VL4A 2OI9B 4S1DC 1ZANH 5D5MF 2DF3A 3FN0L 4NM8H 4PJDB 2YC1A 5FYLL 2LVEA 3D87B 4MDJB 1MCEA 5H8DA 5TDOB 2Y06L 2YZ8A 3P0YL 2NXYB 3BWUC 4XAKE 3MRQA 1I85A 1FH5H 2OMBA 4DVBB 3TO2B 4GLRI 2Y72A 1PBYA 3DMMD 4LBEB 5F1KC 5DMKA 3WN5B 3MACL 1LO2L 1JMZA 1MIEH 3KPRD 4U33A 2OK0H 4LSRH 2OQJA 4HWEL 1GJIA 4P59L 4TUOB 3MFFA 4L8DB 5FF6B 1AHWB 1Y0LB 1WF5A 3HZYB 1LEGA 1IM9B 3FN3A 4NUGL 5MP6H 5DD3L 3O81A 4G9DA 5TF1H 1N3NA 2DWDB 3IJHA 1KC5L 4GRMB 3ZHLA 4M7ZC 1XF4B 3O8XC 2X4RB 4OF0A 4NUJB 4XCNB 3LS5L 2VN7A 2VDMH 4H0GA 4MWFB 5I1GH 3HE7B 1E27B 4PJDF 1D9KC 4QTIL 4XP5L 2Y1VA 5E8NB 4S1SL 1S78D 1V3LA 3MA9L 2BJMH 4L8CB 3EYVA 2DQEH 1MI5A 4ZSOA 2LABA 4PJAE 4PJCB 4PJ9D 4ODHL 3AXLA 3X14A 4G8IB 5A1AA 3DV6A 2XZCL 1GOHA 5K9KB 4KKAD 1PGRB 3T4AA 1JGLH 1G7IB 4FS0A 3QQ3B 2VDQL 5DQJB 4XAWL 5FA3B 5DO2D 3BO8B 2NXYD 1NBZA 4ZFFB 1CT8B 3V6OA 4L4TA 1U8MA 2BMKA 3JWDC 2HT2C 4KVCH 2X4NB 3RY5A 4PV8B 3TN0C 1JF1A 1SY6H 2Q8AH 25C8H 5C0DB 1J1PL 3CD4A 3SE4C 4ZDHA 1EX0A 3G6AB 2VE6B 3FQTA 1DVFB 2W9LA 3MRKA 4HUWB 4K9EC 4X7EC 4WNQB 1UQSB 1I3RA 1Q1JL 3LKNB 2CK2A 2WUBL 5C0BA 1RU9H 4U1JB 1IM9D 4XP4H 1MCJA 2YZ1A 4ZD3L 1HNFA 3R0MA 3STLA 1KENH 1K8IB 5FUZL 3VJ6A 1CE1H 1ZMYA 4UOW0 2YPKA 1SHMA 2IPKB 2FX7H 4DUVA 1C7SA 1PZ5A 2A6DA 5TDPB 4EVNB 1VESA 4M43H 3QA3A 5JXEC 2EDKA 5EU7C 4OJFL 3TNNB 3HE7D 5BXFA 2A0LD 4JEGB 1M6OB 2NR6D 5DJ6A 2WSKA 2V2WB 1CD1B 3MJGX 1NGZB 5ID0B 1CXIA 3OKEB 2DMKA 1KGCD 4K3EL 5DHYA 4QRRA 5I71B 1O7VA 3MREB 2VISB 2ICCA 3VXUA 4UV7H 2RGSA 4X98B 3BEWA 3BGFC 3LKOA 3BVNB 1NPUA 5CMAB 4C57C 4PLJC 3U0WH 1JNLL 4RSVA 3VFWB 5JORA 4UB0H 4QHNA 1H15A 5C0JA 3MBEC 3QIWC 2ZSVA 1TCRB 4ZAKA 4R4BA 3IGAA 3BZFB 4WFFE 4QRPB 3I3BA 3UBXG 3ZKND 2AEPH 1K4DB 3E8UH 4NOFA 2BY0A 1MUJA 5IW3A 3GBNL 3RTQB 4AYFA 1JWSA 1DLHB 4Z76A 1RZKC 1MWAH 3CDGA 3DXAE 4YIQA 1DVFD 4ELMA 1SEBA 3U46A 3VG0L 1BJ1J 1OTUD 4ZUVB 4ZOAA 5ERWA 1REIA 4GMTL 4QEGA 3T65B 1N8ZB 2LU3A 3IU3A 1AD9B 4K7PX 1YEHL 3MJ8B 1AP2A 1S7SB 4PV9A 3QUYA 2NZIA 4LCIH 5KN5B 4IOIA 4XHQA 3OWEA 5JXAH 5EFIA 1JNNH 3IDMB 3MZGB 1X5LA 1MHEA 4LVHB 4JFFA 3QEUA 1S9KC 5J9PA 4Y5XB 1HEZB 3PDOA 1BX2B 1OHQA 4TVPL 3VW3L 3VU2A 4EOWH 1ZVYA 3MRJA 3QHTC 4O2EA 3AVEA 4HLZG 5J1SC 4PJ8C 2MCG1 1NMCB 1QR4A 2ZUTA 2CMRH 4KFZC 3HLAA 1AI1H 5FV2A 1GH7A 4LFHG 3KPTA 1EO8L 1H3TA 1KJVB 2CRIA 3IRZA 4JVUA 1XF5A 2W92A 3MRDB 4KROC 4WFGD 3S8WA 2XPGB 4FQQB 5GS2H 1NFDF 1FO0H 2XZQL 5CEYB 3IDNB 1MFBL 3W2DH 4OD1H 1OARL 3KPPB 3IAGC 2BNRA 4YZFE 3W11D 3RY4A 4LCCC 1B0RB 4X0KB 3A6CL 4QRQA 1S8DB 4QRPD 2VTFA 2AJZB 1T6WA 3VE0B 4ZS6C 4XXCC 5DJ8A 3QCVH 3P11L 4ISVB 5DGRA 4WHYH 4ODUA 1OAQL 3KNBA 3RTQD 4BELD 1CL7H 3KYOB 3ZE0E 3PP3K 1F4HA 4OF7A 1D5XA 1U0QA 5F9WC 3T0EB 3JTTB 1DQML 2A73A 5D7LA 5TE7H 3U2SB 3QIWA 3D5OF 4FQXC 1OP5H 5CZKA 5C09A 2IPTH 5SV4A 3QDMA 1DQQA 2EYRA 3HMWL 4Q58C 5ID1A 4OKVA 4I0PC 3L3DB 5DJXB 5DQDL 2B4CC 3H0TB 4RGNB 2ATKA 2AXGA 5EOQL 3HPJA 2XN9E 2L7JA 5CZXD 1PAMA 2VABB 5LGJA 2Y5TA 1ZT1B 3IETA 3SCMC 2J12B 4EEEA 1XGUA 4JO3L 4M1GH 4XGZA 1YYLH 3ILQD 3HAEH 3SDAC 1QEWA 2QQLL 4Y4FB 2C1PB 2MPAH 3PGCB 4P23B 4KMLB 2Q6WA 3SDCC 3NA9H 4PG2A 3V79C 4NN7B 2ZUWA 2K7PA 1V3JA 3GMLA 4KQ3L 3MOQA 4EN3A 1XF1A 2EKSA 2PTUA 4XMPL 2FLBT 2AVGA 1K6QL 3U6RA 5JO5A 3G5XA 2YA1A 3W39B 4OCYH 5D1XC 1II4E 1MCSA 3CH1A 3ZYJA 3QRFM 4CVXA 4FABH 5HYJE 3VMPA 3TPUB 3QG7L 2GY7B 4LKXA 3MUGA 4LLUA 1FFOA 2CXKA 3GM8A 2I24N 5GSVB 5I18H 2E27L 1UWEH 2ARWA 5T1MA 2X70A 4HKZA 1NEZB 3OKNA 2ED9A 2YD1A 2PCPB 3WSQH 5HHQB 1AR2A 1NUFA 1T5XA 1ZT4A 2EXYD 2PUQT 4HT1L 4KMTL 3S88H 4QWWD 2SEBA 3R06B 1W72A 4JFZL 1U93A 3C60C 4Q6YA 3LN9A 5EZLB 5GGRA 2QHLA 4BSJA 3V9FA 2AJUH 4PUBL 5KG9B 4BK4A 3JV6A 5IP4A 1QO3A 3DIFA 2X05A 4K23H 3RL2B 4RGND 1FFNA 3JV4A 3MRCA 3QSKB 1KB5H 1RVFL 1Z0MA 1LDSA 2BNQA 3T2OA 3HFMH 3QJFA 4OZGF 2X41A 4I77L 4XPGH 4QHKI 3VXTB 4PJAB 2PW2B 2UYLB 4PJ5A 4XTRC 1BHGA 1FPTH 4U0QB 3IDGB 3HI1B 4M1CD 4K3JH 3V5HB 4Y4FD 4I0PA 4RAUB 3BKMH 3ULUC 4P23D 4OT1H 3KYAA 5D1QC 5I75C 3QULA 5C2BL 4OUOA 5HI5D 4ZMAT 1UXWB 1IAOA 2CGRL 4XAKD 4PTUB 4Y1AA 3IKCA 5GRWA 5I6XB 4U49A 3WFZA 4WEUD 3F58H 4XCFL 3AM8A 1OTTC 3O11A 2LAAA 5MI0C 1H5BC 3TC9A 43C9A 2VZTA 3WDJA 4CJ0A 2AI0L 3PP3H 5E03A 3BE1L 3QUZB 1RIHL 1ZHNA 5IW1B 1V3KA 1RJLB 3GHEH 1EEYA 3HR5A 3TFKD 3O4OC 3RNQA 1MFCH 3RWIA 4PBVC 3PP4L 2D4FA 3GK8H 3MOAL 3HA0A 5KSBE 5AZEL 4FZEL 3JUYA 3ABZA 4XHJD 1MQKH 3U83A 1T20A 5D1XA 2A6IA 4PJAF 3RZCC 5E5MA 1F11B 5BO1L 4XC3L 3HHRB 1LE5A 4XH2A 3VFGH 4JZNA 3K0WA 4JO4H 3SE9H 3ES6B 5JW4Q 4I0CC 4DN3L 1MIMH 4O2CB 5IQ7H 3T8XA 2P24B 4I48B 2AKRB 5EULV 3NFNB 1R3LA 4HUVB 4X4MA 5GRVK 5GS3A 5FKPB 5GS0D 1QFUL 3FO2B 3T04D 3TVMC 6FABH 5K9QI 4AMKH 1S7RA 4PJGE 1SYVA 5C0ND 1T2QH 4P5TB 4IS6B 4L3EA 5E1HB 1HSBB 3GSUA 5D6CA 4JRWA 1S3KH 5IUSA 1BPVA 5B38A 4OB5L 4Z7QE 1S9WB 3PHOB 3UAJC 4MB3A 1Z9SA 3S3JA 4WW2B 3FONB 4HS8L 4WHTA 2Z31A 1A64A 2EIBA 2QTEA 2YMXH 1NBVH 4YK4C 3TBTB 4XBGB 2PYFB 1MRDH 3B2VL 4H1LB 2ZJSH 1OP3K 5DJZB 4KKLD 2ZCKL 3X11B 4R97B 4HIJA 4J6RL 4MHHI 5L0QB 5D6DC 1D5BB 1UZ6E 1CBVH 3NPSB 3ARZA 5HYEA 3QUZD 4NJAL 3DXAB 2OZ4L 1KN4L 2XQBL 2YD3A 1S7VA 1RIVL 2IH3B 3D69B 1ZLVK 4OM0L 5CILH 2J7LA 1KG0A 1AGCA 3KPLB 1HIMH 1CXFA 4M9PA 4F2MB 1U3HB 1F90L 4OFKA 3FB5A 4KH2A 2E8YA 1YC8A 3V52L 1IGYB 3BD4A 3RIAK 4WO4A 1CF8H 3T1FA 3ARBA 4QT5A 3TJHC 5ESVB 5E6YA 4OV5B 5DJCA 5TQ2H 2EO1A 5DD0H 1CICB 4G3YH 1K3IA 3DRTA 1DEEB 1K4CA 1HHJB 15C8H 1BREA 2DQFA 4JO2H 2M26A 3VH8B 1AFVH 4L29B 2X4TB 3RZCA 3LKPA 4J4PA 4KQ4H 4DEPB 4LVOB 4P5TD 3NABH 1A02N 1W0VA 4XMKL 4YC2C 2R0KH 5F8QC 4WJ5B 4ORGB 5E8PA 1EZVX 5IK3B 4OAWB 2P48B 5HGBA 4KV5E 5FGBA 1VEOA 4YDIL 2BRRH 1RMFL 2JE8A 3TVMA 1MH5A 2F8XC 5F7UA 3DECA 4NO5B 4WFFD 4E5XB 1MEXH 4KXZH 1BEYH 2B1HL 4L9DA 4JFYB 4TNWK 4NHCL 5HVFB 2AQ3A 2FYYB 3GMPA 3TBSA 1PZUB 3PJSB 4P2QE 5I8OH 3DXAD 3EDFA 3OMZA 1B90A 5IB4A 5LAXA 4BJLA 2VDKH 5K93A 5E5UB 4FFYL 3BQUC 5TE6H 2P47B 2B39A 5E99H 3TWCL 4ZFOB 3WJJA 3HS0B 3P4OB 2CXGA 3SY0B 5C0EA 4PJXB 3UTOA 1U3HD 5D6DA 1CFSA 4LPYA 3V4VL 3D3VE 1MFNA 3GBMH 3LN5A 4KHXH 1MLBA 4JREB 4HIEA 3K46A 3Q6GH 1JPTL 1FL6A 4JHWH 1C7TA 2XN9B 1HDMA 1CICD 4R4ND 3NZ8B 1P6FA 5BQ7B 4YZFF 1LO0L 5I73B 4UT7H 4HBCL 3P0GB 1BF2A 4ZUWA 1UWGL 4F7CA 3DMMC 4U6HB 5GGSA 5ACMA 5IT2L 4HJGB 1TETH 4DKDC 2BVOB 3TIEA 4I3GA 1ZVSA 1QNZL 4GMSL 1OP3H 1F3JB 3OB8A 4XZUB 4DKAA 4N0YH 1IARB 1BM3H 1X4XA 4YO0A 3GKWH 3H9HB 4FQHB 3PABA 2EE9A 5HYJB 1JNHB 3VFVB 4R96A 3LQAH 3MV01 2DLHA 1C5DB 3GNMH 1ZLVH 3LCYA 4HULB 4I13B 2P8LB 3CMOL 2OL3A 3QRGH 2VLME 1S78C 2AJXL 5E94A 5DD1L 3Q3GA 2AAVA 4LLAA 3GEWB 1CLOH 1A9EB 3GKZA 4U6XB 4Y2DB 1QKZH 3KPQB 3QH3A 4PY7B 3UMTA 1ZT7B 5H94A 3BI9X 2JELL 4NC2B 1MOEA 2DWEB 4KKAC 1A6AA 2VKXA 2OI9C 2I5YL 2APWA 4A6YH 4DAGL 2XN9D 1MCPL 5DO2C 4UILL 5GSRA 2NXYC 5J89A 1J05A 1DP0A 1YYML 5HHOA 2E7HA 4PJBA 3X3GH 1WWAX 4KRLB 4G80A 1OPGH 3V7AG 5ALCH 4MJ5B 4WFEE 1YMMA 3ORJA 1HKLH 2QADB 4CU6A 4OZFB 3WN5C 3PWNA 1U3JA 4LP5A 3QFDB 2BVEA 4P3CH 4O58H 5D1ZA 1AHWC 4LNRA 3WXVH 5J6HB 3RWEA 1I4FA 5C0FA 4GG6E 4EQ2A 3WUWA 5I66B 4BSVA 2AEWA 4QYOA 4ZUTA 3IFPB 3KR3H 4H1LG 1INQB 5HYJD 3DMMA 1N5YH 1JGDB 4HDIB 1A4JA 1MJUH 3KPRA 2NXZB 5D5MA 3C5JA 5CEZE 4S11A 3HE7C 1PVHA 2A0LC 1HSAB 3HNSL 4O00A 4UQ2B 2E6QA 1JN6A 1XGTA 1U8JA 5KSBB 2WZPD 3OHXB 4H5SB 4MX7A 1O0VA 2N56A 4U05A 1OSZB 4NQXA 4FRWA 1A1NA 1TJGH 2RB8A 1O7SA 4LSQL 3OGCB 3QPQD 4Y2OA 2VXVL 4Y2DD 3I9GH 3TJEL 3GBLA 1BF8A 5KVDH 1YMHB 4F7EB 2WBJA 1TVBB 4LCUA 2FX8H 2Z92A 1XR8B 3VFUA 1V5JA 3MLUL 2R8SH 3O0RL 1DBBL 1VFMA 4FMKA 4I18A 4X9BA 4HG4K 2DQIH 3MXWH 5C0IA 4YX2H 4P57A 2V9RA 1M71A 3BP4A 3BFOA 4ZS7H 3RUGF 4FQCL 4PJGB 3EDDA 2W65B 4PJ9A 3ZKNC 1KB9J 3SKMA 3O9WA 2DI7A 1TJHL 3PWUB 2FJFB 2XACC 4HKJA 3DRQA 4POUB 4WRLA 5D9SB 4AK1A 3VH8G 1D6VL 2QADD 1OTUC 3C5SB 5C6WH 4TULH 1GZQB 1R3KB 2MQ0A 4OCMC 4OFVA 2HTKD 4NBYB 5DLML 3WBDA 2UUDK 5BZWA 3RIFK 4XWGL 1FNEA 3ISWA 5CJOL 1R6VA 3T09A 3PWPA 3HI5H 1EEZB 4JQIH 3EOBB 1UEYA 1KIPB 2XKNB 1CXEA 4ZOEA 3AS3A 5CEXB 5FOBA 3UJJH 2FCBA 1AGEA 4RMUA 5EC2A 2KPNA 4MA1B 2NXZD 1BQHG 4Q2ZA 4DOHE 1P1ZB 4JY4A 4CJ1A 4LPWA 2V7HA 4GAGH 5DFWH 1JYXA 5FF6A 3WFHA 2IQ9L 1DBKL 1NUDA 2V6HA 4YHLH 5CKGA 1GGUA 4LRIA 5I71C 2YRLA 5F71A 3PV6B 5CBAB 4YHZL 2VLKA 1EGJH 1FVEB 1W8OA 2IH1B 3E6HA 1MF2H 2X4QB 4Z7QF 5L88H 5SWZA 4LLDA 1AGFB 5IIEA 4DW2H 1H0DA 1EHNA 3HE7A 1E27A 2O5YH 3P9WB 1IC5H 3GIZL 3UX9B 3IFNH 3W11C 1G9EA 4OGXL 5B4MC 1UKSA 4L8CA 1EEQA 2X44D 5GGUA 5BOZG 5EZIH 1X5KA 4YXKH 3SQOL 1WISA 3RJDA 1PD6A 2VMFA 1A7QH 1UZ6F 3S36X 3T2QA 5FA4B 3RTQC 5K9KA 2F9BT 4M62L 4OBRA 3VD9A 4LEXL 5GJSL 3DVNB 3QQ3A 5GGVL 1GGTA 5KVMC 4XWOD 1TVDA 4ZFFA 1CT8A 2EO9A 4TOYH 3KYNA 1KNOB 3BKYH 3JVGC 4CL7A 2AGJL 4PV8A 1S7WA 5JQHC 1IRAY 4JG0H 5D96B 5AYUL 3CFIC 1ROWA 3G6AA 4LVHC 4P2QB 5JR1L 1DVFA 2APTA 1OY3B 4Y5XC 2MNUA 2BFVL 2HVJA 1IGIH 2FJGB 4JHZA 1K5NA 1QA9B 1RUPH 5CZXC 5EH1A 1YN6A 5IFJB 3BPCA 4GXUN 5J11B 4NDMB 4YDVB 1XGQA 1NMCC 2W07A 4PRDA 4X6BA 3D3VB 3ILQC 5HSFA 5EBWA 4JRXE 2GTWB 2L7UA 4L1DA 1OGAE 3FO0L 2JLLA 4MNHA 4EVNA 4H8WL 2F5AL 5CFHA 5D8JH 5MENE 4PY8I 3TNNA 1NMBL 1RI8A 3MNWA 5C3TA 1RZ7L 1MHPL 3P4MA 4C56A 1MAML 4KV5F 2ZKHL 3U4BL 2V2WA 1AH1A 4XNMA 1JWUA 2R2BA 3BKCH 3WE6A 5ID0A 3OKEA 4MNGA 2QR0B 2K1MA 5DF0A 1DE4A 4X98A 2C26A 2F8OA 3L3OB 5CMAA 2YK1L 5IOPA 3U0PB 4O9HL 2UUDH 3BUYB 3VFWA 3F6IA 1ETZB 3T0EC 3GJFB 1M1SA 1OLZA 2EXYC 3ZO0A 4ZOCA 3VA2C 5MEOB 1J0KA 4QWWC 1FVDA 4ODSH 1HH6B 4DGVH 4Z9KB 4FP8L 4D8PA 1EH9A 1TJIH 4NYLA 3O2DA 4I3SL 1JZ5A 4AM0A 1LP9E 1HCVA 3V8OA 3DETD 4P2QD 4BK5A 5DI8A 1NFDA 4RGNC 1F5WA 1Z3GL 2ED8A 3OKLB 3JWDH 5FUOL 1N8ZA 4I0KA 1AD9A 4PGBB 3N9GL 4FFZH 2R2EA 5GGTL 4Z0BH 3SGDI 5ILTH 4JZJB 2A9NH 1QRNE 5KN5A 4G7YL 4YHML 5I8KL 4BSWA 4LHQB 4LQFL 1FAIH 2VLRA 3D3VD 3T77A 1SBSH 3MLRH 4M1CC 4NBXB 3DV4B 4Y4FC 4TUJA 4P23C 2D7OA 4U1NB 5EPMB 5LBSL 2UY7A 2W0FA 3CK0H 4OGZA 3OF6A 4HPYL 4KVNL 5AG9A 3HZVB 2F54A 4NN7C 5HI5C 3RWCA 3CFEB 5F70A 3L5WA 3AS1A 5I1KL 3L7FB 1KEMH 1S7XB 5ALBH 4LSPH 5DYOB 5I8CA 2AK1L 3K4AA 4P9HC 4H20L 5D70H 1IT9H 1GIGL 4EDWL 5JW4R 4HZLA 1CWVA 3WO4B 4KAQL 1GL4B 1LVEA 4HLJA 3IXTB 1DL7L 3TFKC 3VWJD 4IJ3B 1D3CA 2XPGA 2GSIA 4Y16A 4JY6B 4MD4B 4KWUA 3IDNA 2FNBA 3F12A 4XNQB 3MRIA 1EVUA 4X6CF 2B2XH 1DLFL 2LTQB 1PSKL 4GG6B 5ENWB 4X80L 1B0RA 3MCG1 2Z91A 4X5LA 1S8DA 2A77L 4LSUL 1E28A 4MB5A 4E0RB 4FHBD 4U7SA 4CMMA 4RGOL 3CSYB 4MJ6B 4HIIB 3OXSA 4HUMB 2YD8A 2NW2B 1LEIB 3ZDZE 1KTKE 2LVCA 1A7BA 2YEZB 3CFJB 2CKBA 3NCYP 1EIBA 3U7WL 3JTTA 2DD8H 4NN6B 4MJ4A 1YNKH 4PB0H 1OAZH 4I2XA 5CSBA 5GS0C 2VLMD 2DQCL 1XCTA 4OUUA 2P8PA 3AREA 3VFPB 1I8MB 1RZKH 5C0NC 3SJVA 2AXFA 3GRWL 4XPTL 5HDOA 5F89A 5L8LB 4LPTA 3TZVB 1YEIL 4HKXB 3L3DA 4NFBA 5DMJB 2YD4A 5BV7B 5KSVA 2CJUH 1U92A 5I1IH 4Z0XB 1F97A 4IDJH 4YPGA 1ZT1A 2A6KB 1XAUA 4JPKH 1KCRL 1RZJH 3DGGA 3KPSE 4WI2A 1RZFH 5T1LA 2W9EL 1BWWA 4WFED 3PGFL 1GC1C 4HQQL 5GJTH 4U6TA 2XG5A 3GSNL 3QUZC 4F7MB 4P23A 2EDJA 1KJ3H 2RR3A 4KKNA 4LQ1A 3RL1A 5KS9B 2DMCA 3JSSA 5FKAB 1JPFB 5I1AB 4UAOB 4MLSA 1Z5LB 1IKNC 4UIMB 1OAUL 3KDMB 3FB8A 4OZGA 4DKEL 5IMLB 1L7TL 5EO1B 1BOGB 3W39A 2KZ1B 3QJHA 2DB8A 3NZHL 2FO4A 4HCRH 4JQVC 3FQWB 1EJOL 2G60H 4PLOB 3TPUA 3BRGC 5E2WL 3L3JA 1QQDB 4TUKL 3MOBH 3W5NA 1Q9KB 4DOHB 5CEZD 5CHNA 3WS6C 3MYJA 1AJ7L 4HEPG 4PJIA 1IAKB 1H3VA 1WFTA 4M8VA 3WFDL 1FZKB 4JFDA 4H0IA 4UDTA 1IGCH 2OTUB 3C9NA 2NTFA 2D7TL 1MNUL 5KG9A 2BXZA 1FG9C 5EZOH 3MR9B 5D71L 3OZ9H 5JOEA 5B8CA 4K8RL 1DANT 3SDXF 4WW2C 3RHWK 2KDGA 4J3TA 3VWKB 5GGQH 4WDIB 3LS4L 1MFAL 3PNWB 4GJTB 5F9DC 4R97C 2EDLA 3HZMA 3VI3E 1G6RB 5L0QC 2B4CH 4N68A 4ZFZB 7FABL 2BSSB 3GM0A 1HQ4B 5L2JB 4FQIL 2V2XB 3NPSC 2ZWLT 3GUTA 4RAUA 4XCCL