4WW2C

Crystal structure of human tcr alpha chain-trav21-traj8, beta chain-trbv7-8, antigen-presenting glycoprotein cd1d, and beta-2-microglobulin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
275
structure length
275
Chain Sequence
VPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atypical natural killer T-cell receptor recognition of CD1d-lipid antigens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords TCR Alpha Chain-TRAV21-TRAJ8
total genus 76
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2014-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ww2C02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4ww2C01
4JN2A 4OD2A 5INCB 2VXTL 3IAQA 3SBWC 3GKWH 2RR3A 2P5EB 4JB9L 5I1JH 3QQ9C 5T3XH 4KV5E 3BPLC 3GKZA 4EQ3A 2GIYA 2EC9U 2V5YA 1M71A 5IB1B 3MRMA 5TH2B 2A6JB 3HI1A 3RWDB 3VFUA 5TE6L 5F6HJ 3GNML 3VXQB 2V5MA 5CILL 3RWDA 3B2VL 3VFUB 3RIAF 3MLWH 3V7MA 3RVTD 2EDJA 5DJYB 4HJGB 5E2TH 5J9PA 4HFUH 1S78D 1Y0LA 2IGFL 1I1YA 1UZ8B 3VFWB 3B9KD 3F12A 4ZXBD 3WMSA 4C83B 5J0BA 4KQ3L 3ESVF 4RA3A 1J10A 2OL3A 4HXBL 4MZ3A 1DANU 1RQ5A 5JLZA 4G9FD 1Q38A 5EIIB 5B3NA 4NQUA 3RDTC 4JZNA 3WNPA 4M8QA 4XWOC 1PEWA 3QUYA 2V7HA 4HWNA 3SKJL 3H9SE 4GG6E 1EERB 1XGRB 3OJDA 1BFSA 4I0CC 4KJYA 2H8PA 3MBEA 3MYZA 3B43A 1XAUA 1P5UA 3MRPA 4NHCL 3FTGB 1MVUB 3BN9D 3GEWB 1X4YA 1AXTH 3KJ4C 4M7ZB 5K9OA 1VACB 4M62H 1DUZA 4HKJA 2WM0A 2WINB 4GG6A 2X2YA 1KJ2A 5DI8A 3BXNA 3CFBA 5B3JE 1DBJH 4ZUUA 1P6AB 3K46A 3T3PF 5DDHA 3V6ZA 2JE8A 3FKUS 4WUUA 3VFVB 1JHKH 2LFGA 4XNUL 2MPAH 1B6DA 2XYCA 1IL1A 3K2UH 1F3DH 5I8KL 3QP3A 1XZ0B 3LKNB 2VSDA 5IFHH 1ZVYA 4JLRB 5E1AB 4MA7L 1ORSB 1DQJA 4KQ4L 3QEGH 4NO2B 3ZKMC 1LEKA 5BS0B 5F44A 3MREB 4LLDA 2J8HA 3MRFB 2P45B 4GAGL 1FFOB 4WJ5B 3ZO0A 5IBTH 3P4LA 4KZDH 1F4XH 5EZLB 3L3IA 2W9DH 5H94B 4ZFZB 1FLTX 4Y5XC 5L6YL 3RY5A 3QO0B 3BE1H 2VDNL 3MODH 4G43A 4I77L 1DANT 1YNKH 4HUKB 2KKQA 4O2EB 4XMKH 3MOBH 3BDYL 4M5YH 2EDFA 3MFGB 3QI9D 2J8OA 5SX5K 4L4TD 2CIIA 1CT8B 5HJ3A 3RVWC 3SGKC 4OCSH 1KENL 2HJKB 2IPTH 5LXGL 5T3XE 3SEPA 4EBQL 4A6YH 1QBLH 2CDFB 3O2WL 4RWHA 4OZFG 3OHXB 1OQXA 2D7QA 1PJ9A 5D7JB 3ULVF 2R8SL 1WQVT 1SVZA 2ITDA 3OR6B 3LV3A 4NKIL 4S0UC 1G9EA 2VITA 4TOYL 3A6CL 2AJXH 2YXFA 4KVCH 5EOCL 4KXZH 3IDGB 4AJ0A 1ZLVH 3ZYZA 4PGZA 3LPFA 3WS3B 1ZANH 1EVTC 3KJ6H 2IADB 5FGCE 5HY9B 2Z93A 1QLFB 1SQ2N 2P8PB 2YR3A 4NKMB 4BFBD 1IQWL 4HQQH 1SBSH 2QR0B 5L2JB 4QYOB 3DJ9A 3BFOA 4OLUH 1EFQA 3PABA 3B3IB 4FMKA 2DN7A 4Z7OE 2KZWA 4UV7H 2UWEE 4RGOL 3D39E 4WUUE 4YPGA 5GGUA 1EXUB 5DWUH 5FM4A 3K1KC 4PIRF 5C07D 3RTQD 4S1QL 1J1PH 2ARWA 3QHTC 1L4IA 4Y8DC 1YEGL 1MCQA 1D9KD 5E2WL 4XAWH 1CE1H 4JRXD 3WHXB 2OS7A 1CBVL 2PO6B 3CXHJ 1TQCB 4M03A 4GFTB 5ACMA 1VESA 4HKBB 4H5SB 3TF7A 4GRMB 1QFHA 1BQHB 4UI2A 4I3SH 4RGND 2H3NB 1DQQB 4ZODA 4DTGL 1QFOA 3RPIA 3WJLC 2ADIB 4M7JL 4H1LA 4PRHA 3FO1B 1R6VA 1YUHA 4V2CB 2AJSL 3REVB 4LU5L 1JPGB 2VLKB 2DIBA 4QHUA 3FQNA 1P2CA 2GAZB 1U0QA 4M1GH 5D1XA 2DTMH 1IGIL 4MJIB 4RQQB 1PSKL 4Y0GA 1A9EA 2NY3C 4OV6F 5GS3A 1FN4B 3J8F7 3OL2A 3UDWC 2H2SC 3L7EA 4IRSC 1UB5A 4LSSH 1OY3B 4LPYA 4ALAH 4WTZG 2YKLH 3MNVA 4NQVA 5MEQA 5E8PA 2BNQE 3P4NA 3QBTB 2X70B 5LGHH 4Q9BA 1EUTA 3TJHD 3RU8H 2PO6A 2BSED 4X6DB 3PDDA 3KGRA 3A67L 3OBAA 3SKNB 4KH2A 4RDQG 4X99B 5CZKA 3ZE0F 3RDTB 4PFEA 5E99L 5LGHL 4MNGB 4S1DC 3MLTB 3NMEA 2ESVB 5FDWA 3WKMH 5FYLH 1HOCA 1DEEA 4HIEA 3K3QA 4HDIA 4WFHE 4I9WE 4JPWH 2FRGP 4V3DB 5FDWB 2VWEC 3MSPA 2YA1A 2EDLA 1WFOA 2W91A 1YMME 2YSSB 2I5YH 4G9DB 3MLPA 5E6IC 1CICA 2DQFB 1IQWH 3MV7E 4MS8D 2ZG2A 4C56B 3DX9A 1FFRA 2R39A 4TQEL 5EUKB 3C60A 5FV1L 1JK8B 5JDJA 1UQSB 3NN8B 2FX9L 2HVKA 1Q8MA 1IILE 2V7NA 4V1DE 2D7MA 1NAMB 3SGKA 4DVBB 1D5ZA 4ODWB 1HXYB 4GW1A 4PJBA 3DVNA 2DQIL 4N0UE 2FJHA 5CBAB 1HI6A 5KANG 2OZ4H 3MA9H 1LMKA 3WUWB 1A6UH 2BC4A 5GGRY 2VN4A 3EOAB 4RMVA 5E2WH 5J13C 3MRNA 1U8HB 2BCKB 5EIIA 4UBDC 5MP6L 4Z7UE 4U1MB 2OZ4A 1WFNA 1MAKA 1YEDB 5T1DH 4GBXD 2I9LA 4PJDE 1Q9LB 1NLDL 5F9JB 2V5SA 4PJ9D 4X9GA 2R4RH 3CAFA 4CGTA 3IF1A 1SEQL 1YMHB 3ARPA 4UT9H 3D1MC 4KDTC 3BWAB 4HUUB 1OT2A 2Q7YA 5E8OB 2FR4B 2J5LC 3RL1A 2JIXD 1SM3H 2G2RA 3FQXA 4P4RA 1S7TB 2G5BA 5BZDA 1N0LA 4JZJA 4AEEA 4PP1C 3I9GH 4GKSA 3MR9B 3HLAA 2QLVB 3BVNB 3WDHA 2UYLB 3MLXL 5CJOL 4O51A 4F7CB 1H0DA 1E4XI 1PX3A 4EUPH 4G59A 4JO1L 4MD5B 1JI1A 4RMTA 3BX7C 2EH7L 1AXSB 2V2XB 4LAQH 3GJFB 4MXQA 1CG9B 3RWJB 5IFAL 3TZVD 1X7QB 2NW2B 2Z31C 5EO1B 1ADQA 4ZFOA 2AKRA 4BQCA 5DRZA 1XR9A 2CSPA 4MWFB 3AREC 8CGTA 4ZFFB 1NEZA 3P77B 3WIHH 4MB4A 3W2DL 2VAJA 2IFFL 4PUBH 4X7TA 5I15H 3HZVB 4RFNC 3SCMB 4XGZA 1BVLB 2AEQL 4OV5B 1KLFA 1DLHA 1KIUA 3BUTA 4J6RH 1FVEA 2CDEB 3TWCL 3HB3D 4GAGH 2VL5B 4I9WD 4N0CD 4X6CF 4BM7A 5GZOC 4P2YA 1TZHB 1FZMA 4POZD 1KXTB 1MWAA 3U9PH 2QQLH 2HVKB 3TT3L 4AH2B 5HI4C 3OKKB 2WWKT 5K9KA 5FYJU 3X3FL 2IBGA 5IW1A 4I2XA 1Q9WB 1T1XA 1OAKH 2KZ1B 2XKNA 3KPNA 4ZFOB 4JVWA 3O0RL 1QLEL 2MTPA 3S96B 1AJ7H 2NTSP 2OI9A 4GQ9H 4HIJB 1AI1H 4KROD 1MHEB 3BP6B 2F8XC 4Y19D 2R1XA 2IADA 1I7ZB 5CGYD 1S7XB 1IAIM 3HPJB 2BSSB 3LQMA 3TLRA 5HVFB 3E6FA 5ESVA 3SQOL 4MJID 4M6OH 4KROC 3LS4L 1YN6A 3SGEH 4PGEA 3NPSB 3HAEH 1JNLH 5FHAH 1IGML 5I76B 1QFPA 1ADQL 5C3TA 1S3KH 3BKMH 3NCFB 1TJGL 3BGMB 5LVEA 2A1WH 4DQOL 2P42B 5SWSB 1X5GA 5ICZA 4XHJD 1IKNC 1HKLL 5K59F 3WLBB 4RWYL 3V6ZB 1CYGA 3I6GA 3UTTE 1EO8H 1HIMH 1RUKL 4IOIB 1KIRB 3AM8A 2FJGB 4F2MA 4KUCF 4X7FC 4APQC 2QADD 1SJEB 3A6OA 4JDZB 5A2KH 1A2YA 4YGAB 1T1ZB 2WWKO 1GGIL 5I1HH 1SYSA 2FECI 2AXJA 3MFFA 5A3IC 3VI3F 3R06B 4PRIE 4OF7A 1MEXH 4MMXC 2QEJA 3MLWL 1T03L 4NO2A 4G6JL 4BZ1L 1BAFH 4D0CA 4KGLA 4YZFF 4V2BA 4L4VD 5CD5D 5DSCA 4X4MA 1UACL 1BVZA 2O93L 3CFIC 3BJLA 1OP9A 1AGDA 1YEEH 3O11B 2VIRB 5J11C 3BD4A 1NFDA 3C5ZC 2MPAL 2ZP0T 3QO0A 5CS7A 1HILB 2UWEA 4WDIB 5C0DA 5A3ID 3RUGB 3A6BL 1S9WB 5I17A 1Z5LB 2MSPA 3VXUA 3PP3K 4WW1B 4APQD 5KSAB 1SJXA 3SDAA 1BHGA 2JLLA 3HC3H 2LABA 5C2UB 3V4VH 5LCVL 5E2UL 5DURD 1A7QL 1L7TL 5A43C 3ARTA 3TYGH 4N8CH 4G9FE 5FM8A 5GGTH 4NZDA 4OLZL 3ZSSA 5DR5L 1T7VA 3HI6L 4RMQA 4ZO8A 1UACH 1P4IL 2ZKHL 3MRRB 5JQ6H 1BLNA 4RGMB 1KELL 1V8HA 1REIA 2VISA 5JHLL 1HSAB 2XN9E 3QI9B 4HUNB 5FYKU 5EA0H 3UJIH 3HG1D 4NKDA 3QIUD 1JGLH 3QCVH 2VUOA 1ULVA 4ZS7L 1X5KA 1DN2A 4K7FB 2QQNH 4MXQD 2VQ1B 2NYYD 2CKBA 2OJEA 4NSKB 3WSQL 4HC1L 5D2LE 1ZHLA 3B9AA 5HHNA 4PLOB 1JRHL 4U6YA 3CCHA 4UT7H 1MJJB 4PJAA 5MENA 1FYTA 2A83A 4MAUH 4QCIB 5LCVH 4S1SL 1G0YR 1WCBB 4QT5B 2VH5H 3CMGA 3GUTA 1A1NB 3O3BB 4M6MH 5ICZB 1JNLL 3ZT7A 1DL7H 1FPTH 1OTSC 1B4RA 5EC1B 4ZAKC 1Q94B 5JIIA 5EB9A 1P4BL 1HWHB 1BZQK 2ZUXA 2VLKD 4JFDA 4M9PA 3RWCB 3ZKND 1OB1A 4R4FL 1XGYH 3JVGA 1TJIH 2VXSH 4W6WB 2VO5A 4ORZC 1K5NB 2XQYG 3C60D 3FO1A 3KJ6L 4JE4B 1H8SA 2YPLB 3EDEA 8FABB 3L95A 4OLWL 1FZKB 2HN7A 4X5LA 4KVCL 5EOCH 1CL7L 1MEXL 3EOYG 1QACA 4MJ5B 1ZE3C 1NEUA 4K71B 4PTTB 3UPCA 3S88L 3BRGC 4XTRC 2BDNL 4N0FB 5HYQA 2FL5A 4ZOBA 3C2AL 1F8TH 1EJOL 1HKFA 5FDYA 2VLRB 3CPLB 1XR8A 3JTSA 3EFDH 4MNGE 3GBMH 5FK9B 1KLUA 1T1YA 1EJ6A 4LSTL 1U91B 4ONGH 2FO4B 1S9XA 3MRJB 3I85A 1FG2A 4M6OL 5CEZE 3TN0D 3KYNA 4PJ9C 4O9HL 4F7EB 5I30L 2EEBA 5E08H 4MLSA 3QQ4B 1ONQA 3HC3L 3W9EB 3G5YA 2R1XB 3AB0B 1TVBB 3IDJB 4X6DE 1FLRH 1XGUB 2EDYA 1KCSH 4JAMB 4P23C 1KCRH 2C1PB 2XPGA 3CVIL 3RNQA 3ULUH 1IGJA 2A73B 4ZUSA 3QXTA 4CVXB 4KMQA 2GJ6A 4UBDD 1DE4B 1N6QH 3B4NA 4JVUA 5IB2A 4IDJH 2YPLD 3L3JB 4PJIA 5FECB 4JM4L 3O0RH 5HHXL 4PB0H 4WGWB 3S36X 2HYMA 3WFZA 2EECA 5BVPH 5HHQA 2R4SH 2DQDL 4JPVH 1F13A 1FG2B 2IAMB 1KFAH 3GMMB 3MUJA 4PRHD 3TF7C 3OG4B 4OF6A 4XGZB 4UU9A 3U4BL 2J6EA 3MBXH 2XZQL 5E56A 4X9HA 4XVUD 5DC0A 4CKVX 3RTQC 5J6HA 1NAMA 3E6HB 1E4JA 4JREB 2NXZB 3ET9F 4JRYD 1XF3A 3NN8A 3ARUA 5MP6H 3HE6B 4D9LL 2CLVA 4NQEE 4PTUB 1WZ1H 3I6KA 1MNUL 3ARDB 5JDSA 4NCC2 1G9NC 5ICYA 5TQ0H 1DQDL 1K2DA 3KLDA 5F3HB 4L8CA 3KYMB 1N59A 1E0OB 5T33H 1MWAL 3SBWA 3OKLA 4XMLL 1VFMA 4KJQC 5EOCJ 2R56H 3KVQA 1CFQB 4XAKD 5EZOL 5C09E 2HA1A 4QNPE 5J3HC 1DQLL 5DVLA 1JF5A 3S3JA 1YEHL 1FC1A 3VFSA 4NN5C 4Y2DA 3U4BH 2JB6B 2XFXB 3V5KB 5ITFA 3PWJB 4HPOL 4RFOH 1P6FA 2R69L 1CDUA 2B5IC 4R8WL 1A6TA 5ADPH 5E9DD 5F9JA 4XP6L 2GK0B 1F3JA 5DMKA 1SJEA 3VWKD 3QUZD 1BJ1H 1HCFX 1HH6B 4ZUTA 3EO1B 1J8HA 3UCRA 2E7LE 3QFJA 1G6RH 3G5ZA 3U1SH 4UINL 3D18A 3HRPA 3WKML 3SCMC 4PRNB 5FYJD 2BNQA 5HDBE 4ZYKB 4HCRA 2E9WA 1NGZB 1NCCL 4OLXL 1T7YA 5LWYL 1QA9B 1I7RA 3QXAB 1N5AB 4JY6B 2PUQT 2QV2A 5FGRA 2BOBB 1QNZH 3UTTB 3JZ7A 2NX5E 4WNQB 3WCYA 3OKOA 5C08D 4RRPG 1GHFL 2I9TA 1IBGL 4G3YL 4GG8B 4RMWA 1K8IA 4UDUB 3RJQB 4WU5A 1U8JA 3EJZC 3LY6A 2NZ9D 2R15A 2J4WH 3MCKB 4YHLH 4H88H 1ITBB 1QQDB 4PJ7A 5DTFB 1YC8A 3T4YA 2VL4A 1BVKB 2XG5A 3D0LB 4MHHG 3MRMB 1FZMB 2GJJA 4HULB 5GGVY 3SY0A 4QRSA 2R2HB 4PRPB 2EKSB 3VD3A 4GSDL 3VFRA 5SWSD 1UB6B 5INDB 4ZYKA 1YNTA 4P3DA 3GGWB 5EN2A 1TQBC 4BYHA 2VZTA 4NWTH 4KJWC 4KI5E 1RVFL 1KG0A 3EOBA 1MCBA 4X4ME 1DQMH 3STLA 4CN4A 2DQEH 2HAZA 3VH8G 5JORB 2X9WA 1NLDH 3KPSA 2VE6B 1BQUA 3U6RA 4LVOB 1KF9B 2F53A 1F4YL 2ZNXA 3K4ZA 3AS1A 5I19L 2PXYA 4OGAC 1PG7L 2DDQL 1GL4B 2GSGB 2CDGA 3VXRD 4HKZB 3DMMA 2EDBA 4CAGA 1OAQH 1BF8A 3BP7A 3MRLA 2EH8L 5A16B 5C2BH 1BZ7A 4ZS6C 1R3HA 4JKLA 4U7MA 4F9LA 4DN4L 2PO6D 5FYLD 1KIRA 1T22B 4X83A 1A1OA 1OT1A 1KBGL 5GPRA 4C55A 4GRLA 4JQIL 4Y4FD 4XHQA 3TYFA 1OAUL 3RHWK 1M7DB 5C86A 3BSZL 2A9ML 3D85B 3P9LA 5C08B 1MCOL 5IBLD 2Z8VC 1VSCA 4CJ0A 2HLFD 4XI5D 2VABA 4M1DL 4EUPB 5ALBH 4XP4L 3B9DA 1FFQA 5CUSL 3L9RA 3BW9B 1BFVL 1B0RB 5GS0C 5J6GB 1XF4B 1VGEL 5HY9A 1AGBB 4W4OC 4XPGH 3HS0A 3OXSB 5T1KD 3UYOD 5ISZB 1HHIB 3TFKC 3MRFA 4FRWA 3RVUD 4WW1A 5I75C 2IBBA 1NCAL 5IB1A 2VXVH 5B8CC 5TPWL 1BIHA 3R1GH 4ZSOB 1MFDL 4GRLB 3DV4A 2GY5A 3F58L 2M8XA 2HJKA 2VR4A 4YPGB 2ZSWB 1UM6L 2R0ZH 1FYHB 1OLLA 3JUYA 4ODUB 3RI5K 1A1OB 2CRYA 1JPSH 4FHBD 3BZ4B 1TCRB 4JY5H 2EE6A 2IPUK 2ZSVB 3VXMB 1E6JH 3GSNA 1R3IL 2EYRB 4FZ8L 4ODSH 4JFFB 4YXKL 2GTZA 3HCVB 4TPRH 5C0RH 1MVFA 4D3CH 5B4MC 1U3ZA 2OSLB 4MX7B 5TQ2L 1LE9A 2ERJC 3U0WL 4JFXA 1MLCA 3TC9A 5DHVA 2FNBA 2OSLA 1CXIA 2GUOB 4NBYB 3QWRD 2AJXL 4PJHB 4EI5A 1PSKH 2BNUA 4HIHB 1ZANL 4NFDA 1PD6A 4M6NL 4ZOAA 4RAVA 2ADFH 1NAKH 4Z8FH 2J8UE 4G6AC 4NOFA 1U3HA 4DZ8B 4EEEA 5CCKL 4XP5H 1MREL 2P49B 1R5VA 5D8JH 2OK0H 3MV7B 5BOPA 5IFAH 3JWNC 3IFPA 3PABB 4YWGH 2R2EB 3IJHA 5KSVB 5H35B 1BECA 1J11A 3MO1B 1WSST 4LASH 1DBAH 4ODTH 5TE7H 5FUCE 4GAYB 3X14A 4LKXB 3QWOA 3VXQA 5DJXA 5H94A 3TO2A 5MEQB 4MA1B 4H1LH 5ESQB 2IAMD 2Y25A 1NDMA 1QRNA 4U4BA 4XNXH 3ZYJA 4KRPB 1AKJB 3NAAH 3D3VA 4XCFL 3PGFH 3PGDB 3DROB 2ICWI 1OB1B 1DQJB 3SE8L 3IXTA 3SDDC 5I73C 5C7XH 1M6OA 2F5BH 5ANMA 4ZDHB 3DX8B 4C4KO 5ECJE 3NCYS 4MQTB 5K59E 4JM4H 1WF5A 4QLRA 2NY3B 3QDMB 1RV6X 3B6SB 2E27H 3WNLA 1HQRB 5KVEL 5EULV 4HS6B 4NQCA 4IOSD 2DM3A 4PJEB 3NCYP 5C71A 4L4TE 4O4YH 2QL1A 4WV1C 5K9OB 5J6GA 3EJJX 4DAGL 3M45A 4FTVE 3QR2A 4O9HH 3IU4H 1KB5H 5HD8D 5C6TH 3JWOH 3NIDF 3O6LL 1F5WA 3TP4A 2NNAB 1IC7H 4HFWA 4NQCE 2CMRH 4DCQA 4X4ZA 3AY4C 1TJGH 2FLRT 1W0WA 4CMMB 4QRRB 3GBML 2ADFL 3EYVB 4KVNL 3TO4B 3O3AB 2PYFB 4PJ5A 1LD9A 3VE0B 3MCLL 4BH7B 3KHQA 1EJOH 3LEYL 5D1QC 3SJVA 4XMPH 3W0WE 2VERN 4KKLC 1EIBA 5C0CE 4CMHB 1KV3A 2BMKA 5I1EH 1JYNA 5CBEA 2WUBH 2NY1C 4JFEE 1CU4H 5EBLB 1B0WA 4X6BA 2OR9H 4PJ8D 2ZJSL 4PY7B 1Z3GL 2H2SD 3PHQB 4YBLC 4UIMB 4HT1H 3GSXA 5C0CA 3IFNH 1KELH 4OZHF 2VXUL 3WBDA 1ES0B 1CDJA 1VGKB 3TBTA 5F1SA 2VLKE 5DJZA 3RX8A 3CFCL 5IW3A 1NFKA 1R3IH 1PYWA 2EIZB 1JYWA 1VA9A 4EN3D 4PYHA 4EZMA 5KOVC 4WI6A 3AS0A 4UU9B 4NYLB 4P46A 4IDJL 3U30B 1OAYH 4FFVC 5T1LD 3NIFF 4OTXH 1WWAX 3HR5A 3MOAH 3EOAA 5BXFB 3KPLA 2YZ1A 4YDVB 1I9JH 3D25B 5GRVL 5IF0B 1ZLVK 4NO0A 4YFDB 2Z31A 1NC2B 3HS0B 3CMOL 4KJQD 5D70H 5DVNA 3WFDH 1U8PB 1CG9A 2DQJL 1MREH 1TENA 3QHZL 4NIKB 5JOPD 3QYCA 4Y5YA 3KPRA 3QIWB 4HS3A 1VDGA 3VH8B 1VCAA 1S7QA 3PQYB 1EEUA 4TVPE 4OFIA 4NO0D 1X5XA 2CRZA 1HH9B 1EBPA 3MR9A 5J12B 4R96B 4X7SL 4AYFA 5ID0B 2YRLA 3CH1B 1HOCB 4OCRH 2AK4A 3T2NL 1N5YH 2AQ2A 1YPZF 1FE8L 5C2BL 4P4RB 3FQXB 2GI7A 1KEML 4PBVC 4ZUWA 3SGDH 4MVBA 1GIGL 1OW0A 2JJUA 1CBVH 4EI6B 1TJHL 1IGTB 1FRGL 4X5XA 5DVKA 1J8KA 1CL7H 1P9MA 1MH5A 5DJAA 4I18B 3V7AE 3DIFA 2ED7A 4L9DA 3FCTB 3JWDC 3NACL 4GS7C 4OM1H 3ZZ1A 1ZLUK 2VR5A 4BK5A 1DQML 1DVFA 1WJ3A 3I84A 3QQ3A 4JY5L 4Y16C 3OG6B 4XP1L 2JF1A 5ACZA 4U6XA 1I8KA 1ZT7A 2BVQA 3GSRB 2DKMA 5A2JH 3L3DB 1OL0A 3AMLA 3U7WH 1MFDH 3REVA 1WUNT 1CD0A 2M1KA 2OBGA 4Q6IA 3MLVL 4JFQB 5DJ6B 4TVSa 4H1LB 2BMKB 3L1OH 1NGXA 2X1XR 3L3DA 1P2CB 1XT5A 2GAZA 3HR6A 4DUVA 5GGQH 4RGMC 5CZVH 4HPYL 1NJ9B 3WUWA 3H9SB 5H2BB 3EDDA 1T03H 2HWZL 3SCMA 2HH0H 2N7AA 2IG2L 4O2CA 4K23H 5GRUH 5T3ZD 3SQBA 3WXVH 1RUQH 2D9CA 3DECA 2WLYA 3DIFB 4PLKC 5ALBL 2YC1A 2X42A 5I1HL 1RUML 3QA3A 5EC1A 4PJ8C 4O5LL 1AR1C 3TVMC 3D69A 4R2GC 5GGSY 4P3CL 3X3GL 2B20A 2NCMA 4R4BA 2JCCF 3FB7B 5JUEL 1OARL 5J11B 4X80H 5EU3A 4YNYA 1G7MB 4LP5A 1FORL 3HRZA 3LEXB 3S98A 5D7LE 1KN2L 4YBLB 3WFBH 2XZCH 1LGVA 1IGFH 1OOAA 2F8OA 4FMFA 3IRPX 1KENH 3CFKA 1NC4A 1PLGH 1S7TA 2G5BB 4PGCB 4ENEC 3MUGB 1YPZE 3ZLQC 2EH8H 1OWRM 4Y5VB 3CLFH 1KSRA 2FGWL 4KROB 1I9RL 4XZUA 2YUWA 1FL6A 2MQ0A 3GIZL 3RWGA 3GSNH 4O2CB 3V4VL 1LWRA 1XR8B 4OQ1A 5IF0A 3GHBL 5BCAA 3BMWA 3FFCA 4ZQKB 5JMOC 3O3DA 1F3DJ 4HS3B 2DWDA 3GSWA 2EIEA 5EU6B 5D5MF 4MJ6A 4DKFL 4HWEL 3O6MH 4I5BA 2D0GA 4NQDB 3VXSB 5FO9B 5I8CB 5KVDH 3FB7A 5BVPL 43C9B 1UH2A 4PLJD 3TO2B 1I1FA 4MD4B 5K9QI 1NGYB 2J88H 1WZLA 3BRFA 1IAOA 4GKZA 3G6AB 3MGOB 5CD5C 4GMTL 1AO7A 4P2OB 4GKOA 4LMQE 1PEZA 1YEIH 4UUJA 4XH2A 4NC2B 1N8ZA 2KQMA 4FFYH 5C0DB 5DMIH 1AHWB 4R6UA 2X41A 3VXUD 4EI6A 1XF4A 5KS9A 2Y4SA 3QIUC 4HBCL 1JGEB 4UDTB 4R7DB 3OF6A 3MRDB 4ESKA 1KUMA 2R1YB 1U8KA 3GMOB 1J0KA 3IDXH 5D1ZC 1DQDH 3S37H 1L0XA 3KDMB 2DD8L 3Q2CA 3HZMA 1HIML 5DZNA 5I6XB 43CAA 2F19L 1E27B 5F9WC 1ZA6B 1IC4L 4P23B 2Y5TA 3FB6B 1FZJA 1M7XA 2WLZA 2BHZA 3IDUA 5KSAC 1OHQA 3DGCR 4ZSOE 4U7SA 4JPVL 1L7IL 4TULH 2NX5B 1YY9C 3JUZA 1NANH 3GMRA 2IAND 1M71B 3IU3A 2P8LB 3ARGB 3F5WA 4P2QD 1JPST 4XRCA 4YHMH 1XEDA 6CGTA 4J4PA 4OLUL 1W0VB 2NY4D 3JSSA 1CCZA 1D5MB 3G08B 4UILL 3KXFE 3K8KA 2BXYA 5DO2C 3CFJB 4JFZL 3VG0H 4UDTA 4LEXH 4KHTH 1QPXA 5BOZG 2WIIB 3MRCA 4PJAB 1MFCH 5DFWH 1RULL 1P4LA 1N6UA 5GRWA 5D7IE 1YYLL 3RGVC 3PWNA 2F53D 4NKIH 3EZ8A 4U6YB 5FYLL 1J5OH 4TSCH 5HD8C 4CADA 3G6JE 5TE7L 5E99H 3VXRA 1FN4A 3UPRB 3D85D 4NO5A 1RZKL 4KHXL 3HC0A 4RAUA 3L5IA 1FNGA 4P4KB 1BX2A 1HHKA 3FOLB 4BFGA 1XGRA 5CLTA 5F1NA 1S7SB 4KJPC 4XWOD 3WKNA 4LSVL 1NAML 1FJ1A 1KTRL 2IPKA 4LHJB 5FYJE 1GGBH 1H3UA 1IGYB 3C8KA 1NKOA 2BSTA 2QQQA 1T4KB 4ZMAT 1RI8A 3RWCA 1MCSA 2FIKB 4U1NB 4Z7NE 1KYOK 4ZD3L 1NCDL 1RZJC 2NX5D 1IGYA 3VGHA 3CC5A 4HKBA 2ICES 5C0BE 1IGIH 1QD0A 2J88L 4RX4A 4N1EA 3VXRB 4UNVA 1WBZB 4PJ7F 1LK2B 3GMQB 4NJAH 5LAXA 4QXUH 1OAZL 4JFEA 4S2SB 3FN9A 3HC0B 1RUMH 1WWWX 3O81A 2H9GA 1FFPA 4PJ9A 4PP1D 3W39B 3P73B 4G6KL 2NXZC 3V8CA 2DQTL 4ORGB 2XQBH 4KUZL 5GGTL 1XFPA 4UNTA 5T1KA 4NZUL 2CRMA 1AFVH 4Q2ZB 1BBDL 5FM5O 3WLWD 4ZO7A 1KPRA 2A77H 3HE6C 2BOCB 1AC0A 1IVLA 4OBSA 1MHCB 4HF5H 4X8JB 4JQXA 4AL8L 1GJIA 3EYQC 5GSRB 2BSRB 5FA3B 1ZA3B 3CC5B 2V17L 4QRSB 3SOBL 3LZFH 2OI9C 1CFNA 3L3KA 4PRIB 1GOFA 5I18L 3LQAL 1P7QB 1FNAA 3M17A 1GIGH 3DVIA 4P5MB 3QEQE 2NY2D 4MQXD 3SGJC 1A2YB 2Z8WC 1WEJL 4RGOH 4L8BA 2OR9L 4Y4HD 5EU5B 3HZKA 4XVJH 3KR3H 1U8NA 3IDIB 1JCKA 1Z0MA 2WBJC 3VMPA 3JTCA 4HXBH 4NUGL 1F4AA 1DUYA 3B5HA 5T1LB 3RUGE 2XZCL 3QCVL 3T2QA 4ETQB 3U4AA 1JHTB 1B4JH 4HGMA 2WIIA 3MRCB 3MCLH 5I1EL 5FYLE 2CDEA 1BQLH 3RVXC 3AM8C 5CLWA 4MHHI 4JZOB 2A83B 5DXWA 1JZ7A 2Z91B 2P44B 5HVWA 5I74C 3QG6B 5BJTB 3PG2A 5IIEB 4FTVA 5CMAA 3EW3B 2HT4D 5EU6E 1QSFD 2IBZX 4OLZH 2YK1L 1YEJL 3IU4L 1HCVA 1EEYB 3ZDZE 1JNNH 3UPAA 3RZCA 3X14B 1G1CA 3GI9L 4P9HL 5LWYH 4OZ4B 3MJ6A 1KB5L 1CI5A 3IDNA 4L8BB 1QSFA 1N64L 4OCXH 4F7MA 4LK4A 4GG6F 4GXUN 3KLSA 2NY0D 2IMMA 1VEPA 2RB8A 2BVYA 4TUOA 2A9NL 5LGKA 3T0XA 4YDJB 5FKAB 1F58L 1DDHB 2GTWB 5DK2A 5ACLA 4LPWA 4XZUB 4IRSB 5CGYC 4DW2H 3MGTA 4QWWC 3RWEA 3T1FB 4LBEA 4P49A 3MV7D 2IQ9L 3W9EA 1JIBA 4M8VA 4NHUA 4HXAH 1A14H 5ERWB 2C3VB 4FTVB 3U79A 2G9HB 2P24A 3QEQA 2ZJSH 4NNPL 5EOTA 2FO4A 4G3YH 3RIAK 1W72L 4D0DB 1EX0A 1LO4H 4OZHB 4NT6A 3BYYA 3EYOB 4EBQH 1NCUA 2ARJB 3WN5A 1H15A 2BVQB 3KPNB 4LASL 1GH7A 3PJSB 4M7JH 2MHAA 3KLHD 3AS2A 3ZE2F 4RGNC 1LP9A 2VLLB 2W0LA 4PJ8B 4I18A 1ZS8B 3EYSH 4NZTL 1FCGA 2GFBA 4PJIB 4CDHA 5C6TL 1PZUB 4NQDE 2E27L 5DJ6A 2H2PC 5BV7L 3ARDC 2MCPH 3EHBD 1EMTL 3FO0L 1A6WL 3QSKB 4PDCE 4H0GA 3FRUB 1YEEL 5F7FA 5HYSG 3DRTA 2NXYD 4X6DF 2DQDH 3PDGA 3MJ9L 3WN5B 1J1XL 3PWUA 1SY6H 4WFHD 5I8KH 1ZT1B 2F54D 4IMLA 2P7TB 4P2RE 4G5ZH 1OSZA 2RBLA 4Z5RA 2AAVA 4FZ8H 4Q6IC 1MCFA 1QP1A 2FHCA 4G8GA 2EKSA 4PRPA 3N9GH 3RWIB 3CIQA 5C9KA 5HI3C 3ZDYF 1RSFA 2AS5M 2EDTA 5TE6H 3QA3B 2YPVH 1FLRL 3GGWA 5EN2B 2IFFH 2FBJL 1H3PL 2B1AL 3ULSA 1A7RH 5F88A 3B8SA 5D7LB 4MMZC 5CJ5A 2C4XA 5AUMB 3HRZB 3LEXA 2VNCA 1NCAH 1IM9B 5B8CB 1IAII 4LNRB 1C1EL 3VGAB 4G8EA 1HHJA 1DBAL 1NAKL 3QZWA 1LO4L 1OW0C 1G9ML 3DOSA 1W72B 2A38A 3NFSL 5BO1L 1C8PA 3HNSL 1A3LL 5F7EH 1X5YA 5EZJB 4P2RB 5JW4M 1KCVL 4D9RE 5D71L 1I75A 4KRPD 4WU7A 4MB3A 5E8NB 4QOKE 4NHUB 2NY6D 1RZIA 4LP4A 4F7TB 4JZJB 4H8WH 4E0RB 4LCIL 3OAZH 2GCYA 3Q48A 3OZ9L 1GOHA 4ELMA 4NNPH 1RJYA 2W9DL 3D18B 3VXUB 5F89B 1C5CH 1FIGL 1WBXA 1NH6A 3F7RA 4ONOA 4I13B 2AK4E 4D0DA 3V52H 1AC6A 1NMAL 4HHAB 2ITCA 2DTSA 3TBVA 3K8MA 2DJSA 2W0KA 5HVHB 1V3LA 3JV0A 3J7HA 5CKGA 2B4CH 1CICD 3ARWA 2HFEA 3DNKA 2XN9B 5LGJB 3E2HC 5FO8A 2VR9A 2I07B 3MXWH 5MHSE 1I9EA 4U31A 3GJFK 2YD5A 3ZKSD 5I75B 3ARFB 5D7IA 5IMKB 4PJHA 3P30H 1DBML 2W0FB 2WBKA 3C6SA 3NIGE 1JJUA 5EBWA 2B2XL 5DJ0B 1QLFA 2P8PA 4S1DD 5D7IF 4LSTH 4ONGL 1JRHI 3LPGA 4XBPB 5J1AB 4GSDH 3BJ91 5MHSD 5BJTA 2EIDA 3SDXE 2QSTA 3IJSB 4LVOC 4RIRB 2FHBA 3KYNB 1W72H 5GRZA 4BQ6A 2EDRA 3S8WA 5MEOB 3MLXH 3UJIL 1SJHA 3EJYD 1AD0B 4Y4KC 4FQCH 5D7IB 4O2FB 4UT6H 3QPQD 4N90D 1OGTA 3FTGA 3SDDA 1HZHH 2HLAA 4OLEA 1EO7A 1ZOXA 1TJIL 2HWZH 4K8RH 1G0XA 4BSJA 3OAUL 3H3PH 2AJVH 1V05A 5IJVA 3WO4B 4MSWB 3KPRD 4TNVK 1Z9MA 1IBGH 3TYGL 3RWIA 2QHRL 1Q9OA 3RVTC 4UB0L 4JHZA 4OFKA 3VFNB 4OCXL 2HVJA 3DTXA 3Q6FA 3P9LB 3LKOA 5C08A 4ELME 5HPOA 5AWNH 1IARB 4YXHL 1Q1JH 4L4VA 1YYLH 1OWWA 5CP7B 1S5HB 1RK0B 3SDYH 5KOMC 1J88A 1PG7H 2DDQH 5EZJA 4BQ9A 3FB5B 5F93C 1R5VB 4XTRD 1K8IB 4UDUA 4K7PY 8FABA 2JJWA 4H5SA 3V4UL 1BWMA 2E9JA 1M6OB 4PY8I 1QBBA 2HG5B 3LD8B 1FBIH 3QIWC 1ODAA 4UNUA 1FNSL 4K2UL 3RGHA 12E8L 4HKJB 1F4WH 4Q0XL 3VXMD 2APVA 5D1QA 3QQ4A 3WDIA 3L3GA 5BRZD 1AGFB 1MIML 4HWBA 5BMFH 2PYFA 2ATKA 2Q6WA 3L5WB 2P5EA 4LLWB 2HFGL 3SKNA 3MJ7A 1PKOA 5DUBA 2IANA 5JTWA 1KBGH 3AY4A 3FQUB 4L9LA 4QRPA 1T1YB 3QDMA 3DO3A 1G7LB 2FSEA 2DB8A 3UTZB 1S9YB 3MNVB 2VDOH 1MWAH 4R0LA 2BOCA 5DD3L 4BH8A 4PJXB 1NMCB 2PTUA 4JHAL 3O9WD 5KS9E 1O0VA 4N0FA 1OP3H 3D9AL 3EDJA 3TT1L 5KW9L 5J1AA 4J3UA 4U1IB 1L8JA 3O2DL 4RBPK 5KN5B 1NCWH 4NNXA 3QAZB 5DMIL 1BBJA 3NA9L 1S7UA 2BVPB 1S7WA 5CJXC 3RY6A 4HUUA 5L6YH 1JBJA 2BHUA 1KLUB 4HZLB 3MLSL 3JTTB 1F4XL 4P5MA 1PG7W 1QSVA 4WENB 5JR1L 4QY8A 4RMUA 4Z7WE 3SDAB 3V4PH 2APBA 1BAFL 3MRIA 3TJHA 3IDMB 1QVOB 5L9DL 1OAKL 2VKXA 1JN6B 4MVBC 3OHXA 1RD6A 4X0KA 3EGSB 1EGJH 3HUJF 3L3OA 4KTDL 5GS1C 4XCEB 3MV01 4DFHA 2CLVB 3RBSA 3HMWL 5IP4A 3QUXD 4LCYA 2AXGB 1DTUA 1HINL 3LOWA 1IFHH 3DXAD 1KYOJ 4LCIH 3MRNB 1E4KC 4MSWA 4LIQE 1A4JB 1Q9OB 3LPWA 1S7WB 1OP5K 5HVGB 5DMGC 3VDCA 2E7LC 3KLHC 2XWJA 4IIQC 3NAAL 3S35X 2Z91A 4ZNCD 4L8SA 4XPHH 1YMMA 1NQBA 3QUZB 1MCEA 1I85A 2FDBP 1G9MH 4U2YA 3AVEA 2JB5H 1JPFA 3G6JA 1FGVL 4Y5VC 4YZFE 5DQ9B 2ZG1A 4LCCC 4U1HB 1IM3B 1N2RA 2Z31D 3BEWA 3MNWA 4G8IA 3G6JF 4OI7A 3MXWL 1I4FB 1XGQA 2CRIA 3FB8B 1UCBH 5D1XC 5E8OA 2Q7YB 2YUZA 5FHBH 2H32B 2E3VA 2AQ3A 3STLB 2AABL 4V1DA 1DVFC 1ZHBB 5K33A 1RZJH 2XXMB 1LP9E 2B39A 3L5XH 1S9VB 5SWSE 1F8TL 2OX5A 4TUOB 5IHUH 3TO4D 4QWWD 2Y5EA 4YE4H 4OZ4A 2IC2A 3HNVH 1MFCL 2J8UB 1FIGH 3MUY1 1UJ3B 2JIXA 1JFMA 4P5TD 4B53A 3GMOA 4OFVA 5IEHB 3FRPA 4PP2A 5LAXB 1JGVH 4I0PD 3TBSA 3E6FB 4NQXB 4PPTA 2LE9A 4AENB 1KPUA 2VZ1A 5B21A 1XGPA 4UQ2B 5DJ2B 4AIZB 4HK0B 4L3EA 4JN1L 1WBYA 4GLRH 4PGDB 1ZSDA 2AI0L 1MHCA 1RIUH 1J18A 3QIUB 4ISVB 5J56B 2Q76A 3IYLW 4NQVB 2QJDA 1JZ8A 5ITBL 3MRQA 1G6RB 1M7DA 3D6GA 3QNYA 4ODBD 1EFXD 4AH2A 3Q3GB 4P5KA 3I3BA 2EDOA 4PLNC 1RUPL 1N0XL 4YHKH 4M6ML 4XBGA 1D5BA 3VRLF 4XPAH 3QXWA 4HLJA 2MHAB 5FYKE 1QO3B 1XIWD 2VDLH 5GISH 1XGTA 2ORBH 1G6VK 1NJ9A 5IW1B 1F97A 3X12A 3O6FB 1Q9KB 5IVZB 3WFBL 5D9SA 4HBCH 2P5WE 3FQWA 4LFHG 4Q6IB 2W9EL 1BM3H 1WWCA 3S88H 4N0CA 1TZIA 4WTXA 3L3HA 4IRJB 1QR1B 3L6FB 1FVEB 2VDQH 5A2LH 5JHLH 4LSRL 1E4WL 3Q0HA 1ETZB 1I3GH 5DZLA 5ABDE 5A16A 4FG6D 4NQCD 1VEMA 2VDKL 3LKRA 4NN6B 5DYOA 4KAQL 1I7UB 3T2OA 3F7YA 3QEGL 2XA8H 3BKCH 2KUTA 1R5WA 1T21A 4PV8B 3H3BC 4WI3A 4JDZA 1KJVA 3HI6H 3GNMH 2GKIA 2CGRH 1I7ZA 3RGVD 4NFBA 3BIKA 1A6VL 1CXFA 1J0HA 3S5LA 3SKMA 4YFLI 5TDNA 4PJAF 1WFTA 5JLZB 5F3HA 4L8CB 1UEYA 3RWFA 1LP9F 1GOGA 4ZNEE 4BELD 3ULUL 4YNYB 5HBBA 5DJ8B 4CUCA 1K9TA 1N7ML 2ZUVA 2AW2A 2NY0B 5JXAH 1ZT4A 4L3EE 4EVNA 1IEAA 3GSWB 2VZ3A 3VFPB 3QFDA 4MNQA 5HYFA 4K3EL 3T0AA 3WS3A 5IJKC 3HC4L 2JB6A 3WNNA 3NIFE 4TSBH 1EHLH 4WY7L 4ZNEA 1GZQA 3DTXB 3Q6FB 4X9BA 2FLBT 4KXZI 4MS8A 1LO5A 4Y2OA 5KSAD 4XXDA 2CIKA 3PDOA 4O58H 5DRZB 3RKDC 4POYA 2HJFB 3WSQH 4X80L 1BPVA 4JFOB 2RGSA 1Q9LA 1NBVH 4KZEL 1B4JL 1MAML 1GVIA 1FDLH 4P2RA 1FE8H 1CD8A 2BDNH 4K3DH 4OCRL 4P2OC 5DJZB 1FG9C 4OZHA 4J3WA 1HXMA 1BFOB 1A4KA 3PL6A 5F70A 5CGTA 4LPTA 2Y7QB 4GXVL 4GH7B 5JQ6L 1FNSH 4K2UH 5GGUB 3ZKQD 5ETUA 3ROLA 3ELAT 1MPAL 5T5NF 3WO3B 2DAVA 3VFOB 3BKML 4R3SA 3SDAD 3V4UH 2UWEF 3GI9H 2VLRD 4P9HH 1H3GA 2YD1A 1OGAE 3ROLB 2KL6A 1QZ1A 3LQZA 4QXWA 1TTGA 5C70A 4WEMB 2VH5L 1KTKE 3PV6A 2R2BB 4KRMB 2DQEL 3JV6A 3L7FB 1ZAGA 3L3HB 5GGTA 5I1JL 4LPCA 3O6KL 1FPTL 1KCUL 2UY7A 4HF5L 3ZTNL 3LN5B 4YHOL 4X6FA 5BW7C 4Q97A 3FB6A 4L3CB 4HZAA 3C8DA 1TJHH 1X5IA 2AV1A 2P5ED 3MCG1 1TETL 3T0EC 3VMNA 4NRZA 1KACB 4HX1B 3H42H 4WI2A 3GB7B 4C59B 1I3GL 4JFPB 4PJ5D 4PGEB 4XP9H 2NLJB 1MCNA 4R3SB 2CDFA 3QDJD 4ZUVB 4BSWB 1MVUA 5AG8A 3TPUB 5DJDA 2P5EE 1BFTA 4KRPC 3THML 4ODHL 5IR1B 4F7PA 3RGVB 3ZDXE 3FN0L 1YNLH 4Y2DD 4IDLA 1UH3A 4BFEA 5ID1B 2PCPB 1MI5E 2R9HC 1IGMH 3KAAA 5CEYA 5T33L 4AENA 1BIIB 1QHPA 4OCSL 4ZDHA 1AR2A 2EEDA 1HK6A 3N85L 2YA2A 4N0UA 3TVMD 1A7NH 4LCWE 3NABL 3UPRA 1DEEB 3LDBB 3PGDA 4IRSD 4X6CB 3A6BH 2WBWB 4NCC1 1KCKA 3SDCD 4PLKD 2WBJA 4KY1H 3SKOA 3WNOA 4CU8A 3SCMD 1DBMH 4IIQB 5H37H 4K9EC 4DGYH 2X1QA 1RUAL 2K1MA 5GZND 2ICWB 1QBMH 1AFVL 4DK3A 1QKZH 4OGYH 5IM7B 2HFTA 1R3JB 2HJLB 4H25A 2ID5A 1WZKA 2YA0A 5BXFA 4LKXA 4OCNC 4L4JA 1W0WB 4CMMA 1S5IL 4GRMA 4WEBL 3MBXL 3T09A 1ZXQA 3AXLB 5D96B 1ZEAH 1KGCE 3MRJA 4X99A 1U8MB 4Z7UB 1I8MB 1GAFH 1WK0A 5E1HB 5DGQA 1H5BC 1X5ZA 5HYQB 4W6YB 3EYFA 1YMMD 2E6QA 1UM6H 2R0ZL 5ENWB 4OSUH 5CJBA 1QLRB 3P2TA 1EFXB 4ZAKA 4TULL 4AIOA 3KS0J 2X4NA 5T1KB 5H8DA 1J1OL 4OCWL 5FGCB 4Y19B 1TTUA 3X13A 3L7EB 4XCFH 3DX6A 3VWJB 3LKRB 5DYOB 1RZJL 3JVGC 2DMKA 4LQFL 4NSKA 5JIPA 4QTIH 5I1AA 1UWEH 5L2JA 1MUJA 2XY1A 2DICA 3DUUB 1BOGA 4MNHA 2XT1B 5D8JL 5CP3H 4ZXBA 4YR6B 3KYKH 1QYGL 7FABL 1PKQB 3SQOH 1D6VH 4D0BA 2RCSH 1OCWH 1YC7A 1FAIL 4NQTA 5B39A 5IB5A 1NL0H 1TZGL 3JXAA 1Z6JT 4NPYB 2DYPB 3KYOB 2FX9H 4RCAA 1F4WL 4XP5L 4OCWH 1H3XA 1UXSA 4JKKA 2VAAB 1SEQH 3RZWA 4QT5A 4FQQB 4M3KB 4JRXA 1TMCB 1PG7X 4HFUL 4ACPA 1QSEE 4OFYD 4XNUH 2PW1B 3PP3H 2UUDK 1TFHA 5CIPH 4ELMF 4EXPX 4XP1H 3EGSA 3BKYL 2EICA 4U1SA 4OKVB 2L7JA 3MLSH 1I7TB 2YUXA 5C09D 2A74B 3GFUA 3G04B 5IK3A 3CCHB 4K94L 3QUMA 4G43B 3LZFL 3UXFA 3MXVH 4U1HA 1EPFA 3IDNB 1E6JL 4P2QE 4G80A 1UJ3C 1JP5A 1MSPA 5EWIH 1SYSB 2G2RB 4E41D 1FVDB 2KDGA 4L8SB 5C3LD 4RGNB 4LGRB 1H3TA 2HP4A 3OTTA 1T83A 5I71C 4Z7WA 4JM2D 2LVCA 5DRNA 1IC5L 4P2QA 1QSEB 2A0LD 1JL8A 3LV3B 5DJXB 2K3TA 3GMNA 4MAYD 5IVXE 4I18C 5BRZA 1EEQA 1MCLA 5TFSH 1HILA 2UWEB 4WDIA 1AD9B 3KG5A 3LSOA 2E8YA 3MRKA 4JEGB 2Y06H 5KVDL 3MRHA 4LVHB 2C1OB 5KSAA 5BV7B 2APTA 4UQ2A 5DJ2A 5EO9A 1UM4H 4OB5L 3HHRB 3HPJA 3KPPB 4BUHA 4ONHA 1YDPB 4PV9B 1RURL 2BVUA 4Y89A 4QHKJ 4Q0XH 3QXDA 3TZVB 2E9BA 1INEH 2B2XH 3QDME 4PBXA 5EOTB 1MLBB 1VEOA 3MRLB 4X6EB 1U92B 4F80A 4N8CL 1QEWA 4ETYA 2SEBB 4DKAA 1JHLL 3I75A 4K7PH 5DMGD 5IESH 1PAMA 1AD0A 3R0MA 4XT1C 1AP2B 1BZ9B 3CD4A 5TDOB 1E4KA 3C60B 1BGXL 3VJ6A 1YN7A 4PJXE 3UTQA 1JHLH 5A40E 4YFEA 3H9HB 2EXWD 1WISA 3S36L 1PY9A 3A67H 1KG0B 5IOPA 1BQSA 4EN3A 2BSTB 2OM5A 4YR6A 1XGUA 1H0DB 3MOQA 4YPJA 1Y6MR 3LHPL 4NDMB 2X1PA 1TTFA 1A9BA 1T5XA 3EOTL 4TTDD 4KUZH 4HCRH 1J7VR 1CE6B 3OKDB 4JRXB 4YHNA 4Y5VA 5EU4B 3T77B 4M61B 2H9GB 4PJ9B 4YAQA 2PXYB 4QTHB 4U3CA 3ARXA 4IM8A 1B2WH 1RMFH 1JGVL 3UTPE 3T2NH 1N5YL 3M8OL 3N06B 5JORA 3MUGA 3CUPA 2R29L 3VA2C 5DUPH 2FBOJ 2DLGA 4LVEA 5D2LF 5I8EB 3V0WH 2O61A 3KPOA 3CJJA 5CINL 5HI4D 5EORH 3LIZH 1CE1L 4H0IA 1VHPA 5GZOD 4HD9A 3U46A 1TCRA 4E42A 3UTQB 1HKLH 1JTPA 3W82A 3UTSA 5ITFB 1L6XA 1WIPA 3Q1SL 2FH8A 5TGBB 5JOFB 4TUKL 1D6EA 3RNKA 1NBZA 1SBBA 4APQA 1MJUH 1EFXA 4AEIH 2HT3C 2XG4A 5BVJB 2OP4H 2H6PA 2FB4H 1YY8B 4KTYA 3IVKA 2FEEI 1RIHH 1J8HB 4NNYA 3PUCA 5D72L 2Q1EA 1G7PB 1RVFH 3CDCA 3U7AA 2BOBA 2OTPA 1JZ2A 2WBJD 2W60A 5HGBA 4E42B 4Z7NF 4M7LL 1RK1B 2MWCA 1NGZA 4ALAL 2NY4C 3X11B 4XVTL 3X3FH 3KPTA 4M1CC 3EJZD 1AGCB 4MAYC 1D9KB 1C5DB 1ED3B 2DM2A 2XWBA 3V5DB 4Q7DA 4DGYL 3JTTA 3IGAB 5CWSB 3W5NA 4ZFZA 5F9DC 1AXTL 5CIPB 2R56L 3JV4B 1NDGB 1TIUA 2HTKC 3GSNL 3W11C 2LU7A 4IHOB 4UTAL 4MQ7B 1SEBA 1NMCC 4KK5D 4LU5H 4J3TA 5DD6A 3U83A 4WI8A 1ZMYA 4LLMA 5AG9A 5BS0D 1C1EH 2VXQL 4H26A 5HYSA 1GGBL 1MQ8A 3NZHL 3BDYH 4M5YL 5GHWL 3AU1B 2HLAB 2I07A 4FQHA 1DSFH 3TT1H 4N8VA 3BH9B 3TBVB 3BKJL 2MKLC 3WLWC 5HYSB 1ACZA 3MA7A 1F45A 1H5BB 5EWIL 4OKVA 3TA3D 4GRLC 4Y4KA 1YQVL 3MLYH 4RIRA 4G42A 1EHAA 4PJAE 1OD7A 4LCWA 2ZPKL 2GT9A 2VSCA 3NIDE 5JIHA 3N0PB 2P5WA 2XNAA 4KK8D 4JG1H 4GQ9L 1OPGL 5B4MD 3TGXA 3HG1E 3LMJH 3FMGL 1JWUA 2LVEA 4TTGA 3MJ9H 2BVOB 4AIXA 5IBTL 1W8OA 4JANA 4NRXB 2MKWA 4BZ2L 2PXYC 4TUJA 4UTBH 3BP4B 2AERT 3UAJC 2R69H 5F7WC 5IB5B 4LKCB 5F96H 5JHDD 1BMGA 4Y4KB 4TUJB 2X4OB 3IS1X 1JI2A 2A6DA 4MS8C 4NZTH 3GHBH 2CLRA 3P9WB 2RFXB 5E6ID 3ULVC 5E4EC 5TGBA 4DWHA 4KVNH 1NFDF 4NKOA 5HGAB 1IEBB 1DN0B 3NABH 3C5ZA 3MFFB 1AKJD 1WBXB 2XTJE 4F58L 1MHPL 2AK4D 3QIBC 4N5EC 3RBGA 4J23A 5HGAA 1U36A 3QIWD 4X7DC 3BD3A 5EO0B 5C0FB 1CIDA 4BA8A 1IGJB 2A73A 3W0WD 4FA8A 4QF1A 3VXOB 2J3SA 1EZVY 4XMKL 2P8MA 2QSCL 4Y88A 4Y4FC 3VRIA 4F33B 2VLRA 4ZFFA 1S5IH 3CU7A 4GW5B 4BQBA 3ARFC 4NGHL 4NUGH 4HIXH 2GSGA 3G5XA 1L0QA 5CEXB 2G60L 4AG4H 2VDNH 4M7LH 5JNYB 4OFYA 1GAFL 1CLCA 4X6DA 3M1BB 4KQ4H 1YY9D 3LRSA 1E28A 1J1XH 1QA9A 3VXSE 1CXHA 3NA4A 4TSBL 4RA0C 5I1GL 4G7VL 2O5YL 3QUMH 5EPMA 3IJSA 4UIKH 5KAQF 3EO9H 1TVHB 1T5XB 1NSNL 5F3BA 2L7UA 5CJXA 3TNNB 3B2VH 4G6ML 3QDJA 1YNLL 1AGFA 5I6XC 5D1ZD 3WL9A 1KNOA 3V0VB 2ZUYA 4R90L 3AAZA 4CRPA 2E7LA 2Y36L 1JHKL 3K80A 4ODTL 4LLQA 1N59B 5DTFA 1N64H 4FN0A 4KPHL 1F42A 4G7YL 3BYTA 5EZIL 1NCBL 1RZ7H 4ONFH 4NP4H 3BMVA 1I9RH 2AK1H 5D2LB 3SJVD 3ZDZF 5D1XB 1ZGLM 1CGUA 3VXNA 2AQ1A 4LCCA 3OR6A 2ITDB 3O4LE 5D6CA 5J13B 1UGNA 1FRGH 3BZFB 1PY4A 4NZRH 5E2JA 2NY2B 4M6NH 5BZWA 3BZEA 3C9NA 3NZ8B 3PHOA 4XNYL 2WQRA 3LKOB 1JTTA 4Q74A 3UTSB 2VDPH 4JFPA 1A1MA 4GUPA 4E0RA 4X98B 2W9LA 5CHNA 4FQIL 4NN6C 1N3NB 2COQA 1A1NA 2VDQL 3IJHB 3O3BA 4OIIH 5MEPB 1MAMH 5KSVA 2X4UB 3SDXF 3ISWA 3O4OB 1MRFH 1LO3L 1EV2E 4N0YL 1XCQA 3ARBB 3TESA 1JFQL 2CR3A 5KVFL 4NGHH 3ES6B 1J0ZA 3FFCD 4XCCH 3GUTB 5IEKB 3CVHB 5C8JA 2CXKA 5MI0B 4C4KT 2Z4QB 4F7MB 2HRPH 3CX2A 4XPFH 4JKPH 3QG7H 3TBTB 1P1ZB 3OGCA 4D9QD 2V9QA 4M9OA 3VH8A 4NQDD 4K3JL 3WIFB 3ZE1F 3BEWB 3IAPA 1MHPH 2F54A 2PR4L 1FZKA 4XPFL 5TF0A 3ZHLA 4QHMB 5KVGL 3T1FA 4W81A 4LOUC 3LQAH 3SE4A 4ODXB 3PQYA 3IGAA 5CWSA 4PJEA 2CUHA 3MNWB 1AXIB 1C12B 3I3DA 3C5SA 5CZXC 2YD9A 4X4XB 2Q7NA 5C0GB 4OIAA 2H32A 4CVZB 2XQBL 5IEKA 5IB3A 1T5WA 5F1IA 3CDGB 3I6LE 4PJBE 4Y5XB 3ARFD 1EHLL 4NQXA 5EIVA 2XTJD 4HJ0C 1I8KB 1ZT7B 2QHRH 4YDIH 4HWUA 1UJ3A 1CLZH 4LEOB 3X17A 2XY2A 3TN0C 4EIZC 4P57B 1U91A 4PRPD 2NY5L 3UROR 4LCUB 1G7JA 3MRQB 1HE7A 1YPZA 3OPZL 1JPTH 4LL9A 5M95B 1U8JB 3MLUL 1LE5B 2BSRA 3CXDH 3ZL4H 4Z77A 4RISL 2V7HB 2ZUSA 1EAJA 3B6SA 2CO6B 1GHFH 3N1GC 4AIZA 1MUJB 1KIPB 1MCPL 2AXFA 1O5DT 4JFYB 5EOQL 3TH3T 2NNAA 3UBXI 1L9NA 1UYWH 5E8DL 3DGGB 1T2XA 3ULUD 1N7MH 5CEZD 4NP4L 4CBPA 2WP3T 2CKBH 4OT1H 1BP3B 2EDWA 2OR7A 3PGCB 3BN9C 3HZVA 3MOAL 3U36A 4Z9KB 4WHTB 1YEKL 1WIOA 4GW4B 1T04A 3OKEB 3SO5A 3RZCD 5FIEA 5E2VL 2PKDA 5HHMD 1ERNA 3TBYA 3O3AA 4KZDL 3P40A 1A7PL 2I24N 1I7UA 5MEND 1U8LA 4MQXC 2GHWB 4HWEH 2VN7A 5IQ9A 4YHML 3O9WB 1DFBH 3MJ7B 3CSGA 4OF8A 4X4YA 3MLZL 3G9AB 3T0WA 1VACA 2QSVA 4BZYA 4IRJA 4XVSH 1QR1A 3WHE0 3B9KC 4FQJL 4OCMC 2CPCA 4LSRH 4HEPG 3L5HA 2O61B 3DI2B 3QDGD 4C56E 4OM0L 4LSQL 2BHYA 1DQLH 3OKNB 3S34H 3IAGC 3H2WA 1Q0XL 4UOW0 3O3EA 5JPMA 5MI0C 1T80A 2XV6B 1JNHB 4JHAH 2V2WA 2WUCL 4WO4A 1BJ8A 4LMQI 4PJDF 5DUML 4JM2A 1S3KL 5DEFB 5K9KB 1U58A 4HUVB 2CMRL 2WV3A 4GQPH 3GK8L 3NFNA 2MQCA 5EU6D 2DMCA 1UKQA 5KZCB 4J8RA 4BKLB 3U30C 1JGEA 2C3HA 4R9HA 1IGTA 5E4EB 1OQOA 2FEDC 3A0OA 3O11A 5GRYA 4GS7B 1BQLL 1NFIA 3MV8E 3QIBD 4N5ED 2ZOKA 4JQIH 2IEPA 5GGSB 3MRKB 1U8IA 2XZQH 2BNRB 4JGMA 4I3RH 3BIAX 1B2WL 1H3WM 5FYKD 2APWA 3HUJA 3TH4T 1D5XB 5EUOF 4HPYH 5L8KB 1N5AA 1VKXB 2ESVD 4U33A 1CGVA 5L2KD 3DSFL 1FZJB 4QO1A 3WJJC 1JYVA 5ANME 3WD5L 3F8UB 5FGSA 1F90L 4QRQB 4RBPH 43CAB 2HFFB 3DLQR 1X5LA 3O2VL 4JREC 1DEDA 3FO2A 4P23A 2ZSVA 3VXMA 3C5ZD 4RRPA 3BI9X 2D31A 5JO5B 2D2OA 3RVXD 1A7NL 4CMHC 1R5IB 5DJ0A 4YXHH 4NUJB 5T1MA 3WUWG 5I15L 4OUOA 3UTSE 3EAKA 4HW6A 1X44A 1F00I 3LQZB 1W0VA 4N8VB 3F58H 4NKMA 4WCYH 4FP8H 1CGSL 3T0EA 5GS2H 5FA4A 3ARGA 3FQWB 4TNWK 4G8GD 2AJVL 4GW4A 1YJDL 2HT3D 2B8OT 2DQGL 1F11B 1UWGL 3TFKD 5DMJB 1OTTC 1X5HA 5JMRA 3AFLA 5FXCH 2VC2L 1QG3A 3WO4C 3OPZH 2EIBA 2VXQH 4DOHE 2R0KH 2X05A 5C0JB 4ODUA 2NY0C 5DLMH 4A6YB 5FYJL 3VG9B 2HFGH 2YWZA 1DBKL 4NBZB 3SJVE 3PWPD 4B7LA 3QIUA 4ISVA 4OAWA 1QFWL 4DN3L 5D70L 3FFCB 4ZQKA 2O5ZH 2K9UA 1Z9OA 1U95A 1HSBB 3QDMD 3PP4L 3BZEB 4ELKB 4NO3B 5D1ZA 1R3JA 2HJLA 1KGCD 4Z18A 3AS3A 1S7XA 1FC2D 2R4RL 1YQ2A 3WXVL 1FO0B 2RHEA 4KK6D 4D3CL 1XGYL 1KULA 2ZG3A 1CFVH 1TVDA 3VWKB 1UXWA 4LEOA 1IEAB 3PXHA 1XIWA 2E7BA 4XXCC 1AQDA 1I8LA 1N6VA 3BWAA 2IMNA 3WUZA 4PGCA 1JGDB 1M05B 3QZWB 5EU5A 3R06A 1BGXH 3DHMA 2RIKA 5F7LB 1G7HA 3CXHK 2X89A 1B9ZA 4OD3L 3KXFA 1CK0L 5DVMA 3LVEA 1P1ZA 2AEPL 2NXYB 2VXTH 4OLYL 4YEFA 1QOKA 5B38G 4OCYL 1T1WB 4GXUM 4M43L 6FABH 4U1LA 2FJGA 2OTUA 2V6HA 4GG8A 3BEVB 1IM3A 1N2RB 2H1PH 3RU8L 4YJZL 2DLTA 4XPGL 3RX5A 2C26A 5KS9B 4FFWC 4F8QA 4AT6A 1K3IA 2YMXH 3SO3B 2A6IB 4Q58C 3WNMA 1UXWB 4UT6L 4X8JA 1EO8L 4LSSL 1BVKA 1UVQA 3O41A 1ZV5A 2Y7QA 4LHQB 5CD3B 2X70A 3OXSA 3G5XB 3RRQA 3G6AA 3MGOA 4H25B 3T3MF 4HUWB 3DPBA 3MJ9A 3CPLA 1PYWB 1FFPB 2M26A 3MPCA 3WXWL 1GZPA 4QOKD 5I1LB 2VRAA 3D3VB 1IC7L 5IHLB 5FV2A 1FP5A 5I8OL 4U1LB 1FBIL 3P4NB 4XCEA 4HKXB 5J4MA 3EKCA 1U3HC 4MJ2A 1NCBH 5EZIH 4Z0BL 4WW2B 5D2NA 4MXWL 4FS0A 3VWJA 1GZQB 1RPQA 3BPNB 4OB5H 2ZUUA 1NCCH 1AJ7L 2HN7B 1KCLA 2UV3A 3OKYA 4FQCL 3V79C 5IMMB 1G6RA 1JV5A 4CU6A 5B38A 5GS2D 2HLFC 1F3RB 1D5IL 2AJYL 2KH2B 4KDWA 3FONA 5ALCH 5I1IH 2XA8L 3P11L 1R3HB 2GJ6D 5F6IB 1GZPB 3VI4F 4LGPB 1SY6L 5HI5C 3V52L 4HT1L 5C7XL 1MELA 4KJPD 4XC3H 1XH3A 1G7QB 1ZLSH 4HFWB 3UZEA 5EA0L 4B50A 4DCQB 5HHXH 4Y5YB 3KNBB 1PKQE 5J8OA 4JG0H 3T65A 2WIMA 3DMMC 5J89A 5IJKA 5E00B 5IM7A 1XCTB 4X6BB 2LQRA 1FNHA 1QSFB 4OZIF 3R8BB 3V9FA 2W0PA 4YHLL 1L7TH 1JGDA 2RJMA 2DKUA 3K2MC 1J0JA 1HQ4A 2V9RA 4RWYH 3KXFB 4XPBL 4Z0XA 3O6LH 5B3JF 4PLJC 4DGVH 5C0IA 3PWPB 2Y07L 3B3IA 5HDOA 1M05A 1UG9A 3V5DA 2PN5A 1KN4H 3OKLB 3HZYB 4JPKH 1MJ8L 2J6EH 2Z9TA 3S5LB 3SKMB 1EBAA 1I1RA 4JY4A 4YIQB 1KXQE 1MLBA 1HYRC 1NDGA 4PJCA 3LEVL 3HNTH 4IJ3B 4NZJA 5CP7A 5E8PB 1C08B 3G5VB 5JOPE 5F96L 3U0TA 1Q0XH 4KI5D 2JK5A 2CUIA 5TDPA 4KKNA 5D71H 5C09B 3V8OA 3WIHA 4BZ1H 4FQ1L 1A02N 4UQ3B 1AI1L 2AJ3B 1KB9K 3S96A 3QB7C 4FQLL 3LS5L 3KPLB 1MCDA 3QEQD 4PTUA 4D9QE 3VFMA 5ADPL 1YJDC 1NBYA 1LNUA 4GAFB 1J8HE 5B39B 3HZYA 4X5WB 4LCWB 5I9QB 3TBWB 3BP5A 5HPMA 3KPSE 1HXYA 2VOTA 3SGJA 4CL7A 3UMTA 1N4XL 4F3FB 4EN3C 3MJ8B 4LLQB 3ME0A 4YFLF 2YD8A 3RVWD 3TVMA 9CGTA 4C56A 1FL5A 3FAWA 1ZLWH 2QQKH 4U1JA 4MJIA 3DO7A 4OSUL 5IBUB 4LOUD 4XBEH 2ZUTA 2NY3D 4XMLH 4OT1L 5HHQB 5EO1A 2BNRD 5JW3L 3QCUL 1CFNB 3EDFA 3L3KB 3BGAA 4WI7A 3E1F1 4GAYA 4IS6B 3U4EA 1TVBA 3IDJA 4AMKH 3OR7B 4TSAH 4JVPA 2CKBB 1MHHB 1JRHH 1T1ZA 2OJEB 3FMGH 1MCPH 4NUJA 3QDAA 3PF2A 3U46B 3RNQB 4D9LH 3T0ED 4CW1B 4PV8A 2BNRE 2OTWA 1G7QA 3C2AH 3GMPA 1DUZB 3ZL4L 2FX7L 1CGWA 4P46D 5SX4H 4C57C 3RWHB 3GRWL 1IGCH 4MXVE 5FCUL 3IDIA 1QSZA 3GMPB 4OZIE 5ANMB 4JQVA 5IVZA 3I6KB 5I76A 4XC1L 2XWJB 3TH2T 3N1FC 3WN5C 3PE9A 2DLFL 2R1WB 3CLEL 4YXKH 5EU7E 4WY7H 5T5FH 4IS6A 3U4EB 4YAQB 3BP6A 5EU4A 4YHNB 2VXSL 2ATPA 5F1NB 2YBRB 3SPVA 3OX8B 4PUBL 2AJZB 5DT1L 5C07E 5JPMB 5FB8B 1VPOL 1KT2B 1DBJL 1R3LA 1ZT4B 3UJTH 2FEEL 4YHIB 3S35H 1KEGL 2F53E 2CLZA 2X4TA 5C0EB 3CX5J 4WU7B 3GDBA 2GQHA 3MLUH 3H9SD 3O8XB 3VDBA 3TN0A 4B41A 5CAYB 3KPPA 2VQUA 5LKNA 1ZWIA 4XVTH 1U8QB 2X4TB 2W59A 4OKDA 4Y16A 3CSPA 4H0HB 2AV7B 1BLNB 1A3QA 3TNNA 4NC1C 2P24B 3B9KA 1NEZB 3W39A 2PR4H 2E6PA 1AD9A 3DHJA 2VITB 1OAZH 5C1MB 4YBHA 4E41B 1FVCB 1D6EB 5J12C 1YEFL 3NTCH 5DFTA 1KPUB 3QH3B 4PJCF 2R1WA 2R29H 3WS6A 1F2QA 4IJ3C 1JYXA 4AEIL 1SM3L 2OXHA 4XWGL 3IU3B 1LK3H 3RAJL 5D7JC 1VENA 5KVMC 1T1WA 1MQKL 2J8UA 1OAUH 1A6ZA 1OARH 2B1HL 1PZ5B 1IC1A 2JCCA 1I3VA 2CKNA 5FF6B 2FX8L 4OGZA 1LO2L 5C0AB 4ERSH 2H1PL 4ZFOL 3ALWA 4PRAA 3VCLB 3WFHB 4XNQA 1CDCA 2NX5A 2CD0A 3AREA 4YDLC 4YEEA 2HH0L 3RA7L 3CX5K 2XKUA 1Y0LB 4NBXB 3DGGA 4M4RA 3DV6A 1I8IA 5HHPA 4K7PL 4DZBA 1TITA 2F74B 4IRJC 4P9ML 4PJHF 3QNYB 3ZKMD 3TM6A 5GJTL 1R0AH 2VISB 4G7YH 1CFTB 2OR8A 4HIJA 3RGVA 2A6DB 4XH2B 5T3ZH 2FIKA 3H9ZA 1PZ5A 1Q9WA 2BY3A 2WQ8A 1QLEH 5J1TC 3QDGE 3FQUA 4L9LB 2CGRL 1A7BA 2FH6A 1A3RL 2IANE 1AQKL 4IOFD 4U6HA 1U6AL 3EFFB 1DCLA 5C0JA 2O5ZL 3BH8A 5F8QC 3HA0A 4C83A 2ADJA 5SV4A 1RZFL 5GS0H 3UJJH 4K3DL 1W0YT 1CGTA 1U92A 2BNUB 4HIHA 5DD5H 1L0YA 3QDGA 1MRDH 2MQ3A 4U6VL 5FYJH 5HYJA 3QIBA 3O2WH 5JA9A 4N5EA 3CK0H 4KK6C 2JK5B 3R8QA 1W72A 1IAIL 2DBLL 3OAZK 1J0IA 4KPHH 1AGDB 3VD7A 4HG4K 4ZUTB 3FT3B 2IALA 3MOBL 4HJJH 1EEZA 4HIXL 1CGXA 5E7FA 4P5TA 2FO1A 3CFJA 5KANI 3G5YB 1ZKAA 5D7LA 1HEZA 5E1AA 4AK1A 3BESR 1CFSB 5EU6A 2B4CL 3SDDD 2A74A 2V17H 2X09A 4ZUUB 4JO4H 3QJFA 4MQ7A 3UTZA 3PNWB 4JQXC 4MA7H 5DHYB 4NQEB 1L9MA 2FZ3B 1NCDH 3C5JB 4R4ND 3QJFB 1ORQB 1II4E 2W0FA 2CR6A 1U3HD 4AY0A 2ESVA 1U8MA 5FO7A 3NH7L 2OQJA 2PO6C 2FL5B 2ZUQC 4NWUH 3GSVA 5LGJA 5JOEA 2J2ZA 5CEXA 4LRNL 2VLJB 4MDJA 4PJ7B 4D0BB 4R2GB 4PJCB 2VXUH 1GYAA 4GW5A 1LO5B 3MYJB 1UM5H 1ITCA 4Q9QH 4HS6A 1BOGB 4NQCB 3KYAA 2X4QA 2ZZUT 3WFEL 3KS0H 3SHSA 2DF3A 3HG1B 3HB3C 1KCGC 1FL3A 1PKQA 2NR6D 5I2IA 5KTEL 1CDBA 3STZA 4HZLA 4K9EL 2FHFA 3FN3A 4OQTA 4GMSL 1CGYA 1TMCA 2X4PA 1ZGLA 3QDJB 4KDVA 4KJWD 4NC0B 3QPXH 5EZOH 5C0NC 3HE7B 4OF5A 5F9OL 1WTLA 4WW2A 5GGVL 3EYUL 5F3BB 1UFUA 3UBXB 2VDLL 1WITA 3SPVB 2HMID 5ISZE 3MYJA 2EH7H 5D1XD 5ICXB 1OSZB 5GSVA 1X3DA 4JM2F 2X4QB 2H45A 3KPRE 2F15A 1NL0L 4F9PC 4HH9A 4MDJB 5SWZB 1NUDA 4Z78A 3O3DB 1PGRB 3ILQD 1A6TB 1RK0A 1KJ2H 1OVZA 4MA8L 1U93A 3O3UN 4BSWA 1PX4A 4Y2DB 1MIMH 5IHUL 4N8VG 4O4YL 2R4SL 3IKCB 4XCNB 2XFXA 3VFNA 2AI0H 1F6FB 3BHBB 3RL1B 32C2B 5HYIA 3PIQB 5CZVL 3ABZA 5FYKH 4BFIA 4H20L 3BHBA 5DK0B 1AXSA 1OLZA 2WUCH 2YN5A 3CZFB 4L1HA 4PGBA 3ZYOA 1J1OH 4F7CA 4HLZH 4PJ5B 2XI9A 5EC2A 3UTPD 1GGCL 5IVXB 2ESVE 1JUFA 4DGVL 3PJSA 4Z78B 1Q1JL 4YO0B 4HJ0D 5IHBA 3PGFL 1G7HB 4R7DA 1URLA 3LKQB 1BD2E 5ICXA 2BVEA 5DQ9A 3GSOB 5TQ0L 3C8KB 1FFNA 1GXEA 2Z4QA 1OTTD 1P7KB 3BO8B 3IRZA 5ID1A 3UJJL 1ZEAL 2D03H 4EDXB 1WGOA 1WZ1L 1ZGLP 4MJIE 1C7TA 2Z31B 3MV11 3ZKXC 2Q76B 1MAJA 3ESUF 1NC2D 1KPVA 3QG6A 4MZ2A 3D5OF 1P7HL 1YDPA 5IT2L 1G9NH 3PWLB 5BV7C 2AJ3A 3CSYA 2VLKA 4JFDD 3N1PC 2NY5H 3UX9B 1ZWIB 5D7SH 5IB2B 4Y5XA 5CCKH 3DX8A 4OD1L 1BWWA 4PBWD 1T7XA 5J7CC 4YO0A 1K8DA 5DFVC 4PP2B 3GIZH 1R24B 1DDHA 2EDHA 5IFHL 4QOKA 3RFZC 1FFNB 1INQA 1RZFH 1UT9A 4OZIA 3LH2L 4ZPTA 4JCLA 2EE9A 2PETA 1I9JL 4M48L 1P4BH 1ONQB 1RJZB 1IMHC 3QUYC 1FNEA 1P7QA 4R4FH 4MNQE 1QNZL 1WAAA 4HIIB 3IFOB 4U7KA 3W0WA 1S7RB 1I9IL 3ULUC 3DVFA 3JV4A 2X7LB 3CVHA 3L3JA 2EO9A 4O5LH 4Y1AD 3WFHA 4G9DA 1T2QL 3EJYC 4P48A 4FQPA 4XVSL 3BP7B 4UAOC 4OZIB 1G6RL 1WAAE 5ESAB 3U1SL 3BXNB 3CFBB 2LTQC 3NPSC 4JCMA 4LSUL 3CDYA 4HH9B 2JJSC 3P9MB 4WRLA 1WICA 1S7VA 2D3VA 2OJZH 2YRZA 1U93B 2D4FA 5KBNC 3GM8A 3T0VA 3DI3B 1A47A 4DK6A 3MRBA 5IIEA 4MNQB 4FQXD 4OCLC 2ZCHL 3KPQB 2IH1A 3KYOA 1TQBB 4HEME 4FQ2L 3MBEB 5CILH 5A2IH 2ZKHH 3T77A 1CDYA 3QPQC 1T0NA 3VRJB 4A2LA 2P47B 4S0SD 4QRUB 1G84A 4DTGH 3ARZA 3IVKB 3O9WA 4FTVD 3WE6B 3DV4B 1QPPA 4LPXA 1DZBA 1G1YA 3GJEB 1I3UA 1A64A 1EVUA 1EO5A 3WJLA 5I1CH 1RJLB 2YOCA 3PDOB 4F9PA 4POUB 3OX8A 1MFAL 2X4OA 4JJ5B 4QRQA 4NN7C 5FB8A 4JKWA 2XA3A 3QWRA 5IHZA 2J5LB 4NQED 3CGTA 5DRNB 1FL3B 3E6HA 1NMBL 5FUZH 2H32H 3VGFA 5IBUG 2GJZA 4WFED 5DWUL 3WJJA 5IT2H 1ZTXH 2NTFB 4DN3H 1NSNH 3VGBA 1WTGT 3LSOB 3QNZB 4OZGE 1HWGB 1C5BL 4YDIL 2ENSA 2IH3B 1O7VA 5CSGA 3TWCH 4JDTL 3ULVD 1C16A 2R0WH 3ARYA 3FQTA 2QTEA 1KIQA 3SDXA 3MRRA 1AO7E 4NT6B 5DA4A 5TE4H 3C5JA 1TZIB 5FKPB 1I8LC 4NC1E 1DR9A 4OZGA 5K93A 3O6FA 4TOYH 4LLVB 1A6VH 2EXYC 4QEGA 2HRLA 4MDIB 1V3KA 3E0GA 5EFIA 4U1JB 1BF2A 2Z35B 4RQQA 4XPAL 3BPNC 3IFPB 3KPSB 4K55A 4NOBA 3K7UA 3QUYB 3UC0H 2LU4A 4HBQA 3EO0A 2WNGA 4FQLH 3VFGH 1ADQH 4F37K 2R9HD 4F7PB 1NKRA 4Z7OF 2NW3B 2NXYC 3EFDL 4P3DB 5F7HA 4LEXL 4YGVB 4AG4L 1NANI 3F12B 4U6HB 5LQBH 5IQ9B 5C0BA 2GUOA 5IMOB 5D93C 4S1QH 2BSSA 5HHVL 1A14L 3ARDD 2WINA 4MDIA 3WHXA 2ADJB 4NJ9L 3RPKA 4YDKH 4DVRL 4WI4A 1KXVC 1UWXH 3ZKXB 1DBBL 1KC5L 5D6DA 5CFHA 1DSFL 2X9YA 4KK5C 1MCWW 4H8WC 2NPLX 2F5AL 2R0LH 2YN3A 3WHE1 5GHWH 1C5CL 2H8PB 2F5BL 3OKNA 3KYKL 2OLDA 1I4FA 1XGQB 3FB8A 5DQJA 3DXAB 1LEGB 3U9PL 1CLYL 3MV9E 3QUXB 2NY7L 2Y23A 5F72S 5SWQA 4KI5F 4PJGB 4YK4C 2ZPKH 1IC4H 4HKZA 1K4DB 2V2TA 4HWBL 2AABH 4WTWA 4L8DB 3S37L 3EYVA 4K94C 2VLME 4NNXB 2HKHL 2EYTB 2W65A 4J3SA 4MGXA 3BKJH 5DDHB 2JIXB 2YD7A 4LSQH 1VGEH 4BZ2H 2C1PA 4PJHE 1XZ0A 1Z9SA 3LKNA 5ENWA 1V7MH 5F7DB 3LS4H 5H37G 3BEVA 4B7IA 5IHZB 5EPMB 5DHVH 4P2OA 3VFVA 5CJOH 5C0ND 3DMMD 2XZZA 3BPCA 1EH9A 3GSNB 1BD2D 1CF8H 1RK1A 4U6TA 4X4YB 1ZLWK 1A8JH 4M7KH 1BJMA 4CN6A 5F6IC 2X10A 4JO4L 3MODL 1JZ6A 4L8DA 4R7NB 4XPTH 3ULVL 1A7PH 1KNOB 1AIFA 3HFML 3HE7D 3GHEL 2HJFA 1A0QH 1JN6A 3QUXA 3VU2A 5HYJE 5DSCB 5EBMA 2QHLA 2ZUWA 5SX4I 1FHGA 1CTNA 3STZB 4Q2ZA 2AGJH 1XGTB 2MOVA 2CKBL 4J3VA 3E2HB 5C9JB 2HKFH 3P0VH 2AEQH 1Q0YH 5EORL 5GS1A 2A6JA 2NLJA 1OP5H 2OP4L 3NA9H 1B88A 5IG7A 3DSNA 5CBEB 1UADC 5T3XD 4DKEH 5L8LB 2EKJA 3WEXA 4RISH 2YKLL 4TTDC 2FECL 2Q8AL 4HJGA 5J9PB 2IANB 5C08E 5KJRL 3UYRL 4JG0L 3DUSA 2DMBA 3PHSA 1LD9B 4O02L 3TIEA 2ATPB 3L7FA 5E5UB 4YXLL 3UTOA 1PVHA 2CO7B 4JO1H 1MPAH 5C0RL 2A2QT 4XP4H 5CUSH 4TVPD 2PYEB 7CGTA 3VWJD 3VA6A 1D5ZB 4ODWA 4FFWD 5TF1L 3KPRB 3QIWA 4S0TD 1KC5H 5GRVK 1DBBH 4K8RD 5D93B 5CP3A 5CJ8A 4WHTA 2EEAA 43C9A 4OQTL 4X6FB 3S4SG 3M07A 2ICWA 4M1CD 3MX0A 4I3SL 4LIQH 2MFNA 5ESAA 5T1MB 5HHME 3OGCB 4C58B 5DK3A 4KZEH 1IT9H 4YUEL 4QGYA 2F58L 1F4HA 4O58L 4JRYB 2UYLA 1CZ8H 1TZHA 4PGBB 4Z0BH 1CFVL 1KN4L 4YDVA 3CVHH 5IGXH 1K3ZA 4PREB 4ODXA 4JY6A 2DBJA 4BFIB 3QUMB 3HC4H 4FZEL 2PYEA 4HGKC 2JKXA 2CIKB 3F7QA 4K9EH 3QEHB 5DD0H 2RAMA 5A1AA 4PJFA 1QRKA 3EIFA 4X7EC 4RNRB 5HHOA 3IDYB 1AO7B 1I1AC 1A6UL 1RHHA 1T89A 5I16B 1SVCP 1JFQH 1FDLL 4M4PA 1DL7L 1EUUA 4JY4B 4OLVL 4YIQA 4NWTL 2YD3A 5EUKA 3WNKA 2BX5A 5FUCC 4Z7WF 5JNYA 3PL6B 1J0YA 2OMBA 2A6KA 1C08A 3G5VA 5D4QA 2VLJA 4FQXA 4F15C 1SYVA 1CICB 3OJMB 4FABH 4JRYE 3FCTA 1R24A 1I8IB 5HHPB 3ZHDA 2CQVA 3UYRH 4WWKA 2HTKD 2YC1B 5TJWK 4PY7A 4CVZA 4NHUE 3AB0C 4FNLL 1UKSA 3ZTJG 1DLHB 4CVWA 2D03L 2NXZD 3CSYB 2VDKH 4NN5B 4QHNB 4PREA 2X40A 3MROB 4ZXBB 4EI5C 1S9VA 4JQVC 3VGDA 5IFJA 3C2SA 5KN5A 2W07A 1G7IA 4L29A 4HWZA 2QBWA 4AL8H 3RIFF 4BK4A 4OGAD 3I50L 1VERA 2A6KB 2ICCA 1CLOH 3RL2A 1AY1L 3VD5A 2GJ6B 1A7OL 4N0CC 4U1SB 4I48B 4KI1A 5I18H 4Y4HC 3LN9A 2WW8A 3OXRA 2DI9A 4IMLB 3DYMA 3TA3B 1MF2L 4PR5A 5E94B 1MCWM 4K8RC 5D5MB 4JHWH 4HDIB 3OV6A 5IWLA 3MV9B 1S7RA 4X8XA 3FZUD 3GSQA 3QRGL 4FNLH 5CHNB 3GMMA 5MERA 5D7LD 2D7NA 5DGRA 4R4BB 4F57H 3TN0B 5E7BA 5L0QC 2A77L 2FIRT 4M61A 4N90E 3VXPB 2YMXL 3QZWG 1DUYB 4HS8H 4TVPH 1UH4A 5T1LA 3BT2H 3BQUC 5SWZE 3RPIB 3NZ8A 3PHOB 4KUCD 4RZCB 5CSBA 4JFOA 4FXGB 2V7NB 3CFKB 3PWVA 1VFBB 3CVIH 4JGUA 1LEIB 3X12B 25C8L 4P4KC 3VFPA 4PRPE 2AJSH 1XF3B 4L1DA 3PWVB 5F7EL 3TYFB 4R4NC 1YY8A 1WAAF 3PWPA 2A0LC 2DJUA 4R7NA 5E4IA 3ULSB 5SWZD 4D94A 5IESL 3VGGA 3LN4B 3K4DA 1NAMH 1DVFB 2J1KA 3LS5H 2F5AH 4KMTL 5GJSL 1HDMA 3OF6D 1JPGA 1W2KT 3QXDB 3F7YB 4L3ED 1NFDB 3ZT6A 4Q6YA 3FQNB 5F7KC 3ULUE 5ERWA 2IPTL 4PY8J 3E8UH 3HG1A 3NFPB 4PGDA 4L9LC 1NGPH 2CJUH 4QKXB 3U2SA 3G5ZB 1LK3L 3RAJH 5JW4N 3GHEH 3BT2L 1J9CT 1B3JA 1JF6A 1RIVH 3GB7A 2DQHL 2ZUQB 3S9DB 2C3GA 3UO1H 1F3JB 5DHVB 4WWID 2D31B 1MJ8H 1WBYB 4FQHB 5AEAA 2SEBA 4FFZH 3D2UA 7FABH 4XRCB 3UBXA 2XQYK 1CXEA 2OL3L 4JFFA 4OZGB 5EOQH 5E5MA 5EO9B 3VDAA 4UV4L 3D39A 4S10A 4U0RB 5GGVH 4YHYB 1AIFB 3QJHB 4JB9H 2XIDA 1MCJA 2Y9RT 5KTEH 2EDNA 1FH5H 1J05A 3VW3H 3FOLA 5DS8B 1ACYH 1QQDA 2HTLC 3O4LB 4FP8L 4HWBH 4LLUA 1TCMA 4QHKI 4LVHC 2VLRE 4GG6B 2H3NA 2X89D 4IRJD 2BJML 4Z77B 5ESVB 2NZIA 2HTLD 4OAWB 4GMTH 5DD5L 2AXHA 1MY7A 1QEWB 2DI8A 2GSIB 3RY4A 2ZWLT 1ZLUH 1OD9A 1LO0L