4WW2C

Crystal structure of human tcr alpha chain-trav21-traj8, beta chain-trbv7-8, antigen-presenting glycoprotein cd1d, and beta-2-microglobulin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
275
structure length
275
Chain Sequence
VPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atypical natural killer T-cell receptor recognition of CD1d-lipid antigens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords TCR Alpha Chain-TRAV21-TRAJ8
total genus 76
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2014-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ww2C02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4ww2C01
1ZHNA 4PJ8D 2F5BH 2W60B 3QG6A 1H3PH 3F8UB 3MBEB 3O6LL 5IQ7L 2RCSL 2X89A 2XWTA 4NJAH 3CDFA 2GITA 4UNTA 2VLKA 2HFFA 1XR8B 1LO2H 3QHZL 2CIIA 3KPOA 1PKQB 1U3HD 3QUXC 4YHIA 5FCSH 3EGSB 5C0DB 1KJ2H 2D03H 4W68A 5D8JL 3U6RB 5T3XL 3S34L 4E0RA 5DDHA 4KMQA 1JRHI 2VLJB 3WEXB 3DTXA 4UB0H 4O2FA 3QULB 2KL6A 3Q3GB 3FQUA 3IB4A 4UT6L 4UT7H 1SJEA 2R0ZL 1T83C 4XX1G 5J56B 2JLLA 2D4FA 5IHLB 1U6AL 2IBZY 5EC2A 4HGMA 3FZUD 1OTTC 4ETQB 2R29H 4ORGB 4HKZB 2A6DB 5M95B 3MBED 3RUGE 4DFHA 1DANT 3OPZL 4MAUL 1Y6NR 1MJUH 1B6UA 3O3DA 1FG2B 2VDQL 1FNSH 1AGBA 2JK5A 2MJWA 3NOIA 3CMGA 3MRNB 3MJ9A 5A2JH 1QFUH 4I18C 1R5IB 4LVNC 4NWUL 5FECB 5KJRH 2IALB 4OZIA 4P57A 3IFNL 4KMTL 5E03A 4X6BA 3BE1H 4M1DL 1C7TA 3ULUE 3TBTA 2YPLE 4HAGA 3L5WA 4EUPB 2IBBA 4YFLI 1FBIL 3KR3H 1DQJA 4HWZB 5DZOA 1RZ8B 1DCLA 1L6ZA 4LPXA 5DRNA 1ACYL 3NCJL 2WP3T 3R8BB 4RGOH 1PAMA 1PJ9A 1OWRM 3ARDB 2K9UA 1LD9B 1BIIA 5HBBA 1JPTL 1OLZA 2FYYB 1TZGH 2EZ0C 3QXUA 1QSFB 2EDRA 5ANME 3TIDA 4XI5C 3IKKA 1NMBL 3T0EE 3ZKMC 1T21A 4APQB 3NTCH 4MA7L 3JWDH 3CZFA 5SWSE 3W9DB 1MH5A 4GJTB 3GB7A 2LVEA 4X7DC 4OF6A 1MAKA 4BH8B 5JPNB 4PRIA 1ZKAA 1VEOA 2OP4L 2R2HB 3PDDA 4IIQB 5EWIL 4EVNB 2NTFB 4NRYA 1C12B 3PGDA 3P4LA 3X14A 2MKLC 3ZYOA 3SE4A 4I77L 4U0RC 5AG9A 2XA8H 4F33B 5L0QB 5DUPL 5ACZA 3D25A 4WWKB 3AS3A 4MVBC 5DJ0A 3EJJX 1ZWIB 4P5KB 1OGAD 1XCTA 5KVDL 4D94A 1BVKA 1TENA 4TUJB 5ITBH 5MI0B 1NDGB 4WEBH 1FZOB 1J10A 3BGMB 1IARB 4IRSD 5DD0L 5ICXA 3FMGL 4E41E 1AGCA 2FCBA 4DKFL 3S98A 4GBXA 4Q0XH 3BKJL 1P1ZB 1U3HA 4X99B 2VDRH 4WJ5A 4KI5D 1N5AA 2XN9A 5BZWA 1BVKB 2BDNL 5D93C 4I0PC 1GVIA 5ENWA 5E8NB 1S5HB 2DBJA 2HVKB 3UPCA 1IQDA 3IDGA 2ZOKA 5I17A 3NZHH 4M43L 4RFEA 1WFOA 3RTQA 5GS1B 3L5IA 4JVUA 4WO4B 3GSVA 4HSQA 1IGIH 1MJJA 3RZCA 3X14B 2FEDC 1P2CA 4ZOAA 2PO6B 3G6AA 1WCQA 3WIHA 4PRDA 4AQOA 4OGYL 4KJQC 2EE2A 3HUJA 5GRZA 1OQOA 2Q7NA 5F8RC 3BHBB 1JVKA 1S7XB 4BH8A 3QDGB 2XKUA 4LSQH 4XP9H 4NRZA 3K1KC 5F9AC 4J4PC 1OP5H 4QRUB 2GJ6B 5C92A 3OX8B 3PWPA 2CJUL 1G7MB 2VOTA 3QFDA 1R3KA 3GNMH 3DO7A 3IRZA 3ILQC 5F93C 3HA0A 3TN0D 5HYSB 4XRCA 2VKWA 2D7PA 3ECBA 3G04A 2DOCA 3NPZB 5I1LA 2D31B 2UVFA 3P4NB 3AY4A 5I15L 1T0NA 3X11A 4KV5E 2DLEA 4QRPB 2DQEH 32C2B 4YR6A 5JQHC 4KHXH 2OZ4A 4MLIA 4MZ2A 5C71A 3HNVL 5J11B 3TJEH 3BGMA 2HKHL 2BY3A 2R9HD 4XNMA 2ARJA 1DEEA 3JXAA 5JOPE 1U8HB 1JI1A 5GGRA 5D71L 1I1YB 1ZLVK 4Z7WB 1U2CA 4OCWL 3IDYB 4LKCB 1T0NB 2C7UA 1RPQA 3U7WH 1ORSA 5T1KD 1LO4H 1F11A 4XNUL 4XVJH 5MP6L 2OK0H 4DFIA 1AGFB 4M3JA 1DL7L 2ADFH 4LARL 1N2RB 1FJ1B 1UENA 2MSPA 4HPYL 3QNYB 4HQQH 3TPUB 4DZ8A 4XMKH 3WO4C 1C08A 3TFKA 4J8RB 1FYTE 1JP5A 3SY0A 5CEXA 3SE9L 2Q7YB 3QEHB 3S36L 5JXEA 2Q86A 4NQCD 4P59H 3B5TA 4XPAL 4Z18A 3RBSA 2MTPA 4HWNA 1OF2B 1AXSA 2YBRB 1MCHA 1RUPH 1EGJH 3B5GA 4F7CA 4KUCD 4QYOA 3P30L 8FABA 4XCFH 2EKSB 3QUZC 1QZ1A 1Q0XH 1OHQA 5BXFB 3LEYH 3NFPA 3KPRD 1I7ZA 1MCWW 3ABZA 3K1DA 5I66A 3BFOA 3QDJE 4XHQA 3ES6B 1HHJB 1RJLB 3U4BL 5KAQF 1TZIA 1DEDA 3FL7A 3OTTA 5C0FB 2A6KB 3BDYH 4MD0A 1NGXB 3KDMA 3GI9L 4POZC 1SBBA 2HTLC 3QJHB 4JFEA 3SE3A 4XI5D 5KSBF 4B7IA 3F6IA 3SKNA 5IKCB 2WIMA 5F6IC 3RUGB 4HG4J 2G5BB 3MO1A 1GOHA 1U58B 1I7RA 5D7IE 3UZVB 3HE6B 1D5MA 3U9UA 4U1IB 3UJTH 1NGXA 3KLDA 4MNGA 1WAAA 4WEUD 4OCYH 2FZ3A 5TJWK 1MOEA 3PQYD 1LK3H 1WBZA 4Y4FA 1A1MA 1BWWA 4WFHE 3W39B 3ULVC 2FECI 1QSZA 1S9WA 3F7VA 4HUXB 4PJ5D 3EYUH 5FUZH 5CJ5A 2Y6SC 1WCBB 3HUJE 4FQHB 3I3EA 5GHWH 2VISA 3JWDL 2DD8H 1JWUA 1Z3GL 3QDAA 5I18H 2VLJE 2BJML 2QBWA 3L5XL 3SGKA 3DVIA 1QFHA 4IEFB 5CJQL 4L3AA 1F2XK 1I1FA 3DGGB 4JO3H 5GSVB 5DTFA 4FQ1L 1ZGLP 4M00A 4KK9C 1TITA 1OWWA 1T5WA 4NCC1 4BQCA 1W0WA 3ZZ1A 1G9ML 1QG3A 3I6LD 4HUUB 3U30C 5I1KL 3CDYA 2CDGB 2NLJB 1FFPB 3DURB 5DFVD 1T21B 3UTOA 1P7QB 4JHZA 4MNHA 3FOMA 4RAVB 2YRZA 4RFOL 3WFEL 3GIVA 3QG7L 1F8TL 4JFOA 1EHLH 1FLRH 3C5ZA 1A7RL 2XQYG 2MQ0A 2B5IC 3S3SA 3SDAB 4XBPB 5H37G 5ADOL 4GG6B 3QNXA 1LO3H 3MLVH 5DT1H 4ZFZA 4UIMA 1A4KA 3ZYJA 4NZJA 4OLUH 6FABH 4GS7B 2Z31B 3WV0A 4S11A 2A1WL 3BIKA 4X6FA 4DGYL 4K71C 1IFHH 2G5BA 4RA3A 4LVHB 1NCTA 3SCMC 1FGNH 1TTFA 4S2SA 3P9WB 1NFIB 4JRXA 3SQOH 4GG6A 1HWHB 2LABA 2QQKL 2DQDH 1L7TL 4QT5B 3T04D 2J8UA 5DJDA 2AEWA 1DE4A 4AIXA 1A14H 2QR0B 4KUCF 3IJHB 1JGLH 5DVLA 3B3IA 4QLRA 1RZKH 5JW4Q 4N0UB 1Q9LA 3MRBB 1HXYA 3C2SA 1QACA 1Q38A 2XIDA 1A22B 4QF1A 1C16B 5C0AE 3OXRB 3VRJB 3ARZA 4RGNE 4P5TB 1BM3L 3MLZH 3TZVC 5DRWB 5HDQH 4D0DA 4BQ6A 1K3IA 1I75A 1LP9A 1UJ3A 4JB9L 1Q72H 2GUOB 3TVMD 5CBEA 4S0UC 1HXYB 3T0WA 4WHDA 1MF2H 4PRPB 2JTDA 3UDWC 5EIIB 3MLWL 1ORSB 3GRWA 3KHQA 1UWXK 4YNYA 1U8OA 1PSKH 4K7PH 2AEQL 1KEGH 1A6AB 1KCVH 4P3CH 1OSPL 3PV6A 2DM3A 1BVLB 3MLRH 1A0QL 1CE6A 3MV7A 4K71B 3V6FA 3IDMA 4I0CC 5JIKA 1OAXH 3RVWC 4KK6C 1ZA3A 5BO1L 5TE4H 4LCUB 5DJ8B 2V5SA 3ZTNH 2IEPA 5L2JB 1GPOH 1Q0YH 5LGHL 5GGTA 4DVBB 2IH1B 4DGVH 2CUMA 1U95A 1DQQB 1Z9OA 4YBLC 5F1NB 4YHPB 4X6CB 1YECH 5ISZB 3AS1A 1F4WH 3BD5A 4OZHE 3V6OA 5DHYB 3T8XB 3K4ZA 1V7MH 5ADOH 1RAMA 3CNKA 4K2UL 1S7TA 3VFGL 1RZJL 4EDWL 1LNUA 4ZUWA 1FORH 3W0WB 4GS7C 5I1DA 3AMKA 4Y1AB 3V5DB 3VWJD 3BEVB 1ITCA 2BHYA 4PGBA 4ODSL 4LLDB 1YYMH 5HGBA 1LWRA 1HI6B 3GHBH 1MSPA 1FNEA 3E6HA 4M1GL 5JW3L 3IT8D 3QP3A 4LSUL 1QUNA 4C56B 1MHPH 4F37K 4L8BA 3VRLE 2RBLA 3V9FA 4FQJL 1ZLSL 3VCLB 4NO5A 4KK5D 1MFCH 3KYKH 3TPKA 1U92B 4HF5L 4TNVF 2YKLL 4HMEA 5E6IA 3AB0B 4OKVB 1BHGA 2QLVB 1QYGL 1S7UA 1ACYH 3NCJH 5A2LH 5EG6C 5IBTL 2BNQB 4QRQB 3SKOA 3EDDA 2V9RA 4LLWA 5J1SC 2CDFB 5LBSH 4F7EB 1CGWA 2WWMD 4Y5XC 5FOBB 2BC4A 1MAJA 1U9KA 3T1FA 4B53A 5K59E 4OFIA 1U95B 3O6FD 2YPKA 1AKJB 4QTHA 3WCYA 4XPGL 1FHGA 4PG2C 4HKBB 1GGBH 5I1IH 2Y7QA 4JZJA 2PYFA 4NKOA 4NWUH 2DTMH 4KFZC 1PD6A 4YDLB 5HGHB 4LKXB 1A6TA 1KTDA 4FFYH 5KVFL 2V7NA 1MCOH 2X4SA 1ODAA 3QUML 3ZDXF 3CZJA 3IRPX 2AW2A 3QAZB 4OCYL 2UZYB 5DMYA 2D31A 3OPZH 2F54D 1YQ2A 1BAFL 2CIKA 4FFZL 3TH4T 4QCIA 1T1ZA 5CUSL 1M6OB 3GIVB 1XCQA 2VZOA 3MZGB 3PWLB 3ZLQC 5JQ6H 5KSBE 3T0EC 2DBLH 1BGXH 5FXCH 3FRUB 3HMXH 4QOKA 4RAUA 1WC7A 3N1FC 1UWEH 3Q5YA 5CEYB 5MENE 3W9EA 1PZUB 1MJUL 1UZ8B 4U3XA 5H94B 4JY4B 4HK3N 1UG9A 4R96A 5EU6D 4M6MH 4PJ7A 4Y19D 5BCAA 3PQYE 1H3VA 4KGJA 1C08B 4JZNB 3BUYB 3F7RA 3BISA 5ACLA 1GGUA 2VISB 3NGBC 3MLRL 4V1DB 1QFWH 2EC9T 1I3GH 4JANA 4Z9KB 4POZD 4DVRL 4X5XB 5GZOC 2R0LL 2MCPH 2ORBH 4K8RC 1QRKA 3T4YB 3CK0H 4PJEE 3WXWL 2A74B 1UYWL 1Q1JH 3MQIA 2NY5C 4PJFB 1OTSC 3ARBD 4PJHA 4LEXL 1JTOA 2XPGA 5DGQA 4JJHA 4AH2A 3O3UN 5D72L 1MFDL 4S1SH 5T1LD 1TVBB 4QRPA 1I9RH 7FABL 2C3HA 3ULVH 2AJSL 3HE7D 1RUMH 1XIWA 1VEMA 3EO9L 3LPWA 1A1OB 3PDGA 1P5UA 2FL5B 4Y5VC 5F21B 3KPTA 4BFBD 4HEME 5K9QG 2EDNA 2Z35A 1TCMA 3NABL 4GW1A 5E2WH 4JLRB 3DVNB 1A3QA 1KCUH 1MIEH 3TM6A 2NXYC 3U4AA 5FEBA 3TEUA 4WHTA 1BD2E 2BHZA 3IS1X 5I19H 4L29A 1LQVA 1D3CA 2BCKA 1RZIA 5CIPA 4K7FB 4G8EB 5KSUA 3RJDA 3BVNB 2Y7QB 4JZJB 3GJFH 4NKOB 5FV1L 1FGNL 2CO6B 3DUUB 3OAZH 5TGBB 3GBNH 1FE8H 1W2KT 2A73A 5K9KA 1P2CB 1U8IA 1E4KA 1QRND 2EXWD 5HGGS 5J7CC 4MA3A 1KXTB 4K23L 3D2UB 1QBBA 2FO4B 4DKDC 4L8CB 5J12B 3SO3C 5E00A 4Y7MA 1SJEB 4LSQL 4XP9L 3CFCH 1NGZB 4UDUA 3NGBB 2Y23A 3B9EA 1U3HC 4U6YB 2EH7L 4FFVD 1IEBA 2D03L 3HR6A 2DTML 3H8NA 4HHAA 5LXGH 3MJ8A 3ARQA 5HHQB 1FFQA 1XF1A 1P7HL 1IKNC 4RMQA 1QVOB 5AG8A 3L3IA 2OR9H 1JF6A 2AXFB 1KCSH 4NJAL 4OLVH 3BD4A 1MCPL 2ICCA 1H3PL 3B2UD 3EOAB 1PDKA 5KS9A 1ZMYA 3VI4F 3GK8H 5J9PA 1I8KB 4F9PC 1AY1H 3UTSE 5KZCD 3NAAL 3NZ8B 5DJ0B 4NKMA 1EXUA 4LCIH 4AG4H 1T1XA 4MGXA 1UFUA 5HJ3B 1GGYA 4OZFA 2WIIA 1EO7A 2V9TA 3D39A 5JDSB 4PBVC 1W8OA 3DX8A 1BREA 1KIRB 3BO8B 4DAGL 3MNWB 2IFFL 2XNAA 1B0GA 4QNPE 2ADIA 4I3SH 4I0PD 3O6FB 4H25A 4LAQL 4NRZB 2IPUG 1FSKB 2O5YL 4L1HA 4AMKH 5IW1B 1CFSA 3NA9H 4HS6A 1Y6MR 5D1ZD 4QWWD 1KJMA 3C6SA 3MV7D 4XPHH 5CEZE 1QSFA 1PYWB 4GKSB 1UM6H 2P43B 3VGBA 2LE9A 1NDMA 1HHKB 1M7DA 2M26A 5F7KC 3Q6FB 3JWNC 1QSFE 5ANMB 1QFPA 2PN5A 2WBKA 3IU3B 4Y2DD 2J8HA 2UWEE 1ZLVH 4OLYL 4MDIA 4Z0BH 1WZ1H 3MUY1 5INCA 5AZ2H 1X3DA 2YK1L 1HH9B 4GKNB 4QRTB 1NGWB 3ARBA 4DW2H 1ETZA 5AUMB 3FHAA 5E4EB 1FRGL 1JPSH 2DDQH 2Y07H 2DLHA 4JO4L 1EMTL 3FRPA 2FATL 4L3ED 4EUPA 3R06A 3BQUC 1ITBB 1DFBL 3HMWH 3G04B 2Z9TA 2FX9H 3BWAB 3S35X 5F3BB 4WFGD 3PDOB 2VXSL 2WQ8A 3V52L 5JORB 1HHIA 4YQXH 1V3MA 4UBDD 4YUEH 3HZKA 4YHNB 3GSNL 1NL0L 2YD7A 5D70H 5E6ID 3RA7H 5F9JA 3SJVE 4U0RB 3V7AE 4L4VE 5INDB 1CGXA 1U58A 1CZ8H 2B7DT 4MMXC 5DYOA 4JM4L 2QSCL 4ODXA 5BRZD 2VDML 1RZFH 3QR2A 2HT2D 4WHYH 2Z92A 1BQHA 15C8H 4QTIL 2EO1A 5CJXA 1RFDL 2XZCL 1FO0H 1AQKL 5IBUG 3WIHL 3VGGA 1N2RA 3SKJL 5GS1A 3GKWL 2ED7A 4EOWL 3AXLA 4LQ1A 2V2TA 2V9QA 4J2XA 4UOW1 2QKIA 5JXAH 3TO2A 4MJ4A 4OF7A 5C0ND 4HUMB 4YDVB 3KPMB 1JZ3A 2PYED 1F90L 4PV8A 4PJAA 4O00A 4XNZB 2B8OT 2YPLA 1YY8A 1G7JB 1ZHLB 4N0YH 5C0CE 4QHNB 3DV4A 4CN6A 4XP4L 5E2VH 4XPFL 3MC0A 5D7LA 1A7RH 3U7AA 4FOMA 2BOBB 4QRTA 4YBQC 2RHEA 4L4VA 3DMMA 4U1HB 3VD7A 4ZOBA 4PGDA 3RU8H 3V4PH 3QJFA 1XGUA 3RWGA 2Z31A 1JWMB 1I85C 5I2IA 3C6LB 3A67H 4OT1H 2DYPB 4FQCH 1KB9J 3TZVD 4CADA 2WSKA 5IB1B 2G60L 4LLMB 4R2GD 3M1BB 2PKDA 2AJYL 3EW3B 4JO3L 2JF1A 4MA8L 1CS6A 5HHMA 3BP5B 1INDL 4M62L 1BLNB 4JKKA 1WIUA 4JHAL 1DEEB 1IM3B 3PP3K 5FK9A 5SV3A 2VXVH 1NUNB 3HKFA 1U8QA 1EVUA 1PBYA 3B2UC 2DAVA 1WFNA 4QHMA 3WLBA 3HMXL 5GRYA 4CVXA 5L8KB 4QRRE 5HGBB 3NH7L 1PW3A 2P5EA 3QUXD 3DROA 3UTQA 1I7TA 2JCCF 4PRBB 1KCKA 3LHPH 4KAQH 2FHCA 3MYZA 2DKUA 4MXWH 1RU9L 4P48A 3PDOA 1G6RL 4N68A 1RIHL 5HJ3A 1KJ3L 3S5LA 4I2XA 1G7MA 3MR9B 2NY7H 3D39B 4JZOA 3H7LA 5EZJB 4QXTB 5C08A 4M7LT 2VZ3A 1QTYT 2XKNB 3MROB 5F89A 2DQCH 4EIZC 2IMNA 2XG5A 1V7NL 3NZHL 5BVPL 4OCRH 1A3RH 3LQZB 3H42H 3HB3D 3OXSB 5FHBL 2K1MA 3QHTC 4NQDD 1YNTB 4L4TD 4I3RH 1SM3H 4S1RH 3SCMB 4U2ZA 4RRPG 3VXRB 3QXDB 1TJHL 4XBPA 1S7WA 5MEOB 1KCSL 1FZMB 4FQJH 4K3JH 5F7FA 3P0GB 3VMPA 4LLVB 1JRHL 4Y4KA 5DEFA 3NPSB 1GGIL 4PB9L 1FCGA 3O0RL 1F4YL 5IROC 2ZOLB 5FCUH 3VFTB 3UPRB 1X5KA 1T2QL 1J1PH 1WZMA 2C1OB 5D7SH 3Q6GL 3D85B 3IDMB 2JE8A 3MCLH 4HFWA 3ZDZE 1ED3B 4XVUD 4HV8A 4CU7A 1CXEA 3UJTL 5FF6B 4YDIH 1UM4L 4R6UA 4XPHL 4PJHF 4YNYB 3UXFA 4GRWB 3VMOA 2WIIB 4JRYE 1S5IH 1L0QA 3SHSA 3RP1A 3V5DA 1G7LB 2AQ2A 3IDXH 2DICA 4WFEE 1HE7A 4OD3L 4AMKL 4OFVA 3M1BA 3C60C 1OAXL 1IAOA 5F1OB 1YMME 4Y5VA 4F8TA 4IJ3C 4K94H 2YD9A 3QA3B 3QUYC 4ELMF 1CFSB 2H32B 1BOGB 3DI2B 1ZT7A 1KN4H 2Y06L 1A6WH 2QV2A 4R26H 2CUHA 2NY5L 5E9DE 2UZXB 1SY6H 4NPYB 3ZT5A 3HPJA 4HLZH 2Z8VC 1JHTB 4XT1C 1E0OB 4L4VD 3OKOA 4L3CA 4OZGF 1Z9SA 1JGEA 2RJMA 3W11C 1YY9D 3RWIB 1S9XA 3LEVH 2IC2A 4M8VA 2L4OA 5J13B 3TT1H 1I1YA 4LRNL 3RDTB 3OKMA 3BAEL 1XF4B 3GM8A 2YC1A 3JBG7 2ZWLT 4X5XA 3U0TA 1SVZA 4L3CB 1HHGB 1AGEB 4JGUA 1CR9L 4WFHD 2HRPL 3LD8B 3ZDYF 3MRPA 4GMSL 3OGOE 1A4JA 1I1RA 4JFYA 1VSCA 1QA9B 1C5DB 2GK2A 3G6DL 3H9SD 1XGTB 2PYEE 3SGDH 5FYJD 4FP8H 4BQ9A 2NCMA 4EOWH 3MGTA 3BH8B 5EU6E 5H94A 3HE7A 3QUMA 1RZJC 1NQBA 2VO5A 4WU5B 1JGVH 3TT3H 2VSCA 3AMLA 1UCBH 2A1WH 2A9NH 2FL5A 5DHVH 3WLWC 4LLMA 4GT7A 3IDIA 5D6CA 5D6DC 4ZDHA 3TBVB 4OCSH 1IMHC 3I75A 4FQ2H 5D5MF 1YEGH 1KCLA 3JTSA 3QPXL 1XF3B 4OFPA 4AENB 2C1OA 3MRLA 3PV7A 2VLRB 1CFQA 3GMLB 2D3VA 3ZE2E 4B7LA 2SEBB 5KSAC 3SKJH 5C0AA 1FAKT 3U36A 2H6PA 1JFQH 1EEYA 3JZ7A 4UB0L 5D1XC 2H26A 5IVZA 3U0TB 3O9WA 5DMIH 1J88A 5L8LB 1MHHA 2AKRB 3HC0B 6CGTA 5GGSA 4S2SB 5I1IL 5GRWA 2AK4A 2X4TA 1W72L 1YC7A 4WI8A 1F3JB 2Y36L 3QCUL 1M05A 4NHUB 4PJBF 3AREB 4ZS6D 4PTTB 1A2YB 2BJMH 1OAYL 4NQVB 3UTSD 1U2HA 2JCCA 1QSEA 2X1OA 2E8ZA 3DMMB 4WFFE 4ALAL 4YQXL 4FQ1H 3C5ZD 5IFJA 4KJWC 4I5BA 2PXYA 3EOTH 4WWKD 1AXSB 2YBRA 4KTEH 2DWEA 4BFEA 4KJYB 5I1EL 5DQDL 2J4WL 5E7FA 4Z77B 4NQEB 5D1XA 2VUYA 2YR3A 4N90D 35C8H 4M93B 3EHBC 2YPLD 1J8HA 3QFJE 2JELH 3EO0B 5D1QD 3FMGH 2IQAA 4F7TB 3LMJH 3F5WB 4KTEL 3B8YA 4U1NA 3TCXA 1U36A 1IEAA 5D7LD 2NXYB 3PHOB 4FQXA 2C3WA 3L7FA 4Y4HC 4P2RE 3ZKXC 1A9EA 4RA0C 3VWJB 4LL9A 5LVEA 1EUTA 4EN3A 2OJZH 4ONGH 4RX4D 3WNNA 1AGDB 5C2BH 2AJVH 4U1MB 1I8MB 4Q2ZB 5DJYA 4EBQL 2NY3D 3BPCA 5B3JF 3WJJA 4YDJA 1YEFL 4PJEB 3LRSA 2WY3A 4DUVA 4UUJA 4NHUA 2NY1D 4ZFZB 2MNUA 3MXVL 3VXSE 4XHJD 3MRCB 1R3IL 1LD9A 1LE9B 1INQA 3FTGB 4NHUE 3JV4A 4PJIF 3P9LB 3FT4B 1PKOA 1PQZB 1X7QB 2F9BT 2NYYC 1YNKL 3BXNA 1IL1B 3RTQD 2RGSA 4I9WD 3WNKA 4JFFE 2ITDA 3GMQB 4NQDE 4TTDD 1MRCH 4RQQB 1MFCL 1MCIA 4KI5C 1WWCA 1S3KH 3FCTA 5FFLA 1NGZA 4UDUB 2WV3A 5ECJE 2GJ6A 1TVBA 2OL3A 3L3DB 1BFTA 3OKNB 4GSDH 1J86A 2R4RH 1N3NA 1ZHBA 3MRLB 2ZUUA 3BN9D 4N9GB 4S1QH 5HHXH 4JFEE 4C59B 1MUJA 3NAAH 4R2GC 1HXMB 4I9WE 4IM8A 2QSTA 2EICA 1U8KB 4JKMA 2R4SL 1H0DB 3S34H 3W2DL 4KXZH 5DZNA 3I6GA 4XNXL 1V8HA 3QQ4B 4AK1A 4JAMA 4J1UB 3O8XB 4UAOC 4YX2L 3HPLA 2XFXA 1CIDA 4Y4HD 4KROC 2KQNA 1YMMB 4JFDD 1FORL 1DVFA 1F6FB 5GPRA 5J9PB 5F8QC 1H3UA 3BIKB 1TPXB 1C5DA 1UWGL 4FFVC 5DLMH 5IIEB 5KSVB 3T0VA 5E9DA 2VXUH 2V17H 3VGAB 1YEKL 3VXMB 4Q9QL 5CZVL 2NW2A 4YR6B 4OFDA 2ZJSH 2P7TB 2B39A 4ZOCA 1IT9L 1A6WL 5IVXF 4OV5A 2FHBA 1QR4A 5FYKD 4JR9H 2AK4D 1CFTB 3D1MC 4Q58C 5HD8C 2F54E 1N4XH 2CKNA 4Y4KC 1XZ0A 1X5FA 4BELD 3I02A 1U41A 4TSAH 2C4FT 3IDXL 4Q9CA 1U8NB 5JPNA 1P84J 4XC3L 3E2HA 2AV7B 2A6DA 1D9KC 2V5RA 2BXZA 1ZXQA 3FRPG 3X13B 1MUJB 5BRZE 5IEHB 1DSFH 3U4EB 2A6JA 2BRRH 3FOLA 2Q7YA 1EAPB 3HG1D 4NRXB 4PJXB 1A9BA 4K3EH 3WSQL 2DQUH 4MNQE 4ZQKA 2I5YL 4FA8A 4P9HC 2APBA 4P2QD 4RRPA 5E4IA 4JVPA 1U0QA 1JYVA 4Z7QE 4OZ4A 1F8TH 4Y16A 4KROD 3VI4E 2QQQA 3H9YA 3UTTD 5ALCH 1MWAB 3QDMD 4P9HH 3VDBA 4WTXA 4OF3A 1HQ4A 4I3GA 3MBEC 5C6WH 1FL5B 2VIRA 5B38B 4R7NA 1A64A 2XRAH 1WBZB 4PUBL 4DVRH 1BGXL 3A6BH 1IC4L 5HI4D 1CG9A 4UNVA 1DQJB 3QXTA 5GSRA 1IM3A 2EIDA 5JW5B 1CIUA 2IANB 5HYJA 4Q7DA 3OR6A 4NGHL 3SDAD 3SDCC 5SWZB 4JFZH 5I1EH 4G9FA 3QG7H 4XVTL 3VXUB 5J1AA 5IT2H 3SQOL 1BZ7A 2J7LA 2Q8BL 3WS3B 2OS7A 3V8OA 4I77H 1MIMH 4HWUA 4IOSD 3VJ6B 1RUKL 3ZYZA 3DUSB 5BV7H 1OAKH 5C0CD 3ZE1E 4HGKC 4Y88A 1JHTA 2BSED 5C0AB 1JGDB 3FT3B 5C2BL 3WHXA 5J1AB 4XGZB 2X5PA 1MAMH 4OSUL 4U1MA 5EOQH 3EJYD 5LAXA 4FTVA 1EHLL 2FX9L 4ZUVB 3WIIL 1OF2A 2IAMA 1BQLH 4TVPL 4RNRB 1Q0XL 4XXDA 2EO9A 2X4OB 3SO5A 3MA9H 4NP4H 1CLOL 3MACH 1BIHA 5T1LA 4M6AA 5CEZL 2HJKB 3B8SA 2DLGA 4OI9A 2ZNXA 2NY6B 1KYOJ 1IM9A 2J4WH 3Q0HA 3BUYA 4TVPH 4Z7QF 4CJ1A 1HOCA 5I75B 4A6YA 5CJQH 4HUUA 3WXVL 3X3FH 3QNZB 3R1GH 1T80A 4ELKA 3TJHC 4LCCB 4KDWA 3S96A 4PRPE 1OP5K 2G75A 1P7KB 2AV7A 2V7NB 4Z78A 2F5AL 4JM2B 1Z9LA 4QHMB 4N0UA 1N6UA 4MQXC 4NQSA 5D71H 1OT2A 1YEHL 3EDFA 2EDFA 3HMXA 4KMLB 5I9QB 2ZG2A 3PGCA 2YEZB 3U46B 4G7VH 4XVUC 3MLPA 1JMZA 4G6KL 2HVJB 5F44A 3VFRB 2AK1L 3J8F7 2AABL 2BNRD 3SQBA 3QQNA 2VLJA 3IAGC 3VJ6A 2R9HC 1XIWB 4HBQA 3EAKA 1TJGL 3QIUC 1N26A 3MA7B 4PUBH 4MA1C 4NQSB 1G7HA 3HC3H 4GXUM 3LKQB 3OKDB 2BNRB 2W0FB 1J8HD 4PGDB 1YJDC 4MB5A 1A6VH 3FFDA 4XXCC 4HJ0D 1WK0A 43CAA 1KENL 3ARPA 4LSRH 3BQUA 3T0XA 3SGKC 2EDQA 3MUGB 1QA9A 4GO6B 4P5TD 3DRQA 4R7DB 2NW2B 2WUCH 5I71B 5MP6H 1BD2D 3MR9A 4N0CD 3VXTB 1VDGA 1I8LA 3ES6A 4JDTH 1PG7W 4JFPB 1YQVL 2EE9A 4WUKH 4XRCB 5EO1A 4X6DB 3SDYL 1WAAF 2FO4A 5T33H 2X1PA 2ZUVA 4D8PA 3QULA 4RMWA 3BGFB 2R2EB 3QQ3B 2M1KA 3GNML 3E6FB 2D2OA 4G8FA 1P4LA 2CLVB 4ZAKC 3QHZH 4FFEX 4BSVA 2YPVL 4R96B 1CFVH 1JK8B 3W0WD 1LO4L 4XNUH 2FIKB 3V5KB 5L88H 4O9HH 4WENB 4L5FL 2F53E 1G1YA 2ZJSL 4Y4KB 5DEFB 5B39G 2V5MA 5E8PA 1LMKA 3W39A 1T2QH 3TVMC 4G9FD 4YHLL 3MLSL 3QA3A 3CVHA 4GRWH 5I1JH 2W0LA 4DTGL 3ZTJH 4DOHE 1E6JL 5T1DH 5TH2A 1I1AB 4JPVL 1UZ6E 2JIXD 3H9SE 1HDMA 4YBLB 5IB3A 2P48B 1B6DA 1T2XA 4U1HA 3QUZB 1MCWM 3OB0H 4P2CG 1UZ6F 2W38A 2R69H 1W0WB 2X7LB 5EC2B 5HI5C 3UPRA 4PRIB 2R2EA 3QQ3A 5MENA 5H8DA 5C0EA 4HIIB 4ZXBD 4RWHA 2OI9A 1S7SB 3UJIL 4H1LH 5KSBA 3S35L 5KAQG 2KQMA 1CXFA 5FAAA 1B4JL 5BV7L 3QCTH 1QRNB 4N8CL 3WFCH 2YMXH 3LS5L 4GG8A 2CRZA 2R1WA 4HFWB 5FM4A 1BEYH 1H3WM 5B8CA 1KCGC 1ADQH 2XN9E 4QHLB 5EZIL 2A83A 4KKCD 3UTSA 3VFOA 2WP3O 5FYKL 4NGHH 2WBJD 3H3PH 3F7PC 1OAUL 3VWJC 1NDGA 5IFHH 2Z91B 2BVQB 3RVVD 4LCCC 3RL1B 2PXYB 3OJVC 5BRZA 4OD1H 1Q9OB 3AY4C 4G7YL 1PGRB 1UACH 3G08A 3KPSB 3LV3B 5D9SB 4LGRB 1UWEL 3GJEB 3D69A 1KB9K 2D0HA 2ENYA 1E4XH 3OKEB 2DS4A 4BZ2H 1J87A 3JV4B 5I1CL 4NJ9L 2GCYB 5LXGL 1ADQA 1F58L 4WV1A 2D9CA 5I66B 5EDXA 2VL4A 3EBAA 2Y6SD 1IAIH 4O02H 4XC3H 1EH9A 2RAMA 5GGSB 5J57B 1CFQB 1RIHH 3O2VH 3S3PA 2B20A 3HS0B 5F96H 3LEXB 3OZ9L 3QDMA 1ZWIA 2PO6C 4P5KA 3HNSL 2DI7A 4HCRH 1UVQB 4NYLB 3CSGA 5EIIA 2H26B 4ZDHB 3TBVA 4EQ3A 5IUSA 3UTQB 4H0GA 3ZHDA 3PGFH 3T0DA 3MV8D 4YFLF 1ZOXA 1PZ5B 1KPVB 3BDXA 3PABA 1ZVYA 4O4YH 2VLRA 5AZEH 4IOFC 3V6BR 5C0IB 3LN9A 1Y18B 1ZEAH 3PWUB 4IRZL 1T7WA 3B9KC 4EIGB 1IGFL 3BT2H 2QADD 4J3TA 5E6YA 2OR9L 4JPWH 5JUEL 2JB5H 5D2LA 2BVPB 1N3NB 3NCFB 5IBLD 1T4KA 4HX1B 4ZYKA 3NN8A 5KN5A 3VWKB 3UC0H 4G7VL 5JHLH 4RFEB 1SJHB 2BCKB 2BVYA 3RL2B 2ESVA 3KYMA 1P6FA 1MFAH 2R56L 4MNQA 5FKPB 2YZ8A 5F3BA 1M6OA 1H8SA 3LKOA 3LB6C 2UY6A 1LO2L 5ID0A 3P3YA 4EEEA 1H5BB 3RKDD 3UAJD 1WWBX 5EA0H 5F7HA 5HYSA 4KI5E 3EOYG 2VE6A 3LRSB 4Y1AD 3BJLA 3QWOA 1IBGL 1EEYB 5I15H 2G9HA 3ESUF 5GRJH 1D5XB 1H8NA 4G59A 4YAQA 3P73A 4U1SA 1KNOA 4TQEH 1AP2B 3KPOB 4GQ9H 3HNSH 2CUIA 4CRPA 5A40E 4E41B 5CSZA 1CDJA 3QO0A 1A9EB 5DWUL 1TQCB 2MFNA 2W60A 3QG6B 1A7NL 5DLML 1CGVA 5C07D 3P77A 3DIFA 4R4FH 5D7JD 1F13A 3SDCA 2X4QA 1T4KB 1WWWX 3LRGA 5GRUL 4WW1B 4BSWA 3V6OC 1FL6A 1CR9H 2APVA 2J8UE 4ZNEE 4J12A 5LGKA 3EHBD 5SX5K 1C1EL 5I8OL 4OB5L 4UT6H 5EC1A 3L3DA 3OKNA 3B5HA 4LRNH 3GSQB 2V7HA 3LEVL 2P49B 1NAML 5IK3B 3L3HB 2R0LH 2YUZA 3G9VA 4HH8A 5CAYB 3BXNB 1I4FA 1DFBH 3HMWL 4D0CA 5K93A 1AQDB 2KUTA 1VPOL 4Y89A 4ZXBB 3SDDC 4OGYH 3CCHB 5KSAD 3MRJB 3VRIA 2N7AA 3L3GA 3NCYP 3RDTC 3VW3L 2IQ9H 3P11H 1D6VH 5ID1A 3CFDB 3HZVA 3KPLB 5ICZA 4OD2B 1I3UA 3LDBB 5E8OB 2EDHA 5FDWA 2FIKA 1I3VA 2AK4E 1NLDL 1AJ7L 2BNUB 4U6VH 5DVKA 5TDNA 1UXSB 3V6ZB 5D2LB 1FL5A 2WBJB 2O5ZH 2V2XA 5IKCA 3QAZC 4YC2C 1CG9B 5F7UA 1N0XH 3TZVA 1L8JA 1S5IL 3I84A 4H25B 4B0MM 4NDMB 1MHPL 2HTKC 4M8QB 3MNZB 5E8EB 2ZPKL 4PP2B 3P77B 2NY4D 5BXFA 4I2XB 1OTSD 1P7QA 2NY0C 5KANG 4YHMH 3GMPA 5HDLA 4JHBA 1MEXL 4P2QE 2PR4H 4LF3A 5CKGA 1DN0A 3MLTB 1N4XL 4EI5D 4XX1E 4PGZA 3REVA 3SDXE 1IJ9A 4HS3A 5JHDB 1J1OL 3CX5J 4H1LA 1JWUB 1E27A 1JGDA 1RUAL 3ALXA 3FT3A 4IRJD 2K7PA 3DI3B 4FTVD 4MVBD 3TWCL 4XNYL 5EU6A 1I1FB 4C58B 1LNUB 4HUXA 5FGRA 3GMPB 4GAGL 4EI5B 3V79C 3KXFE 3KPSE 1YMHA 3WUWA 2XZAH 2AJXH 3MRDB 1BD2B 2HH0L 1GOFA 3I2CH 3HLAB 3HG1E 4G9FB 4AQ1B 4Y4FB 2XKSA 2WQRA 5JZ7D 1JGVL 4DTGH 5IJKC 3WS3A 1J0HA 1KIUA 5D93B 5D7IF 2XG4A 1WF5A 5TDPB 5GIRA 2Y36H 4KMTH 1K4CA 3JV6B 4OT1L 4CN4A 1QFWM 4WCYL 2BNUA 4EKXA 5F9WC 3ILPB 4IMLB 3AAZB 1N6VA 3VWKC 1PX4A 4OBRA 4NQUA 4HMCA 5FHAH 3KYNA 1G7PB 5TQ0L 3WE6B 1S9KC 4NUJB 4FQLL 1PY9A 1XGRA 2FWOA 2E6QA 3BZFA 4GKZB 4QHNA 5F7DA 1DBKH 4M48H 4Y4KD 4CMMA 3GFUA 3AS0A 3ARWA 4GW5B 3DLQR 2YEZA 2DQGH 4O51B 4GAYB 4HC1L 4XP1L 3QEGH 2R0WH 2IQAB 3HAEB 3PWJB 2CDEA 4NO2B 3LSOA 4MCZA 1QFWL 2ZUYA 4WDIB 5C0BE 1ZVHA 4MB3A 1OT1A 4P2RD 1OM3L 1C16A 4P46C 1VFBA 3CMOH 2VR9A 3L3OA 3K7UA 2OR8A 2IADA 43C9A 1QKZL 2A0LC 3QIWD 1GH7A 5EBGA 4JJ5B 4APQC 3SE3C 1MFAL 1PZ5A 1OPGH 2LVCA 3K2UH 2C3XA 3DX7B 4CW1B 4O4YL 5HI3C 3C2AH 2EDYA 1K4DA 4ISVB 5D70L 1YEDB 3ULVL 5C07B 4JKWA 5T3ZH 5EZLA 3MLVL 5EUOE 4UOW0 4CL7A 3RVVC 5CMAB 5I1CH 2W1NA 3T77B 5CBAB 4PREA 1W0YT 2JB5L 2IAMB 5DSCA 3U2SB 2JJTC 5DYOB 1XGQA 3U0PB 4YFDB 1BECA 1SYVA 2DQJH 2VABB 5J0BA 3ULVF 4LPTA 2OJEB 1HHIB 3MCLL 5EU6B 4QNPF 1WLHA 5DFWH 4OTXH 3GKWH 5IEKB 4XZUA 3HI6H 5D1ZB 1SVCP 5L7XH 1M7IA 1RZGA 1CICA 3TJEL 3T09A 4FFWD 1Q9WB 2PTUA 1BWMA 4PGCB 3WNLA 3WXVH 3X3FL 4PRHA 4UU9A 1IZKA 5E8DL 2P24A 5HI5D 4F7PB 3C08L 3OAZK 5C70A 3S96B 5E24E 1IFHL 2YHGA 2B1AH 2I60H 3SOBH 4U7MA 5INCB 1OARH 4U2YA 3H9SA 2NMSA 3B2VL 5C8JB 4ZAKA 4Z7NF 4X4YB 3OB8A 1NEZB 3D9AL 5EUKA 1AC6A 3B9KD 2CK0H 3QUZA 1FZJB 1U8LB 2P24B 4P4KD 2W92A 2NY3C 1KEMH 1JZ2A 4NQTA 1A6TB 3CLEL 3UTTE 1LO5A 5B4MC 4L3EB 2NTSP 4H26B 4MS8D 4E5XA 4F58H 1ND0B 2UYLA 2EC9U 3O3AA 2OI9B 5I0DA 1A5FL 3S35H 4OCXH 3VFNA 5C09D 3RWDB 4U1KB 1XGUB 4CNIA 2BXYA 4PTUB 3NFNB 1NAKL 2R23A 2X4NA 3V5KA 5DA0B 1B0GB 3ULUC 4FABH 1XF2A 1VADB 3NH7H 2E27H 5E2TH 3U36B 5GGVH 4ODBD 3O3AB 4OZIB 4O9HL 5IOPB 5L7XL 1R3HB 5CD3A 1EGJL 1MLCA 4YHZH 1GRWA 4PJ5A 4F33A 3C5ZB 2H32H 1B88A 4LSTH 5T5FH 2A6KA 4FABL 4KKNA 2F53A 1M7DB 3L7FB 1CLZL 4L9LA 4HIXL 5TPWH 5FYJL 3MGTB 5DD1H 4XMKL 2XZZA 2Q3AA 5IROA 3LS5H 4G8GA 5I30L 5MERB 2I5YH 4YGAB 4FS0A 5CGMA 2VC2H 3QUYA 3MXWH 5D1XD 4HC1A 1Y18A 1XGYH 5CEXB 4RMRA 4WO4D 5B8CB 3CLEH 4UQ3A 3DYMA 1T6WA 2GTZA 2XY1A 3CH1B 5CHNB 1ONQB 3FB6A 1GIGL 3MLSH 4X9IA 4E41D 1HHGA 4LPVA 4CMMB 1ZK9A 4NZUL 4N0UE 4P46D 2BK8A 1T66C 1MHEA 4HIIA 4YDKL 4EN3D 2ITCA 3RZCC 1FPTL 4P2OB 4QXGH 5CJOH 3IF1A 4G43A 5F1IA 2B1HH 3H0TB 4XAKD 1ONQA 3FB6B 3H7BA 3WIHH 1K8IB 5F1SA 4Z78B 4NWTH 5EO0A 2XZCH 4P46B 1OGTA 5C0JB 2NY2B 4X6EB 5DS8A 4ZFOA 4WFGE 3RVXC 3KPPB 4PG9A 2IWGA 2DRUA 3S36X 3SEPA 3U82B 3TBSB 1AIFB 4HFUL 5HDBE 4NM4H 4M48L 1JJUA 1KULA 4MDIB 1B9ZA 1DBBH 5CP7A 3ROOB 3RU8L 3V4PL 4OLUL 1RIUL 4XAWL 5KW9L 4NBYB 1JL8A 1G7LA 1SJHA 4LCWE 1VGEL 3ECBB 2VQ1B 4ZXBC 4J1UA 1UXWA 2DWDA 3LN5A 1DP0A 4DN3L 2X4UA 5CILH 4H0IA 5E2JA 4F57H 5HHMD 5GS0H 4HDIB 1W0VB 4HT1H 1M4KA 2CO7B 4HKZA 4C54A 3B4NA 3CDGA 3M8OL 3T65B 4XHJC 3DJ9A 4ZSOE 2JJSA 4EI6A 3H3BC 4FFWC 2X4UB 5T3ZE 4PTTA 3LS4H 3MNVA 3CIQA 3IDJA 4LVOC 5J89A 3QEUA 3DVGB 3K8MA 4RGMB 3REWB 3TYGL 5IB1A 4LIQH 3QO0B 4HZAA 5EBLA 3QDGD 3K74B 1IGTB 3TFKC 5D7JA 1HINH 2W9DH 2NX5B 3RX7A 2B5IB 3SDAC 1T1WA 4KWUA 1EFXA 1UZ8A 1DVFD 4Y4FD 3EFDH 4Y5YB 2B0SL 1YJDL 5LGJB 5D1QB 4D3CL 2DMKA 1LO3L 3NIGE 43C9B 1JE6A 1JPFB 5BRZB 4YHIB 4PJFE 1TFHA 3OKLB 4K3HA 2XTJD 4WW2B 1MLBB 5HGAA 1M05B 2BMKB 1UADC 1CLZH 4UILH 1YY8B 4LFHG 3QXAB 5SWSA 5KOVC 4L1DA 4RDQF 5E0QA 3FB5A 2ATKB 1X6NA 5CJXC 3GSXA 4TVSa 2VXTL 3V4VL 2AQ3A 1G9NL 4L8CA 4YDJB 4DCQA 2NY1B 3C9NB 5TQ2L 2C4XA 3BKJH 1G0DA 1VACA 3VD5A 3GMOA 3VFWA 5H35B 3EO0A 2VR4A 1MJ8L 3FO0H 5DK0B 4JKPL 4XP6H 5IQ9A 3ZHKA 1XF5A 5E4EC 2IQ9L 1U8NA 3P11L 5JW4R 1FFNB 4U49A 5C0GA 2YKLH 4UAOB 3FT2A 1TETL 3IFPA 3GSOA 3BOVA 3Q5TA 5DVOA 3BRFA 3VGEA 3CD4A 1YYML 4F7PA 1KIRA 3BO8A 4WY7L 2HN7A 2YMXL 3EIFA 4E41A 1KF9B 3G5ZA 4PRAB 1K9TA 1BEYL 1F3JA 2P5EE 2FEDD 2WW8A 5ERWB 2F8XC 3DHMA 3O2DL 2NX5A 4L8SC 1BD2A 1V7ML 3MRCA 4DAGH 1EA9C 1F6LL 4PP1C 5GZOD 3KPLA 1UKQA 1N6QL 1FZKB 1LILA 2F54A 2BY2A 2FBOJ 3FONA 5EFIA 1NCBL 2FJGB 5I1LB 1FFRA 5ESAA 1JGUH 4GRMA 5DZLA 1NC4D 1X9QA 4H5SB 4OFKA 3ULVE 3U1SH 4BSWB 1OB1B 3KYKL 2AJ3A 2H45A 3FN0L 4HIJA 2W91A 3KNBA 2ARJQ 4YHLH 5FYLH 5DHXB 4PJIA 1ZGLM 2QKIB 1DLFL 3FFCA 1JF1A 4JPIA 4ONFL 5F7MC 4K55A 3JTSB 2A6IB 1F11B 1X5IA 2GJ6E 2HFGL 2ILLA 3DRTB 2H32A 4X4XB 3EYQD 7FABH 1HZHL 3H2WA 1TNNA 4OZ4B 4YHOL 5FYLD 5HHOB 2VLME 5E94A 4EN3C 4WDIA 4N8VB 4JR9L 4LLDA 2ERJB 1MJJB 1LVEA 3DSFH 1YMMD 4JFDB 3LKSA 3K4DA 3R0MA 2DLFH 1UYWH 4XC1H 1U93B 4NN7C 3GSXB 4P9ML 5FB8B 1PQZA 1K85A 4U3CA 4X8JB 4NHCH 1JBJA 2V5YA 3B3IB 4ZTOH 1NCWL 1L9MA 3RDTA 1P9MA 4UI2A 4YHYB 1MREH 2Q6WA 4BA8A 1GJIA 4UQ2B 4YO0A 3IAPA 2QADB 1U8MA 4ODUB 3DYOA 2W0FA 3DO7B 3ZO0A 4NUGH 1IEHA 4PJBE 4NO3B 3MOBH 1JHLL 2GCYA 4D9LH 4L8DB 2NY0D 4YDKH 4P2RA 1FYTD 4XB8A 3MBEA 1RHFA 3WNMA 4BFIB 4NZUH 5HD8D 4JFFA 3WL9B 3CAFA 3BKCL 1I1AC 4H20L 4KTYA 4NT6A 2VLJD 2GK0A 3IU4L 3IU3A 5DR5H 3WUWG 1GZQA 3QIUD 1EIBA 4KRMB 1IAKB 4BUHA 5E6IC 4Q6IB 4S1SL 3KYAA 4KZEL 3LKNA 2X44D 4UINH 3BZEB 5JMOC 4LVHC 4OUOA 4Z7VB 5HHOA 4WO4A 3ARFD 4EUPG 4MJ6B 5HHXL 3EYSH 3ZE0F 3LKSB 3MTRA 3THML 1G7IA 3CK0L 5MHSD 2PF6A 5HVHB 5F97E 4PRDB 3MV9A 1RURL 4HUWB 3C09B 4TUKL 3SBWC 3BPCB 4N0RA 3P0VL 3FRUA 1RK1A 3RI5K 1UM5H 1G84A 3LSOB 4MCZB 2AXHA 4AG4L 4EBQH 3TJHD 5BS0E 3CC5A 3HPLB 2H8PB 4HIHB 5JORA 1RHHA 5D5MA 4V3DB 5F7EL 4MD5A 5J8OA 2KBGA 1KTLB 3P9LA 5H37H 4MDJA 1J12A 3FQTB 1CF8H 4XH2B 3RVWD 4LLVA 1KUMA 4OF5A 5DRNB 2VXTH 1JCKA 2VLLB 2PW2B 1G6RA 4K7PY 1DUZA 5D4QA 2EC8A 5L0QC 1NGQL 3CXHK 1UB5A 3WMSA 2VLRD 4V2BA 4CNIB 5F96L 3FN9A 3AM8C 1DQDL 1U8JB 3MV11 3TNNB 3MA7A 3MV8E 3E3QC 3CLFH 4OZGB 5DMKA 4HIEB 4WTZG 5EBLB 1U8PB 2LU3A 1EV2E 4MXVF 1WISA 4HZLA 5FB8A 5B4MD 1EZVX 2CGRH 4KVCH 4NZTL 5LQBL 1MNUL 3ARGB 3ORJA 2FB4H 4Z7UB 1AC0A 1WQVT 3TF7C 2PO6D 1RHHB 4ZFOL 5C6PB 4CGTA 5KG9B 4W6YB 4HH9B 1AJ7H 1BIIB 3LCYA 4N5UA 5JNYA 1OSZA 2D7TH 2CKBH 4AIZA 3MRMB 1GPOL 3N9GH 2XNAB 3RZWA 1OL0A 4XVTH 1D6VL 2VWEC 3LN5B 4FQPA 4PGBB 2JCCE 3NMEA 3LPFA 1LP9E 4OLEA 3WFBL 1DUYA 2ICWI 3C5SA 5ALCL 5GRJL 5C0BA 1IAKA 4Y5XB 2VH5H 3IFOB 5I16B 1K6QH 3KS0H 3NZ8A 5CBAA 2FJFA 3P4OB 3VI3F 5MEOA 3RL2A 3BQUB 1HQRB 4KRPC 3WLBB 4MJ5A 2J6EH 2VABA 5IVXE 1QBLL 1FAIH 4YXKL 4LASL 2COQA 4FTVB 1ZHBB 4X6FB 1JNHA 2ZUTA 1CWVA 1PG7H 4HG4K 2VSDA 3H7BB 2AJUL 2P8PB 1BFOA 2WNGA 1QFUL 2ARJB 2OZ4L 2R23B 3ARYA 1X5GA 1U91B 2AXFA 1ULVA 4LCWD 2JJWA 4U33A 5T1KB 4RWYL 1Q0YL 5LGHH 3V8CA 4FQQA 1RZKL 4OJFL 1TVHA 3U7YH 2WM0A 5DD3L 3SBWA 1SJXA 5IQ7H 1NC2D 5CSBA 3TT1L 3RWIA 2AP2A 1NUFA 4UUJB 2R8SH 3K46A 4TRPL 1YC8A 5KSAA 3GMRA 4PJGA 4R4ND 4JN2B 3KGRA 1YN6A 1LP9B 4HQQL 3CH8A 4B41A 3MV9D 3TA3A 1HKLL 4OIAA 4H8WH 1CGSH 3MRBA 2AK1H 5CLTA 4ZS6C 4D9RE 1J5OL 3K0WA 3RX5A 4R9HA 4O51A 1RI8A 3OKMB 5GGQH 1WC7B 5IB3B 3QSKB 3MV8A 2AEPH 1S9WB 4FG6C 2X9YA 2VLKB 3V4UL 1OD9A 1NEZG 4LNVA 4HK3J 1BM3H 3MLZL 4P2QA 3QI9B 1KJ2L 5TPWL 3VWKD 1J1XL 3TC9A 4XNXH 3EYFA 5EO9A 2W9EH 3V52H 4ODXB 3F7QA 4Z0BL 2EDTA 5C0DA 2AI0L 1FDLH 4OLYH 2WLZA 5C3TA 1JZ6A 5GRVL 1E6OH 4UTBL 4YHZL 5F9JB 2Q76B 4MQ7B 3IETA 5C9JA 1H3TA 3MBXL 4F7MB 2EXYC 1R5VA 4M7JL 1WBXB 4OM0L 3HR5B 4CJ0A 3X11B 2OXHA 5AAWA 1KG0A 4W4OA 5E5MB 3TYFA 3AFLA 3VDAA 4C83B 4RAVA 2VKXA 3W82A 4GAGH 4U1KA 4PV8B 3KJ6H 3LKOB 3RVTD 1R5WA 4X80L 2Q8AH 5DI8A 3WS6A 3JWOH 1D6EB 5DF0A 3IFLL 5CJOL 5FYLE 2ICWJ 1J1OH 4KY1L 5C0EB 3GKZA 3FAWA 1EX0A 1MCFA 4PJ8A 1JIBA 1B4JH 4X4ME 4UQ3B 2VZSA 2GY5A 3DXAE 5K9JL 1OCWL 1T20A 1RUKH 1CDHA 1HHHB 4M43H 1NGPL 2VL5A 5FK9B 3KPNB 2CD0A 3C60A 5MEPB 2C1PA 2BSTA 3HRZA 5C0IA 4G8EA 4X7SH 2UUDK 3G6JE 2HTKD 4DZBB 2RB8A 3T2NL 1GXEA 1YNLH 1MCCA 4AEFA 5B39B 4JG1H 5D5ME 3VXNB 2QR0A 2ZCLH 1F45A 4MA7H 2VDKL 4WW2F 1NBZB 5GS1C 4MJIB 5C0CB 4TSCL 1HHHA 3BSZL 4ZO9A 5ID1B 2GAZB 1F4XH 2E7CA 2YA2A 2DWEB 2AK4B 2HWZH 4A2LA 3TYFB 3D2UD 5TQ2H 4HV8B 3O2DA 1KCRL 4XMPH 4PDCE 4X9HA 1A2YA 2DIBA 3C87A 3MROA 1R5VB 1TJHH 3H6JA 4YIQB 3KDMB 3FO2B 1QP1A 1FNGB 3CFIC 1IGTA 3MOQA 1AKJA 3JWDC 4PGEB 3S5LB 2QL1A 1X5YA 2F19L 3G5YB 3I6KA 1KLFA 2OQJB 4J4PA 4WUUA 3QDJB 4MHHI 2D0FA 3MRJA 1CD1B 2NY6D 3VRIB 4JFPA 1AO7A 1RMFL 1LDPH 2L7JA 2W9EL 4U1LA 4P2QB 4X7CC 1E4WH 1UQSB 3P4MA 4KROB 4LHUG 4FQIL 1V3KA 4HKXB 3IKCA 4NFCA 5EN2B 1ZLWH 1HH6B 4EVNA 4P99A 3V7MA 1FNEB 3E6HB 4IMKA 4KJPC 5I8KL 5EPMB 4QRRA 4DUXA 4CU6A 5DRWA 1JGLL 1QKZH 4LVNB 2FDBP 4L8BB 1AGDA 4HMDA 4K3DH 4JM2D 4LLUA 4JQXC 3O11B 1EHNA 3CUPB 3RGHA 2ADIB 4JGJA 4Y5YC 2JJSC 1KIQA 4V1DA 3O3EB 1P7QD 4TOYL 2B4CH 1B0RB 3RIFF 2P5EB 1MY5A 4ERSH 1KJ2A 4GBXC 2CKBB 2FIRT 1R5WB 3FHQA 4PRBA 4ZNCD 3LKRA 3RNKB 5ADPH 2L0DA 4IBLT 2B4CC 4OV5B 3QYCA 1FNGA 4TNWK 5KVMC 4PRNA 4WGWB 3NCBB 5GS2D 3JV6A 1KB5A 5FO7B 1EVTC 1G1CA 4IOFD 3QDME 3BMWA 3CU1A 3L1OL 4PJ5E 3QEQB 2CRIA 1CBVH 1ZANH 2XZQL 3HCVB 4RZCA 2OMBA 1PKQA 5D7LE 4OD2A 4RBPH 5IFAL 1MCBA 4OCWH 2VDQH 2R4SH 3MOAH 2ID5A 4D0BA 1EEZB 3SKMB 5L6YH 1FFOB 1BJ1H 1ZT1B 1RUQL 4LASH 1IGIL 3C8HA 4NN6B 1NCDH 3DBXB 2BP3A 3RVXD 3BAEH 3GSRB 1BZ9A 4KZDL 4I18B 5DQ9B 4Y16C 3MZTA 1HNGA 3A6CL 4JREB 4NFDA 1JNHB 5F1KC 3QQ4A 5ICYA 3IDYC 1JZ7A 3LB6D 1KB5L 2FB4L 3QRFM 1KLUA 2BOBA 1TCRB 3EDKA 3EYUL 5FUZL 1FRGH 1JPSL 2EIBA 2D9QB 3DGGA 4YGVA 4C56A 5J11C 1SBSH 4TUOB 3RFZC 1MRDL 3RY4A 4R26L 1CLCA 5KVEH 2V17L 4H8WC 3CX5K 3VXQB 5DURB 5L2KE 2VXSH 3REVB 4K7FA 4PR5B 3T1WA 1WZ1L 1D5ZA 12E8L 3C60D 4FQLH 5IJVA 4N5EA 1UWXH 5FGCE 2X42A 1V3LA 4GH7B 3G6JB 4GRMB 1BQHB 3DX6B 4U1LB 4PS4H 3ARDA 5FKAB 3H9HB 2DDQL 3BGAA 3VXSD 2V6HA 2EDEA 4XPGH 2QEJA 2WMPA 1HCVA 3H9ZA 3TO4C 3WJLA 3QISA 3NFSL 1I8LC 1WFUA 1ZVSB 5IBUB 5HHPA 4A2MA 2OP4H 4MLSA 5EWIH 1QHOA 4HKJB 3CX2A 4PTUA 2HFTA 3I2CL 2VIRB 1S7TB 5B38A 1I3RB 1XF2B 2BDNH 5FGBA 1I7UB 2VDOH 2BVTA 5HYQA 4XXCA 3ZE1F 4BZYA 5JR1H 5BMFH 1LEKB 2VQTA 1K4DB 1KT2A 3E8UL 4OZFB 4MJIA 2E7HA 3H3PL 3BQUD 5DJYB 4TSBH 4U31A 5L2KA 1P4IL 1WV7T 4OBSA 5K9JH 3OF6D 3VFMA 4CVWA 2VDOL 1A7OH 1IC5H 1LDSA 5DJXA 3STBA 4YHML 4W6XB 1MH5B 1R3IH 1AO7E 4LCCA 1SY6A 3JWOL 3DXAB 1S7RB 3NCMA 1A7PL 3RKDC 3IU4H 5FDYA 3LN4A 3MV9B 4HUWA 1SM3L 1GAFL 4M7LH 5I6XB 1L9NA 1PYWA 2R69L 2XYCA 1U8QB 3GSVB 1Q9WA 3EO1B 1NCCL 1HHKA 3D85D 3VXPB 1JNNL 5J3HC 4TSAL 5HVFB 1KPUB 2X41A 1RJZA 2C3VA 3VCLA 1IAIM 1FL3B 2WANA 1JZ8A 1I3RA 1RIVL 1FIGL 3QIWB 5IW3A 5IVXA 4LNRA 4FQ2L 2MPAH 4PJHE 4BM7A 1MJ7L 4GLRI 1ZVSA 1MRDH 1NJ9A 1WJ3A 2A73B 4PJ8C 1P5VA 5C2UB 4P9MH 5GGUA 3WN5A 4UIMB 3RTQC 1S9VB 1I8MA 4M6NH 2Y72A 2VXVL 4LSPL 4Z5RB 4XTRD 5EUOB 4BQBA 3U0PA 5DJ2A 2A38A 4PY8I 3E3QE 4NKMB 5F7EH 1EO5A 3LQMA 3FAXA 2ADGA 2ESVD 4P3DB 1DQQA 3GHEL 3VGHA 2I9LB 3UJJL 4OGXL 1B0RA 5J6HA 4JCMA 3MRRA 4HS8H 3QFDB 1DUYB 4F7MA 2VLKE 1NAMA 4HWBH 4AEIL 4MD4A 1NCAL 4FQCL 5D1ZC 5JOPD 4BFGA 4GBXD 2Z8WC 2GJZB 1BF8A 2HLAB 4H88L 1Q9KA 4ETQA 1KELH 5LWYH 5HHPB 3TGXA 1T22A 5E99L 3UC0L 5JHLL 5T33L 1JZ5A 3C2AL 3W2DH 1IKNA 3DGCR 5C6TH 1A21A 1P4LB 2CLVA 5KG9A 5D2NB 1NAMH 4HWBA 5IFJB 4QHKI 4LSRL 4LEXH 5IM7B 2VWEE 1I9IH 3PWVB 5ISZE 3BMVA 5JA8B 3PL6D 5HGDB 2YZ1A 3CMOL 4OQ1A 4QGYA 5C0AD 5DUBA 2KH2B 3PWPE 1BP3B 2Y5TB 3AB0C 5DQ9A 5FYLL 2EKJA 4HUVB 3RY6A 4X9BA 4P4KB 4PJ7E 1L6XA 4X4XA 1TJGH 3TA3C 1V3JA 4JZNA 1ES0B 3ARDD 5CS7A 1CQYA 3LEXA 3A6CH 4J3SA 4JFQA 3MPCA 4IMKC 3VXSA 3O2DH 1D5MB 1FO0L 3U9UB 3LIZL 1Z0MA 1NFIA 1KGCE 1U8HA 4JRXB 1KLUB 1K3ZA 3RKPA 4PJ9D 1GL4B 4YX2H 3R8QA 4APQD 3WHE1 2WBWB 3CFJA 2OX5A 2X1WL 3P4OA 2AXJA 4MD0B 1BFVL 2UWEA 4UBDC 2OZ4H 3V2AR 2DJUA 4ZD3H 2UWEF 1HSAA 1NFDF 2QSCH 3PWNB 4QRRD 4KKBC 4BZ1H 1FC2D 3OX8A 3PWPB 3R1GL 2Q1EA 1XIWC 2E8YA 3MV8B 1VA9A 4HX1A 3MJ6A 3VD4A 3IFOA 1QBLH 5EBMA 4KGLA 4MMZC 3B6SA 5GSRB 3VFVA 4G3YH 4KHTL 1GHFL 2QHRH 4BUGA 2DIAA 4HS3B 2ZUQB 2W07A 4IIQA 2Z92B 1J9CT 4YHYC 2UV3A 3WLWD 5IB2B 5IW1A 5F9OL 5DRZA 4HHAB 1HYSD 1OGAE 4QO1A 1XF5B 3WO4B 1WT5A 2DI9A 1AGEA 1NLBH 5DJCA 5FYKH 1UGNA 3C09C 1JN6A 1D5IH 1FNFA 3L7EB 5BOZG 3L3KB 3QWRD 2AVGA 4XCYB 1BAFH 2WBJC 2EYTA 1X4XA 1GHFH 2QHRL 3GSOB 3CSBA 3LKPA 4KQ3H 3MYJA 1BBJA 3UTTA 5IB5A 5E08L 3MRRB 5AZ2L 5EOCL 5FGCB 5IB2A 5IMMB 1TJIH 4NIKB 5I74C 4YGVB 3BE1L 1CE1H 1CFNA 2DBLL 3X3GH 1GGBL 4TVPE 4HF5H 4NZDA 1ZLSH 3TH3T 3UBXB 5EUOF 1GC1C 2EE3A 1ZLWK 3VFNB 5ABDE 2XI9A 5CMAA 4RIRB 3IETB 5HVHC 2DIJA 1VKXA 4X9FA 4JQIL 1QR1B 3THMH 3L3IB 1CU4L 5IBTH 4OD1L 1VERA 1WZKA 1HIML 5D7JB 1AE6H 1P4IH 1NH6A 3LH2H 4YBHA 4NOFA 4MNHB 3VXNA 1CN4A 4G6JH 1NUDA 2YRLA 3ARXA 5IMLA 5HPOA 1FG2A 1AR1D 4JFHE 5D7LB 2IANA 3M45A 4M7JH 4LHUD 4TPRL 1QEWB 1AXTL 1KFAL 1SHMA 4Z7WF 4URTB 2ITCB 4OUUA 1YA5A 5KW9H 1RZKC 5K9KB 1P4BH 5TE7L 3ARTA 3RWJB 4PFEA 4EI5C 5LCVL 4K3EL 2H9GB 2PCPA 3WSQH 4OZFG 3G6DH 3BYYA 1UB6A 2YN3A 4R4NC 1NGPH 3TLRA 4JHWH 4MXVE 2E9WA 8FABB 3BIBX 4F57L 5E5MA 4XWOC 4OCNC 4OIIH 1D9KD 2WWKO 3CPLB 4YFEA 3N1PC 1NCAH 2UUDH 4KY1H 3NACL 3ULUH 2FBJL 3VFVB 5CP7B 3ROOA 4GBXB 4N9GA 2F74A 2WK2A 2DM2A 2NX5E 5C0NC 1REIA 3FO1A 4XGZA 5ESQA 4UOJA 1HILB 1MQKL 1YPZB 4L4TB 3V0VB 3WNOA 1YECL 1Z5LA 4XBEH 1XCQB 2Q3ZA 3RWHA 2FJFB 3BPOC 5EU5A 5BS0A 3HZYB 5KVGL 5C09E 2ATPB 4M62H 4Q6YA 4KVNH 4R90L 1FFPA 3DURA 3PL6C 5E5UB 3T2PA 3FJTA 4BSVB 3OKOB 4Z8FH 2HAZA 2IH1A 1P7KA 1A7QH 5LWYL 1VGKA 4MQSB 3BPLB 1EDQA 5HHOE 4DUWA 4K7PL 3D85A 2UVEA 3PWUA 3MJ9H 3CXHJ 4AEIH 1OY3B 1QLRA 4WU7B 1A7PH 4K94C 4M61A 5I73C 2J6EL 1S7VB 2VAAB 5GGTL 3OJDB 1YZZA 1I8IB 3FB7B 3IKCB 2DQIL 4WI5A 3BRGC 3UDWA 1O5DT 3RGVC 3VXMD 2VH5L 1F4YH 5IW6B 1T22B 5IGXH 1DLFH 1HEZB 1Y0LA 5C3LD 4RMSA 1YPZE 4L4TE 3QEQE 3FO2A 1QEWA 4PJCF 5FDWB 3UBXI 2ZCLL 2EE6A 1JUFA 1HNFA 2D7MA 2HT4C 4NNXB 4DWHA 2W9LA 1XGPA 2VQUA 4EJ1C 3QDJA 2GKIA 3DV4B 4G6KH 1KEML 3FO9B 5FM5M 5DRXA 1M7IB 1RZGB 1A3RL 3HC0A 3MUZ1 1T5XB 1A02N 2OTUA 2O5XH 5DJAB 3HE6D 3VU2A 3JVGA 1ZHNB 4HXBL 5GGUB 3WN5B 4R2GB 4KPHL 1TJIL 4W81A 2Z8RA 2I24N 4G6FB 3C5JB 1EERB 4LLWB 5EOCH 3OAYK 5D7SL 1IGYB 4I4WB 1Z2KA 3RL1A 2IGFL 5FYKE 8CGTA 2YPKB 3BH9A 4LLAA 5I18L 3VFSA 4P23D 4AT6A 1OVZA 1TZGL 3P9MB 4PRAA 1NEZA 1VB9A 5L8JB 5EZLB 5IW6A 4UMGA 3P30H 2VDPL 1DDHB 4G7YH 3VFUB 3BP5A 4U6YA 5LKNA 5H35A 3GB7B 4OM1H 5HHME 4U1NB 4OCMC 3BESR 5HI4C 1GYAA 3LN4B 4KHTH 4JQIH 3B6SB 2R2HA 5GS3A 4OZHA 1ZT1A 4KKAC 1S7SA 1T1ZB 5AWNL 2WBJA 1A9BB 2DQHH 3LEYL 4UZGA 4KDTA 1J1XH 3LVEA 4M1CC 2IBZX 4OAWB 2BRRL 1RUQH 1G7QA 2OSLB 4Z76A 3O8XD 5D7JC 3W5MA 3IJSB 4GOSA 4UQ2A 1R3LA 3GHBL 4XPAH 4LIQL 4MQ7A 4Y4HB 4NQCB 4KQ3L 3D3VE 3GSRA 4JLRA 5I1HH 1Z6JT 4MJIE 2NR6C 1CGSL 3LKRB 5CGYC 3RNKA 2AKRA 3C5ZC 1J5OH 4JFQB 1GZPB 4LAQH 1BQSA 3G5XB 2VDLL 4GKZA 2X4TB 1UC6A 2GTWA 2HT3D 3OR7B 4WWKA 4XCFL 4XP4H 5E2VL 4UINL 3KG5A 4LP4A 3QIBC 2EDLA 1IC4H 4F2MB 2DQTH 5C09B 4P3WA 3RNQA 5KANI 4CVUA 2BVPA 3FQXB 4QKXB 4HT1L 5F9DC 2IPUK 1NANI 4DEPC 1DQLH 2DQGL 2DLIA 5IVXB 4W70A 4X6DF 1T89A 4BSJA 2PUQT 3MCKB 3VRLF 3FQRA 4ELMA 1P84K 5TQ0H 2E6JA 3LD8C 3PNWB 2EEAA 4HGWB 4W4NA 3UBXG 3SDXF 5IM7A 1E4JA 1SMOA 4P23B 3MRQA 1RVFH 1GGCH 1E28B 5CKAA 3X13A 5FGSA 4N0FA 2R0WL 4DKEH 4WHYG 3I50H 3LY6A 2AEQH 3DTXB 5I1GL 1KEGL 1C5BL 4L3EE 3O6LH 3QQ9D 3GZKA 4MXQA 5IB4A 4QGTA 4YHOH 1S7XA 3TH2T 4DVBA 5C07E 4XAKE 3FQNA 4K23H 3P4NA 5JMRA 4J8RA 2QHLA 4GW1B 1NJ9B 3RNQB 4X6BB 1U8MB 3EYVA 1QSVA 2OYPA 4TOYH 3HZKB 3TV3H 5HHQA 4GSDL 3BN9C 2HYMA 3KJ4B 3LAFA 4Z5RA 1IL1A 5E9DB 4BFIA 3W0WE 1PEZA 4GXVH 1YNKH 2HKFH 3QB7C 5JIPA 1T0PB 3RAJH 1KCUL 1MIEL 1IGCL 3BSZH 4P0DA 3RPIA 32C2A 3ERYA 4NNPL 2IADB 2RQ8A 3RIFK 4Q2ZA 2AAVA 5CBEB 2CH8A 5TFSH 3SGJC 1L7TH 4S1DD 1XIWD 1G9NC 3H9SB 1MHEB 2F8OA 2HLFC 2F53D 3ETBF 5TGBA 4PJ8B 4TNWF 3MJ7B 1ED3A 2CJUH 1S78D 1K5NB 1R3KB 3DETC 1XR9A 3K80A 2BNQA 1FIGH 1KGCD 4IDLA 6FABL 3F5WA 3CUPA 3D39E 2DQFB 4JAMB 3QUYD 2BVOA 4I8DA 2E6PA 3GM0A 2IFFH 5EOCJ 1ZS8A 4Z7NE 2VZTA 3OG4B 2A6JB 4EQ2A 1TDQA 5ILTH 4WIQA 2K3TA 1M71A 2FO1A 4QT5A 1S7RA 3KYNB 3EOAA 1GC1H 1QLFA 2XWJB 4WI6A 3O0RH 3QIWC 3N1QC 1FZKA 2HLAA 2IMMA 3ARGA 3JTTB 4KKLD 5I71C 3IDUA 4G80A 4M8QA 4NZRL 3DIFB 5TDOB 4Q9BA 5FYJE 4C83A 2P47B 1LE9A 1KC5H 5GJTH 5JW4M 1Q94A 1CD0A 4H26A 4HUKB 4NRYB 4KRPB 2IPKB 2Z4QB 1NBYA 3GO1H 3O41B 4ODTH 5IF0A 4HKJA 2NXZB 3VXUA 2XTJC 3L3OB 4PJBB 2EH7H 5CP3H 1OARL 1FNSL 3CFDA 3HZVB 3RIAK 2Q8BH 4U4BA 3UP1A 3CLFL 3DETD 5JW4N 2ZPKH 3D6GA 3MRIB 4IRJC 4M5YH 1KBGL 2E7LC 1M71B 3GEWB 2OLDA 1NSNL 2ZG1A 3KPMA 3MMEB 4GXUN 5BMFL 2Y5EA 5GS0C 5IK3A 5JLZB 3VH8B 5F9OH 2KKQA 3QUMB 3ZTNL 3A6BL 5AD0A 3B2VH 1WIOA 1RK1B 1IGCH 2MOVA 3QNYA 4NDMA 4I0PA 3F12B 3DO3A 2FR4B 4G3YL 3BDYL 4QY8A 1AHWC 2VR5A 1CD9B 4OGAC 2PTVA 5E08H 2Q86B 3V4VH 3N50A 1DJSA 4WNQB 1RUPL 2ZCKH 3CFJB 3TIEA 4XCCH 3TIDB 3MOAL 2J8OA 2N7BA 3VH8G 4A6YH 3MRHB 4ZFOB 1NBYB 3O41A 5SWQB 4NKDB 5FM8A 1DSFL 1G6RB 5A16A 1I9RL 4WVRA 3DSFL 3P0YH 5D72H 2OQJA 4WUUB 3DVNA 5CFHA 4UT7L 4MXQC 1A1NA 5C0FA 1EXUB 1BMGA 5HDQL 5BS0B 3NPSC 5AAMA 4XAWH 5DA4A 5A3IC 2ERJC 3SDXA 4GAJH 5FOJA 1OAZH 2V5TA 1RZ7H 3HI1B 3PQYA 5C0RL 5DRZB 3RUGA 5C86A 4LSPH 3MRMA 1E4KC 4LCYB 4TRPH 3B9VA 3D3VB 4GRLB 3O81A 3F12A 3KPRB 3BP6B 4XP1H 4FMFA 5BJTA 4JFDE 2H1PL 2ESVB 3QEHA 3P40A 4OJFH 4Q9RH 3BZ4B 3C5SB 5C0BB 3O3EA 1NCBH 3FZUC 5EU7E 1UWGH 2GT9B 1KJ2B 1TZHB 2YSSA 3M17B 2GUOA 5AD0B 1EO8L 4ZFGH 2VAAA 4BK5A 1J05B 2FD6L 4G6MH 5JHDE 4F9LC 2YA1A 3SDDD 4Z95H 1H0DA 4DN3H 4R97B 3QIBA 4U6HB 4IMLA 5GSVA 2IBGA 4ZUVA 1JHKL 5CUSH 4HC1H 1UB5B 3IJYA 4M5YL 1S7QB 1G9EA 3GJFK 4YXHL 3EYOB 5K9OA 1KXVC 2LV4A 4LHJB 4O2EB 4YHKH 4QOKB 5CJBA 5T1KA 2J8UB 3O8XC 2CXGA 2VMFA 4NUJA 1KELL 2GYSA 3UEZA 3QEQD 1I7UA 3FO9A 1HSBA 4Z7UF 3BWAA 5BZDA 1R24B 2C5DC 2I07B 3MRDA 3I6LE 4O2CA 5EULV 2IH3B 5T1MB 3U30B 1IGFH 4HS8L 4NQCA 2QTEA 3ARVA 3UJJH 1CL7I 2GTZB 4JY5H 5EC1B 4JG1L 4Y8DC 1RJYA 1UJ3B 2E9BA 1CK0L 3V5HA 3TN0B 4WTZA 1LEIB 1E4WL 1BZQK 1N8ZA 1FYHB 3FFCD 1LO0L 5JO5B 3MX0A 3TF7A 1LEGA 2P4AB 4P2YA 3RGVB 2GT9A 5JW3H 2W59A 1R3JA 4X5LA 5HYJE 5F7DB 4GAFB 4JFED 4W4OC 3QDMB 2B0SH 2ZP0T 4JFFB 2DM4A 4YBQD 2BSRA 3GI9H 1TCRA 1LO0H 2OCFD 5TDNB 2E9JA 3GO1L 3JUYA 1C5CH 2P5ED 3QUXA 2XXMB 3TNMB 1WBXA 2BX5A 1IC7H 5B22A 3RVUD 1LGVA 4GUPA 2I07A 5DO2C 5GISL 2F15A 1YEIL 4HKXA 1SYSB 3Q5OA 5FUOL 3SDDB 2JIXA 4L9LB 4G6AD 4K9EH 1TPXC 4LCWB 4ZO7A 3AREA 4DKAA 4FQQB 3BI9X 4HZLB 1J1PL 4NSKB 3MLYH 5EIQA 1ACZA 1IM9D 4CADB 3PL6A 3IDNB 5I1JL 3QUKB 3F7YA 1Q9OA 2J1KA 4R3SB 5IESL 1YEJH 2CRMA 1B0WA 2JJTA 4WNQA 1XR8A 1B2WH 4U7SA 1JK8A 3DRTA 3ZT6A 2DQJL 2NXYD 3HUJF 5CGYD 2A74A 2ENSA 2ZSVA 2FX8H 2W65B 5IMKB 2DMCA 2R2BA 4OQTH 1KXQE 5FHBH 1UKSA 4PJ9A 2HLFD 3SE8H 1ZHKA 4JQVC 2XICA 3D9AH 5E1HB 4APQA 2UZIL 3QFJD 3DROB 4FZ8L 3RQ3A 1DQML 1QQDB 1U93A 5KZCB 3L3KA 5GGSY 5HGDA 3WBDA 2BSTB 3HRZB 4KJPD 3U0WL 4G5ZL 3C08H 2DYPD 4OGZA 3VFPB 3FN0H 3PF2A 1ZT4B 2M2DA 3PQYB 3SY0B 5DDHB 2WINA 3QDGE 3DOSA 3FB8B 3KYOB 1A0QH 4YPJA 4MAUH 3VA6A 1KN2H 2E7MA 3BKMH 4WI2A 5CD5D 4Z7UA 3IDNA 2PXYD 5CIPB 1N5YH 2ITDB 2QQLL 4CUCA 1AHWB 2ICWB 4PJIB 3WFDH 5AZEL 2HRLA 3WL9A 2YC1B 4YHNA 1FV1A 4E0RB 4QOKE 1MVFA 5GS0L 4YUEL 1QR1A 4JE4B 5DEGA 3L3JB 3KXFD 3QH3B 3VWKA 5MI0C 1B90A 4G80B 2VDLH 3K8KA 4XWOD 2HVJA 3VFRA 4K7PX 2XPGB 2HFGH 2EDXA 5ESQB 4XVJL 2PYFB 4RFOH 4HIXH 3H0TA 3TBTB 2CR6A 3GMNA 4K8RD 2APTA 4OM1L 4PRID 3PGFL 5I74B 1YN7A 1U42A 2EECA 3GRWL 1AXTH 1KFAH 5F6HI 4QOKD 1HH6A 1BBDH 3BW9A 3KLSA 4QRQA 3SKOB 1BQUA 2YOCA 1NBVL 2M8XA 4OI8A 1K8DB 4MD5B 4D9QD 5DHVB 5DJCB 5EOQL 5I1AA 4LLUB 3QI9C 1UB6B 1HYSC 3K81A 3MFGB 3EFFA 3ZKND 3BHBA 1CGTA 3LH2L 2Y9RT 3P9MA 4Z77A 1WICA 4LEOB 3BIAX 2J3SA 2XTJB 2XN9B 1CLOH 3TESA 4N9OB 3QFJB 5DC9B 5C09A 2XT1B 4WTWA 3ALWA 4OQTL 3DX8B 5I1DB 2H2SC 3OZ9H 5INDA 2VZUA 5TH2B 5IWLC 5EZIH 1UVQA 4NYLA 3O2VL 1M1SA 4YXLL 3G5YA 4E42B 1NUGA 1A3LL 2BNQD 2N1KA 3BP4A 2X05A 4WCYH 1HHJA 4D3CH 1KV3A 3RJQB 1S9XB 3RWHB 3EYVB 4Q97A 4FXLA 1I8KA 4J3XA 1A6ZB 3RWFA 2EXWC 4FQIH 3Q1SH 5DJ2B 1G7QB 4HLZG 4PLJC 1NMCB 4ENEC 1FVCB 2X9WA 4ZPVA 4F80A 4N0CC 5LBSL 1S9YB 3CFEB 4ZPTA 2FLRT 2GW5A 4UTAL 2O5ZL 1JRHH 4WV1C 1FZJA 1U8LA 4Z0XB 5GS2H 1H3XA 2KZ1B 5SWSD 2DQUL 1JF5A 1EEUA 2VL5B 3Q2CA 4I13B 1J0KA 1G7JA 1ZHLA 4HJ0C 4MDJB 4LOUC 5FUOH 4PJXF 4LPCA 5ETUB 2YD4A 2RIKA 4XH2A 1E28A 4DZ8B 2ICES 4JZOB 3STLB 4XPTH 4J4PD 4WUUD 5I76B 3BEWB 1BBJB 3G6JF 4M61B 3WO3B 5DHVA 1JPGB 4PY8J 3WD5H 2H9GA 2H41A 2NW3A 1I8IA 3FB7A 5GRXG 4LU5H 3C6SB 3BH9B 3TN0A 1CICB 5HHNA 3VXUD 1QBML 2HJFA 3DX9A 4QYOB 3DVFA 3IFLH 1F4WL 2VN7A 2Y1VA 3CZFB 1TQBB 2D4DA 1LP9F 1EPFA 1BF2A 3OXRA 1HKFA 5DR5L 4K2UH 4G9DB 1AP2A 3T2OA 3QPQD 2VZ1A 2O5XL 3TP4A 1FZOA 1NFDE 4XBEL 4WI9A 3BZEA 3R0NA 4LSSL 5I8CB 1BVZA 4HIJB 1NKOA 2VYRE 1NGYA 4PJ9C 1QLEH 4RMVA 3JV0A 1R6VA 2Z35B 1FGVL 2LQRA 5EB9A 5DFTA 5ESVA 1U8KA 2HKFL 3O9WB 2LFGA 2B1AL 2I60L 1NLDH 3SOBL 3FFCE 4MS8C 4I1NB 4X5WA 4NNPH 1UM5L 4H0HB 4UV4L 4BK4A 1CFVL 4IRSC 4QXUH 1IZJA 1EJOH 4EXPX 3U0WH 2CRYA 4XNZC 1A1OA 4DZBA 2L7UA 5JOFA 4Y4FC 1I1AA 3VXMA 3PP4L 4TQEL 4BH7A 3D39D 2CK2A 3QHFH 1KENH 4ENED 3FB8A 3KYOA 4NM8H 1Z0NA 5JXED 3T0ED 4JCLA 4HUVA 2AJUH 1DBKL 1A6VL 5K33A 3HNTH 4HPYH 5BZDB 3QZWA 4X8JA 1DL7H 4PJXE 4O58L 2E7LE 4M02A 2RFXA 4Y1AE 1CDBA 3VXPA 4QXWA 1HKLH 3MREB 2PTTA 2FSEB 3QO1B 5I76A 2FRGP 1ZGLB 3SDCB 2NY4B 3IYLW 2AERT 3RVUC 5IESH 4YK4B 3D5OF 1VEPA 5CD3B 4ORGA 3RWCA 1TVHB 3MOBL 5D1ZA 4G6JL 4LHUA 5FO8B 4NUGL 3V4UH 5IEHA 2NNAA 5HHNB 3U1SL 3VRJA 4D8PB 2AEPL 4EN3B 3SDXB 3QIBB 4U6HA 1V5JA 3BKML 3SJVB 4AM0B 3PWLA 1F5WA 4X0KB 4ZTOL 5EBMB 5HHMB 1ZTXH 3MV9E 4Z7VA 3OGCA 1Q94B 4DGIH 2E27L 5E2TL 2ADGB 4P3DA 5JTWA 1RUML 3KNBB 3RZCD 2VQ1A 1VFAB 3KLAB 3QZWG 4J23A 2XWTB 1U6AH 5C07A 4G5ZH 4NKDA 4ZFFA 5B3NA 4H5SA 2AGJH 4KUZL 1GZPA 2R8SL 4R8WL 4L3EA 1FC1A 3GSNH 3MO1B 4OV6F 1KBGH 3NACH 2UZIH 2X4RA 3MRKB 2IH3A 2EYRB 4G9DA 5I75C 4ODUA 4G8IB 4AL8L 3BX7C 1IAOB 1MCOL 3QIUA 5F3HB 5IMMA 4UNUA 3NFNA 4PJFA 1B2WL 1F58H 3V0AC 1TTUA 3PHSA 1NGYB 3GSNA 4JDVA 4A6YB 3PHQA 3ARFA 2YN5A 3RY5A 5AWNH 5EU7C 5ANMA 1IAII 2FSEA 3QO1A 4PJDF 5A16B 3NFPB 4P23C 3SGJA 5FV2A 4RMUA 3GBMH 1JWSA 3PXHA 5J6GB 4U7KA 1JN6B 5L2KD 3N85L 4YEFA 1HI6A 4F9LA 3F58H 1DTUA 1MFBL 1YYLL 1QHPA 1OAKL 4ODHL 1OAQH 1K8DA 1D5BA 1MCRA 3LKNB 3DUSA 1A3LH 5F7LB 3JUZA 1I9JL 1R5IA 4UT9H 4YXHH 2X4OA 1FBIH 3KR3L 3MXVH 5IT2L 3NIDF 3INUL 2I9LA 4KKAD 1OAYH 4ISVA 3QCTL 1KACB 4NT6B 4JFZL 3TO4D 2P7TA 1IILE 2ZUSA 1A6UL 4I5BB 1H15A 5IG7A 3KXFB 4Z95L 5GZND 4C55A 1I4FB 1LHZA 3ULVD 2A9MH 1KOAA 4PJAE 3GDBA 3CC5B 1CF8L 4OIBA 4JO1H 1EFXB 4PRHD 3MGOA 3SKNB 3S37X 3IF1B 4G43B 3MJ8B 1MFEL 5LGJA 3C6LD 4QRPE 3MLTA 1CYGA 2GAZA 3CVHL 3O2WL 4HWEL 3PIQA 4JFXA 3SKUD 3EYFB 4GG8B 5DUBB 2YUVA 2V2TB 1YEDA 3SGEI 2AXGB 2P5WB 5IV2B 5CCKH 4G6AC 1K2DB 5DQDH 1YPZF 3UCRA 3EOTL 5DO2D 3QT2A 4Q6IA 5T3ZD 3MSPA 2IAMD 2VJXA 1UH2A 4JRYD 2X4RB 4KKBD 3MUGA 1INEH 4TN9A 4CBPA 4OGXH 5I0ZA 1F4AA 2A77H 5C08D 5GGTH