4WW2C

Crystal structure of human tcr alpha chain-trav21-traj8, beta chain-trbv7-8, antigen-presenting glycoprotein cd1d, and beta-2-microglobulin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
275
structure length
275
Chain Sequence
VPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR Alpha Chain-TRAV21-TRAJ8
publication title Atypical natural killer T-cell receptor recognition of CD1d-lipid antigens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 76
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2014-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ww2C02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4ww2C01
1U6AL 1S9VA 4LAQH 1S9WB 2WBJB 5ICYA 3OJDA 5HI5D 1MVUA 3MRDA 3IFNL 2OZ4A 5DQDL 2IAND 5FGBA 5BO1H 5HPOA 2V2WA 2F53B 3FO9B 5EU6B 4LASH 5FCUL 4LSQH 2BVPA 3ROOB 2K7QA 4ETQB 1TTUA 3OGCB 1OP9A 4FTVA 2Z31D 4WI3A 2FEDC 4X7EC 3GRWA 3UDWA 1Z9OA 2IMNA 2O5ZL 3Q1SH 2W0LA 1CFTB 3C5ZA 3MNZB 4UZGA 4G6KL 1DBBH 5CUSL 1I1AB 3P9LA 4XP5H 3DX8B 3IKCB 1EEZB 1A1OB 4ZODA 2W92A 2ZPKH 3CGTA 4Y4KD 2YBRB 4PY8I 4NKDA 1GGYA 1RFDL 5F7DA 1UM6H 3BMWA 2FX7L 2IG2H 4BZ2L 2OJZH 4LIQL 3OKEB 3FKUS 3IXAA 4Z7VE 5F1NA 4QHMB 5H94B 3TFKA 5KSAC 4F33B 4KUZL 3TEUA 4PUBL 1I3VA 1NC2A 4G9FA 1FVEA 1BECA 1U8MA 3H42H 4FQQB 4EVNB 1BZ7A 2W9DH 1ZLUK 4LSPL 4JE4B 5BOZG 4MNQA 2EDBA 4PGBB 4Y4FB 5EU3A 3HE6C 2KPNA 4J7RA 2HFGH 4TVSa 4PJEA 4XB7A 4OI8A 1NGZA 1LO3H 1BEYH 1P53A 5FUCC 1IGTB 4WW2F 4N9GA 2HJFA 3I9GL 1BJ1J 3N1QC 2YUZA 3TVMC 4XRCB 5FA4A 4WI7A 1WT5C 5ANMA 1UZ8A 4NHUB 2GI7A 2X4RB 1J0ZA 2VRAA 3HA0A 4PG9B 1KIQA 2CJUL 5IW6A 3BP7A 4WW1A 5DHXB 5DEFA 4N0FB 5HVWA 2DL9A 3AU1B 4P4KD 4ELKB 4DTGH 2CIKA 4GAJH 1NC4D 1U3JA 5DWUH 5IQ9A 1D9KA 4NO0A 4M4RA 3ELAT 3S37L 5IG7A 1UXSB 4JPKL 5CSBA 1F4YL 2WUCL 4OLVH 3CC5B 3CFDA 1RZFH 3KPPB 4KK6D 5EZOH 2ARJB 4GKSB 5L8LB 4FXLA 1NMBL 2NY2B 1A3RL 3MLWL 4MNGE 4ZOEA 4P46A 1F6LL 4PJ5A 3QCVH 1AP2B 1WV7T 1P1ZB 5DFVD 3AB0B 1I9RH 2A6DA 3AFLA 2JKXA 5C0DA 2CMRL 5CINL 1K8DA 2HFEA 3CUPB 4D0BA 5KSUA 3TC9A 4MQTB 1UB6A 5HYSG 3ETBF 4ODTH 2NTSP 2ERJB 5EC1B 4R3SA 2UWEB 1WQVT 4PJIA 3H9SD 4KMQA 1GOFA 4UT7L 1AGFA 1BAFL 1W0YT 3FB8B 5ID1A 3VG9B 5B38G 5BMFH 3D0LA 5C71A 4FQHB 1NMCB 1NFDB 3P0VL 1YEJL 3GJFK 3WD5H 3MUY1 5C0RH 3IDUA 2A9ML 3QDAA 2SEBA 2FX9H 1CGVA 2HA1A 1E28B 5GGUB 2GFBA 4TPRH 4G6JL 4ODVH 1RIHL 1JZ2A 1C08A 4QY8A 3QIBC 4X6EB 1B6DA 4NWTL 1GGCH 4NNYB 2DQHH 1VADA 4ZO7A 1N0LA 4OCMC 5J1SC 1MHHB 2QHRL 1IAKA 1U8KB 2XN9A 3D3VD 1AC0A 1NKRA 5HVGB 4S1RH 1PG7X 3MODL 1JHTA 1I9IL 4G8IB 4CN1A 1OTSC 1QSFA 1J8HB 4GRLA 1QNZH 4OZ4A 3RJDA 1UENA 3K8KA 2G75B 4LKXA 3P9MB 1OF2A 4BH8A 2X4SB 3VWJC 5DRZB 2IBGA 5IB3A 1I7RA 3VXRE 3LHPL 1P5UA 1NBQA 3TVMA 3EO0A 5D7JA 3H6JA 3U0TA 1JF6A 2XZZA 4ZSOB 3CXDH 1T66C 3IT8D 3RVWC 1G0YR 4JY5H 3L5XL 4FQ1H 4HS8L 4G8EA 1VFOA 4GAGH 4PJHA 3SDAD 3DGGA 3P4OA 1LO4L 1R3LB 2AQ3A 5ETUA 2H2SC 5GJSL 3FQWB 1MAMH 2DBLL 2QR0A 4NUGL 5ICZA 1HSAA 5F7HA 5JW4Q 5FYJE 3GO1H 1CD1A 4IRSD 2BCKA 4DFIA 3VXPA 2V2TB 4XH2A 1K6QH 1IC1A 5FFLA 4KQ3H 3OKKA 2JELL 1TNNA 1P7HL 2AXJA 5L6YH 1Q1JH 3CX5K 1WSST 3UJIL 2XZCH 1CGSL 5CJQL 5F21B 1FPTH 1C8PA 1U95B 1J86A 2C1PA 2R0WL 4X8JB 1KN2H 2NPLX 1QRKA 2D31B 2QQKH 4J4PA 2XKSA 3G5YB 5DD3L 3IU3A 1E27B 2AEQL 3QA3B 2EIZA 2XWBB 3VWKB 3SEPA 4NFDA 4MA7H 3IYLW 3VFPB 1IAIM 4PJAF 5LG1A 4KHXL 4F37F 3O6FD 4FN0A 2YA2A 2FJHA 3QFJE 4N9OB 1NCDL 3OKLA 2NXYB 4LVNB 5TE6L 1BGXH 4L3EE 3GJEB 4OFYA 3V52H 5FHAH 3FT3A 3L3OB 5DUML 3FFCE 2W0FA 1L6ZA 5DJ6B 1OAKH 2J8OA 2OJEB 2EE9A 1F8TH 4Z95H 3REVB 1ADQL 1KFAH 2FBJL 5CP3A 3ZTNL 5F8RC 4I9WD 3RNQA 5GGQL 2JJSC 1VFAA 1QFHA 1RZKC 2Z92A 1W72A 5EG6C 1YECH 3QI9C 3SDDC 5DGQA 2CLZA 2VLJE 4XAKD 3DVFA 3VWJA 1HIML 1U3HD 3TA3A 2WMPA 4GS7C 3G5XB 1XGPA 3D5OF 1ZANH 5ITFB 3PHOB 1J0KA 2LU4A 3ZSSA 5HYQB 4B7LA 5JDSB 3C6SA 4F57H 3V6FB 3TWCH 3S7GA 4L4TD 4MB3A 2J12B 1I1CA 1SYSA 1J18A 4EJ1C 1DQLL 5D2LE 2ADIA 2C7UB 2VN7A 4M48H 3KXFA 5ADOL 1JZ8A 5FKAB 5E4EC 3VGEA 3FB5B 2E9JA 1QLFA 1I8KA 3LZFL 4GXUM 2DMCA 5IR1A 1H5BA 4ZUWA 5L88L 2H2PD 4R4BB 3QUZC 1FSKC 3BP4A 4IOFC 2FWOA 2NY1C 1QRNB 4AG4L 3EDJA 2GJ6A 2VZUA 3CLEH 5CILH 5BXFA 3TLRA 3QO0A 3QG7H 3SKUD 4C56D 1M7IB 3U36B 3QPXH 3D0VA 5J13C 3ZDXF 4RQQB 4TN9A 3O3EA 4QXTB 3UO1H 3ZKND 3ZDZF 3TBWA 4MQ7A 3GSVB 2F5AH 4AZ8A 5ERWA 4JPVH 5C09D 3ARWA 4POZC 1NL0H 1QBLH 3ARTA 2R0ZH 1RUAL 5E8NA 5C08A 4OIIH 5C07B 3G6DL 2KZWA 3BPCA 3O8XC 4JDZB 3NFSH 2ZUTA 2DYPA 2UZXB 4JY4B 1UWXH 3HAEB 1AQKH 3SQOH 4OJFL 2R23B 4WEBH 5C0CA 1NAMB 3VFWA 4QHUA 1D6EA 3I3DA 1K4DB 4L9LC 4JM4L 4JZNA 3WUWA 1OGTB 2H3NB 4XI5D 3RJQB 1MI5B 2YXMA 4RGNB 5HJ3A 5KAQF 2AV1A 4K94H 4LMQE 4P3CL 1GSMA 3GUTB 5CLWA 3UP1A 3EDDA 1OTTD 4RX4A 4C83B 4HX1B 3QWOB 2EXYD 4NOBA 4W6XB 4HKXA 1I7UA 1RV6X 1SY6L 1A3LH 4LSUH 5HHVL 5HXMA 2EO1A 3G04B 3LS5H 4K71C 4LPYA 4PBVC 3PQYD 5F96L 1CE6A 2RCSL 3JZ7A 3QI9A 3UTTA 2Y25A 4YK4C 3DYOA 2WIIB 1ZKAA 5EZJB 1HXMA 4PJBF 4K8RH 3C60C 4PB9L 1LEKB 2LFGA 3PWUA 4JN2B 4EEEA 4U1SB 1CXEA 5DD6B 4ODUA 1LD9B 1HYRC 4OQTL 5EC2A 3WNPA 2P8LA 2ZUXA 5EO9B 4YHOH 1T7VA 1F90L 3MA7B 3H9ZA 5JA9A 5I71C 5DTFB 4N0CA 3OZ9H 4OI7A 3TNMB 4PLKC 5I74C 3W0WB 4YZFF 1WCBB 4IHOA 4PJGF 3QUZA 1UACL 4LBEA 3O4LE 4XPTH 4OM0H 1A9EA 2R2HB 2Z91A 1HYSC 4M62L 1JTPA 5F6IC 3T65A 1SEBB 3WXWL 3WDIA 4R4FH 4H1LB 3OTTA 4PS4H 3VXQA 1UCBL 5EBGA 4XXDB 4NZRL 1R3JA 4RFOL 2YWYA 4U3HA 3KR3L 5CEZE 5BRZE 2YD3A 1JV5B 3C5SA 2NY5C 1T3FA 3GSRA 2VJXA 3EYUL 3TF7C 1A5FL 1XF5A 2VABA 1MJUH 3S37X 1RJZA 1S7UA 1TPXB 1G9EA 4ZFZA 3OG6B 4JHBA 3O8XA 4KK5C 1DEDA 5SWQA 3SE3C 1FG9C 4I3SL 5DI8A 1IBGH 4PDCE 3RL2A 3LKRA 1F2QA 4OCRL 1DL7L 1RY7B 1Q9OA 5EFIA 2JIXD 4NO5B 1CICC 2KZ1B 3OBAA 1C5BL 1MIML 2KQMA 3EFDH 2P5EA 3DPBA 1LNUB 4FNLH 4CU7A 2Y07H 3A6OA 5FYJH 4HGWB 15C8L 3KYNA 3UBXB 3MRCB 1H3VA 3Q6GL 4KK9C 1RZ8B 2ED8A 2F5BL 4BK4A 3HB3C 1RIUH 2AK4E 2X1WL 4OFPA 4RMSA 5IF0B 2YOCA 4JM2B 1E6JH 4I0CC 4JY6A 5TH2B 2EDWA 3QDGA 3WIIH 2FZ3B 5EORL 2FYYA 5GZOD 4X4XA 2NX5D 3N1GC 5MEQB 3W39B 2R4SL 1MLBB 1AO7A 4XVTH 1W0WA 5K9KB 5SWZB 3TBYB 4ZYKA 4U1HB 1IKNC 4M9PA 5HI4D 3GI8H 3IXTB 4OZGE 3MACL 3D85B 3TCXA 3GFUA 1G9NC 3QJFB 3RDTD 2IAMB 5JXED 4H88H 5D7IA 2JCCA 4P2OA 4K3EL 3MZGB 4JZJC 5GJTH 3BYTA 2XA3A 5IESL 1A4JB 1W0VB 4JRXD 3VGFA 1IGMH 3QRFM 4F7PA 4LLDA 3HG1E 1H0DB 1K8IB 2X4QA 5E8PB 1R3HB 3GBNL 4CRPA 3RIFK 2VR9A 3RWJB 1Q8MA 4MA3A 4BH7A 4LLMA 2GK0B 3PP4L 4CVXB 3LKOB 3OR7A 5DJXB 5IGXL 4S1DD 1N3NB 5IFAL 2QL1A 1QP1A 1JF1B 4OV5B 3RUGF 3WFEH 2ADFH 4TVPE 1T0MA 3Q6FB 4HWZA 3U9PH 2NY4B 3BP6B 3DRTB 1BREA 3K2MC 3MR9A 3H3KA 4NZTL 3RY6A 2VL5B 2NW3A 2I5YH 4HS3B 4PGJA 3RWGA 2JJWA 3ABZA 1A7RH 4EN3C 4HZLA 4QXGL 3U46A 3SE3A 2NY6B 2IQ9L 1DBMH 3T0EE 1OPGL 4HMEA 2KL6A 4KPHL 3OF6A 4EOWL 4OFKA 4H20H 5DMJB 3GRWL 3FAWA 2ED9A 4BJLA 1RJLB 4XMLL 1M7XA 4YO0A 1KENH 4OLUL 5TE7H 5BVJB 1KCGC 3PHSA 4MLIA 2C9AA 1C12B 5DJZA 5D9SA 5C0EA 1FHGA 3JTSA 4OAWA 1XGUA 2FATH 4NJ9L 3EDFA 4KJWC 4U4BA 2BSRB 2CDFA 4XP1H 3FJTA 4NZUL 3NGBC 4GXUN 4MQSB 3V6OA 1GYAA 2V7NB 1KT2A 3B43A 5GS0C 2X9WA 3BDYL 1EAPA 2VXVL 3FONA 2OI9C 5MP6H 5BJTA 1L9MA 4FQLH 4HF5H 5ICXB 2HTKC 5E5MB 3RWHA 2W0PA 3S88L 3D9AH 5B22A 3R1GH 3VXME 4X5LA 1KN4L 1MOEA 4HUMB 1IKNA 3ULUE 3SCMC 2Z31A 2FX8H 4HIHA 5DC4B 4PJXB 3GZKA 4ELMF 4OZIA 1S9VB 1VEOA 3V4UH 3HZYA 4AIXA 4GBXD 4PJCF 5IBLC 4FQCH 4WVRA 3VXRD 3HMXA 1KG0B 4GO6B 1MVUB 3CH1B 1QHOA 4Y4KA 4U6TA 3EYVA 3MRDB 1OARL 5DYOB 1EAJA 1TJHH 2V2WB 1FV1A 2C4FU 4E41D 3KWWA 2JB5H 4X6DB 3FO2B 1E4WL 4POUB 1QPPA 1CZ8H 2BVPB 5EN2A 1UA6L 4TUJB 4FTVB 3C6LC 4P48A 5F7EL 2A0LD 3HNSL 3VXUE 3X14B 3JUZA 3VE0B 4L8BA 3MA9L 3C5ZB 3MLXH 4YQXH 3BJLA 5DEGA 3P9LB 5E99L 1EZVX 1X5FA 4HS6A 3WFHB 1HCFX 2F8VA 4D9RE 4B5EA 2Q6WA 5F7DB 5L2KD 3OAUH 4G6FB 4P59L 1RULL 1FAIH 3IXAB 1MFCH 2ZG1A 3TZVB 1T2QH 1N59A 2XPGB 4K3JH 4AL8H 4KQ4H 1S7VA 5AYUL 1NC2B 1U8MB 3SKJL 2ZZUT 4QXUH 1CLYH 1N6QL 3BKJL 3GMMA 5GRVL 1CQKA 1MCJA 1F58L 3C2AH 3MLRL 4Z78A 4MNQB 4PJFB 4Y2OA 1GIGH 5I19H 3L5JA 3ZE1F 1CL7I 1I75A 3NCJL 4P4KA 4A6YL 2W07A 5IJVA 1NC4A 2HJFB 3T3PE 4U6YB 4U6XA 3UYRL 3MV8E 3PGDA 4JKMA 4V2CB 2OK0L 4WV1C 1DDHA 1MCPH 1ZHKA 3NFPA 3MRHB 1PY4A 1R3KB 2K7PA 5HHOE 5FA4B 2R2EB 5ANMB 1XCQB 1UZ8B 3VGGA 1EXUA 1SJHB 3X12A 3F7QA 4ONGL 3UMTA 1KIQB 3G9AB 5IW6B 4Z7WA 3VXOA 43C9A 1WLHA 3BP7B 1ES0A 3FB6A 4WW1B 2MTPA 3B6SA 2Q76B 4JN1L 2BY2A 4XWOD 5HYJE 4LARL 5IQ9B 4FQIH 4Y4HB 1D9KB 3G6JA 4NO0B 2X7LA 5DD1L 5HI3D 3SCMA 5I9QC 5IG7B 4Y5VC 1A3QA 4CDHA 1LDSA 3QIWC 3H9SA 4KVNL 4PJ9C 3CFDB 4RGOL 4XGZA 5D7LD 5FYKE 4LLVB 2VLJD 2FIKA 3SGKA 2WLYA 4QNPE 1RK0A 3OMZA 4PLNC 4HKBA 5HGBA 3O81A 4JGMA 3EUUA 1JPSH 4PJ5B 3BZDA 1X7QA 1OAUH 2HFEB 1JGEA 4D0BB 4F9PA 5DRXA 1UB6B 3CU1A 2H8PA 2APFA 1QZ1A 2UUDK 2W0KA 4P9MH 1EHAA 1MHPH 4P9HC 1QO3B 3BIKB 4R3SB 4DWHA 4PJIB 1TQBC 5D2NE 3U1SL 4YXKL 1AGFB 1NBZA 3ZYZA 2NR6C 3MCG1 3MLPA 5ID1B 12E8H 4KMTH 1V05A 4WFEE 5KSVA 5HDBF 3DSFL 1DQQB 3D3VA 2JJUA 1CE1H 2GSIA 2SEBB 5I1KL 3KPSB 3MFGB 4HHAA 3NA9H 4RDQF 2HVJB 4NM8H 4NQED 2G9HA 5KSAB 3LSOA 3HI5H 3LQAH 3T3MF 5SWSD 1C16B 1UKSA 5EO1B 1NUGA 4YDIH 2DI8A 3V5KA 3UC0H 1ZHLA 3SE9H 3H0TB 3B5TA 5K9QG 4NRZB 2DM2A 4NPYA 4WEMB 5E2UL 3EYOB 2Z8RA 2GSGA 4J2XA 2XN9B 4GRWB 4YXHL 4NQSB 4XB8A 4MSWA 1NEUA 3HE6B 3EOAA 5E0QA 1QSFB 4HMCA 4OZ4B 3K8MA 3SDAA 3HAEG 4L8SC 4LKXB 1AD0A 2VDOL 4RA0C 5DMKA 3VGBA 1OF2B 3LPWA 1TETL 5IB3B 3HNTL 4HJ0D 4WV1A 4X4YA 4M00A 5KSBE 3TVMB 1EBPA 3F5WA 1YEEL 4GJTB 4WUUE 5CS7A 5D7JB 5C0AE 1CD8A 3P11H 3H9HB 3U0TB 3VD9A 3QDMB 4LCIL 3TBTA 3X3GH 4IRSA 1PW3A 2BNRD 3D2UB 4KY1L 5A40E 3UJTL 4UOW0 4EUPA 5TDNB 3T08A 2EE2A 1S5IL 4LHJB 1MPAH 5D1XC 2R9HD 4PJHB 3P4OB 2V6HA 3T2QA 4NHUE 2J3SA 2LE9A 2YC1B 1N7MH 3WCYA 5SV4A 3ARFC 1FLRH 2DQTL 4NSKB 4PG2C 1JWUB 3P30H 4I0PD 4KJQD 5ICZB 3O0RL 2KKQA 2OTWA 4H0HB 1OD9A 1W72L 2A74B 4XVSL 4QEGA 5IB5B 4M5ZL 3NFNA 4XH2B 4ALAL 2UZIH 2M26A 1KTRL 3OKKB 4NGHL 3PWPB 3O6FA 4UT9H 1AJ7L 1A7PL 4LSTH 4Q9QL 3MBXL 4UTBH 1BQUA 2ADJB 4MJ6A 4APQC 4MQXC 2HLFD 1UYWL 4UI2A 2FB4L 3V6ZA 2C1PB 4R8WL 4K7PY 3JWOL 2FJGB 3KYOA 4X83A 4WGVB 4FQXD 2DL2A 4F2MB 2EIZB 1X6LA 4Y5XA 3MBED 2AEPH 3KPRE 1N0XL 5TDPA 2BFVL 2MCG1 4DKEL 5I8OH 3FTGA 5KS9F 1OAZH 1KGCE 4H1LG 1J8KA 1XZ0A 1U3HA 3FT3B 5I6XC 5TQ2L 3RWEB 5C86A 4HC1L 1KPVB 2W0FB 3SKMA 2D0HA 1WWCA 3HC0B 2F9BT 1PG7H 1SM3H 2B4CH 4ZTPL 4DN3L 5IM7A 3OR6A 4L4VD 2QLVB 5MEPB 1MREH 3L3DB 4KJYA 2VE6A 3B9KC 4ZG1A 2V9QA 1FNSL 3GNMH 1S7SA 4L4TA 3RZWA 4G3YL 1MF2L 1VFAB 1W72B 1R5VB 2AXGB 1XF3A 4WCYL 1RAMA 4F7MA 1QYGL 1YEFL 1SEQH 3GDBA 3VWJB 5I75C 1P6FA 1XT5A 4Q74A 1MJ7L 2XY2A 1CBVH 1XGPB 1NJ9A 3UBXG 1A6UL 3CX5J 1YN6B 4GLRI 3VH8B 4CAGA 4WI9A 4L29A 3IJYB 2A83B 1WZLA 4Y88A 4C56A 5C0ND 5BS0E 4WUKH 1EO5A 2HWZL 5EB9A 2ADIB 4PBXA 5D7KD 3U7AA 4NQDE 3KXFB 1KEGH 3HZKA 1RZGB 5C09A 1I8KB 5T3XH 5IR1B 1X4YA 2BC4B 2X4PB 3CFCL 2DD8H 4IOIB 1KTKE 3N1FC 5CZVL 4ZAKC 2Y72A 1RZKL 2FWOB 5GHWH 5LGHL 5EIIA 4CVZB 2FLRT 4HWBA 3R0MA 1UGNA 2VC2H 4XNXL 4GRMB 5BXFB 2N4IA 2NW2B 5T1KD 3D0VB 4PP8C 3BSZL 2CXGA 5D7SL 5DS8B 5CD5D 3O3EB 5C3TA 5JR1L 5JIHA 2AI0H 1E4XL 3JV5A 3JUYA 4MQ7B 2W1NA 1INQA 3M1BA 3RY4A 4APQA 5ERWB 3S5LB 5TDOB 3MXVH 3O3BB 3JBG7 1KJ2H 3RL1A 5CIPH 3WIHA 1XF2A 1HSBA 2MCPH 3KNBA 3UZEA 1CF8L 1HKFA 4HIIA 2ZSVA 3EYFA 2HT3C 4JKPH 1JGUL 5TPWL 4PREA 3CDYA 1VGEL 2DYPB 2WBKA 5T33L 3BWAB 2HTLC 5EU7E 4U1NA 4H25A 5HSFA 5C2UB 2LVCA 1LK3H 4I48A 5ILTH 1D6EB 4NKIL 4GG6E 4RMQA 3PQYA 4JZNB 3ES6B 5AEAA 3HRZA 3MGOB 3WFCL 3WUWB 4ZOAA 5AAWA 2I27N 3HRPA 3MYZA 3LRGA 5D1ZD 3BGFC 4R4NC 5F3HA 3E1F1 5IFJB 4WO4D 1FNHA 1MELA 4P0DA 4XHQA 5E94B 1J05A 3K81A 4KZEH 3RDTC 5CEYA 1G7LA 1CL7H 5J56B 4YHMH 1BX2B 4KVCH 4HUUB 4NWUL 4NQVA 4PJAE 4TSCH 3QAZC 4JFYB 2APTA 3B3IA 2R0KL 1FZKA 1JE6A 5DJYB 2NYYD 4Y19B 4HWEL 3JWDH 1CE6B 4Y2DD 1ACZA 3QI9B 3SDDB 1FBIH 3QRGH 4YNYA 1D5BA 2BRRH 3KHOA 4IM8A 2XWTB 1S3KH 4GS7B 1S9XA 2PO6C 4QHKJ 3WO4C 1QA9B 4L5FH 3HC3L 1T7WA 4S1DC 3H2WA 3LVEA 1J9CT 5K9QI 1P2CA 4MD5B 5CZXC 4NJAH 5EWIL 3GJFA 1LQSR 2VOTA 2NXZD 3LMJL 2P8LB 2YKLL 5B3NA 4UBDC 4ZFFA 4HJGB 3I2CH 4RISH 3SPVB 1V7ML 4OGYH 5E4EB 2AJYH 4UOJA 4JFHE 1JYVA 2ICWI 5CJOL 2V2XA 4LRNL 4M7KH 3QUZB 1FSKB 1HH9A 3LB6D 1A9EB 3W9DA 1I3UA 3HC4H 2NY1B 3RHWF 1UJTA 3PGFH 5IB2A 4XMKL 1OAQL 2YR3A 4DVRH 2P24A 4KI5F 3VRJB 2JIXA 2D4DA 4X98B 4XBGB 1AI1L 4JO2H 3IGAB 4I3GA 3QH3A 3VXQB 1ODAA 5C2BH 5J13B 2WUBL 2FR4B 3MCLL 5HHQA 4PR5B 3MXWL 3JV4B 3HUJB 4NOFA 3GSRB 2ORBH 3DYPA 3L6FA 1XF5B 4MJ5A 4JDTL 4YPGA 4LPXA 1S7UB 4L1HA 1TJIH 4ZFZB 2I25N 2GW5A 3O8XB 1RU9L 1NFDF 5F9WB 2VQUA 5DHYA 1FYTE 1J1XL 2AJ3A 3MV9B 2HN7B 3QUML 4G5ZL 3LKRB 4UDUA 5EU4B 5I1IL 1IFHH 2Z4QB 5I1LB 3THML 4G43A 5FDYA 3OB8A 4JG0H 3CU7A 3ZLQC 1JGLH 4P3DB 4BFIB 2NX5A 4L9LB 4GSDL 3RI5F 3PDGA 4NRXA 2O5ZH 4YFLI 3OKNA 3E2HA 3TH4T 1X4XA 3V5DA 2W9LA 3FZUC 4G6KH 4X4ME 4PLJD 4Q9RL 3BVNA 1NGQL 2CK0L 4JEGB 3MCKB 3VGAC 1QTYT 3MREB 3RTQC 1MJJA 1EHNA 2AXHA 1RFDH 3RDTA 5EA0L 4DZBA 3HZMA 5JXEA 4HDIA 4JY6B 2NY5L 5T3ZL 2FX7H 4YE4L 4BZ2H 3LEVL 3QDGB 3CLFL 3CNKA 3MJ9L 4JB9L 4LIQH 4EIGB 3JVGA 3P9WB 1IGFL 3AXLB 4XZUB 2FYYB 4E42B 3JV6A 3AS3A 4D9LL 4QRPE 1QBMH 4JPIB 4JRXA 3VD5A 4K71B 4KUZH 5LQBL 3ULVE 4PUBH 1FRGL 5IVXA 3PP3H 3QIUC 4RZCB 4YK4B 1ED3B 3DUSA 3WLBA 1W0WB 4LEXL 3CFBA 1WWWX 1HHIA 5C9JA 3CVHA 2RBLA 5DK2A 3C60B 4LSPH 1F6AB 2HT4D 4U3CA 3A6BL 3TT1L 1AY1L 1EFXB 2EDRA 5D7IB 2JCCB 3SOBL 5T1LD 1GXEA 3L9RB 1A2YB 5I71B 3QUMB 1H8NA 4XCNA 4LLDB 4XP9H 5GSVA 4Y1AE 2X4QB 5I74B 3N9GL 5HHPA 2ITDA 4MA3B 2VLKB 1I8MB 3QQ4A 5F6HI 3EZJB 1KULA 3WXVL 4F37K 4ZS7L 1AGDA 1U58A 3UBXI 3C8HA 4UB0H 5HYJD 5F6IB 3MLYH 3MRKB 3V5HA 2VXUL 4HSQA 4HWZB 3ZL4L 3TJHC 1G9NL 2DKSA 3T1FA 4JPKH 1KACB 5A2KH 3ARPA 1F4YH 2WUCH 1CFNA 1EBAA 4X9GA 4FFWD 4NCC2 4HK0B 3RWGB 4PBWD 3HMXL 1NMBH 4X0KA 1A3RH 3MRMB 1II4E 3CFKA 1CFQB 2P47B 3NOIA 3IJHB 1VACB 4JQIL 2CMRH 3IFPA 1Q9KA 5CINH 3ZKQD 2XZAH 5LKNA 2WZPD 3AM8A 3DRQA 1CICB 4WFGE 4ODXA 5F89A 1UWXK 4JFZH 1OQXA 2FEEI 4N5EC 1YC8A 5IEHB 3NCMA 4UT7H 1FH5H 1G7IB 1BAFH 1OGAB 3C9NA 2QQQA 5IB1A 4GQ9H 1PKQA 4X6CE 4IMKC 3NH7L 4OAWB 4LCUB 3RU8L 3P0VH 5I15L 3NPZB 4K9EC 1YEJH 4LSRL 4RNRB 4GBXA 1KT2B 1FNEA 3T4AA 5D6CB 2A9MH 4OCSH 3VXRA 1MH5A 4PRHD 5GRUL 1EAPB 1SYVA 3FONB 5BJTB 4UDTA 2XTJE 1ZGLB 4BSWA 3QO1B 4M8QA 4KGLA 3MNWA 3RWHB 4G6JH 5IVOA 2APXA 4UU9B 5D1QC 3DO7A 4O5LL 5AZEL 2VH5H 4E41A 1DCLA 1EJOL 1EEUA 2Y5TA 3Q3GA 4NWTH 4OLWH 5FUOH 5E70A 2B2XL 1ZHNA 3BZEA 4GLRH 5DMIL 2QHRH 1QG3A 5A2FA 2YD5A 4FFZL 5E8EA 4PV9A 4I4WA 3MODH 4I2XA 1I9IH 1IAOA 2FL5B 2QKIA 4IMLA 3TYFA 1WIOA 1WFOA 1NDGB 2MKLC 5B4MD 3W5MA 4JZJB 3WJJC 3GIZH 4M4PA 3WS3A 1JPTL 3LHPH 2ZUSA 4WUUD 4DAGL 5L2KA 4Y5YC 1FV1B 2DLHA 2FHBA 3HHRB 3KWWB 5GS0L 1GCFA 1L7TL 3FQRB 4MXVE 5JQ6L 3VMOA 2BOBA 1HEZB 5A1AA 3L5XH 4HS8H 2IH1A 3MRRB 2EYSA 4YXLH 3UPAA 5DEGB 1MCOL 4KKBC 2FHCA 5D70L 3GSQB 2VQ1A 3OGOE 5FF6A 2D0FA 1IM9D 2J6EL 4K7FB 5GJSH 2Q6WB 3TJHA 2DBLH 1M71A 3MLSH 1OSZA 2DICA 1BBDH 4P2RB 5I8KL 1X5GA 3RX7A 4PRIE 2PCPB 4YX2L 1WFTA 3QXAA 3RGHA 4EN3B 1N59B 3UXFA 1S7VB 5JA8B 1R5IB 4XVUD 2JELH 1T83C 3UJIH 1CGSH 3GMMB 4W6WB 5CJQH 5C0JA 2AJZB 2R0WH 3GSUB 1P4IL 4OGAD 3FFDA 4MS8D 5TFSL 4N5EA 1JI2A 1U91A 3FQTB 3D87B 3BPLC 3B9VA 5EUOF 1Y18A 2R1YA 2AEQH 1NC4B 4UQ2A 4RAVA 3DI2B 1WBXA 4U6XB 1G9MC 4I77L 2OR8A 3BIAX 4Z7QE 3MLUL 3RVUC 4GXVH 2CR3A 4JAMA 4KJQC 5J6HB 1DDHB 1U93B 5CCKL 5D7LA 1ZHKB 1KCUL 3NFPB 1RURH 3NGBB 1KGCD 2VLJA 3SE4C 1NCDH 1PYWA 1TQCB 3ARSA 1H3PL 5TE6H 5TE4H 3FRUA 2OI9B 1I7TB 1ZWIA 4Z7WB 2H6PB 5D1QA 1HHHB 5IHZA 3B6SB 3LKPA 1MNUL 3CXHK 4XC1L 3Q0HA 2HLFC 1YPZB 1D5XB 3B5HA 5HYEA 5ISZE 1J10A 2X7LB 1ADQH 3SCMB 2C1OA 1YY8B 2FBJH 2GUOA 1CDJA 5BO1L 4TRPH 5F9JB 3BE1L 5JHDE 4FQXC 3T09A 2B20A 4LSQL 1URLA 3NPSC 4O02H 1RK0B 3FOMB 4HKBB 5HGBB 3KGRA 3FRPA 3SDXA 1S7QB 1SJEA 1X7QB 4UAOC 3HAEH 1NAMH 3U9UA 5SX4I 1AR1D 5ENWB 3VH8G 1DBBL 3CFJA 1JGEB 2AJVH 4K23L 4HXAH 4XP5L 1U42A 3VXTA 5DRWB 5DRXB 4QRRB 5BS0D 3GHEL 3DUUB 5E2JA 4NQEA 5C0GA 3EFFA 1MCBA 2ESVD 3C6LB 4X8XA 5IW1A 3I75B 5KZCB 2ZWLT 2IG2L 4ZNEA 4BK5A 3LN5A 5SWSA 1DQLH 1VCAA 3HFMH 5DJAA 5HTSA 5ACZB 6FABH 2YXFA 5HVHC 4FP8H 3LZFH 3MJ6A 1E6OH 3H42L 4FTVE 3UPRA 4HPYL 2G2RA 3F62A 5EBMA 5J1AA 1PG7W 2W9DL 2WLZA 2QBWA 2DMKA 2PYEB 5IVZA 1BPVA 2AVGA 2YMXL 1NGPH 3L3GB 3HPLA 3LSOB 1S5HB 3MOAH 1FNLA 1HDMB 2R39A 1LO3L 3CH8A 1BEYL 2D3VA 3S5LG 4PGCA 4AIZA 3V5KB 1IJ9A 1TMCB 4ZDHA 4NPYB 3TIDA 4P9HL 1KCSH 3TN0C 1A6ZA 4YDLB 3T4YA 3GB7A 4DEPC 1RUAH 5MI0C 1WIPA 3ZKMC 3ET9F 4DOHE 4DQOL 2R1WA 3G6DH 4G9FE 1TZHA 4OUUB 4KTEL 1J7VR 4U1KA 4F7CA 1VGKA 3QEGH 5IP4A 5DA0B 3ALXA 3O4OC 4D2NA 4I0PA 4WV1B 4OJFH 4X4YB 1MCNA 5I8EA 3BD5A 3WUWG 3F5WB 5AG8A 1T7XA 4PJEE 5EBWB 4IRSB 1NGXA 5MEND 4AEEA 5F7WC 4OLVL 1RZFL 1A4KB 4EUPB 3NCCB 3ZE1E 4H1LH 2YSSA 1I3RB 3D48R 3L1OL 4QOKD 3L3IB 1BBJA 5DSCB 3VFGL 4P3CH 3VFRB 3L5WA 2EC9U 5I9QB 3LQAC 3DMMC 4NQCB 4XCEA 5FYLE 3QIWB 4PJ9B 4ZUSB 4HIJA 5I76A 4FQXA 1J11A 4S2SA 4ODTL 3I50H 1D5IH 1XGRA 5HDQL 2WM0A 2RCSH 2AV7A 1RJYB 3MBEA 2OMBA 5FHBL 2WQ8A 4ORGA 2Z93A 4EI5C 2KH2B 5LCVL 3JTTA 3S3JA 5C92A 5BMFL 4L8DA 3V6ZB 4QWWD 1REIA 2DKMA 3B9AA 5D1ZC 5E8OA 5EOCJ 4OQTH 3UEZA 4P5MA 1TQBB 4PJ5E 2FX9L 1MCDA 4L4VA 5JZ7D 4HH8A 4ODVL 1ZLWK 2DMBA 4KC3B 2ADGB 4B50A 1ORQB 1NUDA 1GGCL 1U3ZA 2GK2A 4M7LL 4WU5A 2DQHL 3T0EC 2DLFL 4OF3A 2NYYC 4BM7A 5T1MB 4RMUA 3CAFA 4M62H 3WXWH 1ZS8A 3F7YA 4ZS6C 2HJKA 2HRPL 5JIIA 3HS0A 1UCBH 3SKMB 1T7ZA 4NZRH 3CZFA 4RFOH 4YFEA 4HCRH 3P2TA 1FN4A 2VE6B 5JNYB 4WWKD 4QTIH 3S4SA 4YHYC 4Z8FL 5IQ7H 3DXAD 3EYUH 1AGEB 1YJDC 1A5FH 4E0RA 3U30C 4ORZC 1TVHA 2OL3A 3G6AA 4L8SB 4I3SH 4K8RD 4JY5L 3ARBD 3WIFA 5DD0H 4OCRH 3O2VL 1DL7H 2DIJA 3K0WA 2RHEA 1S78D 3T3ME 2FSEB 2PTUA 3KJ6H 4GRWE 3LB6C 2O5XL 5GGTA 1C5BH 1G6RA 4WFHE 3F6IA 2J8UA 3ULUC 1MAML 3WDJA 2YD8A 2ICEA 15C8H 3DURA 5JPNB 5T1KA 5GS2D 3Q6GH 4R2GC 1A6AA 2F5BH 1EFQA 4TUOB 2WIMA 1ZXQA 4PJXF 1CVSC 1A22B 1IZJA 4XNZB 2VLMD 5J3HD 5TF1L 5I17A 3ARFB 2F54B 2GY5A 2XZCL 5EORH 1FPTL 3DROB 2GT9B 2XG4A 1T4KB 2R4SH 4AT6B 1MCEA 4X6DF 1DVFC 4XNMB 1FDLL 3S34H 1JN6A 4HWUA 4AEIH 3MACH 4MA7L 4APQB 1IILE 5D1ZA 3RL1B 1HHGA 5GSRA 2WW8A 3MRLB 4WO4A 4TUKL 1ZLVH 4K3EH 1EHLH 4HIIB 1QBAA 5IHUH 5IESH 2ZSVB 3EYFB 5K9JH 3O2WH 2DDQH 1SVCP 1H8OA 1MVFA 4PJ7A 1CXLA 4H25B 5E1AA 4H26B 3T0EA 4I48B 2BMKA 2VNCA 1JGVH 3CX2A 1T1WA 2EYTA 1EMTL 1KFAL 3F58H 4Y2DA 4OBSA 1ZV5A 5IGXH 1K4CA 1G7PA 3U2SB 3DIFA 2KBGA 5I6XB 3V7AG 5F3HB 2ZG2A 1J05B 1YECL 3GSNA 4PJFF 1NBYB 1BFTA 4U0RC 2BXZA 3B9KB 5IT2L 4NZTH 5INDB 2AKRB 2ATKB 3HLAA 1MCHA 2DWEB 3VFTA 1X5HA 2GHWB 4RIRA 1YQVL 2R2BA 4QXGH 4F7TA 3RZCD 5E1HB 3UTSD 4FQJL 1BQHB 3KS0H 4F57L 3TWCL 2OZ4H 3OB0K 4XXCC 2IQ9H 5DZNA 4YNYB 2K3TA 4KPHH 1RZ7L 4JO1H 2CGRH 1JHKH 4EOWH 5C0FA 3O2DA 3CDCA 3QJHA 4D0CA 4G6AC 3VXMA 2EDKA 4V3EB 3FQXB 3GRWH 4MAYD 2AXFA 4Z7OE 1D5MA 4ODWA 4OLUH 1OP3H 1P2CB 3HE7D 5FIEA 2IWGA 4ZFFB 3HN3A 4S0UC 1VKXB 5CHNA 3CLEL 3SY0A 1YNTB 3IDMB 2YD2A 2QSQA 4NJ9H 1IM3B 1I85A 4FFWC 4YAQA 1X9QA 5BOPA 2V2XB 2PXYC 2VXVH 1HH9B 5F97E 3V4VL 4JPVL 1XGQA 4ZXBD 3S88H 3KXFE 3KPQA 4HFUL 5SX4H 3VXUA 4L8CA 3ZE2E 4GKNB 1KN4H 3BI9X 5D2NC 1BQLL 4UTAL 2A6JA 3GSWA 4D8PA 1YUHB 4X6FA 5HHQB 3PG2A 4M6ML 2GJ6E 1QSED 3BEWA 5ESAA 3LKQA 2E6PA 3L6FB 1L0XA 1BZ9B 3B8SA 4MJ5B 5B39B 4YPGB 4J6RH 2HVKB 2VAAA 2AJ3B 2V5MA 3D39D 4OF5A 1RK1B 3MMEB 2JJVA 1HINL 3C08L 4N90E 4PGEA 4OZHA 1E4WH 1XF4A 5DQ9B 1T04A 1UKTA 5FYLH 1P7QD 1UA6H 5C08E 2NX5B 1AIFA 3HNSH 4IOSD 1BIIB 4X4ZA 2DLIA 3MA9H 3OKNB 1S7RA 3V5DB 3TV3L 1A3LL 3BGFB 1WWBX 4KDTC 3OQ3B 1FZMB 5E99H 3SDYH 1UVQA 5C0CE 3VRIA 1AXTH 1BFSA 2EYRA 3WE6A 5B8CA 5JOFB 4PRAA 3EJJX 5DD5L 2A6IA 1QSZA 1ZSDA 3RDTB 5E5RB 4P59H 1UEMA 5IMLA 2DQDL 4MX7A 3QAZB 4LCCA 3A67H 3BKYL 5EPMB 5FGCE 5T1LA 5HHOA 2VZVA 2APWA 4MDJB 3OPZH 3SKJH 4YHOL 5D96C 5E9DE 3WLBB 3CFBB 4DGVL 1N6QH 3BKJH 4JLRB 3VXSD 2JF1A 2Y36L 1TTGA 4UNTA 2PO6B 3CSBA 3WO4B 1F58H 3MLRH 4U1LA 3QDJD 3OZ9L 3NZ8A 3PXHA 5DDHA 5HYJA 4WW2C 5A2JH 2J2ZA 5F7YC 3NCJH 3AGVA 4R7NB 3V8CA 2CR6A 3UTTE 1IKFH 4XPTL 2XRAL 1J12A 3TH3T 1ZA3A 3RVTC 2WWMC 2WANA 1EEYA 5E6ZA 2OK0H 2VDRH 4PD4K 2APVA 4G7VH 1A8JH 2AK1H 4MNGB 1YNKL 4IRJC 2YPVL 1I9JH 2UVFA 3HZVB 3QNXA 1JPGA 3QQ4B 1X44A 5J9PB 4ONGH 4W68A 3UZVB 3BPOC 2AEWA 3SO3C 2G60H 3D18B 1FO0A 3KYKL 3QEQD 2VB5A 5D2NA 5L2JA 4K2UL 1IBGL 4GRWH 5DD1H 2P5WE 3T1FB 4DUVA 4RGOH 4NNPL 1TNMA 2W65A 3EFDL 3QXVA 4JRYE 3C8KA 4HV8A 3F6LA 3CFKB 2BY1A 5FYJL 2RR3A 3O3UN 1FORH 1D5ZA 4OKVA 1ZVHA 1Q9KB 1KCVH 3VI3F 2H1PL 1FL3A 5HHNA 1I4FA 3UYPA 4ODXB 1RZIA 2Q8BL 3U1SH 2B1HL 4YXKH 1Z3GH 2X9YA 4P57A 2DM3A 3VFUA 1KYOK 4HPOL 2XG5A 1ETZA 4YHPA 5FECB 3LEXA 3VGAB 2JK5B 3RTQB 2VMFA 3P4MA 4I5BA 2P5EE 4GBXB 5IWLC 1JWMB 3VXRB 5I1KH 1SYVB 2UZYB 1AXSA 5CKGA 4JFDE 4BSWB 3NZHH 4M8QB 2DIAA 2EO9A 3LDBC 3MNWB 3KHQA 4WUUA 2VITB 2W9EH 4WU7A 1M05B 2Q86A 4H88L 1XIWC 3QIUB 3T2NL 4HUWA 3GK8H 2DWDB 3DX9B 3BZEB 3QPQD 5E2UH 2BHYA 1ZVYA 3QXWA 1I9EA 5LGKA 1N2RA 4YXHH 5E8EB 4PV9B 4I4WB 4U1MB 4WW2A 1FZOA 2QKIB 4IMLB 1AO7E 4Q7DA 5F88A 2YWZA 2VDOH 4RCAA 1IM9A 3VI4E 4IJ3C 5GS1C 3SDCC 2R1XA 3HI1A 1S7XB 3HNTH 4K9EL 3P0YL 4Q6YA 1MRDH 4HULB 2GAZA 1T0NB 2ADFL 4JG1L 4JFED 4GW5A 1SMOA 1YEEH 3ARED 5C3LD 3U9PL 2E6QA 1FFOA 4EUPG 4LCIH 5D7IE 2HFTA 4QCIA 5CMAA 1T21A 1X3DA 2VXSL 5FM4A 4Q2ZA 1BJ1H 3WHE0 3K3QA 2PTTA 4LQFH 2GQHA 2EDXA 3X13A 1HHKB 4R96B 4OKDA 4MS8A 1SQ2N 1U8NA 2DQTH 1M71B 5CD3B 5EOQL 1W72H 3VFOA 5EU7C 4O2FB 2JTDA 3QXAB 4XVSH 3ULSA 4MXWH 1H9VA 1RJCA 1X5YA 4YWGH 3QFJB 4Q6IA 5TE7L 4Z0XB 4ALAH 4MZ3A 4NGHH 3GHBL 4L3EB 5J12C 1A7PH 4Q9QH 3MBXH 5IEKA 1I1FA 4XAWL 5HYIA 2E5EA 2FB4H 3FFCB 3BO8A 4S0SD 4R8WH 3FFDB 1INDH 1PDKA 4UV4L 4ENED 3QEHA 1Y18B 5MP6L 2R1YB 4AEFA 2EKSA 4G7YL 4UQ2B 2CRYA 4RAVB 4ZUVA 3QNZA 1Z0NA 5C8JA 5LAXB 1NFIA 3D9AL 3QUXC 4JAMB 1PQZB 5D7LB 4GUPB 3LIZH 2VLJB 1N0XH 4FXKB 4JFOA 3VRLF 2FX8L 3FRUB 2BNQD 1HILA 5DZLA 4OGXH 5D1QB 1VENA 4J23A 1QVOA 4HC1H 1Z2KA 2FO4A 2EDDA 3RHWK 2VUOA 4WGWB 5BS0A 3V6OE 2P7TA 4DN3H 3BESR 4QF1A 2FJFA 4MD0B 2ESVA 2C1OB 2GUOB 4PP1D 4YHKL 1TJHL 5LJYH 3SDXF 4P4RB 4XPAH 2HLAA 4G3YH 3H8NA 2IANE 4LPCA 1MCKA 1CZ8L 2VDNL 1XR9A 1QKZH 3DX6A 4WCYH 1G9ML 1QYGH 3LH2L 2ZUVA 2EDOA 2CLRB 5DO2C 5GS1A 4S11A 4YQXL 3MLXL 4DKDC 1OD7A 4Y5YB 1MJ7H 2HRLA 4ZQKA 1J1OL 1AFVH 5FM8A 1JPFA 4OZIE 5GQBA 2Q1EA 1A6UH 1MCRA 5IW1B 4URTB 1YYMH 1DANT 4YDVA 1FVDA 3VD7A 2RFXA 5I73C 2L7UA 2E27H 1U8QB 3RI5K 1T2QL 5TQ0H 4K3JL 4NBYB 3OJ2C 1UB5B 3OL2A 5ALBL 1K3IA 3HUJF 4EQ2A 1KJMA 4OIAA 4RRPA 5CZVH 5EBMB 1RZKH 2DLGA 3FB7A 4RFEA 5LGHH 1Q9WA 1G1CA 5IVZB 3QQ3B 5AD0A 2BRQA 3ARBC 1GIGL 4XNXH 1UWEL 2QADD 3TO4D 4KHTL 3TBSA 1XGTA 5CGTA 3D1MC 3ISWA 5D7SH 4LRIC 1OP5H 4AIZB 5JR1H 1UFUA 3ARVA 3IJSA 3MSPA 4ZDHB 3CXHJ 3MV7D 4KRPC 5MENA 4XMPL 1IEAA 3X11B 3R06A 3OKMB 1RVFL 2I9TA 4NO3A 4X7CC 1BVKA 2IGFH 1YYLH 3EO9H 2XFXA 3GB7B 5CEZL 1GVIA 4R0LC 3O6KL 4X6BA 1LQVA 5J6GA 3BPLB 4QOKA 4QT5A 4U1KB 4F7CB 4LCWD 4PJAA 1JGUH 4LK4A 5TPWH 3HNVH 3ULVC 2MKWA 3U0WH 1TZIB 3DWTA 3NACH 5DT1L 2IH3A 4HFWB 1ZHBB 5CBEA 1QFPA 1L0YA 2X4UB 1U8JB 4R26L 1B88A 4UQ3B 3LKNA 4XBPB 1WBYA 4YHIA 5T3XD 5EUOE 1SBSL 4ZFOA 3IETA 1WZ1H 1P4BL 3DVGA 3LN4B 1U92B 5DK0A 4WRLA 2P49B 4TNVF 2DQEL 3WN5C 3FT2B 4XCEB 1LO5A 3BN9C 3D25B 4N5UA 4NWUH 1BQHG 3MTRA 2X70A 4HEPG 4HIJB 3KJ4C 1O0VA 1TCMA 4Z7WE 5EU5B 4FQXB 1TJGH 2NY0C 4HH9A 3NPSB 1MHPL 1XGRB 3QYCA 2AV7B 2DJUA 3O4LB 4QHLB 3GSOA 2YA1A 5I66A 3G6JE 4ORGB 4UAOB 5I1AA 5ACLA 2H9GA 1OWRM 4MNHA 5GGTL 4MCZB 2XI9A 3H9SE 4KMTL 2YD7A 4MWFB 3BHBB 1PSKH 1P5VA 4ZMAT 3PGCA 1S9YA 4BUHA 1GPOL 2OXHA 1FP5A 3B2UC 1AQDB 5EWIH 3TPUA 1CE1L 4P5MB 3PL6D 3LMJH 3LPGA 3QSKB 2GJZA 5BRZB 3DLQR 4H0IA 1V7MH 4ZO6A 4RMRA 5HVHB 4O51A 4WWKA 3O45B 3PNWA 3LQAL 1AC6A 4PV8B 5H35A 1KJ3H 3DXAA 4Y16C 4MVBD 1BP3B 5CJOH 4YLQT 3UC0L 4LRNH 3SE9L 3DBXA 2Q7YB 3UX9B 3ILPA 3OX8B 5A2LH 2DRUA 3O11A 1G7MA 1WITA 4MDIB 3KPMB 5CP7B 5AUMA 5JOPD 3ARBA 3IF1B 4TTDD 1ZS8B 3F7YB 2HJKB 2MQ3A 2DQFB 4F58H 3D3VE 1JRHI 1AI1H 3HS0B 3S96A 1M7DA 1T6WA 4LRIA 5H8DA 2WUBH 4M6AA 3CZFB 4MAYC 1OOAA 3WO3B 3I6LD 4TVPL 2WBJD 3MCLH 5B39G 2AK4B 4NN6C 4PLOB 5MI0B 5HDOA 4E0RB 4O2CB 2CO7B 2YPKA 3VXNA 1RU9H 2F53D 3G6AB 5EU6D 3QUMH 1J1XH 4YDJA 3WIFB 3V4PL 2XTJC 3O4OB 4O2EA 5I1IH 5I1GH 4MJ4A 7CGTA 3UTZB 1AKJB 4Z7NF 1EA9C 5F71A 3E6HA 5ID0B 3MFFA 4BSVA 4M1CD 5M95B 1I1AD 5IJKC 1AGBA 2ICEB 1ZVSA 1I1YA 5T1KB 3NCFB 3NN8B 2I26N 4KV5F 1S7TB 1Q9LA 2IALA 4OTXL 2VXQL 2WINA 4Q0XL 5EA0H 4UT9L 3NMEA 3DMMB 5I17B 1NAKL 2NY5H 3CMOL 2D7MA 5T3ZH 1LDPL 3LEVH 3CLFH 3MJ9H 1YJDL 4JB9H 1KOAA 1KCLA 1IEHA 3LEYL 4PRPE 2XQYG 5BVPH 3HG1B 2KDGA 4D9LH 2Z35A 5LQBH 4PJBA 8CGTA 5E9DD 1FRGH 5LWYH 1G1YA 2DTML 5HGDB 3WDHA 3QB7C 1IVLA 2N1KA 3L3JA 4LEXH 1QEWA 1LE9A 2EXWD 5ESVA 3WEXB 4EI5B 1N64L 2RAMA 1YEDA 2XKNB 4OLYL 1EEQA 2PW2A 2OMNA 1CGXA 3ULUL 3TT1H 2AEPL 5D1ZB 1AY1H 1BVLA 5IB4A 5GSRB 3OHXB 3SGJC 1GOHA 1DEEB 1ZT1A 4LLUA 1OAZL 1V8HA 4U1JA 4NN5C 2J7LA 4PJGA 1R3IL 4GMTH 5DK3A 4QYOA 1SM3L 1X6NA 5IROA 5KG9A 3T0EB 5BW7C 3LCYA 3RQ3A 3RZCA 1MREL 3UTSA 1T1WB 2VDQL 2ZOLA 4OD1H 1CT8A 3WXVH 3GNML 4ZS7H 3T77A 3EJYD 2PKDA 1CDUA 3DIFB 4I9WE 2P5WD 2F58H 1S8DA 3ARDC 4WHTB 4GOSA 3GSNB 1OY3B 4MAYA 1G9NH 5K9OA 3ZKSD 2NY2D 1CBVL 4XAKE 4U1IB 4U31A 4YHYB 5D5MA 3HMXH 4NZJA 1CLZL 4RIRB 1CDYA 1DQTA 3U30B 4OCYL 2R2BB 4F7TB 4KI5D 4XP6L 1BLNA 1E0OB 4E5XB 2YPLD 5DMYA 5A43C 1C5DA 4HBQA 3LN9A 3H7BA 5C0FB 4L4TE 2F19L 3JSSA 2MHAA 3VXMB 2EH7H 4ZXBA 2BX5A 1D5MB 5L0QB 5IJKA 3TO2B 1L7IL 1NSNL 2D7PA 4Q9BA 2ZCKH 3O41B 4R2GB 4Z0BH 5JLZA 1YPZF 3MROB 5CHNB 1LP9F 2I9LA 2I07A 3SY0B 1JWSA 3NH7H 2H32A 3RU8H 3EW3B 4YAQB 4LLYA 1LK2B 4LSRH 4YIQA 3FHAA 1QSEA 2BY3A 2R4RH 2WWKO 3F12B 3KPLB 2UY7A 2MFNA 2AI0L 4C56E 3PWLA 4WTZG 5GRUH 3PDOA 4F9LA 4FS0A 1XGQB 5DLML 4XNQA 5EOTA 1KJ2L 3D39A 4O5LH 4HK3N 4Z7UF 1EJOH 3VXUB 5C09E 4L8CB 2MCPL 5HY9A 1DVFB 4MD4B 2A6JB 3GSWB 1P7QA 2E7MA 4KK8C 2Q8AH 4D8PB 3DX7A 5DMIH 1Q94B 4B53A 2BOCA 5FGBC 5JXAH 4LEOA 2Z8SA 1J8HD 4FFZH 4X6FB 2ZCLL 3SGEI 2GTZB 4HKZA 4MCYA 3LKSA 1LK3L 5ESAB 3LKQB 5ILTL 2F74A 1CFSB 4JJHA 5FYKL 3UDWC 3VFNA 2A1WL 1X4ZA 2VAAB 3EOBB 5K59F 3BYYA 3DGCR 1JPTH 4PRIA 1YQ2A 4LGRB 3IDJA 3N06B 4FFYL 5ELIA 3RRQA 5GS0H 1L7TH 2GTWA 3OKDA 5JQ6H 4XPFH 1XF4B 1KPUA 3DJ9A 2IQAB 1T1XA 1AIFB 4U6VH 3CSGA 1CL7L 4NT6B 3RUGA 5DJ0A 4HUKB 3CDGA 4KVCL 4UILL 1HHJA 4TSCL 4O9HH 1S7RB 2AW2A 1XMWA 1MCOH 3MRBA 3TFKC 3VXSA 5DHVA 3IDGA 3RVXD 1KXVC 3VRIB 2EYRB 3QDJA 5F1IA 3WE6B 3KLAA 2J6EH 4ESKA 1HZHL 4U0RB 4J3WA 1ZSDB 3PQYE 5FO8A 1JK8B 2E9IA 4LLWA 4ONOA 1XGYH 3RIAF 2DQGH 4YX2H 3DETC 5HHOB 1CGWA 4WHDA 32C2A 3VCLB 4NJAL 2K9UA 4RMTA 1G7HA 1IARB 4G8FB 4RISL 1MFBL 1MWAL 2ATPA 2RJMA 4OGYL 3BH9B 1TDQA 4Z5RB 3KVQA 5FKPA 2X89D 3NZ8B 1CD0A 3T0AA 1MCFA 1UXWA 5HYJB 4IS6B 1K5NB 5TFSH 5DJ8B 5ISZA 4M1DH 3VWKD 2J88L 1XFPA 1LILA 3QEQA 3HC4L 3FO1B 1ZA3B 3PGFL 3PUCA 4I77H 2OTUA 4LOUD 3DV6B 1U8IB 3MLUH 4MYWB 3U79A 1U36A 2NXYD 3RPIA 3PWJA 5HGAA 1IT9L 1H3PH 1TFHA 2PXYB 1FFNA 1A1NB 3KPNA 2BSTA 3O3AA 4NKMA 5IK3A 5KOVC 3CK0L 2ORBL 1MNUH 4XC1H 4NRYB 4K3GA 1DBKH 1B0RA 1TJIL 1FO0B 2K1MA 4P46C 2BVQA 5HYSA 5J4MA 5D2NB 2HH0L 4ELMA 5L2JB 4HW6A 1A47A 5KW9L 1RIVL 3VA6A 4PJCA 1IFHL 4DGIL 3BE1H 4JG0L 5DRNB 1JGLL 4G9DB 1RPQA 5HGGS 5CWSB 5B38A 2LVEA 1BF2A 4KKLC 4DZ8B 1BQSA 1D5ZB 1ZLVK 3FQNA 4G42A 4JQVA 4KKCD 4K23H 3GHEH 1MWAB 5BCAA 1DUZA 4EUPH 1KELH 4ZUTB 3S36L 3AROA 3QEUB 2D7TL 1K2DB 1H3GA 2LU7A 3PWNA 3OXSB 3BKML 1QBML 3VFUB 3AAZA 4NHCL 3EDEA 1NGWA 4NFCA 1MQKL 4WJ5B 2CQVA 3RWIA 5D6DA 2NX5E 1QRND 4JKWA 4I5BB 4X80L 3MLVL 4HPYH 3V95A 2NY7L 1CU4H 5EH1A 2HP4A 3T2PA 1H3XA 1AXSB 1BIHA 1G6VK 2YMXH 4U49A 5KSBB 1K3ZA 2BVOB 3BD4A 4XHJD 4WUUB 5C0AB 2Q86B 3W11C 3DUHA 4GRLC 1MUJA 2HKFL 4JFEA 3AREA 5D96B 4L9DA 2VLLB 4FG6D 3SKOB 1O5DT 4LNRA 4P9HH 3X3FL 4KRNA 2IPKB 2OTPA 4NQXA 5E24E 1DQDH 1KJVA 4XP9L 4ONHB 4M9OA 3MLZL 4JRXE 2QQLL 4WW2B 5D7JC 4DQOH 5F44A 4EDWL 5IVXE 4IDLA 4KTEH 2X09A 2ZSWB 4R90L 1NCTA 1OP3K 3ZHLA 2G5BB 4XPHH 3HCVA 1OSPL 4UB0L 4W4OC 2CPCA 1I7ZA 3HI1B 3QUYD 3MLYL 4DFHA 3SBWA 5TGBB 4IRJB 3VU2A 4RAUB 3T2OA 2E7BA 1FFOB 3F8UB 2CLVB 4RGND 1I8IA 4QCIB 1A7OH 4FQ2H 3U4EA 3SGDH 3BPOB 1A0QL 1ACYL 1QR4A 3O3DA 4Q2ZB 3SO3B 2PUQT 1JBJA 1ZT4B 3RWDB 3BP5A 5F1SA 3BGMA 4HQQL 3L1OH 3NCYP 2PTTB 3VFGH 3NCYS 1TLKA 3X13B 1KYOJ 3CSPA 3E6FB 5FO9A 4JANA 4V1DE 1U8NB 2XZAL 3KYMA 1I3GL 5I2IA 1X5AA 1MY5A 5IUSA 4KTDL 3MOQA 3ULSB 5HDQH 4EI6A 3WFZA 4JFZL 3KPRB 3LRSA 4J4PC 4PYHA 5FHBH 3GMLA 2EKJA 2HKHH 4JFFE 1FH5L 1ZMYA 2DQJL 4HMDA 4CDGC 5LCVH 4GQ9L 1IQDB 1T80A 2Y06L 4P23C 2BNQA 1I1FB 3BQUD 2L0DA 3AS2A 4M6OH 1DE4B 3GM0A 4OCSL 4CW1A 3QEHB 1A21A 1ITBB 3PABA 3P73A 5FB8A 4X9BA 3W0WD 1FNGA 2VH5L 1NKOA 2V17H 3MRPA 3PWVA 4OLWL 4M7LH 4P5KB 5FUOL 3CIQA 2DLFH 4Z77B 2CKBA 2X4TA 4JFOB 4LHUD 3RNKB 1HILB 4PY7A 3HR5A 2VISA 3LDBB 1PKQE 5ESQA 4M7JH 2HRPH 2Y6SD 3UAJD 1XIWB 4N0UA 5BS0B 1J0HA 2P7TB 2A9NH 2FNBA 4EZMA 3GIZL 2R29L 4PYGA 2A6KA 2ESVB 3TA3C 1DUYA 4NQDB 5KN5B 5FYKU 2Z8WC 4Z8FH 2CUMA 5GRVK 2HLAB 3MRGA 3ECBA 3DYMA 4E41E 1XR9B 1R24A 1OHQA 3DX6B 2OR9H 4JPWH 3UYOD 1F5WA 1GGUA 2NY3C 4UV7L 4IJ3B 1B0GA 4MB4A 3SDCB 3O2VH 5GS1B 5HYFA 4M61B 3V9FA 4W4OA 1NGYA 4YXLL 2R2CA 2D7QA 1F97A 2O5XH 3QUKB 4I2XE 1P69B 1CXIA 5AYQA 5I1DB 1H5BC 2B1AH 3IVKA 4U7KA 1IGYB 4TTDC 4M5YL 3TO4A 3MLSL 1FVDB 1HQRA 1BBDL 1A9BA 1T89C 2ZCHL 4L3AA 4TQEL 1BF8A 5FA3A 5L2KE 4N8CH 3MV7A 2B5IC 1DQJA 4QHNB 5TF1H 4YEFA 1NFKA 4PRPD 3SGEH 3GGWA 4QRUA 4J3VA 3G08B 3HPJB 2YUWA 4RFEB 1H3UA 5I8CB 1CXFA 5SWZD 3GIVB 4Z7VF 1BOGA 1FFPA 1MSPA 2KQNA 4BFGA 4GG6B 4YFDB 1MCLA 2ICES 2PYFA 4MXQD 3TBSB 5BV7C 1ZGLP 3D85D 3U4BL 1FDLH 2EE3A 4WHCA 2AAVA 5J12B 3QHFL 4J3OC 2IAMD 4P23A 4XVJH 1IEAB 4GXVL 3R06B 4FZ8H 2VSDA 5IVNA 3FMGH 1RURL 2XFXB 5DFWH 3OKOA 1JYNA 2AS5M 4TUKH 5FOBB 3MO1A 4X6BB 5DVKA 5TE4L 5J6GB 1LO0L 2BZDA 5EUKA 2P8MA 5E6YA 4PJAB 1CLOH 3MGAA 1YDPA 1C7TA 4QRQA 1UZ6F 4N0RA 3QUXB 3ROLB 1V5JA 1FL6B 5KS9A 4MAUL 2XWJA 4UIMB 3BZ4B 3WHXB 4BQ9A 3RWCA 2CDEA 1EMTH 3GM8A 3G5ZB 4TRPL 1JP5A 3QP3A 4O02L 2J1KA 5D7LE 5GRZA 5DK0B 5CIPA 2VTFA 2VDKH 1NAML 5IT2H 1IC7L 2A2QT 2AJVL 3PL6A 1OB1B 4HXAL 4YDKH 3KLHC 2ILLA 4X7DC 1YQVH 4YR6B 1MHCA 4KI1A 1HWGB 4FFVC 4FQJH 1X5LA 4WNQA 5HGHB 1FL5A 3OXRA 1P6AB 3GSOB 3ULVL 1NUNB 1FC1A 2H9GB 4MNHB 1RZ7H 3HFML 4OM1L 1F6FB 6FABL 4N0CC 3BEVB 5KTEH 1Z9SA 4FP8L 3S9DB 1E6OL 3EJYC 1ND0B 4YHNA 4HT1H 1BVZA 1W2KT 4LMQI 2I24N 3SDXE 4U6HA 3HTLX 5I73B 1T89A 2BVEA 2OP4L 1NGPL 1S9WA 3BZFA 2WBJA 3B9DA 1XF1A 2NCMA 3MOAL 2C3HA 3B83A 4AEHH 5H35B 4NQEE 3K4DA 1HKLL 5IBTH 2NNAA 1F11B 3DXAB 5EO0A 4N8VB 1FYTB 3WLWC 1IRAY 3ILPB 4ZNEE 3V4VH 1A6VL 4KI5C 5SWSE 2F53A 1KCSL 3UTPD 3FO9A 5EU6A 2C3XA 5AUMB 1ZGLM 5FAAA 3ARBB 3MLTA 5JW3H 4JGUA 4HFUH 1G84A 3CFEA 3DVIA 4ONFL 3GMOB 2YD1A 5F9AC 4NBZB 2JB6B 3RKDC 3Q5TA 1D7FA 4LSDA 3S96B 5F9WC 1M7DB 1BQLH 8FABB 4UTAH 3QEGL 1WVZA 4KRPB 1XAUA 4FMFA 1EUUA 5D72H 1ZEAL 1MY7A 3DX8A 4UUJB 3IKCA 4M6MH 1MRFH 2ICWB 2F8OA 1PD6A 3VFVA 1IAII 4R0LB 4O00A 4RMWA 3VXNB 5BQ7B 1U2HA 1DFBL 4OF6A 4YDJB 5H94A 2EDQA 1SVZA 4GH7B 4QRPB 1HINH 4F33A 4KMLB 2BNRE 3C08H 1EZVY 1T6VN 3MFFB 3MJ7B 4HUXB 5E9DA 4BSVB 2AJUL 4QRTB 5BZWB 4EVNA 4NQTA 5F7KC 1AGBB 1FVCA 1ZVSB 1I1YB 4LPVA 3EZ8A 3TV3H 1GZQB 3I50L 1D5IL 4NIKB 1Q9LB 3UTOA 1N6VA 4G6FD 5MERA 3S36X 3RVVD 2YS4A 5DD5H 2UY6A 1IGTA 1KB5L 3WN5B 2CRIA 4XX1E 4Z76A 3MRJB 3TZVD 1NBVL 2DQDH 1NC2D 3BKYH 3KJ4B 5GRJH 4QRSA 2NY0B 4XRCA 4Y1AB 3V0VB 3EYQC 1KBGL 2NZ9C 3VD3A 2UVEA 1F45A 2X4RA 5DJCB 1X5IA 1FZJA 4P2OC 4PG9A 1FFQA 5KVFH 1QEWB 1LE9B 5SV3A 4DGVH 4N0FA 2Y36H 1YEDB 3AU1A 4YGVB 4JKKA 1QSVA 1G7JA 5A16B 5DMGD 4OSUL 4ZNCD 1UXSA 2P5WA 2XRAH 5A3ID 3V79C 1ZT1B 4NYLA 2ARJA 2HT2D 4GKSA 1KEML 1EGJL 2BVYA 4PJGB 5F72S 4JRYA 4F8QA 3T0DA 1CTNA 1YNKH 5FK9A 2YUVA 2YPVH 4Y16B 3ESVF 3IDNB 5LXGL 4HCRL 2FEEL 3CUPA 3JWNC 1ORSA 3MC0A 3RY6C 4QTIL 4KKAD 3RBSA 4CVWA 3CCHA 1F13A 4L4VE 2YPLA 3VGHA 5IQ7L 4Y4HD 4PPTA 4I18C 1N8ZA 5EC1A 1NLDH 2UWEA 3GMPA 3KYKH 5D5MF 2BDNL 4K2UH 4MAYB 4OT1H 5DD0L 3FB8A 1VHPA 1OP5K 3STLB 4X7SH 4NN6B 3KJ6L 4NNPH 1KB5B 4HAFA 4X6CB 4FQHA 1NFDA 1I1RA 4GKZB 4GT7A 2QSTA 1A7NH 4ZD3L 2V9RA 4LOUC 4GW4A 2DLEA 3E8UL 3H3PL 4J8RA 1BLNB 1C1EH 2YRZA 1JJUA 4KJPC 1E28A 2XTJB 4JFDA 1FLTX 1C5DB 1LEGB 1LMKA 2H1PH 1KTLB 3IFLL 3S35L 2FEDD 4GAYA 1JPST 4X6EA 3T8XB 5D7KE 4NNYA 3V6OC 2E6JA 2Q8BH 3L3HB 1DBAL 5HI5C 1MHHA 1NANI 2B1HH 3MZTA 1HCVA 4WFFD 3OAZH 4HPOH 1BD2D 5D2LF 2I9LB 2H32B 1J8HA 4XC3L 2G75A 3KPSD 2VR5A 3P9MA 1DQMH 2J8UE 2X4SA 3ZDYF 5KSAD 3S34L 1JUFA 2Z31C 1MQ8A 4H5SB 3KAAA 3TBVB 4AEIL 4Z7NE 3PDOB 4RWHA 4I3RL 5E56A 3PV6A 4CNIB 4ZSOA 3U0PA 3T2NH 1T5WB 4NBXB 1EHLL 2WY3A 5IHUL 4Y4KC 4KV5E 1P7QB 5K9JL 3C2SA 3O2WL 3DX7B 3HE6D 2FECI 2C3GA 2DDQL 2GEEA 4MCYB 1R3LA 4MZ2A 2ITCB 5IW3A 2F74B 1JGVL 1RQ5A 3FQWA 3BT2L 3F58L 3QXDB 5GXBB 4NN5B 3MUGB 3P0YH 4K9EH 4PRIB 3H3BC 3QDMD 2CK2A 1WAAA 2IBZY 3PIQB 3CMGA 4JG1H 2O26U 2O93L 3D2UD 3OKDB 2OYPA 4C58B 1KPUB 1T1XB 3WFBL 3N1MC 4CMHC 2VXSH 4LLAA 1HHJB 3SJVD 3FOLA 3RY5A 2ENSA 4LGPB 4I18A 3VXSB 4D3CL 5DHVB 3G9VA 4V1DD 4PJ7E 2D31A 3QFDB 3U6RB 2OZ4L 3G5YA 4CMMA 3ARDB 2X89A 2EDNA 1E27A 5L9DL 3QA3A 4ODSL 1J87A 2XWBA 3VWKA 4RGMB 4JO1L 5EOQH 2CGRL 1JHKL 3VFPA 4TNVK 4JFFD 5JORB 1VFBA 1WBZA 3EOYG 3PWPD 1WZMA 2Q20A 2P43B 32C2B 4X5XA 4P4KC 4HIXL 2V5TA 1UG9A 3QUYC 5AZ2H 1IL1A 1UWGH 3GHBH 3GJEA 3WHE1 5IFHH 2MWCA 3HI6L 4XAWH 5I16B 5FKPB 4KK6C 2GCYA 5EBLA 4I0KA 1TQCC 2FD6L 4UV4H 4XPBL 4R6UA 5ISZB 3P40A 4PRDB 5IIEB 1T5XA 1RD6A 2BSSB 4G7YH 5DFVC 1HOCB 5F6HJ 4L3CB 1EPFA 5JHDB 4ISVB 2IANA 2EZ0D 4UNVA 1TIUA 1A6TA 2GITA 4DUWA 4MJID 5HGAB 4LAJH 5IMMB 4M3JA 4F7EA 1KPRB 5CAYB 2WWKT 1Z5LB 3C5JA 5KVEL 4NNXB 2EIBA 4ZPVA 1WIUA 1RUQH 3QIBD 3I02A 4Y7MA 1N5AB 2BSTB 2QTEA 3O3AB 3KG5A 5ITFA 1V7NL 1OLZA 5K93A 1AD9A 3SGKC 1DJSA 5JDSA 4AQOA 5ICYB 3OJDB 1NCBL 1X5JA 3BQUC 1F4XL 4HK3J 4J6RL 4W70A 5AWNH 2FIRT 3WBDA 1BFOA 1LP9E 2C7UA 3TT3L 4YHKH 3G5VA 1OTSD 2HAZA 4F9PC 3FB5A 3H7LA 2VDNH 5FYLL 3VWJD 1DSFL 2H45A 1G9MH 1YN7A 4EDXA 1FIGL 4X9HA 3LH2H 3T1WA 2Q3ZA 1FGNL 1QRNA 3FQNB 2X05A 3LQMA 3BX7C 1J1OH 25C8L 2C5DC 3AC0A 3SDYL 1T66D 1AXTL 3RVWD 1M7IA 3U36A 2JJTA 4NKDB 4QXTA 2VLRE 2Y6SC 5JTWA 1YEIH 3GSVA 4KH2A 2XA8H 1T7YA 1A7QL 2ARWA 3A67L 5F1NB 1ADQA 4HEME 4KWUA 2H2SD 1M6OA 4NN7B 4DOHB 4RRPG 3WMSA 4G9FB 4OZHE 1B0WA 1FVEB 5ALBH 5EIVA 3OPZL 3RWIB 1WWAX 5K59E 1B9ZA 2EDTA 1IAIH 1Z9LA 1BZ7B 2R23A 4YDLC 4HJJL 4NKQB 3EJZD 5EU3B 1UWEH 3QUYA 4PJEB 1NGZB 4KHTH 1E4KA 4KXZI 1IKFL 3TGXA 1MCIA 3SDAC 2H3NA 3VDBA 4N9GB 4OGZA 4TSAH 2IPTL 4CVUA 4XMPH 5CSZA 1RVFH 2WQRA 2VDRL 4G7VL 3GMQA 2AK1L 5EUOA 4OZGF 4G59A 2D9QB 1LE5A 2AJXL 5CEZH 1I9JL 5HPMA 3O6KH 2DYPD 1J0JA 4JR9L 4J1UA 4IRSC 4C83A 2FRGP 4HX1A 2EDFA 3QWOA 3IAGC 4YBQD 4TNWF 4J3TA 2ZOKA 5DEFB 1I7ZB 3G04A 2G60L 2CIKB 2DM4A 2CKBL 1I8LA 2WIIA 3IKKA 2R8SH 5EZIL 5DT1H 4PJDF 1I8IB 1LEKA 2FGZA 4R26H 1GJIA 1GC1C 4U1SA 2MNUA 5GGVL 1LD9A 5T5NG 1YEGL 1SBSH 4P46B 1P4BH 3BQUA 1FORL 2A6DB 3MV11 2DQEH 3E0GA 3O6FC 1UT9A 2COQA 5C0DB 4JANB 4ZO8A 3ZSTA 1K8DB 1KCVL 2CD0A 4Y19D 5KANG 4YEEA 3ZTJG 3KYMB 5KSUB 3SDDD 4KU1A 3TNMA 3W0WA 2LU3A 1WCBA 3I6KA 4FA8A 1GGBH 2E7LA 2R2HA 5GGTH 3O6MH 1QLEH 1Z3GL 1SEBA 4LHUA 4Y5XC 4JFXA 3D0LB 2ARJQ 5CJ5A 4H1LA 4U3XA 1CVRA 1MEXL 1GPOH 5MHSD 4XXDA 4KTYA 2YHGA 4XNUH 4CW1B 4KDWA 1JV5A 1VDGA 3ILQD 3PABB 3NZHL 2GFBB 4N8VG 4KGJA 3RAJL 4PRHE 5GRYA 1U3HC 1O7VA 2W9EL 1A02N 1C08B 1SY6A 4QY8B 4IOFD 2NY1D 2APBA 4HBCL 3GK8L 1VADB 2CKBB 3WNNA 1IAKB 4NO5A 1JHTB 4AQ1B 2YA0A 1LNUA 4GRLB 5CZKA 1F42A 1DLFL 4HGWA 3BD3A 4QO1A 4POZD 3FHQA 3MRCA 4OQTA 4BH8B 4JO4L 2H2PC 4TVPH 5JDJA 2A6KB 1I7RB 3ULUF 1MRDL 4YJZL 3I84A 3EO0B 5IF0A 3BRGC 3MV9D 5C1MB 5GGRY 3K4AA 1R0AL 4B0MM 4LVHC 5F93C 3K74B 1CDGA 5C70A 5CBAA 1OW0A 3PJSA 2DQUH 2FZ3A 4PRPA 3V4PH 1M4KA 3DSNA 4G8EB 1NGYB 2EDYA 3ZKNC 5ITBH 5KAQG 2IBZX 4DN4H 1MLBA 4XNZC 3DGGB 4LQFL 4S1SH 5K9KA 5SWZA 3TBYA 5ETUB 4ZTOH 3DV4A 2DI9A 2QADB 2QR0B 4C54A 3S35X 4MXQA 1HSAB 2LV4A 2J5LC 4MLSA 3D85A 1HQRB 3DO3A 3QJFA 1OM3L 2IAMA 4MA1C 3DHMA 4MXWL 3GSNH 5DUBA 4YWGL 1CD1B 4HLJA 3BUYA 2BCKB 4OTXH 2VXQH 1DQJB 3VXPB 1JGDA 4Q0XH 1Y0LA 3Q5OA 3GGWB 1NAKH 3CMOH 1A4JA 1W0VA 1LDPH 3WSQL 2X44D 1YJDH 1BWMA 3LEYH 2D4FA 1H0DA 2VERN 4XI5C 1K8IA 3PXJA 5E8PA 1R3HA 2FO1A 1INDL 2DTMH 3C60D 3RIAK 4DKFH 2GK0A 4CVXA 3LKOA 3IU3B 5DJXA 4P5TD 1N64H 4M1GL 2PW1A 1JF1A 3FO0H 4P23B 1OTTC 1VESA 4OLYH 1EFXD 2EXYC 3ULUH 3FT4A 3BP6A 3LIZL 3DRTA 2FJHB 3OKOB 3OKLB 2VL5A 4HS3A 4PLKD 4OGXL 4MJ2A 3T3PF 4O4YL 2VLKD 3EAKA 1R3IH 4RWYH 2FDBP 2XWJB 1UADC 3L3KA 2CDEB 2VDQH 5JPMA 2QSCL 3LQZA 5HHXL 1CD9B 3RNQB 4E9LA 4XPAL 1QUNA 3RX5A 4LFHG 2Z92B 2E8YA 1QKZL 4DCQA 2OX5A 3MQIA 2CLZB 5T3ZD 3TA3B 2O61A 1UQSA 1AFVL 1NCNA 4KK5D 1OL0A 1CLZH 4OCYH 2V7NA 1MHCB 2VDML 3GKZA 4WNQB 3C6SB 4BZYA 4LPWA 3UPCA 4XP6H 1YYML 1IC5L 3OXRB 2NY3B 4NKOA 1CICD 1SYSB 2KUTA 5ICXA 2ESVE 2E27L 5E5MA 2ZUYA 4UNUA 2ED7A 2HFFA 5TQ0L 5I1JL 2F19H 4KKAC 1QLFB 2VUYA 3TNNA 2ZUQC 1H5BB 1OGAD 4KK9D 4ZUWB 3HB3D 1R6VA 4KROD 4WI2A 4YHNB 2I60L 5DJDA 1L7IH 1NSNH 1RZJH 4PJXA 3BP4B 2EDHA 3SN6N 3SHSA 2GJ6B 3BZFB 2B5IB 3M8OL 3QO0B 1KG0A 3CH1A 4DW2L 2EEDA 3FN9A 2NNAB 5EO0B 3OAYH 4OD3L 3TBWB 4LQ1A 5DYOA 2OQJA 3VDAA 4X6DA 5DLMH 2IGFL 3FO2A 1YYLL 2YZ8A 3EO9L 3BXNA 3MLTB 4CADA 3IDXH 2DAVA 4OCWL 3CFEB 5E8NB 3ALWA 4QTHA 4TUJA 1PX4A 3K2UL 5C08B 3X14A 5BV7B 2DQCL 3BPCB 3VE0A 1F4AA 5F7MC 4Y8DC 2XICA 3HNVL 1OT1A 1TZGL 3K46A 2ZCLH 3L5HA 5C0CB 4LLQA 4NC2B 3U0WL 1MFDH 3S98A 3VFWB 3BPNC 3NIDF 4JRWA 3MV01 3WFHA 3NACL 5GZOC 3JTCA 4QHUB 3VFVB 5E2TH 5FYKH 5KANI 3TYGH 2A1WH 3W81A 3E2HC 2UYLA 5FGCB 2EH8L 3LS4H 5HI4C 3TZVA 5HJ3B 4JHWL 5MENE 2XPGA 2AV1B 2O5YL 4FFYH 2ENYA 1QOKA 1WZ1L 1GGTA 5KSBF 5JXEC 5E9DB 2Q87A 4TSBL 4QOKE 1RHHA 4U0QB 4UILH 1FVCB 4KXZH 3JVGC 3OV6A 4HKXB 1I7UB 1TJGL 1FO0H 4PJFA 4ODHL 2VYRE 2DM7A 2P8PA 1YEKL 5MERB 1N5YL 3UTTB 1HZHH 4P2RD 1HXMB 1KTDA 4U6YA 4EN3D 4Z76B 1UZ6E 3TM6A 4AJ0A 3QCTL 3PWUB 1PSKL 4JCLA 3MRHA 1R3KA 3WS6A 4QRSB 4KAQL 4ODUB 2R2EA 4ZOBA 1XCQA 5EC2B 1SJHA 1FZJB 4HUVA 4P2QD 1ZOXA 2X42A 1Q0YH 5F7FA 1MFBH 4D9QD 1MWAH 2Q76A 2DJSA 4XCYA 2R56H 1KJ3L 1G7JB 35C8L 4OBRA 4Y4HA 4TTGA 2J88H 4IHOB 4LBEB 2P5WB 5JO5A 2Z91B 1F3DH 1YMME 4NYLB 5AAMA 1IQWL 4KJWD 4LLVA 3T65B 3VMNA 5GS0D 5E08L 1WC7A 4JRYB 4F58L 5FK9B 1IT9H 1QR1A 2HTKD 5EIQA 4WENB 3TPUE 1R3JB 2UWEF 1JIBA 1ORSB 1Y6KR 4UINH 3VW3L 3C5SB 2P42B 3CCHB 2YPLB 1T3FB 2QJDA 3CK0H 4LDOB 1N8ZB 1QO3A 2VABB 3SCMD 3BIKA 1RJZB 2LQRA 1LGVA 3FQUA 3GMPB 1VPOL 2EDEA 3DXAE 5SWQB 2HH0H 2RB8A 5DI8B 3RL2B 4A6YA 5KW9H 1RIVH 5CEXA 1KC5L 1OAXL 5IBLD 5I1GL 1Q9OB 5EFIB 3AM8C 4DGIH 1DQQA 3KPOA 3WFDL 3ZDXE 3ZDZE 1BD2A 3VD4A 2P5EB 2EZ0C 4GW4B 2BNUA 5I18H 3MJGX 2R0LH 4J8RB 3KYNB 4M93C 3KPSA 4QRRD 4RBPH 3OJMB 2HVJA 4JFDB 2VIRA 5KSAA 4XWGH 3C6LD 3GMRA 5CJ8A 4GAYB 2VLRD 5KZCD 3NIFF 5E00A 1C16A 5EO1A 1ZAGA 4GBXC 3H0TA 4NRZA 5D93C 2VLME 3S36H 3EYOA 1P4LA 2D7TH 3L7FA 3BKMH 5BVPL 1P9MC 4NQSA 4X4XB 3ARUA 5DUPH 4NHCH 3ZHKA 3HE6A 1MQKH 2MJWA 1H15A 5LWYL 1AO7B 1OLLA 3R0NA 4PJ8D 2PYED 4X80H 3MLVH 4ZYKB 2NY7H 1QLRA 1ULVA 2EECA 5DVOA 1JUFB 2A0LC 3IDYB 4JHZA 4N1CA 5GGRA 2FH6A 3I3BA 1WT5A 3H9HA 1TITA 3PV6B 3QDMA 1R5WA 4WHYG 5DFTA 3U0PB 2XOTA 5C6PB 2HKFH 3D2UA 4P2OB 2Q7NA 4JCMA 2IADA 5TDNA 3JWOC 3X3FH 4F7PB 1ZK9A 2AJSL 3MLZH 3SJVA 2QQLH 2PR4H 4PJBE 1CCZA 4GMTL 5FO7A 4EDWH 5C7XH 2FCBA 1JHLH 2YC1A 1WAAF 3EYSL 4BH7B 4V1DA 4LLMB 5CLTA 4NSKA 4OD1L 1JWUA 4R90H 3OR7B 2WP3O 3QZWA 1OSPH 1DBJH 2A74A 3MOBH 43CAA 5IB5A 5KBNC 1T0MB 2F58L 4JFFA 3MPCA 2XKUA 3PWPA 5E7FA 4BELD 3EJZC 3MR9B 4FABL 4GG6F 2ADJA 2NW3B 4WEUD 1A0QH 1ACYH 2AGJL 3ARQA 3IRPX 3BKCL 3FOLB 3QWRD 1KXQE 4YZFE 4I18B 4PJGE 4CBPA 4DKAA 2C4FT 2P48B 4HZLB 4HQQH 4NQCD 2XQYK 1PGRB 3QIWD 3U46B 2FJGA 4PJ9D 4CMMB 2IFFH 1F4WL 4F2MA 5J0BA 3QHZL 3UTSE 1B3JA 1I3GH 2E9BA 2AP2A 4YBQC 5M94B 1VFBB 1WBZB 2EH7L 4KTDH 4YO0B 4X5XB 1CQYA 4MJIA 4XWOC 1LEIA 4OF8A 1IL1B 2DQJH 4XCFL 5DJZB 4Z0BL 2ZCKL 5D9SB 1IEBA 5C0EB 3ME0A 2Y06H 3JTSB 5HI3C 1O7SA 3RWEA 1XGUB 5DXWA 1WISA 3QIBA 5D5ME 1KPVA 4M6NH 2CDFB 3HC0A 2GCYB 3WL9A 2NR6D 5EBLB 5KVGL 1NCAH 2R4RL 3PV7A 5MEPA 3T0WA 3L3DA 4C4KT 1KCKA 4G8GD 5I1HL 4IIQC 1T5XB 3I3EA 1P9MA 3U83A 3UCRA 3WKNA 4RDQG 2IANB 5T5NF 1A6TB 2GITB 2DIBA 2P46B 1R5VA 2AXGA 2B8OT 3KLDA 4FRWA 3UZQA 4F7EB 1F3JA 2Q8AL 2Z31B 2N7AA 4HIHB 3C5JB 5JUEH 2IF7A 4XNYL 5JXAL 4ZPVB 3I02B 4OZIB 2E9WA 3HZYB 1YN6A 3VH8A 1AD9B 3IJYA 2A83A 5I0DA 4YHLH 3MUZ1 3P0GB 5BZDA 2YD9A 1QSEE 3GBMH 4EXPX 4Y4KB 4YHZL 2R29H 3EYVB 1BFOB 4UT6H 3G5VB 1CFBA 5JIPA 1RZGA 2D2OA 3D39E 2X4OA 4XPFL 3ILQC 2BC4A 3ZDYE 5EN2B 2X4PA 2E8ZA 4IOIA 4U6VL 5HHME 2ZKHL 1YN7B 4EDXB 4UV7H 4EQ3A 2YN3A 4L8BB 4O9HL 4NFBA 4CVZA 4R97C 1EO7A 4GRMA 5JOEA 1CGTA 4HS6B 2NW2A 5CGYD 4KKNA 1MFEH 5DS8A 3ZHDA 1GZPA 4HC1A 1KCRL 4M5YH 1J0IA 2QSVA 3DECA 4CMHB 3R4DA 5D1XD 1EJ6A 1XGYL 4XCCL 5TDOA 3S5LA 3O3BA 2ZCHH 4TQEH 2DQGL 1ZA6A 1KIRA 2V9TA 1M6OB 1X5ZA 3ARFD 4HJ0C 4J3UA 2F54D 3STZA 1JI1A 5IHLB 2RIKA 3QQ9D 3RUGE 1CYGA 3QULA 4DGYL 2X1OA 3BWAA 2BVUA 1A6PA 3ZTJH 4Z78B 2VQTA 3VXSE 3CPLA 2VDLL 4P4KB 3QUYB 3ES6A 4M1DL 3QDJE 3MGOA 4WI5A 1B6UA 3ULVF 2R9HC 4APQD 4MQXD 3RPKA 3U4BH 1GAFH 5IJVB 3QHFH 3PGDB 5B3JF 1WJ3A 4OCNC 5CSZB 5IFJA 4I0PC 1V3LA 4U33A 4WIQA 1MFAL 6CGTA 3GMQB 1N4XH 5E94A 5EUOB 4CU6A 1LE5B 5HPMB 4LKCA 1NQBA 1EXUB 1LO0H 4J1UB 1BX2A 3X12B 4IIQA 4HUUA 4KZDL 4JFYA 2PETA 1Q72H 2JJSA 3VXOB 43C9B 1TXKA 2ZOKB