4WW2C

Crystal structure of human tcr alpha chain-trav21-traj8, beta chain-trbv7-8, antigen-presenting glycoprotein cd1d, and beta-2-microglobulin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
275
structure length
275
Chain Sequence
b'VPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR Alpha Chain-TRAV21-TRAJ8
publication title Atypical natural killer T-cell receptor recognition of CD1d-lipid antigens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 76
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2014-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ww2C02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4ww2C01
4X6DB 3FB5B 1ZS8B 5J13B 3NCFB 1JZ6A 1F4XH 4S1RH 2MCPL 3KG5A 1RZFL 4NQDA 3HN3A 3BE1H 1CFSB 3CFCL 3ILQD 2ZNXA 3AREA 4GRWB 1DVFC 5D1QD 3ECBA 1I4FA 5DD3L 1E27B 1U8JB 1A1OB 5TH2A 3OAYK 5HVFB 1NFDA 4XCNA 1MPAL 5D7JA 3UYPA 3RVTD 5E5UB 1MI5D 5D71H 1MCQA 3EYUH 3WUWA 4PJBE 1HHHA 5GGSB 5AZEH 1DR9A 1ZEAL 3QIBD 4P23B 4N9GB 4HF5H 4UV4H 5IB5B 1IEHA 4LKXB 4ZS6C 2IALA 4HWEL 4IDJL 3MRIA 1EO8H 3QFJB 1LK3H 1E4XI 5E9DA 5LCVL 3V95A 1NJ9A 4TVSa 5ESAA 3MV8B 3V52L 3BGMA 4ERSL 5SWSA 1BOGA 1DQDH 4YHZL 3SDXA 4OZIF 1FN4A 4R97B 3WS3A 4HJJL 1A2YB 3MLTB 1CZ8H 4O51A 3D18A 2C26A 4WI8A 2VDKH 1WTLA 3QPQD 3JV6B 2E3VA 3FFCA 4M5YH 2HTKD 4JN1L 1NUNB 4XP4H 4YBLB 5F9DC 5DFVC 2BX5A 5GISH 1NC2D 3QWRD 1B4JL 2JELL 5EBWB 4NJAL 4YEFA 4LK4A 2VJXA 5DO2D 4Z7VA 5CIPB 4NHCL 3WIFB 4UT7H 1G0XA 4NFCA 4LCUB 3R1GH 2PXYB 4DEPC 1FV1B 1AXTL 2WWKO 3TNNB 2AEIT 1R5IB 4UDTA 4F57H 1RZKH 2EECA 3EOYG 2NZIA 1SJEA 5BMFL 3VXRB 1A9EA 2FHFA 4QHNA 2DIAA 3SO3C 4A6YL 5C70A 4X7DC 5IWLC 4XP5H 1D9KB 3N1GC 1QR4A 1G7LB 4WO4A 5CCKH 2DTML 1L7TH 2AJ3B 5DYOB 5H94A 1NLBH 4X8JA 3O6FD 1RZIA 4PRDB 1JF1B 1N3NB 1XCQB 3UTTD 1DZBA 1NGWB 3BPCB 4XPAH 2VAAB 2Z8VC 4DFIA 2EYTB 1FNSL 4NO0B 5DZLA 3PWPB 1B3JA 4RA3A 5HYJA 4M8QA 3UPAA 3DV4B 5ICXA 4O2EB 4Y2DD 3DX8A 2CMRL 4OLXL 5GS0L 2C3XA 4Q74A 2GTWA 1YQ2A 5I1KL 2XKSA 4KFZC 4ONGL 3BGFB 2NY3B 2AXHA 4H8WH 3ULUE 1MUJB 5A43C 3HNVH 5JIKA 4RNRA 3LN5B 5B38A 4NNYB 3QI9B 2DQCL 3CVHH 1FNLA 3SGEH 1K8IA 5J06A 3CVIH 5F7FA 2HT4C 2HFGL 2FIRT 3BZEB 3U83A 2I07A 2R1WA 1RJCA 2W9DH 1WBYA 3NFPA 3I2CH 3IDYB 1U58A 2FWOA 1HSBA 3RTQA 3TBYA 2XZQH 3CSYB 3TN0D 3WMSA 2MTPA 3E6FB 3G9VA 3MGTA 3F12B 1F4WL 3MRLA 2ZSVA 3CZFA 2AK4D 4GAYA 1XIWC 2HKFL 4ZUTB 2HMID 4KRPB 3PNWA 4OTXH 5EZIH 4GQ9L 4HX1A 5CS7A 1QFOA 3STZB 1BX2B 3W11C 2AJSH 2ADIB 1YZZA 1EBAA 1KIRB 1TLKA 1FHGA 1YNKH 3HNSH 4OFYA 3WO4B 4ALAL 5FHBL 1IKFH 4WFFE 5E5RB 5JORB 4PJEB 5FO8A 1VFMA 4L5FL 5KN5B 1JK8B 5DWUL 2NTFB 2PW2B 1A4KB 1MOEA 1BF2A 2XTJD 3GEWB 5IOPB 4XP9H 2P43B 3N85H 4WW1A 1WBXA 2AJZA 3BXNB 2NX5D 4BFIB 5CGMA 3VRLE 1GPOL 1U8JA 4IM8A 5GZNC 3JTSB 1MVFA 2GJ6B 4OZFB 1HI6A 4OCSL 3UPRB 3LS5L 4PTUB 2R15A 2LV4A 3S97C 4BZ2H 2P5WD 5BRZD 2VQTA 1YUHA 3IJYA 5T1KD 2FGWH 3D0VB 4XPHH 3VXME 2N4IA 3K8LA 3KPSB 3NH7L 2OL3B 4JFHE 1X5FA 1K2DB 4JDTL 5DMKA 3G08A 2BXYA 3GFUA 3QFJA 1MFAH 1WK0A 4JDVB 2OXHA 2FZ3B 4P46B 1JGVL 5C0JB 1MHPL 1AD9B 1JWSA 3TF7C 5F7WC 3ZDYF 1IILE 4X98B 3REWB 1FO0H 3HMXH 3RHWK 1EHNA 4PY8I 1CICD 3C9NB 3DRQB 4NQXB 2F8XC 3RIAF 3MLTA 1G7IB 3WIIH 5HD8C 5TPWL 1JYXA 2O5ZH 2X9YA 4PV8A 3UTPD 3RNKB 5H37G 3D2UD 1CD8A 4PP1D 2XZCL 3B9KB 3VW3H 1AO7D 4WFHE 1U9KA 3U0PB 5HGGS 4P3WA 2BC4B 2UUDH 3BVNB 3OKYA 1PQZB 3HE6C 1J0JA 4I0CC 4Y89A 3O3BA 4HULB 1B0GB 3T4AA 1MFDL 1T1YA 2R4RL 2BRRH 4PJIF 2A1WL 3O4LD 1D5IL 4RISH 1CFQA 1HEZB 2W1NA 3BW9A 4U1HB 4N8VA 4XNUH 1UT9A 5KTEH 3CFDA 1EV2E 4HUMB 3OAUH 5D8JL 1DDHA 4ZSOB 3ULSB 2MQCA 5FK9A 1UZ8A 2Q6WB 3VFTB 1EXUB 4OT1L 3DYMA 2X1WL 2IJ0C 1BZ9A 4Z5RA 3GSNL 4QNPE 2DI7A 5JA8B 1IEAA 3GI8L 1JHKH 4QRRB 4R4NC 1OAZL 1LP9A 2FATH 5IBTH 3GMNA 5ENWB 4XCCL 1D5BB 8FABB 1D5MB 5F7EL 1CU4L 3CH1A 3TBVA 1W72H 2X4OA 3UZVB 1MCNA 3KNBB 4QWWC 3IDUA 3S36X 1J7VR 2BDNL 5HGHA 2EDJA 2DQGL 1EVUA 5EU6A 1WCBB 3KWWB 4L3EE 3X3GH 1ZLUK 1I1AB 2E7BA 2HFFB 3AB0B 4ISVB 3T0AA 1EMTL 5JLZB 3Q5TA 1H15A 5L2KE 3MXVL 1I9RL 1CFNA 3AAZA 1T21A 3MZTA 5IESH 1DLHB 1CL7L 3HHRB 4IRZL 1PFCA 3PV6B 1QRND 3O2WL 1OGTB 2NR6D 4KRLB 4ZOCA 2YPVL 5IT2L 5I1EH 3MV7A 5DVMA 1DCLA 5CD5C 2YPLA 4TSBH 2IMNA 4WWID 1OGAA 4KMTL 2CQVA 2DBJA 3H9SD 4NQEE 1MVUB 4YDVB 2HRPL 5DSCB 2QQNH 5ITFB 5DJ6B 4NCDA 1CFBA 1ZHKB 3DX6B 3SDCB 5FV1L 1E0OB 3L3JB 3L3KA 4XP6H 3KYNB 4MQ7A 2YD4A 4PJBF 1KTDB 3Q48A 4QHUB 5DRNA 5E5MB 5H2BB 4CVZB 4U6XA 4AIOA 4KTDL 5FYLE 2R23A 1MHHB 1DUZB 1UB5A 5I30L 3MJ9A 5IBLD 2GK0A 4HKJA 1F4YH 5D7IB 1RY7B 1INEL 4PTUA 3LQAC 4PR5A 4JFXA 4HKXB 2A9NH 5ISZE 3LQZA 4Y1AD 4G8GB 3VJ6B 4HK0A 2DKMA 5D2LB 3KPPA 3VXNB 2Z92B 3H8NA 3G5YB 4H88L 2VUYA 2XY1A 1I8IA 4JDVA 4L3ED 3VFPB 3QPXL 1AD9A 4NC1E 1QBMH 5J12C 3DETC 3VWKC 3REWA 4X98A 5T33L 4OCNC 2ARWA 1A7OL 3QXDB 3EO9L 5L2KD 1N6VA 1ONQA 2Y9RT 5SX5H 2BY2A 1HZHL 4FQXD 2VZOA 5FUCC 4PJHB 5LQBH 1WIOA 3RNKA 2NNAB 4X6FB 3MV9E 1FVEB 2SEBB 3BPNB 4G8FB 1BFSA 2Y07H 4D3CL 2DM4A 5I9QC 4BELD 4V3EB 1EHLH 3BVNA 1HIMH 4S10A 1ORSA 3VXSB 3ZYIA 4DOHB 3VDCA 2JF1A 1B0GA 5EU5A 1KACB 3F6LA 4PBWD 1IQWL 1FYHB 5I15L 4G9FA 4M48L 5D7SH 1F3JA 2VC2L 4OZ4A 3PIQB 4DZ8B 1M1SA 2X9WA 4KROC 5AWNH 5T3ZD 1WWCA 4XVTH 2MOVA 2QSQA 1BMGA 4HUKB 4OI7A 3QDJB 1YY8A 4URTB 3ILPA 5DF0A 5IKCA 3ULUF 4OV5B 4X9IA 3ULSA 3NBNA 2UWEA 1EXUA 4M9OA 4LSSH 3MZGB 1CDCA 3SE4A 3RVVD 5DD6B 5CD3B 4PRPD 3INUL 3K2UL 4JFZH 5D1XB 4RRPA 5E95B 2IANE 5ENWA 4OGZA 1BBDH 1T89A 4TVPD 4I5BB 5ISZD 4MHHI 2C3VB 3FAWA 1SHMA 2X4TB 4APQA 3CXHK 1GSMA 1QO3B 2YN3A 4ONOA 1FLTX 3QXVA 5F97E 2JB6B 3KWWA 4JRYD 4P2CG 1MQ8A 2HT2D 3V4PH 4KQ3H 4AYFA 4M6OH 3SDAA 5I16A 1NEZG 4CVXB 4OGYH 2BSRB 2R4SL 3LHPL 1SM3H 1F6FB 2A74A 2CGRL 5FOJA 5BVJB 2AXGA 1BD2E 3OBAA 3QXAB 2DWEB 4R96B 5CMAB 1IC5H 1KB9K 2CJUL 1AI1H 3JWOL 3RX8A 2VLLB 1HKFA 1P84K 1UGNA 1MH5A 1AFVH 1BQLL 3IFLL 1FQ9C 4OJFH 2XXMB 1T5XA 2OR9H 2ADGB 3RFZC 2HLFD 1GHFL 4JPWH 3VRLF 1Q0YH 4G8EA 1M71A 1CE6A 3PF2A 2MKWA 3CNKA 4DGYH 3ZYJA 3C2AL 4DVRL 1RJYA 4GRLD 4UTBL 4L9LC 2J5LB 5D72H 1GGCL 2I60L 1VPOL 2C3WA 3L3JA 3R0NA 1CIUA 1CLYH 3NA9H 4F8QA 1S9YB 3HR6A 3MXWL 1XGQA 1U92B 1JI2A 4C54A 1FL5B 5ANME 4N5EA 8CGTA 5E8OB 3QUZB 1BM3L 5IVOA 1MHHA 1WT5C 1JBJA 4RAVB 4Z7WB 5BVPH 3ERYA 1Q9WA 3X14A 3SBWC 1RZGB 5JOFB 5EWIL 5LG1A 3GSOA 5D7IA 1YMME 3ARUA 3O3DA 5JXED 3FO1A 3WNNA 2I9TB 1OAXH 5LBSL 4YHOH 5MERB 4PJAB 2DQFA 5IHLB 5IHUH 1H3UA 3OX8A 3TPUB 1WQVT 3W9EA 1F58L 3O0RL 1HH9A 1DEEB 4QKXB 4ZO7A 1J9CT 4GUPB 3VXNA 2OZ4A 1JF6A 12E8L 4LKCB 4LU5H 2YN5A 1J1OH 4MAYD 4JO2H 4WU5A 3UZEA 3D0LB 3QUMH 1E4XH 3EYFA 5T1LB 4Q7DA 2OS7A 3IJSB 3QEUB 5BV7B 4PLKD 3BGAA 5ILTH 4KMQA 1P7KB 3TCXA 4XHJC 1FZKB 4RZCA 3CSPA 4X6BB 2AVGA 3QJHB 1NAKL 4M43H 4NBZB 3T0EC 4PGZA 3BP5A 3QSKB 1N2RA 4AEEA 3O2VH 3F7VA 3OXRB 4BFBD 1OT1A 2J8UE 1I3VA 4OD2A 4P4RB 4FFVD 1QR1A 2XKUA 4ORZC 1TZIA 3FOMA 2B0SH 3IS0X 1MCPH 1D5XB 1Z9LA 4JQXC 4KC3B 2OK0H 3AMLA 1BJMA 4QXWA 3HAEH 4QNPF 1L0XA 5DT1H 2RGSA 5AUMA 1BVKB 4HIXH 4J1UA 5ERWB 2NY2D 2P46B 4L4TA 4X4ZA 1KFAH 4Z76B 1JV5A 1SMOA 1XF5B 5DEZA 4LVOB 1Q9KA 3RQ3A 2DIJA 2BOCB 4LGRB 3G5XA 1A0QL 5JTWA 4AM0B 1AXIB 1KBGH 3WFEH 1FFOB 1MIML 4KK6C 1JPFA 4HCRL 1MY7A 3MUJA 5JUEH 1QVOB 5K93A 3SO5A 4B5EA 5SX5K 3F58H 4XVSH 5DD6A 5CD3A 4R90H 4RGNE 1AGEA 1GGBL 2B39A 5DJ0A 1NEZB 1A14H 5D1XA 5EZOH 5KS9E 1QUNA 1D3CA 1K5NB 4MZ3A 3U0TB 4NO3A 4I5BA 2C3VA 1U3ZA 1X4ZA 1DBAL 1A21A 4CMHB 1I9IL 5E2WH 1HHJA 1EFXB 1VHPA 4JHAL 3WL9A 1IAOA 1LEGA 5DJDB 3VD4A 4MWFB 4Y16B 5DHYB 2V7NB 3FCTA 4FG6C 3I6LD 4WW2A 2E9BA 2AGJH 1N59B 3TIEB 1U8NA 1H8SA 5BVJA 4JM2D 5ABDE 3HI1A 1FCGA 3SKOB 3MBEC 1MF2H 4FFZH 4QCIB 3LEVH 3PQYE 2YXMA 5I1GH 4R96A 2VLJB 4LLWB 1LEKB 2VDOH 1DJSA 2XPGA 5HJ3B 2FECI 1MCIA 5C08D 2K7PA 5CINH 1DN0A 5BS0E 5E6IC 5IVXE 2DL9A 5KANG 1JGLL 5DURB 3SCMA 3FQNB 4P2YA 1VGEH 4OLVH 3ARBA 2M26A 1OHQA 3WSQL 3MRCB 3WFDH 3GI9L 1TTFA 4KJWC 4UNTA 1AQDB 3D3VE 1UH4A 2P48B 5F9AC 3L5JA 1UACL 4IBLT 5DRXB 1QLRA 1R3LB 1U92A 1F11A 2NCMA 3BWAA 4IRJC 3LB6C 1FL5A 4RWHA 4CJ1A 3H42H 4RX4D 5DGQA 5E8OA 4JKMA 1QKZH 4HWZB 3DIFA 4P99A 3I02B 4HIJB 2EIDA 4QHMA 1UXSA 3HPLB 5JOFA 3MLRL 4BA8A 3P30L 3T8XA 3NPSB 5FF6B 1KIUA 4JO3L 4KZDH 5HY9A 4XBGA 1BWWA 4PJAA 4RGND 1RVFH 4U1NA 4MS8A 3DX9B 2VN7A 3N50A 4S1DD 3SY0A 3TPUA 3KLHC 1F00I 1QBAA 4PGCA 5DC4B 3QBTB 1ZXQA 2OR8A 1T22A 5E00A 1OQXA 2CSPA 1UG9A 2V2XA 2VDNL 4LF3B 5AZ2L 5CHNB 3WIHA 5KSAD 4MA8H 2X4SA 4MXQC 1KIQA 3GSUA 3MJ7A 3RY5A 1J0ZA 3LKRA 5IMMA 2IPUK 3ULVH 2EH8H 4G3YH 4C58B 2CDGA 1MWAH 3A6CH 3C5ZD 5C0AE 1I1YA 4NHUE 1J87A 3WFHA 1QPPA 4Y4KD 3NIGE 5I8OH 1MLCB 3LKNA 1T7VA 1QA9A 5F9OL 3ARXA 4P3DB 2XA8H 3RWGB 3T3ME 4HUNB 3FL7A 1RPQA 4YNYB 3C5SB 1XGYH 5EPMA 3VD5A 2CXKA 3C8DA 4HT1L 2Y7QB 5DD0L 2ZCLH 2ENSA 3GSVB 1J0HA 4POUB 4RIRB 4ZO9A 2BMKB 4LLQB 4PJ5A 1W0VA 1PKQE 3OHXB 3HCVA 1X7QB 1JF5A 2V7HA 4N0UB 1ZT7A 1OAUH 4J6RL 3BQUC 4XX1E 3BKML 4QRTB 4YHNA 5ALCL 3D3VD 5C0GB 4GKSB 2IH1A 1IAIM 3S7GA 3HG1E 3UTSB 2DJSA 3D1MC 4HXAL 5E4EC 1DL7L 2DM7A 4K94H 1FYTE 1BJ1H 1R3JA 1WTGT 5HTSA 3RI5F 2R56L 3GSWB 1QVOA 5CEYB 2DWDB 1NAML 5HXMA 3TZVD 4PRBB 1QYGL 4M7LH 5A2KH 4KV5E 5C0IB 5GSRB 1F3DH 3W9DB 3VFUA 3WN5C 3U7YH 5EIIA 1DQMH 2Y06H 5C0EA 3OKOA 1W0WA 2VSCA 3VXPB 2MFNA 3OJVC 4GOSA 2Z31B 1YEIH 3HUJB 2FX8L 5DLML 1L7IH 3FT3B 1QG3A 3N9GL 4JQIH 1EFXA 5ADOH 3SDYL 5IB1B 4Y16A 1AQKH 2V7NA 5DDHB 5D2NB 3LH2L 1EEZB 5AD0B 1O7VA 3SGJA 4HXBL 3EYOB 2FR4A 1J1PL 4ZUUA 2CIKB 5F89B 3B83A 1CDGA 5C0AD 2F53B 1GYAA 1EHLL 1M4KA 3KPOA 4NJ9L 4WWKB 4KI5D 5E94B 1XCTB 5D6CA 3GMPB 4NRXB 4U1LB 5TFSH 1FSKB 3TNMB 1HH6B 4TUKH 1BECA 3GMQA 5FUOH 1BHGA 3NGBB 3HNTH 3E8UH 5HGDA 1P7QD 1RK0A 1TVBB 4S2SA 1J88A 5D5MB 1CDHA 4UOW0 1DBMH 4JO1L 3BP7A 4PD4J 4CU7A 4PGBB 3QAZB 4F9LA 5MHSE 4GRWH 4N1EA 5D7JC 4AENB 1QFWM 1R24B 1QFWH 4MMZC 2UVFA 1A7PH 5SWZD 4HS8H 5JW4Q 2IAMA 3NTCH 1JFQL 5TQ2L 1I9JH 3M8OH 4Z78B 4JY5H 3HG1D 1H5BB 3AXLB 1XGPB 4Q6IB 3S3PA 5HYQA 1AY1H 3S3JA 5KW9H 3W5MA 3V7MA 3FO9A 3I02A 3M45A 1ITBB 5FGCE 4HIJA 4M7JH 5GXBB 3IAGC 1KJMA 2P5EB 2BOBB 3GSNB 3D9AH 2A0LC 2CLZA 4B0MM 5C86A 5FF6A 1PGRB 3GIZH 3QDME 2EDRA 4K3JH 1KPVA 4P2QA 3QH3A 5F1OB 2HH0H 4OZIA 5LGKA 4MVBD 2HT3C 3QQ3B 4LRNL 3NCJH 2J8UF 1CCZA 2WY3A 2E9WA 1U8HB 1CQYA 4JRXA 4JAMA 1PEWA 2H9GA 4WUUE 3VXUB 5J56B 3P77A 1S7XB 3SKMA 4KVNL 3JVGA 4KDVA 3HZVB 1U93B 5D1QB 5CIPH 1LK2B 1OD7A 4Y0GA 4LVHB 4KKAD 4NNXA 3E6HA 5INDB 1KLGA 3FO2A 2VN4A 1IGML 1MI5B 3BYYA 5HI3C 3PP4L 4NN5C 3WIHL 4OM1H 1IAKA 3QIBB 2D03L 3ARGB 4U1GB 4HDIA 4L4VD 4JM4L 4XCYB 3JTTB 3CFBA 4OD3H 5DMGD 2VR9A 4YE4L 4JFPA 5C1MB 4RIRA 3QWOB 3S9DB 4NDMA 4R7NA 1X7QA 4N0UA 3L6FA 2XZZA 1LE5B 3UBXG 1B6UA 1NGPH 5KS9F 4JFDD 5JPNA 5KOMC 4LCWD 4HJGA 3LPWA 2F54A 4HEME 3T0BA 4QF1A 1ND0A 5CEXA 2DMBA 4WU7A 5I76A 3RVXD 3H3PH 2E8YA 2A6KA 2HVJB 1R3IH 1NC2B 1S5IL 5TDPA 4XNYH 3MODH 3OAZK 1CS6A 4NOBA 1KCKA 1O5DT 1DQQB 1N64L 3O3UN 2OP4H 2AI0L 1QBBA 1L6XA 2FCBA 3WLBA 3GSWA 4ZUVB 1Q9OB 2ZUUA 3L3GB 2W9EL 2YSSA 1YECH 4RQQB 1U91A 4JR9L 5D7LA 3I6GA 1JJUA 3VXPA 1KC5L 4HFUH 5GGTA 1TJGL 3PABB 2EE6A 4NGHH 2D3VA 3SGDI 1IL1B 3S5LA 2W65B 4UDUA 4K3HA 5IVXF 3KXFA 5EOQH 3C09C 3FMGL 5EC2B 3SKJH 2YD5A 5C6WH 4YUEH 1KNOA 2V5RA 3O6FB 4NQVA 2RFXB 1UA6H 4NC2B 4RMUA 1YEKH 3UTTB 3TWCH 5HGBA 4NFBA 3FQWB 2ZP0T 5IJKA 2MKLC 4XGZA 3Q2CA 4LDLB 5LXGH 2F53A 2APTA 5GJSH 4WFGD 3MJ6A 4YFLI 1MAJA 4P5KA 1CG9B 1XCTA 3GMPA 4N8CH 4Y2DB 5J13C 5DJYB 5C0DA 1YEGH 4CN6A 3V4UL 4W4OA 4IJ3C 4NM4L 1Y0LB 3X11B 3TNMA 3IDGB 3V0AC 4XH2B 5HHOA 1MFEH 4HIHB 2OTWA 2CRZA 2PR4H 3OR7A 1LDPH 2PF6A 4O9HH 4R4BA 2BNRD 3IDIB 1C16B 1T4KB 2AXFB 4NQUA 4Q9BA 4M7LT 1N8ZB 3Q6FA 4YH6A 2O5XH 4GMTL 4BKLA 1UM5H 2GSGB 1G9ML 3TT3H 2BHZA 4OZFH 4AG4H 5CSZB 5TDNB 5HYIA 4Z8FH 4F7TA 4Y5XA 4TULH 4Q6IA 5I8EB 3QZWG 5C0BA 1LQSR 4YDKL 2OL3H 4JZNA 1FLRH 3TN0B 3V7AG 1MCLA 3D69B 3E1F1 2EDBA 4XTRD 5GJTL 1KCUL 5KVGH 1RZ8B 2AK4B 2CR6A 3GGWA 5FDWB 1N5AA 2X4RB 3VG0L 1GGTA 3NIGF 3BEWB 2JIXD 3HC4L 5DD1H 1YEDB 3AS2A 2F5AL 3RWEB 3O3EB 4GT7A 4GLRH 4XC3H 3JV4A 4YBLC 5M95B 4ZD3H 2P8LA 2VLME 4ZQKB 3RAJL 5HHXH 1BGXL 3T3MF 4K8RL 3MTRA 5T3XH 2AJVH 1YEEH 1U8HA 4LASH 2XTJB 5FECA 4G7VL 4UUJB 2AJYL 3VXUA 5JMOC 3PWLA 1AJ7H 5DA0B 4MXWL 2NX5B 3WE6A 3TIDB 3HZVA 2LTQB 1DBKL 1U93A 1AKJD 3LVEA 5GRVL 1CDBA 2BSSA 2ITDA 3QQ9C 3EDEA 3BUTA 3ARWA 3FN3A 1C5BH 2P5WB 4OV6F 5BRZB 3RVUD 4PJIA 5B21A 5T1KB 4DAGL 4X9FA 3TYGH 4I1NB 1S5HB 1B0WA 2AXJA 2JB5H 5DVLA 3MJ8A 2DD8L 1CGTA 3C08L 4FTVD 3ARGA 1ZHBA 3C8KA 4WTWA 2G60H 3AU1B 3HMWL 2AJUH 4FQ2L 4UNUA 1N6QL 3RL2B 5JNYA 3ZL4H 1GC1H 3KPNA 4UU9A 4E41A 2EKJA 1F13A 4P3CH 1OP3H 4KV5F 3FB8B 3H3BC 3CH8A 5EZJB 4ETQB 2BVQA 3QEHB 3CDGB 4JGJA 2FJGB 1CICB 3DNKA 5EDXA 3RA7H 1NGQH 4MNQA 4W68A 5DUBB 2EDDA 3SJVD 4HFWB 2BXZA 3KPLB 2ZWLT 1IGCH 4MD4A 3PV7A 3JWOC 3D2UB 4P2RE 2QHLA 1AO7B 4TOYH 4MD0B 2ZUXA 4DK3A 3ZSSA 3GBMH 3MRDA 4C56E 2D7PA 4K71C 4H0IA 5EU4A 4WEBH 1ZA3A 1XGTA 5F1IA 4KJQD 5E8EB 4RMQA 4AT6A 5BQ7B 4L8DB 4HC1H 1U8PA 2VXVH 3ARDB 3RWHB 3L7FA 3PWNB 3VGFA 5GIRA 2MPAH 3QHFL 5KANI 1I7ZA 4ZUSB 2PYEA 4I2XE 4LSQH 4MA3A 3C6SB 1WC7B 5FYKL 1SYVA 2VLMD 1NCNA 4PJFA 4PS4H 4PDCE 1J12A 1E6JH 4XHQA 3O6FA 4XCEB 3QG7L 3P0YL 1YYLL 3H9YA 1I3RA 1CDUA 5J6HA 5MEND 3FQWA 1NCWH 4D9QD 5GGTL 1MIEH 2HG5A 3EO1A 3ARFA 3S6CA 2FHCA 5DJYA 4GH7B 3BI9X 4N90E 4PJBA 2FB4H 1YNLH 1FP5A 2C5DC 4L3CA 2K3TA 4HK3N 2IADA 1JE6A 2DQHL 4HIHA 2AKRB 4QT5B 4R8WL 1KXTB 5KBNC 3LEYH 1JFMA 4MA7L 2AXFA 4V1DE 3VFGH 3FN0L 1A02N 2EDNA 5I19L 5AG8A 2H2SC 1EHAA 1INQB 4I4WB 4EI5B 2H32H 4PYGA 4QTHB 3ROLB 4Z0BL 4S0SD 3DMMA 3TVMA 4OZGE 1T20A 4G9DA 3GK8L 2FJHA 3MROB 1QRNB 1C12B 4OIIH 3F5WA 5L7XL 4Y5YB 5CKAA 1HWGB 3GJFB 2OM5A 3OKMA 2VE6B 4P46C 1K6QH 3O9WB 4Y4HA 3H0TA 3KPMB 3H9SB 4XBEL 5IROA 4DUVA 4YGAB 1NANI 3BO8B 2ICEA 2EIZA 3IJHA 5TE6H 4U6VL 5HVWA 2X4RA 2D7NA 4OUUB 4XWGH 5H37H 3LPFA 4P9HH 2P24B 3G04A 5FAAA 4NM8H 1A3RH 5I71B 2FDBP 3P4NB 4GSDL 2JCCA 2RQ8A 2R1XA 3KYAA 2P8MB 3VCLB 1ZOXA 35C8L 2OLDA 4NZRL 4X6EA 3QQ4A 3HB3D 2YD8A 4E0RB 1R3KA 4JG1H 4KUZH 2Z91A 5EA0H 4XPBH 4O2CB 4YPGB 3RPKA 3TO2A 5C0FB 2NW3A 1F3RB 3BRDA 4XC1L 4F80A 5GS3A 5IMOA 1K8DA 1ZTXL 2PNDA 4JDZB 2XZAH 1NCUA 1QLFA 4JG0H 2K9UA 3S4SG 4Y1AB 3UBXA 5E8NA 4EKXA 5DMJB 5GGQL 3TH3T 2GKIA 3DXAE 2UY7A 3DTXA 1QPXA 4N90D 3I50L 3I84A 1MCRA 4BZ1H 3B3IA 1U6AL 4W6XB 5I1CH 2R8SH 4P4KB 4L3EB 3H9HB 5HHMA 1CLCA 2CDEA 5T5FL 1OB1B 4V1DD 1INDL 1HYRC 5L2KB 1T89C 1H3VA 5K9JH 3L3OB 2J88H 3CK0H 4FQXB 3UPCA 3O45B 4APQC 5F70A 1M6OB 4DK6A 1JPGB 3FQUB 1I1AC 3W81A 2ATKB 1MLBB 3FONB 1PSKH 2D7TL 2DYPD 2B4CH 2R0KL 3I6KA 3HPJA 5E8EA 3DV6B 2Y6SC 4PP2B 4CRPA 2A9ML 1KENL 4ODSL 2WBKA 3ARDA 5I6XB 3EJYD 3MC0A 4XVJH 1FZMB 1T1ZA 4JY6B 4MAUH 1A6AB 3WEXA 4XNZB 4ZXBD 5GZOD 1TDQA 4J4PA 4Y19D 1KB5B 5B8CA 4JREB 3ARZA 5DR5L 1TMCA 4QXUH 3FRUA 4QOKE 5GS2H 1CFVH 1BIIA 2XN9D 4UINH 3U30B 1YEFL 5JQ6L 3RKDC 4JKPH 1NLDH 1FG2B 5GS1B 4DGIH 4F37K 4KQ4L 3R8BB 5ISZB 4HH9A 5F3HB 4ZUWA 4N5EC 2XQBH 3VXMA 1MY5A 2HYMA 1KCRL 4EIGB 1LMKA 3QUYD 3DXAD 3ULVE 4TTDD 3WKML 4FQCH 4YHKL 3TV3L 4YHIA 1QRKA 3QZWA 1UWXK 1S9VB 1PYWB 2FGZA 4C83B 3IDMB 5C9JA 2GSIB 4MA1B 2R0LH 1OSZB 4EI5A 3OGCB 1EEUA 3UAJD 2FO1A 4GMSH 1U95B 2IBGA 2EKSA 4P5MA 1LILA 3ESUF 1MELA 2CRIA 4H5SB 2ZUYA 4LOUD 4WGVB 1J18A 5CBEA 1GCFA 1IGFL 1H3XA 2A77H 4M62H 1P5UA 4PRIE 1OLZA 4LVEA 1C12A 3CX5K 1BBJA 4HZLA 3OPZH 1GL4B 1S8DB 3VWJD 1CTOA 3UTQB 3IDXH 3GJFA 1GH7A 4JVUA 3KR3L 1NAMB 4WI6A 5CEZH 4QXGL 1IVLA 3NIFE 5I18L 1VACB 5HGAB 2VDQL 3O9WA 1N0LA 2FHBA 4NP4H 3IXTA 3TCLA 2NXYD 1WZ1L 4ZFGL 3EFFA 1AGDB 3KGRA 4GRLB 4X5XB 1YA5A 2ZSWA 2NY4D 2QEJA 1RZ7H 5BV7H 3X3FL 3VFNA 1MCOL 4X4ME 1TTGA 4PRAA 2W9LA 5CGTA 3NAAH 3BJ91 5GGUB 2W92A 4HW6A 5EOTA 2PYFA 3HFMH 2E7CA 3KHOA 4YR6B 1V7NL 1Y18B 3S4SB 5TE4H 4XT1C 3UBXI 3CLFH 4YHPA 1RIHL 1K4DA 2NY1D 5FKPB 1EIBA 1HXMB 1CT8A 1A6TB 2W59A 3GKWL 1NGXB 2WMPA 1I8MA 3CFKA 1I8KB 1D6VH 3BH9A 1GZQB 4HK3J 2AEQH 4H26B 5HHQB 1CBVL 4P2OD 4NQSA 4EDWL 1F2QA 2XRAL 1XF3B 3KJ4B 1YPZB 3QO1B 2VLRD 3VI3E 4MAYB 1OAKH 4YHMH 1RZFH 4HMCA 4P4KA 5GQBA 3IU3A 3M17A 3ULVD 3SOBL 4DKEL 1KLUA 4YWGH 5J3HC 5CBAA 1Z3GH 5DD3H 3TT1L 5D1XC 1KCVH 1QACA 4YHYC 5FOBA 2YMXL 2Z8RA 3T65A 1MJ7L 2R29H 1MJJB 2XIDA 1VKXA 3O45A 3PGCB 1OWRM 3QISA 4G59A 2I5YH 4NNPL 1M7DB 3IXAB 1IGJA 3RWIA 1ZEAH 2QADD 2MQ3A 4JANB 3LV3A 1VFAB 3MRGA 2E7LE 4GRWE 1HINH 1RZJL 4WW2C 4DQOH 1CWVA 4NQEA 1UKSA 4MD5A 3KPQB 3BWUC 3DBXB 5KAQF 1AH1A 3HZMA 1EUTA 2EXYD 3KDMA 1R3HB 1H3GA 2NY2B 5JXAH 4HJJH 5HHVL 5GRWA 3SGDH 5LGHL 5INCA 5KG9B 1RJLB 3QA3B 1A9BB 1S78D 3RBGA 1DQLL 2X6MA 2JELH 4G7YH 4NJAH 3DPBA 4TUJB 1KB5A 2HRLA 1AGBA 3ARBC 1VEPA 4AK1A 4AEIH 4GAGH 4JE4B 3HE7B 1IM9D 3MV8E 2J5LC 4H1LA 1YMMB 4W4NA 3S37X 5CJXA 4PGEB 3C60A 1LGVA 2Y36H 5GS1A 3MLZH 1D5ZA 4FZEL 4OZGF 1YC7A 3LS4L 2VXQL 5LAXB 1WFTA 1ZGLA 1M7XA 4I9WD 3TJEL 1IKNC 1QFUL 3QQNA 2WW8A 1ACYL 3NCEB 5JHLL 5EZLB 2MMXA 4MNGE 3WHE1 1DVFD 1UZ6E 5TGBA 1MCSA 3LKSB 4EDXB 5ADPL 1NDGB 4JZOB 4UQ2B 2FL5B 1T04B 1TCRA 1YMHB 1IC7L 2NY0D 4LAQH 4LP5A 1BIHA 1Y6MR 2IG2H 4OCRH 4Q9QH 2YUWA 1NPUA 2G9HB 5MEQB 1FNSH 4JM2B 4MS8C 1KELH 1ZSDB 1FNHA 4OAWB 4B41A 4YK4B 4ZTOH 5KVEL 5IB3A 3VXRE 4ZS6D 2WWMC 1U8KA 1G6RA 1HQ4B 5GS0H 2A73B 2HVKA 1NC4D 5C08B 1S8DA 4OCMC 3UTQA 3KAAA 3BUYB 3MV9A 4EUPA 4OF7A 5DQ9A 1G7PB 5HBBA 2NXZD 4Q9RL 3U0WL 5EU3B 4PJ9A 3PWPE 5A2LH 5JO5A 4X5XA 4K2UH 4U6HA 5DFVD 4GW1A 3T09A 1DE4A 2FLRT 1MCHA 2ESVD 1IAMA 4LAJH 3IKCA 2Q3AA 2J6EH 1EGJL 2AJXL 3EYSL 4ZOAA 3SE8H 5C09D 1OSPL 3V5DB 4LCCB 1G7JA 3S4SA 3HS0A 5FHAL 1RUKL 3VRJA 1NMCB 3OJMB 4ZFOA 4LNRB 5JXEA 1QSED 2XXCB 5TQ0H 1JGEA 3BKYL 3P9WB 1AXSA 2OJZH 1VSCA 2BVOB 4RGNB 2FLBT 1GZQA 3L5WA 3M07A 1E4JA 2IANA 3P4MA 4ALAH 1FFNA 1T7ZA 4LVOC 1OL0A 5I74C 1QOKA 3QO1A 2DQUL 4LLMB 3GJEA 3MLYL 3MOQA 1A4JA 3JXAA 5KSAB 2GT9B 2BERA 2BY0A 1XR9A 3NZHH 5CJBA 2X09A 3WNLA 1J0KA 3BEVB 1OP5K 2KH2B 5TE7H 3C5ZB 4LPXA 1U2HA 3TGXA 4OCSH 4S0TD 2UVEA 4U1IA 4Y4KB 2Q86B 2AABH 4CDHA 1BD2A 5CZVL 1EH9A 2VO5A 2XG4A 4K7FB 5JZ7C 3LMJL 1IC1A 2N7AA 5C2BH 2BK8A 1NCAL 4NFDA 4DW2H 2GY7B 4XMLL 1S7TA 3NH7H 4X7TA 5ALBL 5JMRA 1CD1B 1UFUA 1LD9A 2FX9H 1AIFB 1JNHB 2W07A 1KCGC 4Y4FA 1QSFA 4Y16C 1WWBX 3V0WH 4AL8L 1AD0B 2XQYG 1JGVH 4W6YB 1MHPH 2HT4D 3SGJC 3KPQA 3QJFB 4F2MB 2GJ6E 3KYOA 4L8BB 4PJDE 3S37L 2A6JB 3VGEA 1I7RA 3B8YA 3D3VB 1OAQL 1QFHA 2CIIA 3GIVB 4GG6A 3BJLA 1G9MC 3KPSE 4NO2B 4HKZB 1A9BA 4HWNA 1S7RA 5ANMA 1XIWD 1TJIL 2YRZA 1IGTA 3O41B 3CFJB 3ULVF 4POZC 3DX7B 2ID5A 3VFOA 5DVOA 3W11D 1XR8B 1NDMA 3Q3GA 1RUQL 1IC4H 3STBA 4DKFH 3HE7A 4LCIH 1CE1H 4XAKE 4HG4J 3BMWA 1YMMA 4UT6L 3V6FA 2GJJA 4IIQA 2CKBA 5T3XE 2IAMC 1RU9H 4HGWA 1D5IH 3GO1H 4P59H 4NQCE 4PB9L 5FA3A 3MR9B 4M6ML 5FYLL 5MI0B 1JWUA 3TJHA 1RIUH 2GUOA 1EEYB 4FFWC 1JRHI 4P5TD 2DQJL 3DGGB 4ONFL 3NIFF 4K8RC 3UP1A 4FQLL 4TSCL 2FL5A 3B6SA 4KK9C 1YMHA 4Q2ZA 4DZBB 4OT1H 3LY6A 3N1FC 3VG9C 1G1YA 2YKLL 4JEGB 4UBDC 3O11B 4U3CA 5HVHB 5MEQA 3GSNH 2VITA 4RFNB 1SY6A 2R69L 1ZSDA 4FQJH 1VADA 1OAZH 2PN5A 5C0AB 3CUPB 4NHUB 2YD9A 5C07D 3VH8A 4Z0XB 3RUGB 1CU4H 5C92A 4MZ2A 1IBGL 2CD0A 4KWUA 2XKNB 2BDNH 4H25A 1ZA6A 2J8UA 3BUYA 4GAJL 2BNUB 1CXIA 2VLKD 5IW6A 4JPIB 4GRMA 2B1AL 2G5BB 1P7QB 1NANH 3JVGC 4F33A 1EMTH 5HD8D 5IP4A 2EDXA 4XPGH 3FTGA 3LKPA 1G6RL 5ESQA 1I9RH 1IE5A 4F3FB 1I75A 5BZWB 2P45B 5SWZB 4HBCL 2XWBA 1FFPB 2WBWB 5CWSB 5F9JB 3U9PL 2VDML 2H26B 5DJ2B 1FRGL 3HE6D 1OPGH 3O2WH 4GS7C 4LSVH 4JY4B 3HG1B 5GRYA 3VI3F 4U6YB 4RSVA 2WSKA 3MYJA 2OSLB 3TP4A 5EUKA 1FYTB 2VISA 4QHKI 4LNRA 3BPOC 4G5ZL 4KTYA 3GSQA 4HUUB 3IDNB 4LP4A 1S7SB 5IF0B 1A47A 5J8OA 1LO0L 2HJLB 2YRPA 4UIKH 5KS9A 4P48A 4YDIL 5DRWB 5MEPB 3BSZL 1NBZA 3W2DH 5IVZA 1KT2A 3BISA 3QIWD 4FS0A 4ZFOL 5TJWK 1E4WH 2ENYA 4KTDH 1YN6A 3QUKA 4FN0A 4GRWF 2AV1A 3MRPB 1HHGA 1WF5A 2MJWA 2H6PA 2BVPB 4OD1H 2ZKHL 1PX3A 4G42B 4QWWD 3VGDA 2NY5H 4NKMB 3QUXA 2BSTA 5L8JB 3PQYA 2IFGA 5EO1B 2V17H 4J3UA 2G2RA 4D0BB 4YBQC 1OARL 1DUYB 5J1SC 2A6IB 1EVTC 2IEPA 4L4VB 2ARJA 4N0YH 5T1DL 1HNGA 5K9QG 4LEXH 4UILH 4H88H 5D6DA 5BS0A 5IVXA 5E70A 2HFTA 2WUCH 4FMFA 3CD4A 4NSKB 5JR1L 4MX7A 2OQJB 4MQSB 3K7UA 3QPXH 4XZUA 1I3GL 2HJFB 1FO0B 5IJKC 4FXGB 4FNLH 2A6JA 1F90L 4UIMB 5T33H 1KEGL 4JFDB 4LCWB 3U46B 3GMRA 4R0LA 4KKBD 5CD5D 3IFOB 2VB5A 4G8GE 3G6DL 4ZNEE 4W4OC 3TBTB 5D2LE 3W0WD 1DBJL 1UZ6F 5C6TL 2VR4A 3NGBC 4IS6B 4D3CH 2ZG1A 3Q6GH 4I3SL 5J6GB 3AS3A 2NQCA 4XRCA 3DOSA 1HE7A 5EB9A 3VGBA 5FGCB 2DQEL 5L6YL 3NZ8A 4D2NA 3FT4A 4R7DA 3LKQB 4RA0C 2B2XL 4G6JL 4FXKB 4MNHA 3MRFB 1T3FA 4HIEB 3T0VA 1F5WA 5CGYC 4IOFC 3MA7B 4RAUB 4HEPG 2G75A 4FFYH 4Y5XC 1CXHA 5TF1L 4JJHA 4Q6IC 3TESA 5ECJE 3PDOB 2X05A 1G9NH 3DGGA 4GAFB 1BFOB 2VOTA 5IG7A 4X99A 2Z93A 5HHPB 3QDGD 4XPTH 3OR6A 3VXSE 4DOHE 3MUGB 4OZHB 2CKBL 3BKJL 4G80A 1B6DA 1VFBA 3W82A 1V05A 5DI8B 3GMLA 3K2UH 3FO0L 5FGRA 3WXVL 2GFBA 5D9SA 3LRSA 4YIQB 3WCYA 1LE9A 1IM3A 1UKTA 3OZ9L 1S7UB 2XTLA 3QDJE 4G43B 3T2OA 4DCQB 3K0WA 4OLZH 2VDLL 4JPIA 4YFEA 4JFQA 5I66B 1SY6L 4LNVA 3I3BA 5DJXB 2BNRB 4BSWB 2YEZB 3ARVA 3CVHA 4GW4A 4EBQL 2PKDA 4BZYA 4LVHC 3MRRB 1PKQA 2DKSA 4F3FA 1BFVL 3D48R 4HUWA 4M93C 3EDFA 5KVMC 2D9QB 4J8RA 5IEHA 3TEUA 3RRQA 2HWZH 2X4NA 3ARGC 1K9TA 2X4QA 1ODAA 2QSCL 4R3SB 1TXKA 3NCMA 1CQKA 4U1GC 2WUBL 4MJ5B 1BQLH 3O6MH 3U1SL 4U6YA 5C6PB 4F7CA 5I0DA 4Q0XL 3ZKQD 2OSLA 5CKGA 1BQHG 4IHOA 1HN1A 1FYTA 3GBNL 4JFOB 5HDQL 5FKAA 4BQCA 3L3IB 1U3HA 1ACZA 3LZFL 3QFDA 4JVPA 4KROD 4H20L 2KQMA 4DVRH 1TENA 3U2SA 4IMLA 1GGCH 2I60H 2IGFH 2JIXB 3C6LD 4O58H 2FYYA 1IZJA 3V5KA 1KUMA 3RIAK 3U82B 1QQDB 4I77H 3QPQC 1T6WA 3QIUB 2OTUB 2QQLH 5EORL 3MOAL 3L1OH 1BM3H 1Z2KA 5C0CE 4RFEB 1MAMH 2RHEA 5DO2C 1Z9SA 1OAYL 3WHXB 3AFLA 5IM7A 4HLJA 2Y25A 1ORQB 2NY5C 1TZGL 2L7UA 5CP3H 1IJ9A 4FQIH 4OGXH 4WY7L 2BVPA 1AKJB 4PJDF 2UYLB 1WIPA 5L0QB 2V2TA 2Z35B 4G42A 5DFTA 1F4XL 4S1RL 4PRHD 5I73B 5JW3H 4NYLA 3ZHLA 4UB0H 1F02I 1AGFB 3MO1A 2WZPD 2Z4QA 3BE1L 2EDFA 4PJCE 4K7PY 4DN4H 1AGCA 3GSRB 4FTVB 3JWDH 1NEUA 3O6FC 3ZKXB 4WHTB 4Z7WE 1FNEB 3RWJB 4DN3H 1YEHH 6FABL 5D71L 3CXDH 3EYUL 3HMXA 1T66C 4UOJA 1ZGLP 5AZEL 4Z77A 1TZHB 2X4PA 3ARFC 1K3IA 4UV4L 5J7CC 4E5XA 1MCWM 1NAKH 1EO8L 4LPUA 4Z18A 2WBJB 3OKNB 3SJVB 1LK3L 5CEZE 4OCXH 2HLAB 4QRPE 3FT2B 4KJPC 3IAPA 1UWEH 2RB8A 2Y1VA 4PLOB 1CGUA 1KJ3H 2P8PA 2AQ3A 4IS6A 1DQDL 4GKNB 4HWUA 3FFDA 1CZ8L 2F5BH 4JLRA 2VDKL 3SE9H 4HUXA 1NGZB 4M5YL 5DRZA 4XP4L 5GISL 1WUNT 1YN7A 1X3DA 2X70A 3PUCA 3QDMA 3DMMC 3TVMC 4HIEA 2XG5A 2ITCB 1I7UB 1WBZA 4WV1B 5HHNA 2FEEI 4QEGA 4UT7L 2BHUA 1ZT1A 3R1GL 3EYQC 4HPYH 2DLFH 3RNQB 1KJVA 2YBRA 1CFTB 2QLVB 1PDKA 3MLSH 4ETYA 4DVBA 2BNQA 1EUUA 2BJML 2ZCHL 5C0CD 1T5WB 4TUOB 4PPTA 1MIMH 1RZKL 3HI6H 4HCRH 1NSNH 4LLUA 4WUUA 4ZYKB 5IROC 4DUWA 5LJYH 3BIAX 3BT2L 4OUOA 4ZFZB 1IT9H 2JTDA 5GHWL 5IGXH 5MENB 3L3HA 1HHKA 4XP5L 3ES6A 4KJYA 4J3SA 2VWEE 1HQRB 3D85D 1L7TL 1NLBL 1W72A 3ISWA 2DMCA 3G5ZB 4N0FA 4ZDHB 4TQEH 4WUKL 3SGEI 2DMKA 1EJOH 1QBLL 1FL3B 4HUVB 4DCQA 3CLEH 5IW1A 1XF2B 4HWBH 2PO6A 2YRLA 4D9LH 1DFBH 3VXOB 4MYWB 5C0RH 3R4DA 1UQSA 1JHTA 3ZDXE 1SEQL 3CGTA 4XHJD 4BSWA 2YEZA 4O00A 4ZFFB 4GBXA 4O4YH 3T0ED 3RZWA 1AR1D 5JDJA 3MRRA 1BQHB 2C7UA 5F6HJ 3U6RA 4LHUA 1CDYA 4WI4A 4PFEA 3DUUA 4H8WL 1JI1A 1JZ3A 1FFRA 4JFFA 1B2WL 3HNVL 5E1HB 4U0RB 1NCCL 4R3SA 3P9MA 5FA4B 4WJ5B 1X5ZA 5CEZD 2FEDC 3PGDB 4LCYB 4QRPD 5D70H 3CVHL 5FB8A 3BH8A 3LN4B 1UXWB 4P2RB 3MNVA 3CVIL 1XT5A 4NZDA 3ULUC 3LAFA 4MMXC 2XWTB 1B4RA 3CZJA 2EIBA 3V0VB 5DUPH 2X89D 1OF2A 1RZJC 2W9DL 5EBMB 3BESR 4KVCH 2RJMA 2JIXA 3I2CL 2VLJE 4F7EB 2AK1H 2CLRB 2XZQL 5A16B 3QIUA 4WEUD 2BZDA 4KK6D 4U1MB 3E2HB 4XAWH 1HNFA 4BUHA 2DBLH 4LPCA 3HC0B 4G6FD 3RWFB 4RFEA 5DUMH 2AJSL 3WHXA 2W0KA 2P49B 1YNKL 3HNSL 3OJDB 3RY6A 3MLRH 3UEZA 3DHMA 4QXTB 1UYWL 1HDMB 4AEHL 5HVGB 3ARDC 1BEYH 2DRUA 2ZUVA 3BIKA 1DLFH 4XP9L 1CXEA 1FVCB 3V4VL 4TTGA 4WFEE 5K9KB 4AY0A 4HS6B 5D2LF 2I9LA 3O8XD 2VZTA 1VGKB 3PGFH 3E3QE 3RGVA 3PL6A 4J4PC 5T3ZH 4PJXA 5B8CC 2VDNH 3HLAB 3RWJA 3EJZC 5DQJA 2R2BA 3MBED 4TRPH 1ZHLB 2Q7YB 1FE8H 1PY4A 3EW3B 3L9RB 2KZWA 3FQTB 4IRSA 4JFED 5FO7A 4V1DB 4OI8A 3HR5B 1TZHA 1GIGH 4L8CB 3PG2A 3QT2A 1Q72H 3TFKD 1EZVX 3F65A 4XXDA 3VXTB 4KKLC 2J2ZA 5E6ID 4XMPH 4PRNB 1GZPB 1MFAL 1OTTC 2WBJA 2QJDA 4YAQB 1M7IB 3VMPA 5F9OH 2GJZA 1A1MB 4TVPH 4M6NH 4FP8H 1DQJA 1M05B 1TCMA 3PXJA 3HMXL 4YDJA 1HKLL 4KJWD 2XWJB 5EFIB 3WIIL 3L95B 4GW5A 1XGUB 2DYPB 3P0VH 1WWAX 3SKNB 2O5ZL 2ZOKA 4EI5C 4JQXA 5HPMA 4KUCD 1A6ZB 1F42A 4J6RH 4IRJD 3LB6D 1TNNA 3VW3L 2GITB 4P49A 1I7UA 1TITA 3EOTH 5L88L 2EEAA 1S7VB 4LQ1A 3O2DL 5GRUH 4QRQB 1CVSC 1JWMB 5I1AB 2Y5TA 1T7YA 5F9WB 4BH7B 1JRHH 3QEQD 5F1NB 4RDQG 4ZXBB 2R2EA 3DUSA 4N0CD 5I8KH 1DL7H 5HYEA 4HAGA 4Y19B 3O9WC 2IQAB 4X4XB 4RISL 3FOLA 4L8SB 2R56H 4ZFZA 1NAMH 1NBYA 1QYGH 1UB6B 3BKCH 3KLHD 3S35H 1EFQA 4XNUL 2XN9B 2Q8AL 3X12B 3BDXA 3Q1SH 5JW4M 5GPRA 4BQ8A 5KTEL 5IEKA 5KSBB 3NPZB 4QHLA 3IFNH 3D25B 3UTSE 3VGAC 4WFED 4OQTH 3DI2B 1FL3A 4MXQD 5HSFA 1R5WB 4XMKL 4D0CA 3P9LB 2QKIB 1MEXL 3SDYH 1JHKL 3QUYB 3DXAB 5IBLC 1U8OB 2YC1B 2FATL 5IBTL 3U4BH 1VA9A 1VENA 3HRZA 1RHHB 4ZFFA 2FIKB 1BFTA 4JGUA 4U31A 3LOWA 1U42A 3WXWH 4W81A 1JHLH 2PW1A 5I2IB 4M6AA 1Z5LA 2DM2A 4LLVB 4KDTA 3RKPA 3BRGC 3ZKSD 3D39D 1U8IB 5KSUB 3X3GL 3HUJE 3OKDA 1JP5A 5DEGA 3TBWB 3V6ZB 3S96B 2M8XA 4WJ5A 1XGRA 3NFSH 2FSEA 5CSBA 5DXWA 3GJFK 4NKDA 3VWJB 4AJ0A 5HYSA 3NABH 4P2RA 3V8CA 4P4KC 1MHEB 3S98A 3BQUD 3FB7B 5IESL 5D2NE 5E0QA 5E99H 4C56A 1YDPB 2NXYB 3RDTA 4N5UA 3UJIL 4I0PA 4NRYB 2KKQA 2HJKA 2NY4B 5I1EL 4CAGA 4HGMA 1J8HD 4TSBL 3ROOB 2NY7L 3QCTL 4FQXC 2X5PA 5K9QI 2BVTA 2PTTB 1FNGA 1JFQH 4PJCF 3BZ4B 3WLWD 4G8IA 4I2XA 4LBEB 1X5HA 1RUPH 4Z7WF 4MDJB 4QLRA 2AW2A 2P47B 4G6KH 3THMH 2O93L 2NY1B 4XP6L 5D5ME 2VABA 4X7FC 3DURA 3MNZA 5GRXG 2EEBA 3MPCA 4ODHL 2IF7A 1LO4L 5F8QC 4ZTPH 4QY8A 4ZPTA 3IGAA 2IMMA 4I48B 4UQ3B 3KYMB 4P2OB 4XNZC 5CP7A 3VE0B 4HS6A 5C7XH 1F4YL 4HS3B 2MSPA 1H0DB 1GAFH 1KPUB 3RVWC 3OKLA 2FH8A 2VLRB 3QUMA 4LMQI 4HLZG 2P5EE 3VGGA 5JOPE 2A9NL 2F19L 3SDDD 2ICWJ 1UVQA 3FQXB 3K8KA 4NBXB 5CJXC 2AERT 4LQFH 4YGVA 5GS1C 5EOCL 4OFPA 4V3DB 4NQDD 4A2MA 5ACZA 4OZGA 3ARED 4YO0A 1QBML 1AC6A 3CXHJ 2QADB 3IETB 5D7KD 3DVNA 4JM4H 1JUFA 4KHXH 5D7JD 3VRIA 3HAEA 4FQHA 4NC1C 5LQBL 3VFSA 5I1DA 2VZ1A 1MHCB 4TNVF 3OB0K 3V5HA 2Y07L 1EPFA 2B8OT 5SWQB 4WGWB 1MI5E 2K7QA 1KB9J 1HIML 1B90A 1Q0XH 3LEXA 4TN9A 4YXKH 1G7HA 3ZTJG 5A3ID 4JPVL 3GM0A 3VMNA 5E9DD 1P84J 2ERJB 2A0LD 5ID0A 1JPTH 5D7SL 2BFVL 3RY4A 1YY9D 5SWSD 2ED9A 1MFCH 2DN7A 3ZDXF 3ZSTA 3BMVA 1R5VB 2AI0H 2VERN 1CGSL 2HTLC 3OXSB 4PJ9C 2ADJA 1UWGH 2HN7B 3WYRA 1IM9B 3IF1A 3O6KH 3MRMA 1BLNA 4XVTL 2HT3D 3G6JE 3X12A 3CFIC 3FFCD 4W6WB 4KK8C 5I75C 1KXQE 1TJGH 5IMLB 1LWRA 1DVFB 3A0OA 4JFZL 5GSVA 2EE9A 3SKUD 1ZT4B 1NMAL 1KCSL 1RHHA 4WHCA 5JXEC 3HZKB 4PY7A 2NY0B 2YA1A 2MCG1 3MYZA 4ZS7H 1P4IL 3U4EB 5I2IA 3CAFA 4WO4D 5CUSH 4EI6A 3V4PL 4KQ3L 4M6OL 3VFWB 4OGYL 1K4CA 2FNBA 1SM3L 3B43A 3I3EA 4QRUB 3X13B 5EBLA 1NC4B 4NM4H 2FO4B 3WDIA 1MSPA 2NZ9C 1MHEA 2YK1L 3FB7A 3UC0L 3UTTE 5HYJD 2NXZB 1AI1L 1KULA 4NWUH 2PCPB 4PB0H 4YFLF 2V5YA 3MRHA 4LLYB 5DEFA 2XFXA 1RK1B 4HQQL 4P9ML 1FNFA 1ZHNB 4NRYA 2J3SA 4OJFL 4MJ6A 5L9DL 5IIEA 2OR9L 4MCZB 1QHOA 2V2WA 4FOMA 1IEBB 2PTTA 4JPWL 1CXLA 2ESVB 4XPFH 4BQBA 2J7LA 1Q0YL 2NLJB 4ODWA 2ZOLB 2A6DB 4FFVC 4DGYL 4U1JB 2E9JA 2PTVA 5D1ZA 4Y4FC 1C5CH 2ZZUT 4KY1H 5D72L 4DEPB 3KLAB 1E28B 5D4QA 2P4AB 4OZFG 1L8JA 1CLYL 3LSOA 5GJTH 5F96L 1KCUH 5J57B 5JHDE 3MGOA 4QOKA 3RL1B 3REVA 1TFHA 3VG0H 2NY2C 2O61B 25C8H 1P6FA 3ELAT 2BCKB 5IFJA 4Y5VB 1UCBH 2F5AH 3RTQD 5E8DL 5BVPL 2NPLX 4HV8A 4WHYH 3UZQA 2CLVB 3VE0A 2ZJSH 5EOCJ 1F45A 3P4OA 3RAJH 4PREB 3VFMA 3OKKB 5DTFA 3CPLA 6CGTA 3G5VB 2P44B 4YHOL 1ZLVH 5LWYH 4J12A 4MNGB 1FZOB 2EC9U 2VIRA 3A67L 4NUGL 3RI5K 5GRJH 3HE7C 2VQ1B 4RCAA 3NACH 1MWAA 3MA9H 2AK4E 1XZ0B 2APFA 4OQ1A 4IIQC 2HKHL 1EAPA 1TVDA 4LU5L 1J1OL 4CNIA 4JO2L 3LCYA 4PTTB 3K74B 3TJHC 3QUML 1E4XL 3Q5YA 4XVUC 1F6AA 3MCG1 2DD8H 2WINB 3C08H 3H7BB 4P0DA 2C1OA 4PRIA 4AIZA 2XTJE 4K3GA 4U0QB 1LP9E 2LU7A 5ILTL 1V7ML 3L3DA 3EO0A 2NX5E 4D9RD 4M43L 4J23A 2ZG2A 1ZMYA 5C0NC 3T4YB 5FM4A 3QNXB 2P5WE 3C5JA 4KDWA 5BRZE 4LGSB 2B0SL 4JN2B 1FL6B 3GZKA 4X4MA 3QFJD 2OK0L 1N0XL 4ELKA 3SPVB 3GHEH 4QO1A 2XI9A 5KSVA 3ARQA 2E27H 2P7TB 1PZ5B 1XIWB 5DT1L 2YWZA 4HIXL 4NT6A 2B20A 3MOBL 1R5VA 2QSVA 4AH2A 3UTZA 1TPXC 4I3GA 4WI3A 1KFAL 5SX4H 4TPRL 1P4LB 2ORBH 1A1NB 4XB7A 4MSWA 1FJ1B 2WLYA 4X8XA 2QQKH 4PGDA 5JHDD 4KZEL 4BH8B 5DJ8B 1OT2A 3A6BH 4RMRA 1KBGL 3HUJF 3J7HA 3QXWA 3DO7B 2AEPH 3BDBA 5LVEA 2EO1A 5JUEL 3UTPE 5B3JE 3F58L 4XVSL 1XF4B 3VFRB 1AO7E 1Q9LA 4P5TB 1A14L 4NRZA 5HYFA 5EZOL 3TA3A 1C08B 2W0FB 3QG7H 2MHAB 2XT1B 3QQ9D 4GG8A 1K85A 1S7QB 4PG9B 5FYJD 4HKBB 3RX7A 3RZCA 3K46A 1MNUH 2W60B 4R6UA 4RGNC 1T0NB 5E2WL 1CGVA 4KK5D 5IHZA 1N4XH 3O4LE 4E42A 4MJIA 1LO5B 2EC9T 4S1DC 1N5YH 2YXFA 1EJ6A 3PHQA 4XNQB 3GMMB 3UXFA 5IJVB 2HFEA 4X6DA 3FB5A 2AGJL 1ZS8A 1TQBB 2FO4A 1OM3L 3L5XL 3QNZB 4KRMB 5EO9B 2VLKB 2D9CA 1IRAY 3LEVL 3ZKMC 4B7IA 5I1GL 4QRSB 1KG0B 5D5MF 1NUFA 4FQQB 1CFSA 2VDOL 2E7LA 3FN0H 4N0RA 1ZVSB 1A6VL 1E27A 5ESVB 4OCWH 4TYUA 5CINL 4M02A 4Y4KC 5DA4A 1A1OA 4X9GA 3QUXC 4PJDB 4Z0BH 5EU6D 1KIPB 4DWHA 4WDIB 1SEBB 2JJTA 2OI9B 2GEEA 5F7DB 1JCKA 4OLVL 3GK8H 5GGSA 3DJ9A 3HE6B 1G7MB 4R4FL 3IDJB 4P23A 4LEOB 3I9GH 4N9GA 4OLYH 5D6DC 3T1FB 1W8OA 5IB5A 4LKXA 1AHWB 5FDYA 4MB4A 2M1KA 3L5IA 4KKNA 3RL1A 3H42L 3V7AE 3MV8A 2EE2A 2O61A 3U7WH 3EDJA 1EDQA 4R0LC 3MV7D 2YPLD 1A2YA 4NUJB 1X44A 3RJQB 1OGAD 1QRNE 3PE9A 4NQCB 5CLWA 3QIWB 4ORGB 3DO3A 4NZRH 3EOBB 3JV6A 3ZDZF 2DS4A 4IOIB 1RVFL 5EBWA 4OF8A 1EA9C 3H9SE 5CIPA 3WIFA 3JWNC 1XZ0A 1Z0NA 1RFDH 3MLPA 1HSAB 4LCUA 2PXYA 1RZKC 2UZIH 1FV1A 4RMVA 3JTCA 4L1DA 2CUHA 3TNNA 2GCYB 1R5IA 3CMGA 4PTTA 4MA8L 3VD3A 3VXRA 5D93B 3T3PE 4XBPB 3FZUC 1D9KA 2EH8L 4G3YL 1J10A 1IAII 4PBVC 1I1FB 1MWAL 1G7LA 3A6CL 2H2SD 2AJ3A 3B2UC 5DYOA 1U6AH 5I8OL 4HIIB 4PRDA 2VSDA 1UJTA 1LNUB 1JF1A 1N3NA 1XCQA 2YWYA 1YNTB 1NGWA 2NYYC 3JSSA 3BPCA 2VAAA 3G6JF 3L5HA 5L8KB 2XA8L 2EYTA 4NO0A 4RBPH 3PWPA 1XGYL 4JN2A 2R0WH 1CIDA 1H3PH 2ZCLL 4Y1AE 3DV4A 4Z95H 4O2EA 1MCBA 2EIEA 5J0BA 1A7QH 4H8WC 3SPVA 1AE6H 3W0WB 5I17B 2P7TA 1UKQA 1OCWH 1BVLB 3WDJA 2O5YH 4OLUH 3LD8B 4BM7A 1KTLB 1MUJA 3BP6B 1P4LA 4JRWA 2R9HC 4EQ2A 3O3AB 3LN5A 4NNYA 3QI9A 5E2VH 2Q87A 4K23H 5DJ8A 4RGMC 2A9MH 4K94L 4YXHH 4ODSH 4K9EH 4MDIB 1KPRB 1FBIH 2VDRH 3MREB 4WI5A 3BZEA 4M7LL 1DBBH 4G9FD 4FABH 1J5OH 5MEOB 3EYVB 3QDGB 3CSYA 3U7YL 1DQML 2Y06L 3E6FA 1U3HC 4ODUB 1F8TH 5DR5H 3F12A 4ZUTA 1L7IL 4JQIL 3STZA 4Q9CA 1BX2A 15C8H 5ADOL 2ADIA 1KIRA 5B39G 1QFWI 4AMKH 4Y8DC 5T3ZE 1AQKL 1J11A 4KQ4H 5F7MC 4M1DH 5JORA 4PJEA 5KN5A 1JK8A 2ICWB 3UYRH 4U3XA 3S34L 5J12B 2NTFA 2PW2A 1A4KA 5IB2B 3L7EB 5IOPA 4ZAKB 5TDOB 3CFEB 2EDWA 3BXNA 2JJUA 4BFIA 2H32B 3CU7A 3NOIA 5BO1L 2ZCKH 4PRPE 5TFSL 4QYOB 4APQD 4NZJA 3JTSA 2GJ6A 4OZFA 4DTGH 1PAMA 4ODTH 3UPRA 4TUKL 3K4AA 5FUOL 2MWCA 4TVPE 3HNTL 1C8PA 3E8UL 3SDAD 2D0HA 5I9QB 5F7DA 3D0VA 1NGYB 5GGVH 3KPSA 1DBML 2OL3A 5J9PB 4JRYE 5GGRB 1K2DA 4ESKA 1AHWA 1WWWX 2Y6SD 5I18H 4PIRF 1J8KA 3MLVH 1A7PL 1GOGA 1KGCD 2VDQH 4HS8L 2VAJA 1CN4A 3NTCL 3WD5H 5EO0B 2FZ3A 2YD1A 3EBAA 4P46A 4QTIH 5C0JA 1JPSH 1I9JL 3M8OL 1N7ML 1WZMA 3QG6B 1YEJH 4JY5L 3RU8L 5ICYB 4FA8A 1FNAA 3H2WA 4OKVB 3C6LB 3C9NA 3DRQA 1AY1L 4NQXA 1T03L 5KW9L 1G7IA 4NUJA 4M7JL 1U2CA 3CDYA 3F7YB 3RVXC 4NQCA 3D9AL 3ZT6A 4EVNB 2I26N 4Z7NE 1LP9F 4CDGC 2ZUQC 3B9KA 2C1PB 4K3JL 3U0PA 4PY8J 3RKDD 1KN4H 2BC4A 1ZK9A 2HH0L 5A2FA 5H35B 1S3KH 1S7WB 3HZYB 1PQZA 4UTAH 3NCJL 3MLUH 4N5ED 2Q76B 4PRHB 2GCYA 5T1MB 1NFIB 4C4KT 2E6PA 5I1IH 1HEZA 5D96C 1L0YA 4LSUL 1DSFH 4U1HA 1KJ2B 2VXUL 3S36L 1NUDA 1I1FA 5CJOL 1JNNL 43CAB 5SV3A 3T77B 4KAQH 3DRTB 5HI5D 3MRKB 4HIIA 3LN9A 4ZSOA 2CPCA 3SOBH 1YNTA 2Q6WA 4DKEH 4S1SH 3VFTA 4OM1L 5FYJL 3PP3H 2YMXH 3RX5A 3KJ6L 1JN6B 1KXVC 1X9QA 4QRRA 3GBLA 4OD3L 1D5BA 4D0DB 1P9MA 3X17A 1BJ1J 8FABA 1D5MA 3JUYA 5B3JF 3LKOB 1SBSL 1YPZE 3KNBA 2UUDK 2PO6C 3CMOH 2GYSA 3U7AA 1A3LH 3MLWH 1ES0B 1JMXA 1NGPL 1P2CB 1WCBA 3ZHDA 3MNWB 3GUTB 3QO0B 4L9LB 1I1AA 3ORJA 2HFFA 3H7LA 4GBXC 5JW5B 2RIKA 4ISVA 2UZYB 5JLZA 4UAOB 4K9EC 5E2UL 3N1QC 4HC1A 3H3PL 3MFFB 1R3IL 4U1SB 1FIGH 3MODL 4MDIA 5CJQH 4R9HA 2H45A 4I3RH 1DLHA 2IPUG 3EFDH 1PG7H 1TETH 3NFNB 3PV6A 1FAIH 3QYCA 4X0KB 4LIQL 5B39B 1OGTA 1YECL 3VDBA 1T2QH 5C0CB 4RBPK 4ZOBA 4L4TD 5EN2B 4X4YB 1T0MB 4LDOB 5DVKA 4NGHL 1MVUA 5ETUB 4YDVA 3B9VA 5EU7E 5DSCA 5ITFA 3GHBH 5DJ6A 2FX7H 1ZHKA 3D85B 3SKJL 3DX6A 4YUEL 3SDCA 1UH3A 3QIUC 4FZEH 2AAVA 4PJGB 5DC0A 1UA6L 2H3NB 1X5JA 2VXQH 3MSPA 1YEKL 3KYNA 2ATPB 3PHOB 4OCYL 1KTDA 2IPTH 2UZXB 4PUBL 1IZKA 2AEWA 4FQ1H 4QHUA 4X7EC 4CVZA 5E5MA 5H2BA 5JHLH 4PJCB 5J3HD 1DUZA 4ZAKA 5LXGL 3RY6C 2JJWA 3ALWA 3MQIA 1C1EH 1WISA 5IQ9B 2F9BT 2H32A 3DVGB 4N8CL 3M1BB 3T0EB 3MJGX 1G6VK 2HAZA 5I73C 1MFBH 1S9XB 1C5DB 2UV3A 2D0FA 2EYSB 1MFEL 4HKXA 1LEIB 1RJZB 2PR4L 3W39B 1LDPL 4LSTH 4O9HL 4YDLB 4G8GA 4ZNEA 4GLRI 4HAFA 3RGVC 3BAEH 3VJ6A 3MJ9L 3PL6C 1FGVH 3ZKXC 2CK0H 4QRPB 5D2LA 2O5XL 4TSAH 5JQHC 1UM5L 5F93C 2Z92A 3G5YA 3K80A 4XP1L 1I8LA 3TT3L 3VXQB 2L7JA 3I6LE 4AG4L 4I18B 4KGJA 4IRSC 3VFPA 1FPTH 3KS0J 5F3BB 4Z8FL 4TULL 4ELMB 3QXDA 2FJFB 2DJUA 3NIDE 2OL3L 2WBJC 1FLRL 1PY9A 3SCMD 3F7YA 2I27N 4K7PH 1FDLH 2FRGP 4I13B 3T3PF 1MJUH 3S3SA 4S0UC 5KVGL 3ARBD 1JGDB 5C08E 5KJRH 3P73B 4PJHA 1EGJH 2NNAA 2PTUA 4G6FB 4X6FA 1FVEA 2SEBA 5E1AB 2FD6H 4G8FA 1OTUC 1NMBH 1RUKH 5DD1L 3SQOH 2NW2B 3VXSA 2N7BA 2M2DA 4KJQC 4NN6B 4X5LA 4XC3L 3QULB 2CUMA 4P57B 5HHXL 2XICA 1B0RB 2AJVL 5T3XL 3P11L 1YEEL 1H3WM 5BZDB 2PETA 4LASL 3PIQA 4DZ8A 4Y7MA 5LGJB 1L9NA 1AJ7L 2OCFD 2ICES 4M03A 5CILL 3EIFA 3O8XB 3QDJA 2DQUH 1S9KC 3GM8A 4MS8D 1EK3A 4OV5A 1C5BL 3MBEB 3JZ7A 3WS6A 1JPST 5JW4R 4M9PA 1FIEA 3TYGL 4JFEB 2D31B 2IQ9L 2WWMD 2JB5L 1DQTA 1S9WB 2DJ4A 2G60L 5E6IB 5CZVH 2AJUL 3LMJH 3ZL4L 1GC1L 1WCQA 1NCAH 2CUIA 3ALPA 2JJVA 2X4TA 4CUCA 3Q0HA 1I7TB 4P3CL 5ALBH 1G7QB 1QO3A 1UENA 1ES0A 1ERNA 5HI4C 1R0AH 2JB6A 7FABL 3GUTA 3QO0A 2LFGA 3RA7L 1NGQL 4AL8H 1RIVH 5CAYB 4CVXA 1GRWA 2BSRA 1V3MA 3B5HA 5I1LB 1RULL 3MFFA 1IGCL 4B7LA 4UMGA 4KDTC 4IRJB 4U1KB 3S88H 2APXA 4TOYL 3QXAA 2DWEA 2R2CA 5CMAA 4NIKB 2VLLA 1WFUA 3LIZH 5B22A 4PJ5D 5SV4A 3QDHA 3WUWG 4HC1L 5BXFB 2YR3A 2ADGA 2VXVL 5DK0B 2EDYA 3C2SA 3MRQB 1RUQH 2ICWI 4ONHB 4OB5H 3RDTC 3N06B 2NY6C 4I0PC 4J7RA 3BD4A 1TVHB 5DMIH 2ZPKH 3ARSA 4PS4L 1E6JL 4AQOA 5KVDH 4A6YB 5J11C 2ATPA 3PHOA 3E2HC 1S9YA 5FM5M 5IB4B 1SVZA 3FB6B 1NCWL 1IKNA 3QUZA 4K3DH 1MIEL 2DQJH 3G6AB 4ZPVB 4ONFH 1PD6A 3OV6A 4RAVA 4FQLH 4Z7WA 4TSCH 5JW4N 5DJZB 5IQ9A 1CGXA 4PV9B 1RZGA 4HZAA 2FECL 3M1BA 3KYKL 3NN8B 4YQXH 2I9TA 1ZGLM 2FB4L 1YNLL 2R69H 3ME0A 1HILB 4JRXE 3RWDB 1J05B 5MERA 1JZ4A 3CCHB 5IMKB 4O5LH 1E4KA 3D39B 3QCVL 3DGCR 2WLZA 3LEYL 4Y16D 2X1QA 2WIIB 1X5GA 4Z7NF 3TBSB 2X41A 1DEEA 5BJTB 1C7SA 5J1AB 4GUPA 4JJ5B 4LKCA 2X10A 3TO4D 1HXYB 1LQVA 4LFHG 5FUZH 3BQUB 4JFYB 4I18A 3D0LA 3MMEB 5T1LA 1RAMA 1LO3H 3IJSA 3QEUA 3IFPB 5E6YA 4OIIL 4WNQB 5E6ZA 1P7KA 1J8HB 1FZKA 2A83B 2LU3A 4X6BA 3QJHA 5E4EB 4KI5E 4HBCH 3RUGE 1K6QL 2OZ4L 5F6IC 4POZD 1BWMA 1NBVH 4OBSA 2VR5A 3OXRA 5DHVB 4KPHH 4GO6B 3V6OE 5DMYA 2XNAB 5TE6L 1FRGH 3DARA 2DLHA 1ETZB 2D7OA 4P4RA 4PJ7B 4XWGL 4P9HL 1D5XA 1PEZA 1H8NA 1ZV5A 4JO4L 1PLGH 3WN5B 2VXSH 1Q1JH 2IAMD 5L8LB 4M1CD 4G5ZH 3OAYH 3FHAA 5BZDA 4JG1L 4KUZL 5BOZG 1BVKA 5ERWA 2RBLA 5SWZE 5B38G 2EDKA 2YD3A 4N68A 4Z76A 3BSZH 5FFLA 4K8RD 2ZNWA 5F9WC 3NCBB 4R2GC 1XF5A 1YPZF 2EDOA 1IAIH 4KK9D 5DD5L 2BOCA 3EJJX 1YQVH 4G6ML 3ZE1E 4RGOH 4UBDD 4CU8A 5E56A 4AM0A 4L8SC 3BP4B 1FFOA 4UV7H 4F9PA 2XZAL 4P2QD 5JPMB 3SDDB 4JG0L 3WDHA 2CO7B 3TFKA 1NEZA 3GSXB 2ADFL 4JRXD 2Q8BH 2IH3B 5JOEA 1FGNH 1K5NA 4NQDB 3U0TA 2XYCA 5IV2B 3AREB 1FORH 1OARH 3O4OC 3ECBB 1I4FB 3DVFA 4DGVL 5TH2B 5DHXB 1NFDB 5D7JB 5DJDA 1P4BL 3WBDA 3H6JA 4MWFA 1LDSA 2J88L 3CK0L 5DHYA 1B9ZA 3UAJC 4KH2A 3WUWB 4CBPA 1N59A 3TIEA 1HHHB 1F90H 4EOWH 2H1PL 4TNWF 4U1KA 3SKOA 3FAXA 4QCIA 4ODXB 5F21B 4M61B 1X5LA 2IALB 2VLJA 3MRIB 4LLWA 1LEKA 1PSKL 4GKOA 5HJ3A 2B4CL 4GXVH 2WNGA 5E9DB 3CX5J 3UO1L 4L4VE 5ESAB 5C6TH 3BGMB 5SWSB 4LPYA 4UT9L 3SDXB 2EICA 3ZYOA 3WS3B 3FQNA 2F54D 1OW0A 4XVJL 3D18B 4ONHA 4MAUL 4KHTH 5L6YH 3MRCA 5B3NA 5C0BE 3FFCB 4G6JH 4JFDE 4LCWE 1AQDA 1MCJA 2F15A 2Q3ZA 2DICA 1N26A 1MREH 4Z7VB 1T6VN 5DRXA 5IB4A 1R3LA 4QXUL 5FYKD 3VI4E 4RMTA 1CFVL 5D1ZC 3LDBC 4UINL 3E3QA 4HWZA 2YZ1A 1CXFA 3CDCA 4JKPL 1NLDL 4HPOL 4UDTB 5D7LD 3Q5OA 4DGIL 5IFHH 3HPLA 3EOAB 1A9EB 4JM2F 2XQBL 1HILA 4YBQD 1J05A 3NIDF 3FO0H 4WO4B 3KXFD 5IMKA 4HLZH 2VXTH 3DX9A 5H94B 1P6AB 4X8JB 4FQCL 3T0WA 1IGIH 2WANA 2R0LL 5BJTA 5M94B 4GMSL 1JL8A 2D4DA 1T80A 2DDQH 1JZ8A 4LF3A 3ULVC 4N8VG 4LVNC 5CHNA 4POYA 4OZHE 2F53D 4M8QB 3DWTA 4X80H 3MMEA 5ICXB 2A77L 4M62L 4HBQA 3DX8B 4WNQA 2R1YB 4GXUN 4R26H 2A83A 4WFGE 2J6EA 4XNXH 4NCC2 5KVFH 1MLCA 5HHOD 4NP4L 3BPLB 2QADC 4NWTH 4RNRB 4P3DA 2XNAA 5FCUL 5B38B 3N0PB 4M5ZH 1ETZA 3RWGA 3ZE2E 4YNYA 3C5SA 3U1SH 1EERB 5BV7L 3GRWH 1QFPA 1K8IB 2Y7QA 3H3KA 2BNRE 5HDQH 3MCLH 3CC5B 3GSVA 4FMKA 4OM0H 3ZTJH 1UM4H 3NAAL 3VMOA 2BMKA 4LLQA 1LO2L 3OHXA 2I07B 4IOFD 4PLJC 2R1WB 4JGMA 1W2KT 1WBYB 3HFML 1MQKH 3NFPB 3G6JB 4QRTA 5C0BD 5TE4L 3C09B 1U58B 2FWOB 1HSBB 3RTQB 3CLFL 3TBYB 5C0GA 2YUVA 4GKSA 2EEDA 4BUGA 4K94C 1B88A 1S78C 3T2QA 3MGTB 1NCBH 2ZSVB 9CGTA 3CZFB 1OY3B 3UTSA 4GAYB 4C59B 5I0ZA 3PNWB 4HX1B 3ET9F 1D6VL 2EZ0C 5AAMA 2VZSA 2AEQL 5E03A 5CEYA 2DWDA 4PRBA 5IQ7H 2YPKB 5A1AA 5FO8B 2VH5H 4PJFE 5C0IA 3GSXA 3EZJB 5GSRA 4MGXA 4RWYH 1X5YA 4IJ3B 1C7TA 3W9DA 1OAKL 4YHML 2IH3A 3KVQA 4WW1B 3VXUD 1WBXB 2AJZB 2ICCA 2Z31A 4JB9H 3HUJA 5IV2A 2RR3A 1CLOH 4YWGL 1Z3GL 3FT3A 2VRAA 5FO9B 1KCVL 2C9AA 3TA3C 1HI6B 1YC8A 5IB1A 2R29L 2NY0C 6FABH 3RZCC 5DDHA 3IJYB 1YUHB 2V9RA 5D2NA 1EEZA 1NBQA 5IW3A 5AD0A 2I5YL 3EYOA 3ARGD 3TYFB 2CIKA 4ODXA 3G08B 4M61A 5F89A 5DMKB 4WWKA 1HINL 5E94A 4DQOL 4NRXA 4U1LA 4FTVE 1CLZL 4E41D 2F58H 4ENEC 1JWSB 1U8MB 1ZE3C 7CGTA 1HH6A 4YHLH 2NXZC 1NCDH 5JXAL 4IMKA 1A6UH 2E7LC 4MNQD 1X5KA 2EXWC 1TVBA 4XXCA 5D5MA 4KTEH 1EO5A 4CGTA 4KGLA 3E0GA 4PV8B 4PGBA 5JHDB 5IR1B 1CDJA 3I75B 4AENA 1R24A 4G7YL 1BAFH 1I1RA 2JJTC 4LMQE 5FGBA 3SJVE 1J1XH 3QHZH 5F1KC 4AEIL 2VKXA 4GAGL 3UROR 2Y23A 4OLWH 5J1TC 3O3BB 4Z78A 4P23C 5IHBA 1HCVA 1H5BA 3AXLA 1XGPA 3T4AB 4Z7OE 1ZLUH 1T1YB 2GQHA 2BJMH 2C3GA 2Y36L 2ZCHH 2JCCE 3MLZL 4JPKL 1QD0A 2P5EA 3EOAA 2BOBA 3GSNA 3BT2H 1CFQB 5GHWH 2PYED 1RSFA 3BW9B 2Q20A 4N8VB 3PJSB 4Y5VC 4R97C 4YZFE 3A6OA 4KI5F 3CFDB 1J0IA 3RUGF 4S1QH 1DDHB 2DLGA 4WUKH 5C8JB 4X7SL 1MRCH 5FK9B 1UZ8B 4UOW1 3QQ3A 4LAQL 1QBLH 5C3TA 4YXLH 2IG2L 4OCRL 4Q9QL 1BZ9B 1T66D 4Z5RB 3EHBC 4OF5A 5F44A 1KELL 1YJDH 1IEAB 4ZTOL 3ARFD 1LP9B 3EZ8A 1SEQH 1WEJL 3GMNB 4EN3D 1S7XA 5MENE 3QEGH 4PYHA 2PXYC 5F7KC 3CH1B 1SJVA 4D9QE 3TBVB 3QRGL 2X4OB 5D1QA 2R1YA 1LK2A 5HGHB 4KJPD 5EULV 5EU6B 5INDA 2UY6A 5HHME 1MI5A 4LHJB 1B2WH 4RRPG 1D9KC 1NCCH 4K71B 3QIBA 1NUGA 1H15B 3ZE1F 1NKRA 4K2UL 1WIUA 4OGAC 4XCYA 1CFNB 3AAZB 3JTTA 4U05A 3BN9C 1KV3A 4FRWA 1SQ2N 3CC5A 1T21B 3DMMD 3TVMD 2VUOA 2JJSA 3QWOA 2J6EL 5HDBE 1KTKE 3SE8L 5K9OB 1LE5A 2V9QA 3EYQD 3G6JA 2X1PA 2CDFB 4BSJA 3MV7B 1A7RL 2YPLB 1CK0H 2E7HA 1ADQH 3OSKA 1OGAB 3HA0A 4Y4HD 1NL0L 1ZLSH 5TQ0L 2HVJA 3OF6D 2OJZL 1NC2A 3BGFC 3QWRA 2NY3C 4H0HB 3T04D 1DQQA 4C55A 3L3KB 4ZUVA 3QI9C 4MQ7B 4MXVE 2YPKA 1UYWH 1Q9OA 4AEHH 3L3GA 5DRNB 1JGUH 4U6XB 4RQQA 2R23B 1VEOA 1UB5B 3O4LB 1MFNA 3V4VH 2CKNA 2Z8WC 2GK0B 4HKJB 1L9MA 3PABA 3NZHL 1RURH 4P5TC 1IL1A 2W65A 5FO9A 3IDYC 1WJ3A 5TE7L 5EC2A 4J3VA 3EDDA 1KYOK 4PR5B 2AABL 4LDEB 4JFXB 2RFXA 3UTTA 3LQZB 3KPRE 3MUHL 5C2BL 4LSRH 4KRPC 4DW2L 3LQAH 3F7PC 1TJHH 4HK0B 3TYFA 2FX9L 3PHSA 3KPPB 5DZNA 5DQDL 3WO4C 2FEDD 3PXHA 4MQXC 3V0WL 1A5FH 4FZ8L 1CG9A 1I8IB 2EYRB 4D8PB 3VI4F 4Y2DA 1TQBC 3ULUD 5HHMD 4OSUH 4GQPH 1Y0LA 1U8MA 4L29B 3X11A 3MLXH 1PW3A 1HKLH 3IDGA 1MJ8H 4XH2A 1ONQB 3IDIA 1C16A 1T4KA 5DC9B 5IFAL 1N8ZA 4DFHA 5JHDA 5IR1A 3I75A 2GSGA 3IU4L 2OI9C 2D0GA 1P69B 5L88H 1U8QB 1UM6H 3O2DH 1IC4L 4DKFL 2IBZY 4OIAA 1ORSB 1PG7W 5CSZA 2G5RA 5TDNA 1CR9H 4LCIL 1CE1L 5EU5B 1NCTA 4A2LA 2OR7A 2EC8A 5I8EA 3GB7B 1AHWC 2YUZA 3DI3B 4G9FB 1A6WL 1F3JB 4OZ4B 4OZHF 3ARDD 3TN0A 1RU9L 3GO1L 4JKKA 4P59L 1RMFL 3D69A 4LLDB 4KKCC 3BDYH 3QNYB 4NKIH 2P42B 1RZ8A 2AK4A 3ZT7A 1RIUL 4WFFD 3WNPA 1VEMA 5FDWA 3PJSA 2Q8AH 4U7SA 4YX2H 1YY8B 1YYML 3BEWA 3ILPB 4KMLB 1A7NH 1QLEH 4J4PD 1YEDA 5IKCB 5C8JA 3RWEA 3O3EA 1JNLL 1QNZH 3EJZD 1YJDC 3QIWC 1RUML 2UWEB 3AVEA 1CL7I 4ZQKA 3ZE2F 4XMKH 1FH5L 5E2TL 3B9KC 4Y19E 3QXUA 1MEXH 4FQJL 4UUJA 2FBJL 2EH7H 4KKLD 2NX5A 1ZVHA 3TIDA 1OTTD 2XN9E 3DHJA 3KPRD 2OMNA 5DJAB 4APQB 3VXMD 5KSBE 4JFHD 2P5WA 5BRZA 5D93C 1P53A 3SDAB 2QV2A 5I16B 5T1KA 1S5HA 2A74B 1J86A 3HI5H 4C4KO 4EI5D 4XPGL 1GC1C 3WNMA 2AXGB 4PJ8D 1KJ2H 4B53A 3AU1A 3RL2A 4CVUA 3ZO0A 4PJFF 5K9OA 3FB8A 3UJIH 1OPGL 4LSVL 1KN2H 4G6AC 5EZJA 2QHRL 1MH5B 3QEHA 4ETQA 3CDGA 2CDFA 2FJGA 1CICA 1V3LA 4KKBC 1ZLWH 2NY7H 1T5XB 1P9MC 2DQIH 3QCTH 1KTRL 4WFHD 5DUBA 3O9WD 4CN4A 4G8EB 4HFWA 1LHZA 1JVKA 1CE6B 1M71B 3KPLA 1RUAL 3RGHA 3T1WA 3D2UA 1RJYB 1AO7A 3LD8C 5CP3A 2BRQA 4MD0A 5CLTA 3AB0C 4UIKL 2VZVA 3W2DL 4GKZB 2DOCA 3B9EA 1XGQB 3B4NA 1UADC 4OLEA 4ODHH 5AYUL 1LO4H 1E4WL 1OWWA 5BQ7A 4L8DA 3ZKNC 3O4LA 4ODVH 4WEMB 2DM3A 3RWHA 3PWNA 4ZUSA 2AS5M 4NO5B 5ITBL 2DLIA 1Q9WB 3X14B 3GSOB 3O3DB 3FO1B 4OD1L 3C6SA 3WFBH 1WC7A 2B1HH 5EUOE 2NY5L 1L0QA 1OP3K 2DQFB