4WW2C

Crystal structure of human tcr alpha chain-trav21-traj8, beta chain-trbv7-8, antigen-presenting glycoprotein cd1d, and beta-2-microglobulin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
275
structure length
275
Chain Sequence
b'VPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR Alpha Chain-TRAV21-TRAJ8
molecule tags Immune system
source organism Homo sapiens
publication title Atypical natural killer T-cell receptor recognition of CD1d-lipid antigens.
pubmed doi rcsb
total genus 76
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2014-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ww2C02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4ww2C01
2CUHA 4ZQKB 4XP4L 4G3YH 1G7IB 2B39A 2CKBB 4GBXC 5HHMA 1N7ML 4Y89A 5GIRA 3KPLB 4JVWA 3DUUA 3NFSH 2F53D 4N5EA 1YMMA 5DQDL 1AXTL 1S5IH 1N59A 5JW5A 5CAYB 4U7KA 1NLDH 4OGYH 1MPAL 3LS4L 4UMGA 3E8UH 3TFKD 3C6LB 2UUDK 2H26A 3FZUD 4WI7A 1WEJH 2CRYA 5EA0H 1FV1A 1Q9OA 2IPTL 3VWJC 3BZ4B 2BSSB 4PJAE 2ZWLT 3VFUA 4H8WC 1G7MB 4TYUA 1XR9A 4JZOA 4UINH 5EU5B 2VH5L 4N0CD 3B6SA 4TOYH 3PV6A 5D2LA 1U58A 2IQAB 4PJDF 1FO0L 1UJ3B 2OJZH 4QHLA 4U1MB 1G9MC 1FNEA 3FOLB 4C59B 2HMID 1YPZB 4Q0XH 3UC0L 1N3NB 4N0UA 4KQ3H 5EULV 1IRAY 3O3BB 3TYGL 4XVSL 4RBPH 4OV5B 4ZAKD 4IEFB 3WIHA 2YPKB 3CZFA 4RQQB 1FNSL 2X05A 1LE5A 2O61B 1P4BH 4M43L 2ZNWA 5E6YA 1FBIH 1IC7H 3D6GA 4MDJA 1F4WH 1FQ9C 4OF5A 4RFEA 5HHOA 1OP5K 3MOAH 4EQ2A 1Z9MA 1HK6A 2K3TA 2AJXH 1A7RL 1JWUA 3GSXB 3FFCD 2YEZA 3EYVB 4HIEA 3DO3A 4KJWC 4FHBD 4PR5A 1FH5L 3KLHC 1P5VA 4RMSA 3QQNA 1VFOA 5F9OH 4H1LH 2EDKA 4MXQC 1FVCB 4M62H 1ZT1A 1S7SA 5CIPA 5C2BH 4HHAA 3CCHB 1SVCP 2FSEB 5EUKB 3SDDC 3V9FA 5B22A 1WAAE 2ARJA 3PV6B 5D2LB 1UACH 1C8PA 5ICZB 3REWA 2I9TA 4QGYA 2MPAL 5BV7C 4GAJH 3MSPA 5DC4B 4W4NA 4IRSC 3THMH 1CWVA 4IRJA 1IZJA 4JPVL 2YPLB 4IRZH 2CMRH 1VACA 4LGSB 5E6ID 5J06A 1X4YA 1P4IL 3BPOB 4IHOA 3GJFH 2YPVH 4ZPTB 2GY7B 1AKJA 4EOWH 4U1SB 2P5WD 1CDJA 5DJAB 3UZVB 5I73B 4UUJB 3WS6A 3QUYD 4YHZL 5F7DB 4OGZA 5ICXB 1JPSH 5SWSB 4MJ5B 5DMGD 3UYPA 1R3JB 3WXWH 3PJSA 4K7PH 4D3CH 4OLEA 1CGSL 1NC4A 2OZ4A 3OKDB 5GGSB 3VXSB 4UV7H 3BXNB 4QOKE 1DN0A 3OJ2C 1ZS8B 5C0NC 1M7XA 4C56A 4EKXA 4M4RA 1RZGA 4YQXH 2AK4E 1NMAH 1UM5H 3F58H 3VGEA 3W0WA 3FT2B 5GRXG 3EOAA 2WQ8A 4MJ6A 1R3IL 2GHWB 4LEXL 2HFFB 2D9QB 4RGOH 2CGRH 4FQXD 1FFOA 5E6IC 2BSTA 3IJSA 1S5HA 1B2WL 4FP8L 3U46B 1A6ZB 4LCUB 3ARFB 5FA3A 5ESQA 2XQYG 4EI6A 2MHAB 4DUVA 1MJJB 4PJDB 4Z9KB 3P0VL 4QEGA 2FIKA 4DGYL 2JELH 4KAQH 2DBJA 3IXTA 3VFTA 1NJ9A 2DQHL 3LMJH 5AUMA 1A6UH 1Q0YH 5DJXA 3FAXA 1FNGB 4KJYB 2VXTH 1B0GA 3QFJE 2ZSWB 5IHZA 3QNYA 3U0TB 4FMKA 5MEOB 3ROLA 5IW6A 1XH3B 1MREL 3T8XA 3IYLW 5FYJE 3D39B 2ITCB 5D71H 3QIBC 4LFHD 1T4KB 2VDKL 3LRGA 3KDMB 2FEEI 5IHUL 1YY8A 1IAII 5EN2A 2HT4C 3MO1B 4HZLA 1BEYL 4NQXB 2ORBH 1NDGA 3T0WA 1R5WB 3S36H 3PQYB 3NIFF 3T3MF 4J3OC 5AYUH 4K8RH 4YHML 1BIIB 2CRMA 4K71B 1DE4B 2NY2D 1VDGA 4L3CB 2AEQH 3T0DA 3OV6A 5DK0A 2XZCH 3H8NA 5HHQA 5TPWL 3N50A 5HDLA 4RDQG 2B8OT 1OAZL 4MJID 1N4XH 3HB3C 4MAUH 4XBGA 3TBYB 5FECB 5I1GL 3ZTNH 1IAOB 1WISA 1B6DA 3SGEH 5F70A 2YMXL 1EJOL 4YPGA 2IPUG 3KLHD 4H1LA 1A6AB 3FTGB 1KPVB 1N59B 4KI5E 1YMHB 2LTQC 5I75C 4LLYA 1YNTA 2CPCA 3LIZH 4NWUH 5EU6B 3LEXB 2XT1B 5DT1H 4DWHA 2KL6A 1MIEH 3TV3L 1B90A 5I76B 3UAJC 1LMKA 1NMCB 4XVUD 4X6CA 2NY6B 3IAPA 2EIEA 3O6KL 4JG1L 4UAOB 3MRCA 4CJ0A 2BSSA 2AJZB 3F7RA 3RX5A 4EUPA 1ACZA 1MH5B 2KPNA 4RX4A 1I9EA 5EUOE 1DDHA 4Z7QE 1RUAL 5GGRY 4JJHA 5I19L 4LLQB 5D6DA 1T22A 1U8HA 1I9RL 1MFDH 1YEFH 3O11B 2NYYC 3O6FA 3MLUH 2F5AH 5DVMA 5GRUL 3ZKQD 5LJYH 2AQ3A 2F8OA 4LCWB 4HSQA 3BN9C 1BOGB 1J10A 4YGVB 5DEFB 3GO1H 4G8GA 4PG9A 5FYKU 5DVOA 1WIUA 1XIWD 2F15A 3KLAB 1UB6B 3QQ4B 2HAZA 5IV2A 1JCKA 4MNGB 3G6DL 3P4LA 4ZOEA 4OB5L 1IARB 4P23B 4EBQH 4ELMF 4AQOA 3NIDE 3QUZC 2A6JB 1DANT 4K9EC 3RTQA 4BZ2H 5C09B 3PQYD 5DRWA 2CLRA 1S7WA 2EH8L 4MA1C 4F33A 5L2KE 3SQOH 1BBDH 1AGEB 4U31A 1CLZH 1RZJL 3D3VA 1OAXL 5HDQH 1CFVH 2WIMA 4M7JH 1W0VA 4GKNB 5KAQF 3CMOL 1V05A 3P11H 3ZSTA 5IVNA 2WINA 4FQXC 5TJWK 4Q9QL 3E1F1 4JQIH 5IMOB 2HA1A 1H3UA 1T0PB 3Q6FB 4MXQD 4CUCA 2VDOH 1FYTA 1KN2L 3MV11 5FHAL 1D5MB 3CFCL 3GMQA 5E8EA 3TCLA 1AR1C 5GS1B 1RZ8B 4NOBA 1W2KT 4IHOB 5D70L 4NBYB 5LGHH 2VLLB 4GS7B 2MJWA 1D3CA 1YECH 3T2NL 3WJJA 4ZNEA 1SJXA 3L7FB 3SBWC 5I8OH 5EC1B 4JAMB 1AIFA 3DGGB 4XNUH 5T1KD 3RVWD 1FLRH 1R5IB 3FO0L 5FM5M 1H9VA 4JCMA 4GQ9L 1CYGA 4XHJC 3GHBL 4BUGA 4DTGL 1D5IH 2O5YH 4U4BA 3ILPB 4RMRA 4M7KL 1UEMA 5HY9A 5KS9A 3S88L 5FDWB 4MQ7A 3GMLB 1GAFH 4U1GB 4F9PA 1GHFL 3QI9B 3GIZH 1TLKA 3D69A 4WIQA 3ECBB 3T0VA 2FX8L 4QRPE 2NR6C 4Y4FD 3VGAC 5AZEL 1C5CL 1KPRB 1XGQB 5HYQB 1GCFA 2XI9A 4EN3C 2QQLL 1LO2L 2Z35A 1WCQA 3MRJA 4Q58C 4M7ZC 4DVBB 3BH8A 4P2RA 3CFEA 3GK8H 4QXWA 3MNVB 5BS0D 2P7TB 4NSKA 1FLRL 5C09D 1EDQA 5MI0B 4OZ4B 3ULVL 4YHIA 2VUOA 1S5HB 1M6OA 3RGVA 2FJFA 1E6JL 3ARVA 3TPKA 5L8JB 3OHXB 3V0VA 5AG9A 5ESQB 4M61B 4NC1C 4PFEA 2P5EE 2B2XL 5D70H 2R0ZH 4HUNB 4MJ6B 4YDKL 1H5BB 4OZIA 1T66C 4NBZB 1RUML 2V7HB 2OI9A 5F7EL 1V7NL 2F9BT 4Z7WA 2QHLA 5MHSE 1JUFA 4U6VL 1MJUH 4Z7UF 5CUSL 1QLEL 1S8DA 1OTTC 4ODWA 5DVNA 2UVFA 1PKQA 4AT6B 2HVKB 3ARPA 2PCPB 1XFPA 5INCA 4KTEL 2R4SH 1ERNA 5BMFH 4KQ4H 1IM3B 1IAKB 2GUOA 3K1KC 3SOBL 4M3KB 4MCZB 2MKLC 1Q9KA 4JKMA 3PNWA 4X4XB 2I26N 3MJ9A 4K7PL 3MOBH 2R2EB 1GPOL 3DVNB 3DGCR 2GY5A 4QY8A 3HCVA 4F7PA 5DRXB 3QHZH 2EH8H 5KSUB 2CDEA 4H26A 3OX8B 4G5ZH 3LQZA 4ONHA 1OAKH 5F7MC 1PG7W 3K46A 3T77B 1EJ6A 3EJYC 3O8XA 5FYKE 1XAUA 4OZFB 3VFVB 3JTTB 4WNQB 5B3NA 2C3VB 2EYSA 4UUJA 5C0RL 4KKCD 3QZWG 4L3EE 3AY4C 4JFHE 4EIGB 1EAPA 1K5NA 3UBXI 1TPXB 2IMMA 2YUZA 4RIRB 5ALBH 4I2XB 4P2OB 5JIIA 4D0BB 3NH7L 3O3EA 25C8H 4RMQA 3PWVB 1EEUA 3X14B 1V3KA 1UVQB 3TYFA 3RZCB 4F7EB 4E0RA 2VXQH 1MHHA 1BQHG 1ADQH 3ARTA 2WBJA 2VLRA 2UZIH 4U6YB 5FEBA 2F5BL 4P57A 1V5JA 3WFEH 2NXZD 1KELH 5MP6H 4OLZH 2BK8A 5ANMB 3U48A 4PP1C 1RU9H 1N6QL 1DBJL 1RUQL 3P0GB 1J1PL 4G8GE 4HZAA 1F4AA 1DQQA 1U8PB 3W11D 5CCKH 1KTLA 5FA3B 2L7JA 4IMKC 5C0JA 1F4WL 5AD0B 2WLYA 3V4UH 2FD6H 5T1MB 1K3IA 4WO4C 4LCWA 5DWUH 3GDBA 1H3WM 1NEZA 4FQIH 4NZJA 4WHDA 4C4KT 4X7CC 3T4YB 1UH4A 2XTJB 3ZDYE 4GRLB 3S96A 3BW9B 1Z5LA 5EFIB 5T33H 4KRPB 3RDTA 5FO8B 4YEEA 2CDFB 1CL7I 4KUZL 4WUUD 1ETZB 5K9KA 3T3PF 3VXMB 3BO8A 2P43B 3SOBH 4UNVA 2CK0L 1U3HD 3BAEL 4RMWA 3G04A 4QRPB 1LNUB 2BNQE 2QKIB 1OWWA 5FA4A 2OM5A 3RAJL 3V0AC 1QQDA 4JKPH 4CKVX 4LIQL 3NAAL 2DKMA 4JDZA 1IQWL 4I9WD 3K4ZA 3K1DA 4PRNB 1E4KA 1EEQA 1A2YA 1T1YA 3MREB 4WO4D 3KHOA 2XZCL 3MGAA 1F6AA 1IT9H 2DD8L 3LEYH 4NZUL 1U92A 2APTA 5I18L 1ZKAA 5GS1C 4YAQA 4KZDL 4HS3B 1MWAB 1XF3B 3SCMB 2CRZA 2ORBL 1DUYB 4XPBH 5HPMB 4HUWB 2J88H 1LDPH 1WT5C 3H2WA 5AAMA 4I5BA 2VZVA 5MEQA 3OPZL 4YDLC 2MQCA 1U8LA 1DBBH 1KJ2B 4PJDE 3HFMH 4JG0L 5E8NA 4MMXC 5GSVA 4HC1A 4Y16B 3AS1A 3FQUB 4ZO8A 3VA2C 4CW1B 3DYPA 1WIPA 3RIFF 1FO0B 3CDCA 3LKOA 3QI9A 1EFXB 1I1AB 3IU3A 5K93A 2G60L 1CXFA 3QDMA 4FABL 1OHQA 5TDNA 1EV2E 3QIWD 3AREC 1CTOA 5FYKD 5L2JA 5BO1H 3PWPD 4XC3H 3VFNB 4E9LA 3E3QE 4RA0C 4NM8H 5GZNC 2VLMD 2CDGB 2NPLX 3U4BH 5I8OL 3QUZD 4NHCL 4ZUUB 3LSOA 1SMAA 1XZ0A 1NAMA 1LQSR 4FP8H 2Z8RA 1E6OH 5I1CH 4XBEH 1UZ6F 2P5WB 1QKZH 2BHZA 3RFZC 4R97B 3LZFL 4M1DH 2GYSA 1U3HB 5KOVC 4FQPA 4EIZC 2VDOL 1R0AH 3TP4A 3UTTA 3E2HC 4QRRB 3C6LA 4G7VH 1A6TA 2PF6A 1A3LL 2K7QA 3ZL4H 1Y6KR 4G9FE 3K3QA 2FX9H 5FKPB 3EO9H 4JPKL 2AXGB 4NJ9H 4WCYL 1BFVL 3H7BA 2X4SB 3ARDC 4LNRA 1D6EB 5EOTB 3QXDA 2C3HA 2DQUL 5F72S 3FRUA 1DQJB 4Y1AB 2YPLA 4ZOAA 3JTSA 3FN0H 4BFIB 2D0FA 4HUVB 3PWJB 4K94C 3RNQB 3T1FB 1D6VH 1JTOA 4JN1L 1A4JA 3RI5K 4O5LH 5LXGL 3BKML 4RNRA 2ESVA 5EB9A 1ZSDA 2AV7B 4N5UA 4PP2A 5F6IC 1VENA 4RWYH 1JYVA 5DK3A 4U1LA 4QY8B 5GJTL 3QDJA 4J3VA 1EXUA 2R1XA 3C6SA 2E7CA 2NX5E 5ISZA 3FQRB 5K9OB 1R3KA 3VFSB 1VCAA 3OGCB 3U2SB 2CMRL 3SKMA 4ZDHA 5JDJA 1WWWX 2VO5A 1Z9LA 3LRHA 3BESR 1JNHA 1I8IA 2AKRB 4BZYA 2VDNH 5T3ZE 2NXZB 4WTXA 4FFWC 4NZTL 1KBGH 4UT9H 3TZVD 1ZGLM 4LLWA 1B0WA 4OLYL 2W9EH 3QXDB 1LEKB 1WVZA 2BNUB 1I1FA 3W2DH 5T5NG 3S3SA 4QHMB 1MSPA 1F97A 4WEUD 5HGBA 1PFCA 4PRPD 1NMBH 3CGTA 5D7IA 4BFIA 1M05A 4G42B 5F6HJ 3WEXA 4UINL 1JYWA 5E9DA 1X5ZA 2BSTB 1X3DA 4NOFA 4X8JA 1H8OA 3QDGA 4V1DE 5GGSY 3BKJL 2UWEA 4CVUA 1B0RB 3UJJH 3BQUC 5IEHB 1B4RA 4YHYB 3EYOB 2F54A 3FO9A 3G08A 4XWOD 1X7QA 3KLDA 2EDOA 2IBGA 3LKPA 2HFGL 3QJFB 3ZTNL 5HYSA 1ZLUH 3UZEA 4AEFA 3DMMD 3C8DA 5E6IA 5HDBE 4GG6E 1IGTA 2YBRA 1NEZB 3BKYL 4LCYA 3X11A 3QXVA 3WN5B 1H8NA 2HJKA 3QWOB 4JJ5A 3MLTB 2QHRL 5D7KD 2QSQA 4LLMA 1TTGA 1U36A 3DIFB 1U3YA 1U6AH 4N9OB 3KPLA 3RTQD 3EYSL 4L3CA 2ZOKA 3MJ9H 3W0WD 1U8IB 3O4OC 3VXRA 4G6JL 2E7LC 4BFEA 1ZHLA 4I48B 1KCSH 1NBYB 2FIRT 1PSKL 3CFBB 2B1AH 3LKNB 8FABA 4X80H 3EYFB 2F19H 1I7TA 4G6AC 4YHPB 3GSUB 3QDGD 5KN5A 3NCYS 2QQNL 3DRQB 1BZQK 1WV7T 1QRNA 3IFOA 2V2XA 3D5OF 3PWUA 3DVGB 2DS4A 1FVEA 1MI5E 3QAZB 4N68A 3VMOA 4HJGB 1G7MA 3F65A 4IDLA 1AQDA 4AL8L 4XT1C 3E6HA 2UZYB 2WANA 4CU7A 1DVFC 1A64A 5I66B 1J18A 1N6UA 5C0BA 1FG9C 5KSAC 4DK3A 1X5GA 2BZDA 3BDYH 3GMNB 4GRWB 3VXSE 3RJQB 4OZHB 4UB0L 1FRGL 5HVHB 1BQLH 1QSFB 4F37F 4V1DA 1SMOA 3RI5F 1EUUA 5DR5H 3PF2A 3EDJA 3ZDZF 3DWTA 3L5XL 4Z7QF 4PJ7F 4ZSOB 2NNAB 1NQBA 2FYYB 4B7LA 4XVUC 1TETL 4FNLL 2YN3A 4WFGD 4BFBD 1JYNA 3MRMA 4X99A 2AJSL 2F54E 1ZE3C 2EYTA 1TVBB 2XZQL 3HZVB 1ZVSB 2IAMD 4KKBC 3HC0B 2B7DT 4OCXL 1JZ4A 3QIBD 3LKNA 2W9DL 2KQMA 3VFRB 5L9DH 1TJHH 5MEQB 1KPUA 4ONFH 1L8JA 4KI1A 2FLRT 4GRLC 3TJHC 1Q0XH 5C3LD 1FL5B 1VPOH 1VEPA 5FUCE 1IM9B 3L9RA 1RZFH 2WY3A 1A7OH 2J8UA 1P5UA 2MWCA 3VGAB 2KKQA 3KHQA 4X6EB 3S37L 2HJFA 4EI5C 1IC1A 1UXSA 2KBGA 2Z9TA 4HK3N 4Y8AA 3U7WL 4Y88A 5D7LA 4CADB 1YMMD 2C1PA 2BY3A 3JWNC 4S1QL 3WFBH 3UTZA 3RHWK 3BZ4A 1J1XL 1G7PA 4OD3L 4APQA 5ADPH 4ZUUA 4K3EH 2I5YL 3DV4A 3P77A 2MSPA 3WFZA 2MCG1 4Q97A 1BJMA 5EZLA 1AO7D 4L4TE 3OG4B 3SDAB 3H3BC 5T3ZL 3UTTE 1OOAA 1C1EL 1D9KA 3CXHJ 1WFOA 4Y5XA 1U8NA 1DQDH 4ZFOA 2FGWH 5DFVC 3V4PH 1KT2B 3MUJA 4JFQA 1QFUL 2GCYA 5CJXA 2IADA 1YPZF 5JQ6L 1NAMB 2YA0A 3BP6B 1MFCL 1HILB 5E08L 1NCWH 4S2SB 4XWGL 5EOCH 1JVKA 4RFNB 1RVFL 4PRHE 5E8OA 5DJ8B 1W0YT 4ZTPL 3TZVB 4F57H 4RNRB 5CD3A 4HMDA 2IALA 4X98A 3T2OA 5IFHH 1HQRA 3DBXA 5CS7A 4J3WA 2X2YA 3CCHA 4NM4L 5ISZB 5DUBB 1ZLWK 4H5SB 2BDNH 3O2VH 3UPRB 2CLVB 3Q5TA 4FG6C 5IJVB 5IJKA 3P9LB 1ZSDB 2BRQA 3QWQB 4PP2B 1FPTH 4P9HH 3ETBF 2JIXD 2VDMH 4GUPB 3RKDC 1NLBH 1FL3B 4N90D 5F8RC 3MNVA 3ZLQC 1ACYL 4P9HC 5I74C 2P8PB 4KZEH 1XGRA 5E95B 2EIDA 1F02I 2EE3A 1LP9E 2IBZX 3JUZA 5JNYB 1AD9A 4D8PB 4KI5F 1OGAA 2HLFD 4N1EA 5CWSA 5F3BA 1IQWH 4JFFD 4YHLH 3D0LA 4LSUL 2QQNH 4NQCA 2DYPA 1H5BA 2NY3D 3RAJH 1WEJL 4S1DC 3ZE1F 43C9B 3DECA 4ENED 4MXQA 5EIIA 4IMLB 3QO0B 5ERWB 5CZXC 3A6BH 5CMAB 5GGUB 3B43A 4GRWE 1Y0LA 1S5IL 4OZIB 2DLTA 1EVTC 3BQUB 4XXDA 1U6AL 4OI9A 2Z0BA 3AMKA 3BPLC 2BERA 4R7NB 4ZXBA 1QP1A 4ODBD 2PW2B 4X4XA 4HKXA 5T1KB 2VL5B 2EDXA 4JY5L 2FB4H 2P47B 3W2DL 4G6MH 3UXFA 3DSFH 4ZAKC 1J8HB 2VQ1B 5D7IE 4XAWL 3CLEL 3VXQA 2VDPL 2UWEB 3IDJB 4Z7WF 3BDBA 2R0LL 3TN0C 2BRRH 4DKEH 1A8JH 4F2MA 1IGML 2NZ9C 3B5HA 4P5TA 1OGAB 1ZWIA 1QNZL 2OI9C 4X5WB 3TPUB 1CD1B 2BNRD 1A6WH 3D87B 4KTDH 3FFCE 5C8JB 3HAEB 3KJ6H 2EYRB 5F9JA 4QXTB 4PDCE 3N1QC 4QHNB 1BVKB 4AJ0A 5I76A 2H3NB 2IFFL 2D7QA 3R06B 2LAAA 5GS0D 1XF4A 3BGMA 4XWGH 3ROLB 1DLFH 4K8RC 4NN5B 4CBPA 2ADGB 3PWUB 1TVHB 2FHCA 5EU3A 1CGXA 3QEUA 1P9MA 4RBPK 3SKMB 2Q7YB 1OGTA 2W0KA 4OCSL 3PGCA 2MCPH 5IROC 1N26A 2ZUVA 3V0WL 1C5DA 1OTSC 4UIKL 5F21B 5J7CC 4XPTL 2ZUXA 4JO2L 1S9VB 2B5IC 1QFPA 5FUOH 4Y5VA 1LK3L 5JHDA 4R2GC 2DI8A 4XTRD 4P0DA 1SYVA 3EHBD 1QUNA 1JHTA 1I8KA 3OTTA 3REVB 1AGFA 4JR9H 5DQJA 1FL6A 4PJ9B 3ARRA 2OLDA 2ZP0T 5KW9H 5IOPA 3NPSC 4QRTA 2EDJA 1LQVA 3B5TA 1MFBL 3HB3D 1JJUA 1G7JA 3O6LL 5CSGA 2PR4L 3W9DB 4POYA 5FECA 1DBKL 4XCCL 4G6FD 4YHNB 1S9XB 4FQ1L 4HK3J 5IM7A 2ED9A 2AJUH 4FQ2L 1W0WA 4QLRA 3VFOA 2Q3ZA 3VJ6B 1I3RA 5DHVH 2IG2H 3O3AA 2VC2L 3RA7L 1TCRA 1NGYA 3HNSH 4PJEF 5E2UL 2JTDA 4ODSH 1W0VB 2GAZA 3IDIB 4IS6A 4ZUWA 3VFRA 2OMBA 2R1WB 2JCCE 2PTUA 2Q8AL 2VLJA 5HYIA 4WEBH 4I9WE 4KJPD 4HK0A 3UTZB 4U1KB 1UADC 4RAHA 2VMFA 3QPXH 4U6XA 1OP3H 1R0AL 4JRXB 3JBG7 3QG6B 3CSYA 1DLHB 2NW3B 4NQSA 4ODTL 4OFYD 5B8CB 3MV8D 3MRHA 1OTUD 4HV8A 3R1GH 5I71B 3E2HB 4JDZB 1IC5H 1EZVY 3QNXB 2Y5EA 4NUJB 3QH3A 5GJSL 1IKNA 5C6TH 3MV7E 4KGLA 7FABL 2R69L 4LHUG 5BO1L 3O6ML 2OJEA 1MFAL 4POZD 1TZHA 3O4LB 4OIAA 1N6VA 4O2CB 1EK3A 1UEYA 2D2OA 2JJSA 1OSPH 3L5WA 1U2CA 5FB8B 3AB0B 2J8UF 4P23A 4JHWH 2W1NA 5HYJA 5HY9B 1SJEB 1T5XA 3RRQA 1QOKA 1RHHB 3M45A 2X4RB 2JIXB 3FQTB 3D69B 1AO7A 1BWMA 3C2SA 2XPGB 2Q8AH 4YUEL 1DFBL 1M1SA 5FM5O 4OZHA 4WI8A 4P4RB 1PG7H 3MFFB 2MFNA 4K23H 4GO6B 3QT2A 5FUZL 1JGUL 2RFXA 1DTUA 4BQCA 3BSZH 3OKLB 4Z18A 1C08A 4HG4K 3MGOB 4PG2C 2AK1L 3ARXA 4PJBF 2J1KA 3I6GA 2KH2B 5TQ2H 1T7XA 5D2NB 4PJCB 3VFWA 2SEBA 2NY0B 4Z0XB 4QHLB 1ZHNA 5I15L 2BOBA 4NQVB 2PKDA 3GMQB 3AB0C 1HHJB 5IMOA 3G04B 4QRPA 4W4OA 2XN9B 2P5WA 5C07D 1T2JA 4W68A 4KRNA 1PYWB 1X4ZA 3I3BA 4YC2C 1ND0B 5ID0B 5JNYA 3DUHA 1AKJD 2EE9A 3CD4A 4XNXH 3C09B 2CLVA 4BELD 4YXHL 1FN4B 1XGYH 3HI6H 3GSWB 3V0WH 2K7PA 1JFMA 4TUKH 43C9A 3MLRL 4WO4B 5D2LE 4M1CD 1OAXH 5HDQL 5ADOL 5CP7B 3ORJA 3RIAF 4PJAA 1BBDL 3PWNA 3DXAA 2FR4B 3VCLB 5DD6B 3QSKB 3KGRA 3O2DH 1YJDC 4ENEC 2QV2A 3MXWH 3WS3B 1ZT1B 4U0RC 2ESVB 2XG4A 3CU1A 2O5ZH 2ZSVB 3V7AG 1DQLH 8CGTA 1XIWA 2AW2A 2BXZA 5MERA 3MROA 1LK2A 3JUYA 5IBLC 1J8KA 4KKLD 1KJ2A 5L0QC 4FN0A 5EPMB 3VD7A 1IGYB 5T1DH 4JY4A 1JPFB 2FJGB 1FNGA 4KJYA 1B88A 2HRPH 2P24A 5MEOA 2YRZA 3SE8H 3L3IA 3W81A 3VW3H 1NC2A 2XXCB 3ARED 5TQ2L 5CEZD 2APFA 3V2AR 5C0IB 3WHXA 5L2KA 3DXAD 5IW3A 3FFDB 4WI9A 5DO2D 4JN1H 3N9GL 3AS2A 1HEZB 5EOCJ 3PWLB 5IP4A 4K2UL 4ZUVA 2HT4D 3IJYA 2ZKHL 1LO5A 4WW2A 5E5MB 4OLWL 4JHAL 3TZVC 4MVBA 1RFDL 3QNZA 3GGWA 3RVXD 2D7OA 3IAGC 3RWIA 1EHAA 3U4EB 3V6OE 3HPLB 4G6FB 1RV6X 4KUCF 3MGTB 1U3ZA 4MQSB 3VXUA 4KV5F 4KHTH 1NUGA 1U8QB 2COQA 1OF2A 4Y16C 4PJHA 2WZPD 1T7WA 3KVQA 5IESL 3PE9A 1RURH 5JPMB 3PL6A 3T77A 4Y2DD 2DQDH 3FRUB 2YXMA 1CU4H 1JTPA 4DZBA 2CDEB 4H26B 4RAUA 2GJ6A 3V7MA 5J13B 3TH2T 1JHKL 3VRJA 5LAXB 4XTRC 4XPFH 5EO0B 1X7QB 4P23C 1NGWA 4G7YH 1CF8L 2X7LA 3MA9L 4HF5H 5JIKA 2WBJC 2BOCA 3BVNB 1IGFH 3WIFA 1JGEA 4KTEH 5DRNB 5J11C 1CFTB 4PJ8B 3IFNH 3IU4H 4HT1H 4B0MM 1OP9A 2QSTA 3ZDZE 3TA3D 1IQDA 1FHGA 1HIML 1HINH 2NR6D 3EKCA 4Y4FC 5E1AA 1OAQL 3MRDB 5IMLA 4U6YA 3U4EA 2GIYA 3HI1A 1I8IB 2AKRA 1HHHB 1N0XL 2WIIB 4Y0GA 4M8VA 5ANMA 5DJDA 3BIBX 4F7EA 3RZCA 4YFDB 5E1HB 4IIQA 4YK4C 4GQ9H 3O0RL 2EE6A 3QRGH 2JELL 4NQSB 3JTCA 8FABB 2A77H 4NRZB 2HH0L 4TQEL 4HWBA 1A7BA 4YR6A 4IJ3C 2N7BA 3I9GL 3DTXA 4FQ2H 2HH0H 3DRTB 4NUJA 1ZWIB 4XX1G 3O8XC 5D93C 2AI0L 2FO4B 3C5JA 1ZA6A 5D5ME 2NLJB 3BH9A 1MCIA 2GJ6B 4FZEH 5IG7B 3X3GL 4K8RD 4Z8FL 3RY6C 2X70A 2OL3B 4HIIB 3CFCH 1X4XA 4OV6F 4GAFB 4BH8B 1AO7E 2GJZB 3MBED 2PYED 4NO2B 2YOCA 4M1CC 2Z31D 1U8JA 1Z5LB 5EFIA 3I2CH 4LIQH 2R1YB 3MLYL 2H9GA 2JB5L 5I74B 3BZEB 5FOBA 4L8DA 2J7LA 1W72L 1MCNA 3GHEH 4QHUB 1NGPH 2DJSA 4ZNCD 1MCOL 1FVDB 1ETZA 5D2LF 4YNYA 2R2HA 4I18C 1BLNB 4XCFL 3ZT5A 4MVBD 4JM2B 3VWJD 3G6JB 3FB6A 4LHUA 1NDMB 2AGJL 4B7IA 2I25N 4POUB 3DIFA 3X12A 2O61A 5BVPL 3QIWA 3UJTH 4JFEA 2OTUB 3CFKA 4NZRL 3VFMB 1HCFX 1A02N 2Y06L 2VKWA 4HH9A 1OT1A 3DX6B 3VXTA 3ERYA 2C9AA 5BZDA 4Q9QH 1G6VK 3V79C 4YAQB 4J23A 5CCKL 3DV6B 4K3JH 1RZJC 1IFHL 3SE4A 3QIUC 1UG9A 1A7NH 4Z78B 5HI4D 2FSEA 3VE0B 2QBWA 3DX8A 1JGVH 3VGGA 5C0BB 4M5YL 1MRCH 4PGJA 3F5WB 3GSOA 2YD9A 4X6CE 4WHTB 2A2QT 1FIGH 5F3HA 3TIDA 1ZLSH 4BZ2L 4NKIH 1BQHA 2CJUH 1C12A 2OQJB 1IKFH 1MCEA 1XF5A 3STBA 1K8DA 2UZXB 3G6DH 1BVZA 2ADJB 1MHEB 3U0PA 1YJDH 4HLZH 4S0TD 4OGAD 5D1QD 1CN4A 3V95A 3QIBB 1IL1B 1FSKC 1QFOA 1JPTL 1TIUA 4PS4H 3VCLA 5HHNB 3W0WE 3KPRB 5I1GH 3EYSH 4H0IA 4FQLH 2VLLA 4WDIA 4FRWA 3STZA 3M17B 3O2DL 2L4OA 3PJSB 5T3XE 1HYRC 3BP7B 1F13A 1TQCC 1WWCA 3QHZL 4PJ8C 5IHBA 3QDME 4AZ8A 1WT5A 3D9AH 4W70A 5HVGB 4LDOB 3DLQR 3VD3A 4P59H 1GIGH 1MJ7L 2ID5A 2OSLA 5KSBF 4FTVB 3HG1D 1DEEA 2NW2B 4MD5A 1UB5B 1KN4L 3UO1L 1EVUA 2W0LA 3G5ZB 5EA0L 3R8QA 4Y2DB 3H3KA 4PIRF 1T1WB 3MRKB 1FL3A 1U41A 1WF5A 3SDAD 4RZCA 2IQ9L 2MTPA 2VLKE 3WV0A 5D7JA 2YMXH 1KEML 2PYEE 4UIMA 2R56H 4WEMB 1HHIB 3P9MA 1A3QA 1U93B 1OAZH 5D1XA 2FL5A 4NKOB 2OTPA 2I9LB 4XRCB 1I3UA 4DVBA 5K9QG 3ECBA 2E8YA 5GGUA 2VSDA 4QOKD 4HWZA 4U2ZA 5CGMA 3A67L 3KPRA 3WN5A 1P84K 1KEGH 2X9YA 3MA7B 3CFDB 4Q9CA 7FABH 5JW4Q 2FX7L 4LCCC 4NQDA 4TSAH 3QNYB 3HAEG 4NNXB 2A6IB 4JFDB 5TH2A 3TO2A 1I1RA 5GJSH 5F7YC 2VDNL 1I7UA 2P5WE 5E8OB 3D39A 1LO2H 2OI9B 1CICD 3CK0H 2G9HA 4ODTH 4QHKI 2VDKH 4MS8D 2NY4C 2PW2A 1GRWA 4Z77A 3VDCA 2C4FT 3NTCH 3RWHB 2G75A 4L8BA 4NBXB 3LB6D 3ARZA 4QRSB 1QRNB 1NFKA 4JZJA 1OW0A 1Q9LA 2NX5B 4BZ1L 4TULH 4I3GA 4BQ8A 3LQAH 2HVKA 4JFOA 3HMXL 4X9BA 3L3KB 3TPUA 4DFIA 4LPVA 4NFBA 3MRIB 1CFTA 4QOKA 1TJIL 1ITCA 1LHZA 4GW5B 1OM3H 1KG0B 4MJ2A 2E27L 4HIXL 2FX9L 4KVNH 3RWJB 1A5FL 3O8XB 5IB1A 3I6LE 3AM8A 5FCUH 3TBWA 3OF6D 3WFDL 1CCZA 5DQ9B 4Y1AE 3H9SE 3C08H 2CO7B 5ADPL 2HMIC 1F3JA 3NZHL 1QR4A 3S35X 3CFJB 2DLGA 4HIXH 4XPTH 5GGQL 1JHLH 3DI3B 3RA7H 3D0VA 3KPSD 1YN7A 2HRLA 5IOPB 4O02H 3UAJD 2X9WA 3BDYL 3LEVL 1KXVC 1UJTA 1I8KB 5HHME 4JZNB 2OR9H 4CNIA 2Z93B 1YYLL 1QVOB 5C86A 1JI2A 4ONFL 3QXAB 5EBLA 1U92B 5LQBH 5FF6A 4AENB 1IGCL 2V7NB 3SJVA 2RB8A 3KNBA 3O4LD 4AY0A 1EEYA 4UQ2B 5C7XH 4ZD3L 4QCIB 4HJ0D 4MA7L 3UBXA 4D2NA 3C6LC 5JHDE 4QHNA 3L5XH 1JGLL 4AEEA 4UBDC 5JDSB 1KV3A 1A6VH 1FZMA 5DMGC 3FZUC 2VDPH 1FZKA 3D48R 3W9EB 2VXVH 2DI7A 1RK1A 4UU9B 1JF5A 5DTFA 4GW4B 4XVSH 2ATKB 4XZUA 4HKBA 3DETD 4CDGC 3T2PA 2OTUA 1XF2B 2EDYA 2ZCLL 4QO1A 4ZTOH 3VRLE 2BVOB 3PWPE 1IJ9A 3HRZB 3T0EB 3T08A 4URTB 5DA0B 3QIUD 3N0PB 2Y1VA 5HHPB 3DUSB 3SO3B 4JEGB 1HHGA 2IPTH 1UWGL 4YHKL 1AFVL 1MUJA 3JV5A 3IJHA 2YPKA 3ARFC 1MCLA 4HD9A 3WFCH 3V8CA 3D18A 1CE1H 1U8MA 4PJ9D 5HI3C 3LKQB 1CR9H 2V9TA 2I24N 1NLDL 4OGYL 3C5SA 4R6UA 5D7LB 1RZ7H 1VGKA 4EUPB 5EIQA 1MCKA 1CXLA 5FB8A 3UYOD 4GKSA 1S7VA 1U3HC 4QXUL 4FTVD 5DHVB 4LPWA 1FYHB 1AIFB 1HOCB 4RMUA 4UTAH 5K59E 1ZLUK 4WV1A 4WFHE 3SKOB 4Q0XL 4O9HL 2FEDC 2EEDA 5EZLB 4M9OA 1CTNA 2P8PA 4O51A 2V2WB 5ICYB 1FPTL 4I3RH 4O2FA 2X4PB 1AD9B 3S34L 3HNVH 2DRUA 3D0LB 4MAYC 4LLQA 3WFCL 3UJJL 3MRRA 5EDXA 3MC0A 1TNNA 3BP6A 2EDQA 3T65B 4E41E 3RY4A 3MUZ1 5TE6H 4G8GD 5TE7H 5IR1A 4PJXA 12E8L 1GGYA 1FNHA 3H42H 5E2WL 2J12B 2NXYD 1S7SB 5CIPB 3B8SA 4KPHH 5E2TH 2PO6B 2AABL 1ZLSL 2R23A 2ZCLH 3H0TA 2X09A 3VFMA 3L1OL 3U2SA 5D72H 4WFHD 3DBXB 2R69H 4M93B 4I8DA 4PP8C 2HWZH 5ALCL 4OLUL 5FK9B 1HH9B 3ZTJH 2JCCB 4Y7MA 3GJFK 1B2WH 2AERT 1BFVH 3IDJA 1X5YA 3ARBC 3U9UA 3U79A 3R1GL 4JFHD 2XKNB 3DXAB 5E03A 1A3LH 2NTFA 3MTRA 2YKLH 3OKDA 5GGSA 3NCJL 4PJ5B 4F7TB 4KKAC 4YE4L 4LGRB 3F12A 4ALAH 3WFDH 5IMKA 4NZRH 2M8XA 1NCCH 3DX9A 4PGDB 3T65A 5ICXA 3BZFA 3WNOA 4NCDA 3LS5H 4YHOH 1SEBB 3OQ3B 2ZCHL 4G5ZL 5CWSB 3RGHA 1ORQB 4O5LL 3MYJA 3NPZB 4HUKB 4NHCH 4EI5D 5FGBA 2IFGA 4KKLC 4L8SA 2ICWI 4P46B 2DYPB 5FYJU 1BFTA 3K74B 5KSBB 3KPPA 2X4SA 4LNRB 5DJ2B 5IIEB 1A7OL 3GJEB 5KJRH 4ZAKB 4CN1A 4JANB 1ITBB 3MJGX 4C54A 5T3XH 3QA3B 1UM4H 5I75B 5C0FB 4LAJH 3K2UH 4M00A 1V7NH 3BEWB 3PWLA 4KHXL 2AV1B 5EUOB 5IJKC 2V5RA 2ZUSA 1PY4A 3H9SA 1C7SA 2MHAA 4ODXA 4F7TA 4QRUA 2B2XH 3BT2H 5A1AA 4I48A 1CGWA 4R7DA 1L0XA 3DX9B 1VADA 4PGDA 3W9DA 4M8QB 1F6LL 3DNKA 1CXKA 1BQLL 3HPLA 3DO7B 2NZIA 3BD4A 5CEYA 2NZ9D 5I1EH 4G8IA 4TQEH 1P4LA 2H2PD 5INDB 4OZGA 4ESKA 4OLVL 3L5HA 5I16B 3U4AA 4OZIE 3OKKB 5D5MA 3UBXG 4KPHL 4CMMA 1P9MC 3RVUD 2FX8H 3WJLC 5LVEA 3L95B 3H42L 5IROA 1EMTL 3ZYJA 1IC4L 4PJIF 3GMNA 3BWAB 4X4YA 1QBAA 3I3EA 2V7HA 2XZQH 1TTUA 1PVHA 3AU1A 3CX2A 4LSVL 1CGTA 1U91B 3CNKA 5CILH 4DW2H 1E4KC 2APWA 5ELIA 3KPQA 1F2XK 1HHHA 4X7EC 4PJBA 4PGEA 4Z5RB 1UCBL 2V17L 3C8KB 3PL6C 3DSFL 3U7AA 2Q8BL 4FFEX 5F9DC 4OCWL 3T4AB 2FB4L 3U9PL 5DDHA 5FXCH 4LBEA 3IVKA 1S7RB 2UY6A 4BK5A 3JTTA 2V7NA 3QUYA 3EOAB 3ARGD 4DUWA 2YBRB 3NIGE 4LCYB 5BXFB 5DRXA 3OKMA 2R8SL 1S78D 5I2IA 4OZHF 5BRZB 1BZ9B 4Y5VB 5DK2B 4TRPH 1NBYA 2QJDA 4A6YL 3NCYP 1Q94A 1QHPA 3L3DA 2DIAA 1UQSB 3G6AB 1I85A 1YA5A 3L7EB 3I84A 2GJZA 1BX2A 1PSKH 3VFOB 2AEWA 5GRVK 3Q3GA 4G80A 5EU4B 2CUMA 2ADFL 4PG9B 2XA3A 4YHNA 4WWKD 5DQDH 1OSZB 3NFSL 3RWJA 2K1MA 1VKXA 4LPUA 1FFNA 3S98A 2ZG2A 4G6AD 2F74A 4XP4H 4XP6L 3TN0B 2DWEB 4PY8J 1J0JA 2YK1L 4N0UE 5DEFA 3OKOA 4PJCA 5KS9E 1JZ5A 3P9WB 1KJVA 4JPWL 2AXHA 4XH2A 3NABH 2NY6D 2EDRA 1GZPB 1NFDA 1NL0H 3E2HA 4RISH 5ALBL 1ZTXH 1SJHB 2CIIA 4HWEL 3AXLB 5C71A 1DLHA 4NM4H 4PJGB 5C0RH 1T20B 1CGUA 2AXJA 4HV8B 2OJEB 4WUKH 3MBXH 1T0MB 4NRYB 5IB3A 1DL7H 4GAGH 3VGDA 2Y4SA 2PTVA 2X4NB 2CIKB 1QFWL 2VITB 3ZDXF 1KOAA 5CD3B 4OIIL 3F6IA 1AGEA 1ODAA 2GK0B 2VR4A 4GT7A 1MRDH 3FAWA 2IAMC 4XB7A 5E2VH 1T03H 1NCWL 1T5XB 4G8FB 5DD6A 2PO6C 4UQ3B 5DUPL 5F96H 4O02L 4KKNA 4LMQI 2JK5A 1QYGH 3KPTA 2J8UB 4PRIA 5EC2B 1INEL 1NANI 2NXYC 4KK5D 4HGWB 5EC1A 4ONGH 1Q72L 1BD2B 1WCBB 4X0KA 4OF3A 4M1GL 5E5UB 4FMFA 1PW3A 3FQNA 1X6NA 4O58H 2VNCA 4LPCA 2V9RA 1K4CA 4WW1B 3V7AE 2EEAA 3TIDB 2JJWA 4MGXA 3AMLA 3MFFA 2APXA 5D93B 3KPMB 1NBZB 4OV5A 1QQDB 4YDKH 3VXSD 5C0EB 4HAGA 3X3GH 5DGRA 1MLCA 2AXFA 2DQTL 3EFDL 4ODUA 3SKJH 1XF3A 3SCMA 4U6HB 4YK4B 3WUWB 1MCBA 1RJCA 2R39A 2XN9A 5L2KB 2BSRA 4U3CA 5EIIB 5FUCC 4Z0XA 3S36L 4ZOCA 3VD4A 1KJ2L 2OYPA 3SDYL 3WNMA 4TSCH 4EVNA 3MJ8A 1MCWM 4J12A 4ELKA 2FH6A 4U0RB 2IALB 4X98B 1FVCA 2QADC 1CI5A 3V0VB 1JBJA 4U1HA 4TPRH 1CBVL 1FO0A 2XACC 2EKSB 1JNHB 5JOEA 5J1AB 2FHBA 5IVZB 1GAFL 4J3XA 3WKMH 1FFPB 1S7WB 4JHWL 5CSBA 3OKEA 3JWDL 1WAAF 4HT1L 4LVHB 5HI5D 3AFLA 4JPIA 5ID1A 5GGTL 3O4LE 2RIKA 2XY2A 2P48B 2YUWA 1U95A 3LMJL 4AIZA 2YA1A 3WSQH 3P9LA 5DC0A 4KXZH 1PLGH 1I3VA 2Q76A 1QG3A 4K94H 3UROR 3V5KA 3QUYC 3IU3B 3F7PC 1MCDA 1ZGLP 3BPOC 2JCCF 1T0NB 4Y4FB 1Q9KB 4M02A 4K07A 2GSIB 3ULUD 5CEYB 3NFNB 5HVWA 3D25A 2OZ4L 3BEWA 4FG6D 3W39A 3VFPA 3U30C 1NMCC 3QHTC 5KANI 3BXNA 4J4PD 3WKML 1BMGA 1TVHA 2RBLA 2F54B 3FO9B 5IMMB 3F58L 3MLWL 2AK4D 1RIUH 2IANA 2BMKB 5D8JH 4U1HB 1DQJA 3IFNL 4Y1AA 2HYMA 3GSXA 2BY0A 4TN9A 3WXVH 2RGSA 1D5IL 1G7HA 2J88L 1FG2B 2O5YL 1T89A 4LSDA 1R5IA 4LPXA 1CGSH 2EDTA 1F58H 3GI8H 3WIHH 2IPUK 4D94A 2HG5B 3QO0A 1J5OH 2DM4A 3C87A 2OK0H 5B8CC 2A0LD 1OWRM 4TSBL 1RZIB 4UTBH 4WW2B 3PDOA 4OAWA 3VU2A 5EU6D 3F12B 5DUML 3OG6B 3LHPL 3V6OC 4MXWH 4OKVA 1D5XB 2JB6B 1YNKL 1G9ML 4FQQA 2WBJB 3B2VL 5B38A 3Q6GH 5EUOF 3UDWA 4BUHA 3AS0A 1U91A 3GRWH 5TFSL 5T1DL 4U7MA 1VFBA 4NO0D 1JNNL 4JQIL 3SDAC 1G9NC 4R90H 1BZ9A 5KVFL 5EZOL 3BYTA 4P2RE 4E42A 5FOBB 2NY1C 5C8JA 5K9OA 3TN0D 3L3DB 3BPLB 4R4BB 4G6KH 3EBAA 3RUGF 3FT3A 1MQKL 4L4VE 1QEWA 4XRCA 2UUDH 3FRPG 5LG1A 3WFEL 5LBSL 1PGRB 4NO0B 1TTFA 3ARDA 1RULL 1QSEB 3PQYA 4HX1A 1IGJA 1O7SA 1TMCB 5SWZA 2WUCL 5DK2A 2OL3L 3TVMD 1CIUA 3RBSA 4TNVK 4Z7WE 1OGTB 3MLSL 2AV1A 5EUOA 2A1WH 2X1WL 4YXKH 1C5DB 5KZCD 5HGBB 4X7TA 3ARSA 4K3JL 5A2JH 1HDMA 3LDBC 5IVXE 3MOAL 1F42A 3SO5A 3DX6A 1KJVB 4XH2B 5DSCB 1A9EB 4NN7B 4XNZC 1P4BL 2V6HA 3IFPB 3KNBB 3QZWA 2BVUA 2DM2A 2QKIA 1YMHA 3HE7D 4JJ5B 4R2GD 4XPAL 4Z78A 1EHLL 3ARBB 4MMZC 3P4NB 1RUAH 3LEXA 3LV3A 3NPSB 4AH2A 4AENA 1JRHL 2D0HA 4DFHA 2YXFA 5F9WB 3NZ8A 5E7BA 1NFIA 3QRFM 3ULUE 1KUMA 1ZK9A 2C3VA 3JVGC 5DEGB 1OP5H 3VI3E 4YHMH 4LSRH 3JXAA 2Q1EA 4R0LA 1G7JB 4Y4KB 1I7ZA 5JPNA 3EYFA 4NPYA 1LP9F 4KJWD 5I17A 3HI6L 3WNLA 3ES6A 2FHFA 3B4NA 3P4OA 4JDTH 4NQEA 3OKLA 4YNYB 3C60C 3QUXA 4JFFB 2H9GB 1U8IA 4N8CH 2J6EH 4FA8A 1INDH 1QLEH 4HGWA 4GJTB 1CGYA 2Y9RT 1W72A 1KT2A 2PYEA 4JFQB 4NQTA 4PD4K 4WFEE 4Y4KD 4M03A 3VWKD 3IVKB 4BM7A 4HAFA 1AY1H 4K3DL 1KIQA 5GIRB 3LZFH 3F7VB 3ABZA 2XA8L 3DUSA 5A16B 5F44A 3QEQB 1RUKH 4TSBH 2XIDA 4NNPL 4DN4L 1UH3A 4F80A 1Q94B 4G8GB 2A6JA 1SY6A 3I9GH 4WTZA 3MRNA 1JV5A 2V17H 2X89A 3NMEA 2QL1A 2VLKB 4U6HA 1KCLA 4F33B 5DEZA 1RMFH 3BE1H 2BDNL 1INQA 1AE6L 4HQQH 4XBGB 2V5SA 5KZCB 1AGCB 5FF6B 1HZHH 4KI5C 5E00B 6FABL 3ILQC 3QCUH 3LN9A 4XP9H 1DBBL 5CFHA 4J1UA 4Q6IC 1HZHL 3L3GB 2VIRB 4KY1L 4TSCL 4MD4A 4R4FL 2DQHH 2FNBA 1PDKA 3GHBH 1XGUB 2GTWB 1YEKH 1KIQB 3G6JE 3HR6A 3P0VH 4DGYH 5I1EL 2JF1A 3DETC 4LDEB 5F6HI 3VRIA 1C12B 4UI2A 5C6TL 4IDJH 1DVFA 4ZXBC 1C16B 2F53B 3BMVA 4F58H 3T2NH 2ERJC 1J1OL 3MRNB 1OPGH 3TO2B 2X10A 4E41D 1KCGC 3STLA 3MLVL 1T22B 3QDJE 2VLRE 2R0KH 2YD8A 4V3DB 5AZEH 3KYOB 4XPHL 5CLTA 4JO1L 5E8DH 4F3FA 1UKTA 3ZYZA 4U1LB 5DMYA 1D6EA 1Z3GH 4GLRH 4XNYL 3FMGH 1L7TL 2GFBB 4OFKA 5F1IB 2E3VA 1SQ2N 5GS3A 4JO4L 3ULUH 4EQ3A 1WAAA 2MCPL 4M7JL 3GSQB 5I1JL 2XZAH 2V5MA 3BP7A 3DPBA 4J3TA 4MD5B 3P73B 3CXDH 3OGOE 1JZ2A 2BJML 2ESVE 5JA9A 4YFEA 4U6TA 3LPGA 1RPQA 4FTVA 4OZ4A 3VXMD 1HKFA 4U1IA 1YEGH 5GSVB 3CVHH 5DZOA 4FFYH 4NRXB 4ZFZB 4M61A 4YH6A 1QLFB 4XGZA 5DUBA 1BF2A 1CD1A 4WUKL 1T04A 4FFVD 4PLKD 1X44A 5T5FH 1ZLWH 4HJJL 3UTSE 1N5AB 5FUOL 5FHBL 32C2A 2C4FU 2FJGA 1FNAA 3U0WH 4PB0H 3TBTA 3NOIA 2BOCB 4R96B 1DBAH 2VYRE 1DANU 3MROB 4R97C 1F4HA 4PJ8A 1QYGL 2X1XR 3JVGA 5FO9B 1DP0A 2C3WA 3H0TB 5C0AD 4GW1B 1IQDB 5DD0L 3LQAC 1CG9B 5D72L 1EBAA 1DLFL 4NQDB 3NCCB 2DQJH 3OXSA 3C60B 3FB8B 2LVCA 3H9SB 4OM1H 5E2TL 4HIEB 2HFFA 4Q6IB 2ED7A 4ZO9A 3ARDB 5CJQL 5GRVL 4JPIB 4MCZA 5ID1B 2X44D 4R26H 5J3HD 1BPVA 3DYMA 5AWNH 4S1RH 2Z91B 2GITA 2YWZA 1EEYB 1IGMH 5DHXB 3FJTA 4LU5H 1P84J 1A9BA 3EFFB 3TVMC 3UBXB 3LKSA 4WUUB 3CU7A 5CLWA 3LN5A 1EBPA 3GSUA 1JYXA 3LH2L 5TQ0H 5ESAA 2Z31C 3FKUS 3PWPB 4P46D 2EYSB 3CDGA 3L5IA 3U9PH 3BKYH 2OK0L 1UENA 3WNNA 4Z5RA 1NGWB 1CDBA 3CFBA 4P2OC 2PTTB 4FXKB 4M48H 2BVOA 3IGAB 5C1MB 1OB1B 4DZBB 1T6WA 5DT1L 4KQ4L 1MAKA 4DQOH 3TT3L 1AQKL 1JMXA 4P2QA 1AD0B 4Q6IA 3WXVL 4KVCL 4LHUB 3HE7A 1I9JH 5F88A 5D71L 1T83C 4MJ5A 3GMMB 5KBNC 3MNWA 3E8UL 2YRLA 1Q38A 1MPAH 3LS4H 4MNQE 5MHSD 3GSNA 1QSZA 4I18A 5F7EH 2Y7QA 4GKOA 4DVRH 1R5WA 5DEGA 4NC1E 2N4IA 3VD9A 3QEUB 2P5ED 3K7UA 4MAYB 5AZ2L 1L6XA 5EO9A 5KG9B 1U8PA 3UTPD 5DURD 3ZKXB 3FB7B 3RZCD 2VDML 3QDGB 4RRPA 4O2CA 4P9HL 1MVUB 4PV8B 5IFAL 3DV6A 2QQKH 4YBQD 2M2DA 3C60D 1KB9J 1O7VA 3QXAA 4RGNC 4QCIA 1QR1A 2CR3A 4OQTH 1YC8A 3O2VL 3C9NB 3TBSA 4ONOA 1A6ZA 1H3TA 4LLVA 3D85B 3FO1A 4YBLB 2IPKA 1UWXH 1YEIH 4Q7DA 1E27B 1P6AB 3GBNH 5J0BA 1CVSC 1RK1B 5ACZB 4HC1H 2UYLB 4JKLA 1K2DA 4GLRI 1K9TA 5FM4A 1OP3K 4LKXA 3TN0A 1SJHA 4JFFE 3WE6A 1S9KC 2DAVA 4PV9A 3OZ9H 3PHQB 4R4ND 4YQXL 3O81A 2E6PA 3GIVA 2X89D 3MBEC 4PB9L 3RWEA 4X7SL 3BZDA 4I18B 1I3RB 3VXPB 3NACH 3G6JA 4OZIF 4N90E 4HW6A 4X7TB 4KRLB 3CH1B 3E3QA 1FAIH 1ZHLB 3PL6D 4QHKJ 4PRPB 1FAIL 4EXKA 4S0UC 3RWFB 2ADIB 1MRFH 1LEIA 2Q86A 3W5NA 1LO0H 3EO1B 4OGXL 3VXUD 4X7SH 2D31B 3C5SB 3STZB 1BJ1J 4X9FA 5IVXA 5FHAH 1SYSB 1C1EH 4IOIB 5GISH 4HHAB 3D18B 1DE4A 1V8HA 1XIWC 5DRWB 3G6AA 3OWEA 1YMMB 4JRYB 1G7LB 3BGFC 2IAND 5HGAB 4FNLH 2RHEA 4HMEA 5KS9F 4PJAF 3O4LA 3MZTA 1GGCH 3D3VE 4JM4H 5A2IH 2Y5TB 5F1IA 2DLFL 5EBWB 1IBGL 1KC5H 4XC3L 5CKGA 1BF8A 3FCTB 1I8LC 4P46A 1N3NA 5B3JF 4JGJA 4FABH 4ODVH 1T6VN 4DGIL 1FGNL 1Q0XL 1XGPA 4AL8H 4C83B 2X9XA 1WLHA 3T1WA 3CUPA 3RKDD 4FTVE 2Q3AA 4EBQL 5D9SA 1TJHL 1QO3A 1Q1JL 3MV7D 2W9DH 4L4TD 5A40E 4LKCA 3MR9B 2C1OA 2A9ML 4LMQE 5A16A 2IH1A 3AUVA 4NQEE 5TE7L 3NCJH 3AXLA 3HI5H 3CK0L 4P5MA 4XMPL 3BGFB 1TETH 5SWZD 2X4RA 2XQBL 1HSAA 1RUPH 2VAJA 3ARDD 4KROB 4Z95L 3TWCH 2HWZL 3MOQA 4HBCL 1RHFA 1IL1A 3CLEH 5DFTA 3PXJA 1NKRA 2J8HA 4NKMB 3TLRA 3ZZ1A 1OTSD 4LPYA 3OKEB 4GXUM 4LRIC 1UB6A 1FO0H 1PZ5B 1TZIB 3SDCA 3S37X 5DO2C 1RIVL 2EO1A 1WBXB 3MX0A 1A4JB 4L1DA 1WBYA 4HUWA 4MSWA 1EA9C 4R96A 3KPNA 4CMHB 1XEDA 1BAFH 3CIQA 4F15C 4HBQA 5CMAA 5CJOL 1BFSA 4N0RA 5L8LB 5BCAA 1A1NA 4Z7VA 4YDIL 1M71B 3RZCC 4FXGB 2IANB 4M48L 1HXMB 1YZZA 3KPSA 3MYJB 1EERB 3V6FA 2GEEA 4Q9BA 2R9HD 4OM1L 3QISA 1IEBB 2HT3D 4HUUA 2HLAB 4TUJB 5H8DA 4LPTA 3PDGA 3QUKA 3WUWA 3KPPB 5HPOA 1PD6A 3IDGA 4LHUD 1Z2KA 5L2JB 4LLDB 4L29A 3AS3A 1NLBL 1UA6H 1WBZB 2ICEA 2H3NA 3TT1L 2CQVA 2X42A 1G7HB 1CS6A 1QBMH 3TGXA 3I75B 1S7QA 4Z95H 3MJ7A 2HFGH 5EPMA 4HCRL 1CR9L 2E7HA 5CILL 4JB9H 3SDCB 3QDGE 4G42A 3EOTH 3E6FB 2EDWA 5DYOA 5IK3A 4PBWD 1SHMA 3ZE0E 2P24B 4PD4J 4QXTA 3MRDA 4U1NB 3V5HB 1JZ7A 4I0PC 3L3OB 3ZTJG 5J56B 1T1XA 4WHYG 1IAKA 2IJ0C 2Y07L 4LFHG 3ZYIA 4KRPC 1FFOB 3KYMA 5C0CE 1KELL 2F8XC 1S7TA 3DMMC 7CGTA 5KS9B 5FDWA 3V5KB 3OKNB 4F8QA 4JHBA 5IEHA 1IBGH 1YUHA 4Z76A 3X3FH 4ONHB 2GSIA 5JQ6H 5I1JH 1FZMB 2XQBH 1WJ3A 3MNWB 4EI6B 2A6DA 4YXLH 1N64H 1HQ4B 2YC1B 1BM3L 3U0WL 1GZPA 1NFDB 2VDQH 3GNMH 1L7TH 1S7QB 2G5RA 4J4PC 1AGFB 2CIIB 2B1HL 2DLEA 4U3XA 2DQEL 3K2UL 4OSUL 2VZTA 2KDGA 5DJXB 2E6QA 4NP4L 3WLBB 5IK3B 5LQBL 1UM4L 5LCVL 1I85C 3T0EC 3NCMA 4DKFL 1RI8A 3UJTL 1A1MB 1YYLH 3KPQB 3PWVA 3OAUL 4P2CG 3SGDH 5GRJH 3D0VB 4I77H 2DF3A 4Y19A 4F58L 1MRFL 2E8ZA 3T04D 2AJVL 3DVFA 4M7LL 1NGYB 1D7FA 1O5DT 4YHPA 1GJIA 4WJ5B 2ITDA 1AP2B 2NXZC 5E8PB 3IFPA 1HI6B 3ARWA 1NANH 3QZWB 2JK5B 4D9RD 3TPUE 5JW4M 5GS0C 2EDBA 1JZ6A 3WUZA 1I1YB 2BHUA 4GKSB 4HXBH 5ECJE 4EOWL 2H6PA 4Y4KA 1K8IA 1FNLA 4KMQA 2VXUL 4L9LA 1GSMA 3DYOA 4X5XA 1OSZA 4M93C 1FC1A 3OZ9L 4ALAL 5CBAA 1PX4A 1MELA 5AD0A 5ITBH 3BHBA 3V8OA 3FO2B 5HHQB 4HC1L 1KXTB 1J05B 1TVBA 2VLKD 3FT4A 4ODHH 4U2YA 5DJ0B 1TFHA 4PGBA 3AROA 3H9ZA 5JPNB 2EICA 3QDHA 4OD1L 4Z8FH 4GMTL 4ZSOA 4V2BA 4XBEL 4XPBL 4WGVB 1RZKL 2HVJB 2Q87A 3WLBA 4MB4A 3WDJA 1JK8A 5DD5H 1KJMB 4B53A 5CEZE 4S1SL 1ZA6B 1E4JA 4LCWE 1WZ1L 3EJJX 4LDLB 2X41A 1ZLVK 1F5WA 1EUTA 4ZS6D 3TNNB 4HPOL 4GRMA 3OSKA 3L3HB 1XR8A 3A67H 1FZKB 2P8LA 4BH7B 1T0MA 4NRYA 3W5MA 5L6YH 4PYGA 1YDPB 2GT9A 3EJYD 2WUBH 4PRNA 1FIEA 5E5RB 2AJZA 3P40A 3BISA 3TYFB 4JLRA 4MCYA 5H94A 3VWJA 1JV5B 4GXUN 2V5TA 3QCTH 1ZHNB 2J6EL 2NY2B 1CDIA 3M1BA 2A9NH 5M95B 2VLKA 4BQBA 3MR9A 4LVNB 1MVUA 4PV8A 2BXYA 4DQOL 4NHUB 3ARBD 4MNGA 5C0AA 1J05A 3HNVL 4AIZB 1ZVHA 4G6JH 5DHVA 3VG0L 1U8NB 3SGKC 3OJVC 3MJ9L 4XNQA 4R4NC 5HSFA 4KZDH 5FFLA 4NJAL 3WFHA 1MCWW 1XF1A 1VFAB 4KK6D 1RD6A 2VSCA 4XVJL 2LU4A 1CU4L 3O41B 5SWZE 1IEAB 1YECL 2V2WA 1T5WB 3FB6B 2WWKO 2QSVA 1ES0B 1JRHH 2JE8A 5J1TC 1WFTA 2GK2A 3TA3C 4M6OL 3VDBA 2CKBL 2WBKA 4NUGL 5HYFA 4JFXB 1AJ7H 2DBLH 5C0EA 5JQHC 2PXYD 3BW9A 3LAFA 2FD6L 4JFFA 4W81A 3RY6A 1D5ZA 1F8TH 5F8QC 1CK0H 3TJEH 1I9JL 3QCVH 4M6MH 4H0HB 2GI7A 1XR9B 4JZOB 4R8WH 2OTWB 3RVTC 3HC0A 1ZVYA 3NIDF 4PGCA 2YN5A 3MUHL 3M1BB 2PO6A 4WTZG 5F7NC 3O9WD 4CGTA 1CT8B 1IVLA 4YO0B 2AJ3B 4WFGE 5EORL 4ZODA 2VE6B 1JWMB 5IJVA 2DLHA 3QQ9D 1JL8A 3KWWA 1XZ0B 4ZS7H 3UTTB 2VXQL 1M7DB 3SE9H 4KMTH 3TEUA 4OLXL 3ARYA 2GTZA 3MJ6A 4RMVA 1AHWA 4OB5H 1MFEH 4M7LT 2G9HB 4FQIL 2V5YA 3GSQA 1I4FB 1BQSA 1MF2L 2R2BA 1U8KB 4H8WL 5KVFH 3KYNA 5J1SC 1K6QH 4JRXD 4WI2A 2NY3C 2Y5TA 1JNNH 3A6CH 4OKDA 5DLMH 5BVJB 3HS0B 3IDXL 4FQJL 1CLCA 5F7HA 3U9UB 4MQXD 5IMKB 1CXIA 4P4KB 3VWKA 3WCYA 3QULB 5JORB 4S1DD 2BCKB 1KLGB 2B20A 5HBBA 5ISZD 1DUYA 5HPMA 2DDQL 3MV7A 3FT3B 2HKHH 4MD4B 4F9LA 3LB6C 4L1HA 1F11B 3I3DA 1Z0MA 3I50H 1WK0A 4RFOL 4XB8A 1VEOA 3QDJB 4CAGA 3SE4C 3CXHK 3O9WC 4PR5B 3S35L 4D0DB 2V2TB 1HNGA 3NGBC 3VH8B 4ZYKA 1ONQA 5KANG 3WMSA 3BMWA 1CDCA 1T1WA 3MRKA 3NH7H 1EXUB 2R1XB 3C6SB 3C5ZC 1JHLL 4RFNC 1HCVA 5B21A 5LAXA 1N0LA 5SWSE 4PB0L 3ZHLA 4BSJA 3T2QA 5B39A 5C0GA 4HKJA 3GJEA 1E4XI 2YD4A 2HG5A 1AKJB 3L6FB 2VLRB 5JPMA 3RY5A 2WP3O 2BNUA 5ETUA 4HXAH 4XPHH 1PKQB 4AT6A 2ZOLA 1DEDA 1PY9A 1YEEH 3TIEB 2QSCH 1MHCB 1I1AC 4EDWH 1JUFB 1OPGL 5B4MC 2ZUWA 1KCKA 2AI0H 4XCNB 1I1FB 4KK8C 2Z8SA 5IBUB 4LSSL 3U7YL 1KYOK 4XCEA 3IDYB 3INUL 4QF1A 4K94L 2XZAL 5FUZH 3EDEA 1KF9B 5DD3H 2Z92B 5KOMC 2NY0D 4LIQE 3HMWL 5JIPA 4X8JB 3BP5B 2XV6B 2V2TA 1BGXH 3VH8A 5I17B 5GGTH 4LLUA 4KY1H 4L3ED 5DURB 4U3HA 4HWNA 1RIUL 3MCLH 2EC9U 3MLWH 4ZFFA 1YN6B 5T3ZD 4ELMB 5LGJA 5JHDB 1E28A 2XWBA 4I1NB 4P4KD 4YR6B 4IOFC 2NY6C 5DTFB 5HGDA 3GSNB 3ZYOA 4NO0A 3VXRB 3IXTB 3C5JB 3NCEB 4XXDB 1MH5A 1JRHI 2A6KB 4NQDD 4V2CB 3OGCA 3EYUH 2ZSWA 5IHZB 1R6VA 2VZ3A 1IAMA 5TDPA 4P99A 3MLXL 2DQDL 4ETYA 2DLIA 5JO5B 3PP4H 2FECI 1AY1L 4K3DH 3O3AB 3VMPA 2LU7A 1FVEB 5DF0A 2R56L 5AUMB 5D1ZC 1Z0NA 5D7SL 3CLFH 1ZT7A 3HUJF 2IQ9H 5D7IF 3TBWB 3IFOB 4MNQB 4NKDB 4ZS6C 4QTIL 3DVGA 4EEEA 1BGXL 4XAKD 4JCLA 3MV9E 4M7ZB 5ILTH 4E41A 1H15A 5DJZA 43CAA 2WMPA 1KCUH 4PY8I 2Z8VC 1K4CB 2EDEA 5DJ6A 1T3FB 2AJVH 2HTKD 3TBYA 4JN2B 3IKCB 4MNHA 4HWBH 5SV4A 1J0HA 3PIQB 3LKOB 5K9JL 2HFEB 5IB4B 4FQLL 3S96B 4QRPD 5F7UA 2YPVL 3QUXB 2Q6WA 4I0CC 4XPGL 3CH1A 2XTLA 5IVXB 3OAYK 4Y19B 5F9AC 4F7CB 1K6QL 1G7QA 4XWOC 4JY6A 4C4KO 1MHEA 3U0PB 1JF1B 4YXLL 3CMOH 1MJ8L 3GMRA 4GS7C 2R23B 1YEFL 1DBJH 4OCSH 3EIFA 4DEPC 4YDJA 1A2YB 4L8SC 1TPXC 3MXWL 2MPAH 5CJQH 5I19H 5EOQH 5F96L 3HE6A 4NYLA 1NGZA 2YR3A 4YIQB 1QSFD 3Q2CA 4PBVC 1UM6H 5TF1H 3DURA 2VITA 4YO0A 4GMSL 1G9EA 1C08B 3RP1A 4ACPA 5J6GB 3O4OB 4U1IB 1KCRH 3T09A 2MOVA 1YNLL 3D85D 2VDRH 5JW4N 2WWKT 2HRPL 3KJ6L 4PJ8D 3E6HB 3FL7A 4G6KL 1KB5H 1CQYA 4LLVB 4NRXA 1DBAL 4QWWD 5CGYD 4ZFZA 2IPKB 1PKQE 2KZWA 3CUPB 3GMOB 3ZT6A 1A14H 1DBMH 1KJMA 4EZMA 3QDJD 3VD5A 4XNXL 1A14L 1DBML 2W60A 2VQUA 1K85A 1GH7A 1NDMA 3B9EA 3Q6GL 1VGEL 2DQCH 3VXNA 5EH1A 1JPST 1YNLH 3JWDC 3QQ9C 3KWWB 35C8L 3PGDB 2Y6SC 3QIWB 4HIJB 3LHPH 4L8SB 1YPZE 1X5XA 3U82B 1DR9A 4ZS7L 5BVPH 5IMMA 5JORA 3CFKB 2D0GA 5F89A 2R4RH 4S2SA 3QUZB 2G2RA 2X1QA 4KGJA 2XRAL 3ME0A 5J13C 3STLB 5HI4C 1LEIB 1RJYA 3SKOA 2WV3A 3NBNA 3KYKL 1LD9B 2X1OA 4KC3B 5SWSA 4PJXB 5C0FA 4NGHH 4R8WL 4NIKB 2AQ2A 4KJQC 4PJFF 1PQZB 2OP4H 1Z6JT 4WTWA 3UTQB 5IBLD 3I6KA 3WL9B 1D5MA 3R0MA 5E8EB 3TCLB 3BD3A 1AR1D 5IVZA 5INCB 3CLFL 4X6CF 2XICA 3GSOB 1IMHC 1J8HE 5D7IB 3FOLA 4M6OH 4CN4A 1N4XL 4MAUL 3UPRA 3UJIL 2R8SH 4PLOB 3IFLH 3SCMD 3CC5A 2BNRA 1BQUA 4HWBL 2R2CA 3RNKA 1T2QH 2IBZY 4R3SA 4YBHA 1IEBA 1UCBH 2IH3B 1ORSB 3DHJA 1JPFA 3OAZK 3WIHL 3KAAA 3X17A 5C0IA 1JGUH 3MRQB 3HLAA 4BK4A 5IEKB 2ZCKH 5JHDD 5ILTL 5IB2B 4GBXA 4PGCB 2VXSL 3IDYC 4WY7H 2YEZB 1I9IH 4U05A 5IHLB 2B0SH 4MZ2A 5HHXH 3TO4C 1QSEA 3RWCA 5D7SH 3HUJE 1OGAE 2WW8A 1E4XH 2VZOA 1CIDA 3B8YA 3C60A 4GH7B 3BPNC 2WUBL 3K8LA 4M7KH 1RVFH 4ZFFB 1P7KB 2H32B 1GC1H 5DJ8A 3FQRA 5DQ9A 5EOCL 3SDYH 1HSAB 4LRNL 2EZ0D 2FRGP 1RMFL 2ICCA 5LGJB 5DYOB 1E28B 1F3JB 3RUGB 1MI5D 3GJFA 3PDDA 4RDQF 1FE8L 3IDNA 2FR4A 1WZ1H 2J5LB 1XCTA 4BSWB 5FCSH 3KPSE 3K4DA 1CE6B 2H1PH 2JJTC 1OARH 1RUKL 5BRZA 3EZ8A 3ARGA 4I77L 4Z7WB 3ESVF 1Y18A 1UYWH 1HKLH 4OFPA 3LS5L 4YHOL 3P4NA 4HJGA 5KVEL 5GXBB 1J7VR 4LQFL 5DJ2A 2EIZA 4Y1AD 3QPXL 3CFJA 3TF7C 5T1MA 2D03L 5HHVH 4L4VB 5ACMA 5E9DB 3LKSB 4WUUA 3W11C 1IAOA 3TBVA 1RSFA 2O93L 1M71A 3I02B 1YQ2A 4OZFH 5KJRL 4D8PA 2WWMC 5C0CB 4NQED 4H1LB 2LU3A 2EH7L 4QYOB 1PBYA 3RDTB 1HWHB 5EIVA 1IGTB 3SKNA 5IBUG 1GL4B 4L4VD 1JPSL 4LSSH 3U7YH 1GOGA 5B39B 3MLTA 1WFNA 4HKJB 3BI9X 3L1OH 3EFDH 1RZFL 3PNWB 5DVKA 3SKJL 2JJVA 4UV4H 4LSQH 4LSPH 3W0WB 3VW3L 2AABH 3HHRB 4KK8D 4NQCD 3BWAA 1EHLH 2LABA 1FL6B 4PJ9A 5IB5A 1DUZA 3SGEI 1TMCA 2OXHA 1X5HA 1SYVB 4X5LA 1AP2A 3A6CL 2ZJSH 2IANE 3D2UB 2Y7QB 2GSGB 4PRPE 4ISVA 5GRUH 4G59A 4JB9L 4J2XA 1BOGA 1NBQA 3KYMB 3JWOH 4GAJL 4XNMA 1GXEA 1P1ZA 5I66A 2W9LA 1G1YA 4A2LA 3FO2A 5EBWA 4MVBC 3QBTB 4KXZI 3RU8L 3MUGA 1A1OA 1QFWH 4Y4HC 3HE7C 2DL9A 3HZKA 3B3IB 3MRHB 2VISB 2VR5A 4LBEB 1RAMA 3DURB 5DRNA 4V3EB 4YDVA 1K2DB 1CGVA 2AJXL 3S36X 1CD8A 3D3VB 4OCLC 1CXEA 4PPTA 3L5JA 2V9QA 4Y5YB 4I4WA 1QACA 1CK0L 4TVSa 1ZTXL 1KTRL 1LEGB 3S4SA 1AJ7L 1UQSA 2DBLL 5FOJA 3VG9B 1UJ3C 2FJHB 2CKBH 1NGZB 4ODUB 5IWLC 3GM8A 5BJTA 5FO8A 3IDMB 4MJIA 3IF1A 5JO5A 3OBAA 1O0VA 2LFGA 4K55A 5F71A 2ZG3A 1AI1H 2VABB 2RCSL 4JY5H 4DKAA 4IOIA 1C7TA 5T3XD 5C08B 1FZJA 5TQ0L 3RVUC 1DSFL 5E8PA 3RIFK 3FQTA 5KVDH 4MA8H 3L7FA 4PJCE 5JXED 1K4DB 2BVQB 4XNQB 4JHZA 3KJ4B 4MXVE 4QRRA 1LWRA 3VE0A 1I8MA 2JLLA 1AO7B 2DMBA 2QQQA 3TJEL 3UTTD 5CKAA 4GW4A 2N56A 2VKXA 4WFFD 1R3LA 5IFHL 1QHOA 1WTGT 3RKPA 5T1LB 1P6FA 1QRNE 1XGTB 4ZFOB 4WI6A 4EI5A 2Q76B 1XGPB 2OZ4H 3KPSB 5E2JA 3HZMA 1FGNH 4XC1L 1T04B 4ZTOL 2OR9L 3HMXA 5LGKA 5BZWA 1MWAA 1PX3A 1YMME 2BNRB 2W9EL 3GSRB 4UDUB 3IRPX 5IQ9B 2Z35B 4YGVA 2ED8A 2X1PA 3L3HA 4PJCF 4HBCH 3RNKB 1QO3B 3I75A 3SDDD 3TF7A 3V4PL 1KIRB 2FH8A 1NBVH 4A6YA 4GW1A 2ZJSL 4HJJH 4OFYA 4X6FA 1JWMA 4OCYH 3OXSB 1YYML 4GKZA 3G5VA 1L9MA 5EU7C 1Q8MA 5I8CA 5I73C 2VB5A 4DZ8B 1TQBC 1A5FH 1T83A 1A3RH 1KENH 4DGIH 4ODSL 1NCDL 2OS7A 2R2BB 1U93A 5GSRB 4KUCD 5E08H 1OL0A 4OTXH 4D9QE 1GC1C 4YLQT 4QRUB 4RZCB 3HC3L 3RX8A 4ELKB 2GUOB 4OTXL 1RZGB 3NACL 4N0UB 1KLUA 4X6DB 3T0ED 5I1AA 3S5LB 3AAZA 3MXVH 4RGNE 4LARL 4IMKA 2EZ0C 3H9YA 2NY3B 4JM2D 4MS8C 4NP4H 5HD8D 1IAIL 4OSUH 3B83A 4B50A 4JO1H 4JQXC 4HLJA 1KCVL 4XMLL 3QJFA 5HYSB 1U3HA 4KJQD 4ORGB 4PRAA 4IJ3B 2VDQL 3VFWB 1HKLL 3L3JA 3MXVL 5CZXD 1A1MA 2VAAB 5ETUB 5KVGL 4GRWF 4QRSA 1OM3L 5FYJD 2A74A 4PREA 4LCIH 2QR0B 3HR5B 4U1GC 4Z77B 3LPFA 5IQ7H 5I8KL 1X5IA 1OQOA 2D7NA 2LV4A 2X4OA 5JIHA 3QEHA 3P2TA 4JFEE 1IGIL 1KENL 2ESVD 1MWAH 1BP3B 1T0NA 4LOUC 4TNWK 5JW3L 1TXKA 5L9DL 4P5KB 2Y72A 5TDOA 5E2WH 3ZKXC 5I1AB 3CSPA 4KTDL 4LLUB 4HZLB 3K4AA 4X6BB 1J8HA 2VQ1A 4U0QB 2CK2A 3GSNH 4X80L 4Y5VC 5CD5D 5GRWA 1ZAGA 1BM3H 3BOVA 4P5TD 2OR8A 5KSBE 1KN4H 1S7TB 3UTOA 3WNKA 4LASH 4PUBH 2ITCA 5M94B 2D7TL 2YD6A 2AAVA 4AMKH 3B9KA 1MJ7H 2OBGA 1BD2E 5MERB 3DVIA 1FRGH 3WIFB 4X4ZA 4Y2OA 5GRZA 4HWZB 4HUXB 5D1QB 5JOPE 2VTFA 3GBML 4B41A 2NY7H 3HC4H 1EHXA 3GIVB 1QSEE 1G6RL 1NFDF 1S8DB 4CJ1A 3S9DB 4JRWA 1GGBL 1ZOXA 2X4QB 4WWKA 2Y07H 2ZUQC 1QFWM 4QTHA 3V4VL 3WNPA 3EYQD 1CICC 4OZFG 2NY5C 3GM0A 1FORH 5EWIL 1TITA 3NIGF 3QI9C 3UO1H 4KK9D 2CK0H 3BAEH 1A6AA 3FTGA 5J4MA 3F7YA 1KPVA 4MA8L 4NKDA 5FGBC 1GIGL 5EBLB 1Y18B 2NY4B 2ICWB 3NA9H 4EUPG 4QRTB 2NY1D 4DN3L 5I1IL 5GS2D 2H6PB 3OXRA 4OM0L 1B3JA 1UXSB 4P49A 3B3IA 4HFWB 1GVIA 3L95A 3MGTA 3MRFB 4G9FB 3QJHA 2RCSH 2CRIA 4OCWH 2BVPB 2BX5A 3OR7A 3SGJC 2W07A 4P4RA 4QXUH 2IMNA 3R4DA 4XPAH 2I60L 3G5YA 1PG7X 3VMNA 5E6ZA 1CDHA 4HX1B 3ROOB 3GRWA 5DHYB 3RL1A 2ENYA 4K9EL 4Q6YA 4XXCA 2RFXB 4NDMA 3TM6A 4LSVH 2ATPA 4BSVB 5DJ6B 3HRZA 4HCRA 4XCYA 3T0EA 5FYLD 3V6OA 4G9FD 2P5EA 3BKJH 15C8L 1U8HB 5EC2A 1F00I 2G5BB 1YY9D 4WFED 1K4DA 2BVQA 5J9PB 4PV9B 4MA3A 1F3DJ 2OX5A 1T4KA 2UY7A 2VDRL 1NCBH 3NA4A 3RHWF 1TQCB 4FFYL 3OB0K 1YY8B 4O4YL 3RWEB 1RIVH 3SDDB 1NMBL 2E7BA 3MCKB 1I7RB 3QH3B 4K7PY 1QSFA 2WUCH 2LTQB 4LVEA 1ULVA 3BFOA 1DUZB 2V2XB 5E70A 4P2QD 1ED3B 2Z4QB 1EFQA 3K81A 3LOWA 4PJFE 5KTEH 1DQTA 2DLFH 4NWTH 1MQKH 4CU6A 4L8CA 2B4CC 4M3JA 2EH7H 4CNIB 3ZKNC 5JW5B 4J3UA 3UMTA 2FATH 1NAMH 5I9QB 1V7ML 3EZJB 3BIKA 3TA3A 4EI5B 1CFQA 2Z8WC 3PHOB 5BW7A 1FYTE 2D03H 2A9MH 1CFSA 1J87A 4ZFGL 4N1CA 3WS3A 4Q2ZB 2FBJH 4RGMB 3TO4B 2WK2A 5CGYC 1EEZB 4PJ7E 5J89A 4FQCH 2HKFL 3EW3B 1G7LA 2IBBA 2AGJH 2ZNXA 1TJIH 4MNGE 1U8JB 5DZLA 5B3JE 4MHHI 2R1YA 4UAOC 1C5BL 3G9AB 5F89B 1I1CA 3L9RB 9CGTA 2XWJB 5HYEA 4PYHA 1KLFA 4IM8A 4X6EA 3MNZA 4R4FH 3MRPB 3GHEL 1N0XH 2FJHA 2J5LC 5D8JL 1FGVH 4JFYB 2JCCA 5FAAA 5CUSH 3ZO0A 4XHJD 1HINL 1HIMH 1ND0A 4U6VH 5ESVB 3FHQA 1LVEA 1MHPL 4ZPVB 3L6FA 3IJHB 3G5XB 4OCYL 2VL4A 4IMLA 5E8DL 5GISL 1AGCA 2FEEL 5MENB 4M1DL 3HN3A 3C2AL 4G8FA 4JFDE 2B0SL 5F6IB 5GS0L 3TIEA 1LE9A 2N7AA 3SY0A 4LL9A 2E27H 1NGXA 5ANME 1UZ6E 3PQYE 2OSLB 4P5MB 5LKNA 1J86A 4LHJB 5I71C 3BPCB 4XPFL 1U8KA 2WP3T 3VXTB 3P0YL 3HE6B 4NYLB 3B9AA 1RK0B 2FZ3A 2PYFA 2A77L 3REWB 1DCLA 3GK8L 4JFED 3VXQB 1TZIA 4L5FL 3KYAA 1EGJL 3MFGB 3HR5A 3CC5B 4FOMA 4UZGA 1MY7A 1XGTA 4YBLC 3VFUB 3BP4B 4ETQA 5H37G 3PGFL 2I9LA 5IFJA 3QPQC 3L3JB 3M07A 5I1HH 3B9VA 3VRJB 5DZNA 1JE6A 6FABH 3TCXA 1INDL 3MYZA 3IS1X 2EYRA 2P44B 3IU4L 3MRBA 4FQQB 2YHGA 2X7LB 5DJYA 3BN3B 2J8OA 4WY7L 1T1ZA 2XWBB 3NVQA 4WV1C 4X6BA 5F7LB 4OCNC 3S34H 3IS0X 5I1KH 3O3UN 3PDOB 1DJSA 3V5DA 1ZS8A 2HLAA 3QA3A 5C07B 1ZLVH 5HHOB 4FZ8L 2QHRH 1OCWL 1T2QL 3SE3A 4YX2L 4NNPH 4PRIE 4DN4H 1D5XA 2JB6A 2ICEB 2W91A 2R2EA 2AEPH 3BWUC 4KI5D 4P5TC 4TUJA 1YEEL 1KN2H 2B5IB 3P3YA 4HXAL 4WDIB 2VN4A 3VDAA 5C0GB 1RZ7L 2R9HC 3FONB 2NY4D 2W59A 2A73A 1PKOA 3VWKC 4I2XA 3ZSSA 4JKPL 4O58L 5CZKA 3REVA 4PRBA 2J8UE 3P11L 3BH9B 4D0CB 4Z7OF 5HHMD 4L4VA 1KB5L 4PRID 1KB9K 4K7FB 3MRLA 4LGPB 4X4YB 2Y23A 3LRSA 3QUMA 3E3QC 1KCRL 4KUZH 4LSRL 4JO3L 4HGMA 4Q9RH 1QPXA 1W0WB 1CLOH 1T89C 1EH9A 3BH8B 4P2RB 4WW2C 4QXGL 1E4WH 5SWQA 5CP3H 3S35H 1B6UA 3ULVC 3VFPB 1ADQL 4UDTB 4X7FC 3ARBA 1PZUB 4GBXD 1LP9A 2EXYD 2FWOA 4KK9C 5GRYA 4AEIH 1CG9A 4PTTB 4HKXB 3M8OH 1JK8B 5T1KA 1VGEH 1DL7L 2DQCL 1JGLH 2YZ8A 4GAGL 3TH3T 3OB8A 5E4EC 1N5YL 3MACL 1MAJA 4LF3A 3ZDXE 5DLML 1FFRA 4N9GB 4F37K 3MA7A 3RWCB 1MIML 3WKNA 1QRND 4LOUD 3MACH 1J1PH 3RGVD 2R0WL 4DGVH 1DQQB 1RUQH 3NABL 4MX7A 1JF1A 4PRHB 1TDQA 1MI5A 4G9FA 1ZVSA 1ADQA 1FDLL 4D0CA 1W72B 3F6LA 2VZSA 5EU4A 1KIPB 3VXOA 3ZKSD 1FCCA 1D6VL 2GJJA 4YIQA 2ITDB 1KB5A 1Q9OB 5C09E 1I8LA 2ARWA 1CZ8H 4P46C 5FA4B 1JGDA 3A0OA 3MLRH 1MIEL 4E42B 1OAUL 3LDBB 3G08B 1MAMH 3QFJB 5BMFL 5J9PA 2EO9A 2BSED 3WO3B 4YPGB 1UWXK 3OKOB 3HUJB 1S9WA 4NT6B 3PV7A 4P3CH 4LEOA 3BO8B 1MJJA 2XYCA 4HH8A 5HGAA 2PXYA 5IBTL 5HHVL 1L6ZA 4TRPL 5D1QA 5AYQA 4Y5YA 4L9LB 4LQFH 4LAQL 4JREC 5TE4L 1CXHA 2DQIL 4NHUE 2BY1A 4HIJA 1UYWL 1QSFE 4WWKB 3QIUA 4OZHE 1F90H 1T7YA 4C58B 3QUZA 4NM8L 3BSZL 1HDMB 4N0YH 4K8RL 3MOBL 1OY3B 2NY5H 2X4UA 5JHLL 4KDTC 4ZO7A 1F58L 4C55A 3RWGB 2P49B 1IC5L 2Y36L 3SDCC 1F4YH 4J7RA 4W6XB 5IV2B 2IH1B 1H5BC 3OKMB 2QQLH 3JV4A 3UTSA 4R0LC 1C16A 4JLRB 2GK0A 3WHE0 4U1JA 5DRZB 4HLZG 1KTLB 3D2UA 1OSPL 4PRHD 2H8PB 2AS5M 1HQRB 2NW2A 1LO3L 4DTGH 1KJ2H 4WU7A 1HXYA 3CPLA 4FQHA 1HE7A 2NW3A 1CF8H 1KACB 4Z7UA 3SJVB 3QG7H 1H3VA 3QIWC 5JHLH 4XNUL 5FYKH 2WINB 4POZC 3QNXA 4XCYB 3H7LA 1ORSA 2DQTH 3GSRA 1IT9L 2DD8H 1P7HL 4L4JA 1EO7A 3B6SB 1LGVA 2P4AB 1FYTB 3VFGH 3IFLL 3CZJA 2JKXA 5F7WC 1BBJA 4LEXH 3F7VA 4UNTA 1A1NB