4WWYA

Human cationic trypsin g193r mutant in complex with bovine pancreatic trypsin inhibitor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
224
structure length
224
Chain Sequence
IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINAHVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mesotrypsin Has Evolved Four Unique Residues to Cleave Trypsin Inhibitors as Substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Trypsin-1
total genus 56
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2014-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wwyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wwyA02
3A8BA 1AO5A 1UVOA 1D4PB 1ESBA 3HKIB 4GUXA 1AFEH 1SGFA 1C2MA 1O2WA 2J92A 1NU7B 4CRCA 1CT2E 2BX3A 2J4IA 4YM9A 1V2NT 1SQAA 3TIUA 2BTCE 1AQ7A 1GG6C 3M3VA 1PQAA 1C5WB 2ZGXH 2FS9A 1O3PB 2QYIA 1P12E 1Z6EA 1V2LT 2IOTA 1P06A 5K0HA 3T27A 1P09A 2ZDKA 3RXKA 1GI3A 1UK4A 1CHOG 1SOTA 2QXGA 1BRUP 2ZECA 1FDPA 4JZFH 1AWHB 4LZ4B 3I29A 1Y8TA 1EASA 1GBAA 4WMEA 2Y5FA 1K1MA 1G37A 4AG2A 1GHWH 1N1LA 1GVLA 1XUKA 5JB8S 3PTBA 1ZJKA 4OS2A 1P04A 2NU3E 4MTBA 1GCTC 1HDTH 2NU1E 1HV7A 3VPKA 3W95A 1P2IA 2PUXB 5EXMA 1TGTA 2AGEX 1UTJA 1CSOE 1F92A 4IMQA 1C5TA 2BY6X 4B2BA 4H6TA 2TGDA 3CENA 4U2WA 4E7NA 3PB1E 4ZUHA 4MPUA 1G3EA 4Z0KA 1ZHRA 3MNXA 1TNJA 3D62A 2A0QB 8GCHG 2UUJB 3RUOA 3T26A 3L3TA 1TQ0B 3TVJB 1GDUA 1DWDH 2ZTYA 4ZROA 3RXVA 2SGEE 3BEFB 2SGQE 1NFUA 2GP9B 3P6ZB 1K1PA 1IQGA 4AZ2B 3SU6A 1TPPA 1LVBA 1E0FD 1T8NA 2Z7FE 1O33A 3E3TA 3RP2A 1GBIA 2BDBA 1PYTC 5LH8A 4XOJA 3B8JA 1DITH 1GI5A 3RM2H 4INLA 5DGJA 2P3FH 3EA8A 1VJ9U 1JRTA 1OP2A 3ZV9A 3T29A 1S0QA 1OXGA 2NU4E 3PMHB 2VIPA 5T6DA 4X1QU 1ELGA 1AI8H 3M3TA 3ENSB 3D23A 3RXSA 1O3EA 4BOHA 3GCOA 1YM0A 2QC2A 3SQHE 1ZHMA 4NZLA 1VZQH 1BTZA 4H4FA 2ALVA 4E7RG 3FP7E 2ZG0H 2OP9A 4NFEA 1TPAE 1ZPCA 2ZU1A 3KIDU 3BG4B 3K9XB 2XC4A 4K69A 1HAXB 1HYLA 1C5VA 3F9EA 2Y5GA 3VXFH 2FOGA 4X1PU 1AHTH 4THNH 2V6NA 4OS1A 4DOQA 3RXOA 3H7OA 1MKWK 1GPZA 2ZCKP 4Y7AA 1GDQA 2XW9A 2Z9LA 5CE1A 3BEUA 4WF8A 1QHRB 1P2QA 2IN2A 5JYIA 1QY6A 3ZZ5A 1MUEB 1SBWA 3BN9A 1H9IE 2ODYB 1NU9A 4VGCB 4ISOA 1GMCG 3F9GA 3O8DA 3SO3A 1X7AC 2BHGA 2Q1JA 3OYPA 4KTCA 1DLKB 3RMLH 3FVFB 2QF3A 4YZUA 8KME2 4FXGH 4GAWA 2HPQH 1LQEA 1O5EH 2WYJA 4Y10E 4K60A 2XBXA 3RLYH 4Q2KA 4I8JA 1HUTH 4ABFA 1TMBH 4YESB 4ABBA 4K2YA 1AKSA 2C8YB 3SNBA 3TJOA 2ZDNA 2A5IA 1W14U 1FY3A 2PR3A 4J2YB 4BAKB 1L1NA 2ZPRA 4MNYA 1BBRH 5ESBA 2OUAA 1TLDA 1Z8IB 1HAOH 2C8WB 1BRCE 3RXUA 1FN8A 1NRRH 3V12A 4B71A 1HJAC 1FY8E 2ZKSA 1C2KA 4NA8A 3IG6B 1LVYA 3FANA 1E37B 4IMZA 4O3UA 2XWBI 2HNTF 1NM6A 4PROA 1S0RA 1T8LA 1FJSA 2O8LA 4O9VA 5J4QA 1TX8A 1LVMA 1EXFA 4AYVB 4UFDH 3ZZ6A 3MTYA 1HPGA 1SGIB 3MNBA 2GVFA 1O3JA 3RXAA 1GI1A 3SNCA 3VEQB 1SGDE 4ZXXH 2BY9X 1BJUA 3MH4A 1CBWC 4XFQA 1MTNB 2WV4A 3CS7A 4B73A 3M5NA 1GBFA 4D76A 3SJ9A 1ELEE 3BTQE 2ANYA 1RD3B 3MO6A 2P94A 4HGCA 1FAXA 3A85A 4JYTA 1K28D 1T8MA 2BD2A 4A1VA 1P3CA 1JWTA 1YP9A 4BANB 1GBMA 5T3HA 5TCCA 2VU8E 4DURA 2BDAA 3ZVCA 4BAHB 3RXRA 1V2UT 1O3FA 1XUJA 4K8BA 1Y5AT 4LZ1H 3QZQA 2ALPA 1BBRE 5B6OA 3N7OA 1GVZA 2V0BA 4X0WU 1C1SA 2I6QA 1BTWA 4B2CA 1O3CA 2VVCA 1D9IA 3MH7A 3GCTG 5DP4A 1FY5A 1KLTA 2QY0B 1HXFH 1FPCH 4Z6AH 1CO7E 1L1GA 2W3KA 3KQCA 3SUFA 3K6YA 4DJZB 2PKAB 2TIOA 2FO9A 4WVPE 1TNKA 2P59A 1ZR0A 5E2PA 2HALA 2HWLB 2ZWLH 1KSNA 1AGJA 1EZSC 1W10U 2WV5A 2XCNA 4KTSA 5JB9S 2FOAA 5JBCS 1C2DA 1GMHG 1NRSH 1YPHE 2BXUH 4ZMAH 4BAOB 1GI6A 1QL8A 1HAIH 4ESTE 5F8XA 1GHZA 2D1JA 2PHBA 1GHAG 2FMJA 1SVPA 1QBVH 1HJ9A 2VVUA 3C27B 2QCYA 2YNBA 4UEHH 3T28A 5EODA 2SGDE 3UWJH 1P05A 3SORA 4DIHH 2ULLA 1MTWA 1GJAB 3FZZA 3A88A 2SGFE 3MMGA 4NA9H 5AFYH 7KMEH 1ZMJA 1O2HA 5H4IB 2CF9H 2QF0A 4X2VA 5C3NA 6ESTA 3QDZB 2Z6BD 1EAXA 1P2KA 4AFSA 4AYYB 1O5CB 3K65B 2QGRA 3A7ZA 1Z8GA 1O3AA 1C5MD 4WH6A 3UPEA 2W3IA 4BAMB 4WMDA 3OY6U 1EJMA 3KQEA 1YBWA 2VIWA 1UCYE 2GDDA 1C1PA 1QBNA 2GZ9A 1CA0C 1D6WA 1WCZA 1HCGA 3LGVA 1BTXA 1Y59T 1ZTJA 1XMNB 2HVXA 1GDNA 4FUIA 4SGAE 1L4DA 1BTUA 3E8LA 2O8MA 5JPMH 1E38B 1IQFA 1BTYA 1C1NA 1GJDB 3MH5A 1ELFA 1C1QA 5LPEA 4KELA 1C2FA 1WOFA 3RC6A 2VH0A 3PROA 2G81E 1NFXA 3K2UA 4O3TA 1EAIA 1P10A 4I8LA 4INKA 1SQTA 1GHXH 1C1UH 2HNTC 1SG8B 2J2UA 3GCHB 4OS7A 4BTIB 4BAQB 3GICB 2BX4A 1OWHA 3HATH 1N6YA 5FHTA 1SMFE 2IPHA 1DUEA 5EG4A 1GHBF 4U32A 1DVAH 4VGCC 1UHBB 3EQ0H 4FU9A 3NKKA 3GOVB 1C2LA 1FMGA 5GIBA 1YC0A 1VCWA 5C67A 1F5RA 3ATLA 2PUQH 3F9HA 1QBOA 1TOCB 1ESAA 2ZEBA 1A2CH 1M9UA 1P11E 4LXBH 5A0BA 3UR6A 2VWLA 1LO6A 2V3HH 3GY6A 4JZDH 3UOPA 3RXPA 3E91A 4Y6DA 3EE0B 1NFWA 1RJXB 1O2IA 3TNTA 1MKXK 1CA0B 2AEIH 1O3HA 1SOZA 2PGQB 1CA8B 5DP8A 3L6PA 1W7XH 1DWEH 1BCUH 1S85A 2QIQA 2F83A 3MFJA 3ODFA 3HPTB 2VIDA 1TB6H 1XUHA 4HFPB 3MWIU 4CH2B 2A32A 4Y11E 5DP5A 1Z1JA 2F9UA 5FAHA 2AMQA 1IOEA 2OLGA 1HFDA 3ZVEA 4ZHAA 2GT8A 1A4WH 2GMTB 2JETC 1QA7A 5ESTE 4D9RA 1BITA 2FIRH 1TGCA 3MU0A 4ISIH 2O9QA 5GJ4B 3VB3A 3ZYDA 1GJ7B 1J9CH 2Y7XA 3GISB 1FNIA 5T6FA 3SJ8A 5E2OA 4KP0A 5GCHG 2K1QA 1KXEA 1MTUA 1EUFA 1ZLRA 2AGGX 1KTTB 1IQJA 1XXFA 1Z1IA 3R0FA 1CGJE 2PV9B 1HXEH 4AB9A 1T32A 1T31A 1O2MA 1WUNH 1MTVA 3F9FA 1Y3YA 4TY7A 1HGTH 2TPIZ 4I32A 5A8YA 2BDYA 4UD9H 1RTKA 4NSYA 2WUCA 4ZKNU 2XBVA 3LJOA 3S9AA 3KGPA 1LHEH 4NZQA 3VGCB 4F4OC 1TPOA 1Z7KA 1RIWC 1K22H 1XVOA 2Z9KA 3M5OA 3BSQA 4I31A 4I8KA 1ZMLA 1GJ4H 3A80A 1QNJA 1TIOA 1BRBE 4ZKSU 1PPBH 3BTTE 1ZGIA 4D8NA 5HM2A 1L2EA 1GBKA 1H9LB 5C1UA 1XXDA 1GJ5H 3TH4H 2UUYA 2GZ8A 1IQKA 1JIMA 3PLKA 9LPRA 1TX6A 1VR1H 3PM3A 4R0IA 1BMAA 3SV6A 1GI2A 4X2YA 1EJNA 2J94A 2VNTA 5C20A 1CGHA 2ZGBH 1ID5H 4MPVA 2GDEH 5EGMA 4X8TH 4DIIH 3SGAE 3E6PH 1GWAA 3SNDA 3BF6H 1O3NA 2FS8A 6LPRA 3JZ2B 3AAUA 1BMLA 3F68H 3A7WA 1FY4A 1V2TT 3GY3A 2ODPA 1ZTKA 4Q7YA 2EI8A 2NU2E 1LDTT 3DUXH 4DCDA 2QXJA 2G51A 1ELCA 2A45B 1FPHH 1UO6A 3RXMA 1XX9A 2KAIA 3C1KA 4DT7B 4Y0ZE 2RA0A 5FCKA 3SOSA 4GHTA 1V2WT 1V2OT 1W8BH 4CHAC 1V2QT 5AHGH 2XRCA 1TE0A 5HGGA 3ZZ8A 4JK6A 1KYNA 1WU1A 3A8AA 1SPJA 1WTHD 1MQ6A 2H5CA 1OS8A 3BIUH 1QIXB 4BTTB 3Q3YA 2R0KA 1O2YA 4AB8A 5EPNA 4ABDA 1NPMA 1OP0A 3LC5A 4X6PA 2WPIS 2BM2A 3JZ1B 1O2PA 1LPZB 1D3DB 4CRGA 1SGYE 2ZPSA 1AKSB 2VH6A 2HGTH 5PTPA 2C4FH 2QA9E 5F8ZA 3UIRA 2BZAA 1ORFA 1A61H 2A5KA 1LHCH 3FP8E 2BD3A 1ZHPA 3BTFE 2BVRH 3L33A 1EZXC 1LPKB 2ODQA 3S0NA 1SB1H 2BD5A 1NS3A 2XC0A 1O31A 5EPYA 4NWLA 4IN1A 3B23B 2C8ZB 2PTNA 2ZC9H 2AGIX 1HAGE 1GI4A 5T6GA 1MCVA 1AFQC 3P70B 4B74A 4LOYH 3RC4A 5JBBS 4FUDA 3RC5A 3GDSA 3E90B 4ABAA 3VB4A 1BTPA 2FI5E 1C4U2 1HB0B 1O3BA 2BD4A 5E0HA 4MVNA 3ZZAA 3ZZCA 2Z9JA 2H9HA 1NRNH 2GCTC 2ZF0H 3PMJA 5FXLA 3RXEA 3RM0H 4X6OA 2FX6A 1NFYA 1G32B 4Q7ZA 2FX4A 1YPJH 3OSYA 4X2XA 1G3CA 3FFGA 1OWKA 1WAYB 3SV2H 1AE8H 1GI8B 3VB6A 3U98H 1IQHA 4NCYA 1BHXB 4UFFH 4Y8ZA 1GMDG 1LHGH 1TALA 1JMOH 1OOKB 1ZMNA 2FEQH 1ETRH 3ZZ9A 3E0NB 3UQOA 1G2MA 1HRTH 3LJJA 1TA6A 2QV1A 3SHCH 1T8OA 5BRRE 3LONA 2XCFA 1EQ9A 1OP8A 1GI0A 1XUGA 4MG3A 3EDXB 3LH3A 2O8WA 3GDUA 2AYWA 4ASHA 1GBEA 1DY9A 1UTKA 2ZGHA 1H8IH 1Z6JH 1BBRK 5C1YA 3KN2A 2JH5D 1K1IA 1Y3WA 3D65E 3DT0H 2UWOA 1O30A 1EATA 1G3BA 1BB0B 1BA8B 2GT7A 1D3QB 1NESE 1P01A 4XSKU 1EOLA 1YCPK 2UUFB 2ZHFH 2BLQA 2WPJS 1VCPA 4Y0YE 1T4UH 1O39A 3E0PB 1C1OA 4WWYA 4CH8B 1N6XA 4JYUH 2G4TA 1PJPA 1WQVH 1FY1A 4K1SA 4RKOB 1QJ1B 1C1MA 7LPRA 3M37A 1A0JA 1EOJA 4AFUA 1QL9A 4XE4A 3BTME 2PW8H 1MQ5A 1SL3A 2XNIA 3DHKH 3BIVH 3TU7H 4IN2A 3OU0A 2BOHB 3QLPH 1ZPBA 2F9BH 2H6MA 5FBEA 1AE5A 2A5AA 1SGTA 3LIWA 1P2NA 3ATIA 1UTOA 3A7YA 3NK8A 1UVPA 1HIAB 1SGEE 2OCVB 3UREA 5C5OA 1O2OA 4K5ZA 2BQ6B 2C90B 3RU4E 1LHFH 1O2QA 2ZDMA 2A2QH 2XWAA 1GHBG 2ZPQA 1HNEE 4OGXA 3ZVFA 1S82A 1TRNA 1TA2A 3QGJA 2GCHF 2TBSA 3MU1A 4NIWA 4DY7B 3URCA 9ESTA 2VWMA 3AAVA 3BTHE 1GHVH 8GCHF 5SGAE 1V2ST 3U8OH 3EA7A 1TQ7B 1TNHA 2WPHS 5A09A 3ATMA 3M5MA 5DP6A 3SI3H 1W11U 3SU4A 3MU4A 1AZZA 4BTUB 1O2TA 2G52A 2VIQA 4U30A 1EPTA 3KNXA 1MTSA 1T7CA 2R3UA 3E1XB 1TGBA 2TGPZ 3VB5A 1O38A 2SNWA 3ZV8A 5FCRA 3TGKE 5L30H 1O5GH 3Q3KA 4TYDA 1V2KT 5EQQA 4GCHF 1C2HA 2C3SA 1SSXA 5A8ZA 3EAJA 1YCPH 3F6UH 1ZRBA 1XUFA 5TCAA 4ZAEA 2OQUA 4K3JA 1TX7A 2CHAC 2FOEA 2BDIA 2FYRA 2CGAA 3VB7A 3STIA 1RRKA 2ZGCA 2AMPA 3DFLA 1YPKH 1MU6B 1GJCB 5DP9A 4CBOA 3URDA 3HK6B 1J14A 2BY5X 3T62A 1WSSH 1A0LA 2GGVB 3LGWA 3GCHC 5ETXA 5DJ7A 2STAE 1DWCH 1UTLM 1GJ6A 4IS5A 5JBAS 2ZDVH 2QN5T 3OTJE 1GBDA 3SUGA 1KXFA 1MH0A 1PPZA 1Z8RA 2Y82A 4X8SH 2W5EA 3EGKH 3CS0A 1TABE 1CQQA 1NO9H 5EQSA 1VITG 2VVVA 2FOFA 3M35A 4MNWA 5AFZH 1LPGB 4MNXA 2ZTZA 3HKJB 1O3IA 3GY4A 4WH8A 3DD2H 1OWDA 1THRH 1G3DA 2BOKA 3S9BA 1GJ9B 3O8RA 4HZHA 4AFQA 1IQNA 1O3DA 1ELVA 3RXJA 1Y5UT 3TK6A 2B8OH 4YT7H 1BRAA 1P03A 2GMTC 3V7TA 3LGTA 2BDGA 2OXSA 1K1OA 1BOQA 5K7RA 1DX5M 3KEEA 2GD4B 3RXFA 2AERH 2W7SA 1FAKH 2Z3EA 5DPAA 1ANEA 6CHAB 1CU1A 4U01A 1BHXF 4I7YH 4YOGA 1EP5A 1VGCC 1AZ8A 1C2EA 1ZJDA 1ZPZA 4IW4E 2BD9A 4XBCA 4UONA 2BLWA 1SGRE 3A81A 2Y81A 1WBGB 1CVWH 2VGCB 1B0FA 2R3YA 1O3OA 5F8TA 5JBTA 1AIXH 2ZIQH 4JCNA 4KKDA 5HMAA 1O3GA 1YGCH 2OBOA 4Q7XA 1DY8A 2ANWA 4IBLH 2Q6DA 2XYAA 1G36A 1FIZA 5IDKA 1EZQA 5L2YH 2ZHEH 1QQ4A 1K21H 1XM1A 3IITA 3M7QA 1F2SE 2QXIA 1C2JA 2GCHG 4Y8XA 2VGCC 2ZU5A 1DT2A 3ATKA 1P0SH 1SC8U 2CHAB 3QZRA 1Z71A 7GCHF 1TBRH 3SU2A 1Y3UA 2J38A 1HLTH 1UK2A 2GV6A 2FZZA 3SW2B 2ZCLP 4JZIA 1UVUH 1ANDA 1SI5H 3O8CA 1V2VT 2P3TB 2ZA5A 2GZ7A 3TITA 4ABJA 2C8XB 3P8FA 4FU7A 4Y7BA 2BQ7B 1TRYA 3I77A 2V3OH 3ELAH 1NC6A 3FZDA 1INCA 4A7IB 1A7SA 1AFQB 2F91A 4JMYA 2G00A 1K1LA 2FLRH 2BDHA 4GCHG 1G9IE 1TWXB 1GVKB 2ZI2H 3GYMA 1UMAH 1FONA 1VJAU 1EAWA 2BVSH 3TPIZ 3VFEA 2ZNKH 3ZVAA 1C5SA 2FM2A 3BTKE 3FAOA 1O2SA 4CRDA 4K1TA 2O8UA 4GLYA 2ZHWH 1KIGH 1O2VA 3P92A 1QB1A 1AB9C 1PPEE 1E35B 1A5IA 2F9VA 1TAWA 3GCNA 1ETTH 3M61U 4IC6A 3UNRA 4KGAA 4NSVA 4DG4A 1NN6A 1F5LA 1MD7A 1DICA 1C5ZB 2ZU2A 2AH4X 2W7UA 5EXLA 4OS4A 5JDUB 3BEIB 3HGNA 3T5FH 2Y80A 2JETB 3ZZDA 1HIAA 1O37A 2VIOA 1YYY1 4YT6H 2AS9A 4ABGA 2GTBA 5LPRA 2SGPE 1VGCB 4ZKRU 1NT1A 1A5HA 5E8EH 3TK9A 1GGDB 4FUFA 4FVDA 4GSOA 5DK1A 1DANH 4FUBA 2BLOA 4Q80A 4H6SB 3SJKA 1OPHB 1W12U 4YO9A 3SUDA 1U6QA 1MAXA 1O2NA 2ZHDA 1SHYA 1THSH 1A3BH 1J8AA 3P8GA 8ESTE 2V35A 1YKTA 2ESTE 1C5QA 3LGIA 4FVBA 2Z3DA 2ZO3H 3MOCA 1IAUA 2OD3B 4ISLA 1KXBA 1ARBA 2ZFFH 1BTHH 3SNEA 2BYAX 4CRBA 5C1XA 5FX6A 1F0UA 1WYKA 1WV7H 2ZQ2A 4ZKOU 1XUIA 2WPKS 3M5LA 2ZFQH 4FUEA 5CMXH 1Y3XA 2B0FA 3DFJA 5A0CA 1RIWB 1XKBC 3ZVGA 2SFAA 3GY7A 2OC1A 1SGCA 3UOUA 1TOMH 1NZQH 5EW1H 5FX5A 1ARCA 5L2ZH 2VJ1A 4MDSA 2PSYA 3B9FH 4O03A 2J95A 4GPGA 1UCYH 1S6FA 4B76A 2PTCE 3QTOH 1S5SA 1QRWA 2CXVA 2D8WA 2B9LA 1W13U 2Q6GA 1C9PA 1JIRA 1QB9A 5FPYA 1ACBE 5C5NA 1XKAC 1MBQA 1SQOA 3H5CB 1W3CA 4ZH8A 4ZHLU 3V0XA 1PPFE 3RXTA 1EKBB 1E36B 2PKSC 1QTFA 3S7HB 3H7TA 5GCHF 4CRAA 3VXEH 4YTAA 4KTUA 1V2JT 2ZDLA 2TGAA 4FUCA 2FOHA 2OC8A 3SHAH 1L0ZA 2F3CE 4UDWH 1OYTH 3RXGA 1AVXA 1VITH 1A0HB 1P3EA 1O36A 2XTTB 3SI4H 5EQRA 1GHYH 1O2ZA 1TNLA 2A7HA 3BG4C 1A3EH 3AASA 2B5TB 5DO4H 1LKBA 1MMJN 1O32A 1TNIA 1K2I1 1YPLH 4A5TS 3TH2H 1MAYA 1VCQA 2A4OA 2P95A 1C4Y2 2G55A 4XDEA 1GBBA 1WTGH 4ISNA 4MLFB 1A1RA 1UCYK 1DUAA 2ZU4A 2B7DH 3WY8A 4MNVA 1DE7H 1GMHF 3AVZA 1GL1A 1Z8JB 2ZQ1A 2WPLS 2VINA 1IQLA 1P8VC 5LPFA 1ZSLA 2ZFPH 1HBTH 3U9AH 3NCLA 2RA3A 2YOLA 1MD8A 2FDAA 1O2XA 1C9TA 1EAUA 2Z94A 1MU8B 1AVGH 4YLQH 3S69A 1AY6H 4H42U 1CT4E 1KLJH 2BQWB 1UTPA 3MNCA 3GY8A 2OBQA 1NTPA 1GBLA 3RDZA 1G30B 2OQ5A 2AIPA 2ZZUH 4B2AA 2FTMA 3A83A 3PWBA 3BTWE 2A2XH 2F9NA 4WXVA 4B1TA 1J16A 3RMNH 1O5AB 1TYNA 1V6DA 2CMYA 1P2JA 3AW1A 1V2MT 4R8TB 3BV9B 4DW2U 4OS6A 2H1UA 4NIXA 5A2MH 5DKMA 4FU8A 1QCPA 1SGNE 1YF4A 1PQ7A 1WQSA 4CR9A 3U1IB 3QK1A 3A82A 2FP7B 2CJIA 4X1RU 3RU4D 3KF2A 1HAPH 3SJOA 1OX1A 1BT7A 2FWWA 1P9SA 1DXWA 2ILNA 3A7TA 2Z9GA 3SV7A 1D3PB 5CHAB 4SGBE 2F9PA 3A84A 1LCYA 3M7TA 3ODDA 1PQ5A 3FP6E 2UWPA 4TY6A 4Y76A 1O2UA 1SHHB 1OWIA 2YNAA 1ANBA 1OYQA 2FOBA 3KCGH 3QTVH 1Q2WA 1LKAA 1RXPA 2ZHQH 4ABHA 4BNRA 3U1JB 1HAVA 3QGNB 1RFNA 2WYGA 3TLOA 3U8TH 1THPB 3P95A 1CE5A 3TGJE 1C5UA 1RTFB 1TGSZ 8LPRA 1GI9B 1DXPA 3U8RH 1O3MA 2BZ6H 1GGDC 2G5NA 3KHVA 5I46H 3PTNA 5CHAC 5AF9H 2J34A 1S83A 3LKWA 2I6SA 2FXRA 1OWEA 5G4BA 5ABWA 2SGAA 1JXPA 4HI3A 4NA7A 1V2RT 3A8DA 2OC0A 4A92A 1K1JA 2THFB 2ZU3A 1DS2E 3TH3H 2GKVE 2ANKH 2EI7A 3M7UA 1SGPE 1NRPH 3TK5A 1C5YB 2H2ZA 3RU4T 3RXBA 5LGOA 2WINI 2XBWA 1NY22 3EA9A 1YPGH 1ABJH 4TWYA 3K6ZA 1BIOA 1C5XB 2HPPH 4X1NU 2UWLA 2P8OB 3MO9A 1GMCF 1C1RA 2Y6TA 2ANMH 3BTGE 1GCDA 1TBQH 4CR5A 1QRXA 2FTLE 1AVWA 1P9UA 2A4QA 3ZZ7A 1GL0E 4AOQA 1RS0A 2DE9A 3QUMP 3A89A 3MYWA 2FI3E 1S84A 2BDCA 1N8OB 5AVDA 3PWCA 3TNSA 2PLXA 2GX4A 2R9PA 3RXIA 3SV9A 2CF8H 4GVUA 1GJBB 2OINA 1MBMA 1FZZA 4FUGA 1P57B 4WXIA 5GWZA 1IQMA 2BY8X 4UE7H 1W0ZU 3PV4A 2A7JA 5E0GA 2G8TA 5F03A 1CBWB 1KY9A 4JZ1A 1YLDA 4FUJA 3RXHA 1MKWH 3UNSA 4HTCH 4GHQA 3QN7A 1O3LA 2EA3A 4E05H 3ZYEA 3UY9A 4NGAH 3PO1B 1F5KU 2XC5A 1AN1E 1FQ3A 1MTNC 4UFEH 1CHOF 3Q77A 5EOKA 3SJIA 2STBE 2DE8A 2M5TA 1GBHA 1F0SA 1Q3XA 4ZHMU 2Q6FA 2GCTB 3LU9B 1MZDA 2EEKA 3MU5A 1TMTH 1AD8H 2CN0H 3F1SB 4I8GA 3TJVA 2BD7A 3A7XA 1BDAA 1MZAA 2FOCA 1S81A 1EB1H 3DA9B 1FV9A 1TPSA 1UVTH 4Y71A 1KTSB 2FODA 2P93A 2PGBB 3P17H 4ABIA 4RN6A 4A1XA 1HAHH 2GV7A 5FBIA 1ZSJA 3PMBB 1VITF 2A4GA 1RGQA 1XVMA 3ZZBA 2W26A 3RXCA 1L4ZA 1ZOMA 4XBBA 1OSSA 2OC7A 5HM9A 2P8OC 3NXPA 1E34B 3SN8A 2VWNA 2A1DB 4K1EA 3KL6A 4CRFA 3V13A 3ZVDA 2P3UB 1H1BA 1SLUB 5DP3A 1C5OH 2A4RA 1CGIE 1YCPM 2D2DA 4TPIZ 1KXAA 1QFKH 1YPHC 2QAAA 3LDXH 1DPOA 4D7GA 1KLIH 4D7FA 1S6HA 1SGFG 1SFIA 2Z9IA 5DG6A 2ZFRH 3SNAA 7ESTE 1IQEA 1EP6A 3E16B 2BXTH 2SNVA 1OWJA 4I33A 3QX5H 4A1TA 1BMNH 3G01A 3PYHA 1BUIA 4I8HA 2EI6A 5FPSA 2J9NA 4AORA 1AUJA 1JRSA 1G2LA 4TPYA 4AX9H 1LQDB 1LMWB 1D6RA 3HK3B 4UFGH 5EXNA 4Y8YA 3A86A 4QT8C 1FUJA 2HRVA 3ZZ3A 3EYDA 2A31A 1QRZA 1CT0E 1GI7B 3TGIE 1SLVB 2F9OA 6CHAC 4JK5A 2XBYA 5EW2H 1MKXH 3SUEA 1N8OC 3UR9A 3MU8A 3RMOH 1MCTA 1C1VH 4CHAB 1QL7A 3KQBA 5BPEA 1W2KH 2OTVA 5HXFA 3QWCH 2AIQA 4J1YA 2Y5HA 4OGYA 5L6NH 3VGCC 1C1TA 1EPTB 2R0LA 5GPIB 1ELBA 1ZZZA 1ZRKA 2FPZA 3V3MA 1Y5BT 3BG8A 4X6MA 3ZZ4A 2HLCA 1EZUC 4CREA 1B5GH 2RCEA 1D3TB 1GJ8B 2FOMB 1DOJA 3PO1C 5GDSH 1O2RA 4B75A 2BY7X 1TONA 3ZVBA 3ITIA 4X8VH 1PPGE 2CV3A 1RTLA 4JYVH 1F0TA 2BMGB 2EC9H 1UVSH 1C1WH 2HNTE 1NRQH 4RKJB 1HAZB 2IJOB 2FI4E 3OX7U 1IHSH 1K9OE 2RG3A 1GHAF 2DUCA 1PPHE 3GY2A 3NPSA 5DP7A 3UNQA 3MNSA 2VWOA 3MHWU 1J17T 2LPRA 1KXDA 2RDLA 5FPTA 4DGJA 1ZGVA 3QO6A 1O34A 1C5PA 4D9QA 1PYTD 3RLWH 1H9HE 1ZTLA 3M36A 1AUTC 2PWXA 3AW0A 3GYLB 3NUMA 1P2MA 1JBUH 1QURH 1SFQB 2A7CA 2BLVA 1GBTA 3SU3A 2ZDAH 1SLXB 4NFFA 1W0YH 1KDQB 1UJ1A 1QJ6B 2ZGJA 1EX3A 1BMMH 4AGKA 4IC5A 3I78A 1C2IA 3UFAA 1ESTA 5I25A 3TJUA 1ANCA 2H5DA 1F0RA 1KXCA 1JOUB 4X1SU 1UTNA 4F49A 1AB9B 1DLEA 4JZEH 1BQYA 3UWIA 2C93B 2HOBA 1FN6A 1NROH 3GCTF 4X6NA 3T2NA 5F6MA 1SLWB 2JKHA 4AFZA 3MI4A 1O5DH 3SU5A 2R2MB 2FESH 2BD8A 1IHTH 3SBKA 4RSPA 3SZNA 1T4VH 1O2GH 4AN7A 2TGTA 1GBCA 2ZCHP 3ATWA 4XBDA 3UQVA 2P16A 3ESTA 2WPMS 1LTOA 4YOIA 2AFQB 2ZFSA 4LK4A 2ASUB 2G4UA 1ELDE 3D49H 1P2OA 2FLBH 3LT3A 4K8YA 1H4WA 1O5BB 1DWBH 4NG9H 1C2GA 2H9EH 2QXHA 1K1NA 1TNGA 1UK3A 1C5LH 4NIYA 4IGDA 4AGJA 2BB4A 4X8UH 3MO3A 4M7GA 3RMMH 1LVOA 1HAYB 2ZTXA 3PLPA 3M3SA 1O0DH 2NU0E 4ISHH 1DM4B 2TRMA 4X2WA 2JH0D 1LHDH 3CP7A 1EPTC 2XXLA 3LGUA 3LGYA 1EB2A 1DSUA 4OS5A 4WMFA 3LOXA 2AMDA 1O2KA 2ZP0H 3HGPA 1GG6B 2D26C 1YLCA 4MPWA 5EU8A 1Q31A 5TJXA 2PKAA 4Y79A 1SGQE 2ZFTA 3MH6A 1H8DH 1DSTA 2PKSB 1C4V2 3S7KB 3A8CA 1AU8A 2BVXH 5E0JA 4E06H 1AWFH 1HJ8A 4MPXA 1ABIH 3S9CA 2UUKB 1TBZH 1P02A 4INHA 4A6LA 1DDJA 2Z3CA 7GCHG 1TFXA 3T25A 2G5VA 3Q00A 5A8XA 6GCHF 1YPMH 3P8NA 1TGNA 4ABEA 1ELAA 3P8OA 5J4SA 1ZSKA 4BXSA 1OKXA 2LNCA 1HAVB 1O5FH 1W7GH 1KDQA 1HJAB 1B0EA 1TMUH 4O97A 4ZXYH 3W94A 5IYTA 2O8TA 3PMAB 3Q3XA 1TRMA 3PLBA 3R3GB 1FLEE 1FIWA 2NWNA 2H9TH 3U69H 1QGFA 3LPRA 1PQ8A 3NZIA 1EJAA 6GCHG 3A7VA 3UUZA 1UTMA 3OY5U 4WY3A 2VB0A 1QB6A 3UTUH 1C5RA 3SQEE 2FYQA 1A5GH 3LC3A 1L1JA 1QR3E 1SR5C 3NWUA 3RXQA 3RXLA 1V3XA 1F7ZA 1UTQA 1ETSH 3KQDA 2PSXA 4CBNA 1FXYA 1O3KA 1AMHA 1ELTA 3BTEE 1BZXE 1J15A 2Y7ZA 1PFXC 4YLUA 4FUHA 1YPEH 4WJG2 5C2ZA 1DFPA 3RXDA 1A46H 4AG1A 1GCTB 2VIVA 1O2JA 3Q76A 1CHGA 4NWKA 3GDVA 1BJVA 1V2PT 4YOJA 1IQIA 3SU0A 5A0AE 4BXWA 1QQUA 1QA0A 3TJNA 2WUBA 4MQAA 3STJA 3LH1A 3BTDE 3IWMA 2JH6D 3SGBE 3SV8A 2KAIB 3A87A 3GY5A 1FI8A 1UHBA 1O2LA 2R2WU 1QJ7B 3O8BA 3SU1A 4TWWA 1O35A 1PPCE 1GMDF 1GBJA 5GXPA 1C5NH 1Y3VA 1ZYOA 4NIVA 1B7XB 2PFEA 3SGQE 4DVAU 5HYOA
chains in the Genus database with same CATH superfamily
3A8BA 1AO5A 1UVOA 1D4PB 1ESBA 3HKIB 4GUXA 1AFEH 1SGFA 1C2MA 1O2WA 2J92A 1NU7B 4CRCA 1CT2E 2BX3A 2J4IA 4YM9A 1V2NT 1SQAA 3TIUA 2BTCE 1AQ7A 1GG6C 2KZ4A 3M3VA 1PQAA 1C5WB 2ZGXH 2FS9A 1O3PB 2QYIA 1P12E 1Z6EA 1V2LT 3F2HA 2IOTA 1P06A 5K0HA 3T27A 1P09A 2ZDKA 3RXKA 1GI3A 1UK4A 1CHOG 1SOTA 2QXGA 1BRUP 2ZECA 1FDPA 4JZFH 1AWHB 4LZ4B 3I29A 1Y8TA 1EASA 1FX0B 1GBAA 4WMEA 2Y5FA 1K1MA 1G37A 4AG2A 1GHWH 1N1LA 1GVLA 1WXRA 1XUKA 5JB8S 3UB0A 3PTBA 1ZJKA 4OS2A 1P04A 2NU3E 4MTBA 1GCTC 1HDTH 2NU1E 1HV7A 3VPKA 3W95A 1P2IA 2PUXB 5EXMA 1TGTA 2AGEX 1UTJA 1CSOE 1F92A 4IMQA 1C5TA 2BY6X 4B2BA 4H6TA 2TGDA 3CENA 4U2WA 4E7NA 3PB1E 4ZUHA 2J5UA 4MPUA 1G3EA 4Z0KA 1ZHRA 3MNXA 1TNJA 3D62A 2A0QB 8GCHG 2UUJB 3RUOA 3T26A 3L3TA 1TQ0B 3TVJB 1GDUA 3PRBA 5EJZA 1DWDH 2ZTYA 4ZROA 3RXVA 2SGEE 3BEFB 2SGQE 1NFUA 2GP9B 3P6ZB 1K1PA 1IQGA 4AZ2B 3SU6A 1TPPA 1LVBA 1E0FD 1T8NA 4RT0A 2Z7FE 1O33A 3E3TA 3RP2A 3UAIC 1GBIA 3OTPA 2BDBA 1PYTC 5LH8A 4XOJA 3B8JA 1DITH 1GI5A 3RM2H 2W6ID 4INLA 5DGJA 2P3FH 3EA8A 1VJ9U 1JRTA 1OP2A 3ZV9A 3T29A 1S0QA 1OXGA 2NU4E 3PMHB 2VIPA 5T6DA 4X1QU 1ELGA 1AI8H 3M3TA 3ENSB 3D23A 3RXSA 1O3EA 4BOHA 3GCOA 1YM0A 2QC2A 3SQHE 1ZHMA 4NZLA 1VZQH 1BTZA 4H4FA 2ALVA 4E7RG 3FP7E 2ZG0H 2OP9A 4NFEA 1TPAE 1ZPCA 2ZU1A 3KIDU 3BG4B 3K9XB 5EJ1A 2XC4A 4K69A 3ZIAD 5KEDA 1HAXB 1HYLA 1C5VA 3F9EA 2Y5GA 3VXFH 2FOGA 4X1PU 1AHTH 4THNH 2V6NA 4OS1A 4DOQA 3RXOA 3H7OA 1MKWK 1GPZA 2ZCKP 4Y7AA 1GDQA 2XW9A 2Z9LA 5CE1A 3BEUA 4WF8A 1QHRB 1P2QA 2IN2A 5JYIA 1QY6A 3ZZ5A 1MUEB 1SBWA 3BN9A 1H9IE 2ODYB 1NU9A 4VGCB 4ISOA 5T1VA 1GMCG 3F9GA 3O8DA 3SO3A 5CHBA 1X7AC 2BHGA 2Q1JA 3OYPA 4KTCA 1DLKB 3RMLH 3FVFB 2QF3A 4YZUA 8KME2 4FXGH 4GAWA 2HPQH 1LQEA 1O5EH 2WYJA 4Y10E 4K60A 2XBXA 3RLYH 4Q2KA 4I8JA 1HUTH 4ABFA 1TMBH 4YESB 4ABBA 4K2YA 1AKSA 2C8YB 3SNBA 3TJOA 2ZDNA 2A5IA 1W14U 1FY3A 2PR3A 4J2YB 4BAKB 1L1NA 2ZPRA 4MNYA 1BBRH 5ESBA 2OUAA 1TLDA 1Z8IB 1HAOH 2C8WB 1BRCE 3RXUA 1FN8A 1NRRH 3V12A 4B71A 1HJAC 1FY8E 2ZKSA 1C2KA 4NA8A 3IG6B 1LVYA 3FANA 1E37B 2KCAA 4IMZA 4O3UA 2L74A 2XWBI 2HNTF 1NM6A 4PROA 1S0RA 1T8LA 1FJSA 2O8LA 4O9VA 5J4QA 1TX8A 1LVMA 1EXFA 4AYVB 4UFDH 3ZZ6A 3MTYA 1HPGA 1SGIB 3MNBA 2GVFA 1O3JA 3RXAA 1GI1A 3SNCA 2EQNA 3VEQB 1SGDE 4ZXXH 2BY9X 1BJUA 3MH4A 1CBWC 4XFQA 1MTNB 2WV4A 3CS7A 4B73A 3M5NA 1GBFA 4D76A 3SJ9A 1ELEE 3BTQE 2ANYA 1RD3B 3MO6A 2P94A 4HGCA 1FAXA 3A85A 4JYTA 1K28D 1T8MA 2BD2A 4A1VA 1SKYE 1P3CA 1JWTA 1YP9A 4BANB 1GBMA 5T3HA 5TCCA 2VU8E 4DURA 2BDAA 3ZVCA 4BAHB 3RXRA 1V2UT 1O3FA 1XUJA 4K8BA 1Y5AT 2J97A 4LZ1H 3QZQA 2ALPA 1BBRE 5B6OA 3N7OA 1GVZA 2V0BA 4X0WU 1C1SA 2I6QA 1BTWA 4B2CA 1O3CA 3GS9A 2VVCA 1D9IA 3MH7A 3GCTG 5DP4A 1FY5A 1KLTA 2QY0B 1HXFH 1FPCH 4Z6AH 4RI0A 1CO7E 2RFKC 2K8IA 1L1GA 2W3KA 2XOKD 3KQCA 3SUFA 3K6YA 4DJZB 2PKAB 2TIOA 2FO9A 4WVPE 1TNKA 2P59A 1ZR0A 5E2PA 2HALA 2HWLB 2ZWLH 1KSNA 1AGJA 1EZSC 1W10U 2WV5A 2XCNA 4KTSA 5JB9S 2FOAA 5JBCS 1C2DA 1GMHG 1NRSH 1YPHE 2BXUH 4ZMAH 4BAOB 1GI6A 1QL8A 1HAIH 4ESTE 5F8XA 1GHZA 2D1JA 2PHBA 1GHAG 2FMJA 1SVPA 1QBVH 1HJ9A 2VVUA 3C27B 2QCYA 2YNBA 2IJD1 4UEHH 3T28A 5EODA 2SGDE 3UWJH 1P05A 3SORA 4DIHH 2ULLA 1MTWA 1GJAB 3FZZA 3A88A 2SGFE 3MMGA 4NA9H 5AFYH 7KMEH 1ZMJA 1O2HA 5H4IB 2CF9H 2QF0A 4X2VA 5C3NA 6ESTA 3QDZB 2Z6BD 1EAXA 1P2KA 4AFSA 4AYYB 1O5CB 3K65B 2QGRA 3A7ZA 1Z8GA 1O3AA 1C5MD 4WH6A 3UPEA 2W3IA 4BAMB 4WMDA 3OY6U 1EJMA 3KQEA 1YBWA 2VIWA 1UCYE 2GDDA 1C1PA 1QBNA 2GZ9A 1CA0C 1D6WA 1WCZA 1HCGA 3LGVA 1BTXA 1Y59T 1ZTJA 1XMNB 2HVXA 1GDNA 4FUIA 4SGAE 1L4DA 1BTUA 3E8LA 2O8MA 2VBCA 2YMSB 5JPMH 1E38B 1IQFA 1BTYA 1C1NA 1GJDB 3MH5A 3DCLA 1ELFA 1C1QA 5LPEA 4KELA 1C2FA 1WOFA 3RC6A 2VH0A 3PROA 2G81E 1NFXA 3K2UA 4O3TA 1EAIA 1P10A 4I8LA 4INKA 1SQTA 1GHXH 1C1UH 2HNTC 1SG8B 2J2UA 3GCHB 4OS7A 4BTIB 4BAQB 3GICB 2BX4A 1OWHA 3HATH 1N6YA 4TT3D 1SMFE 2IPHA 5FHTA 1DUEA 5EG4A 1GHBF 4U32A 1DVAH 4VGCC 1UHBB 3EQ0H 4FU9A 3NKKA 2WPDD 3GOVB 1C2LA 1FMGA 5GIBA 1YC0A 1VCWA 5C67A 1F5RA 3ATLA 2PUQH 3F9HA 1QBOA 1TOCB 2KFWA 1ESAA 2ZEBA 3N7DA 4ACBA 1A2CH 1M9UA 1P11E 4LXBH 5A0BA 3UR6A 2VWLA 1LO6A 2V3HH 1YY3A 4Q4LA 3GY6A 4JZDH 3UOPA 3RXPA 3E91A 4Y6DA 3EE0B 1NFWA 4ZCNA 1RJXB 1O2IA 3TNTA 1MKXK 1CA0B 2AEIH 3W1EA 1O3HA 1SOZA 2PGQB 1CA8B 5DP8A 3L6PA 1W7XH 3FO8D 1DWEH 1BCUH 1S85A 2QIQA 2F83A 3MFJA 3ODFA 3HPTB 1BMFD 2VIDA 3KYGA 1TB6H 1XUHA 4HFPB 3MWIU 4CH2B 2A32A 4Y11E 5DP5A 1Z1JA 2F9UA 5FAHA 2AMQA 1IOEA 2OLGA 1HFDA 3ZVEA 4ZHAA 2GT8A 1A4WH 2GMTB 2JETC 1QA7A 5ESTE 4D9RA 1BITA 2FIRH 1TGCA 3MU0A 4ISIH 2O9QA 5GJ4B 3VB3A 3ZYDA 1GJ7B 1J9CH 2Y7XA 2KCOA 3GISB 1FNIA 5T6FA 3SJ8A 5E2OA 4KP0A 5GCHG 2K1QA 1KXEA 1MTUA 1EUFA 1ZLRA 2AGGX 1KTTB 1IQJA 1XXFA 1Z1IA 3R0FA 1CGJE 2PV9B 1HXEH 4AB9A 1T32A 1T31A 1O2MA 1WUNH 1MTVA 3F9FA 2JJ2D 2V7QD 1Y3YA 4TY7A 1HGTH 2TPIZ 4I32A 5A8YA 5B6LA 2BDYA 4UD9H 1RTKA 4NSYA 2WUCA 4ZKNU 2XBVA 3LJOA 3S9AA 3KGPA 1LHEH 4NZQA 3VGCB 4F4OC 1TPOA 1Z7KA 1RIWC 1K22H 1XVOA 2Z9KA 3M5OA 3BSQA 4I31A 5DN6D 4I8KA 1ZMLA 1GJ4H 2KCPA 3A80A 1QNJA 1TIOA 1BRBE 3DSOA 4ZKSU 1PPBH 3BTTE 3OAAD 1ZGIA 4D8NA 5HM2A 1L2EA 1GBKA 1H9LB 5C1UA 1XXDA 1GJ5H 3TH4H 2UUYA 2GZ8A 1IQKA 1JIMA 3PLKA 9LPRA 1TX6A 1VR1H 3PM3A 4R0IA 1BMAA 3SV6A 1GI2A 4X2YA 1EJNA 2J94A 2VNTA 5C20A 1CGHA 2ZGBH 1ID5H 4MPVA 2GDEH 5EGMA 4X8TH 4DIIH 3SGAE 2CK3D 3E6PH 1GWAA 3SNDA 3BF6H 1O3NA 2FS8A 6LPRA 3JZ2B 3AAUA 1BMLA 3F68H 3A7WA 1FY4A 1V2TT 3GY3A 2ODPA 2L6OA 1ZTKA 4Q7YA 2EI8A 2NU2E 3FN8A 1LDTT 3DUXH 4DCDA 2QXJA 2G51A 1ELCA 2A45B 1FPHH 1UO6A 3RXMA 1XX9A 2KAIA 3C1KA 1YWUA 4OM9A 4DT7B 4Y0ZE 2RA0A 5FCKA 3SOSA 4GHTA 5KECA 1V2WT 1V2OT 1W8BH 4CHAC 1V2QT 5AHGH 2XRCA 1TE0A 5HGGA 3ZZ8A 4JK6A 1KYNA 1WU1A 3A8AA 1SPJA 1WTHD 1MQ6A 2H5CA 1OS8A 3BIUH 1QIXB 4BTTB 3Q3YA 2R0KA 1O2YA 3VG8A 4AB8A 5EPNA 2RDEA 4ABDA 1NPMA 1OP0A 3LC5A 4X6PA 2WPIS 2BM2A 2W6JD 3JZ1B 1O2PA 1LPZB 2EY4C 1D3DB 4CRGA 1SGYE 4P00A 2ZPSA 1AKSB 2VH6A 2HGTH 2WSSD 5PTPA 4B6EA 2C4FH 2QA9E 5F8ZA 3UIRA 2BZAA 1ORFA 1A61H 2A5KA 3OEHD 5HIZA 1LHCH 3FP8E 1VKYA 2BD3A 1ZHPA 3BTFE 2BVRH 3L33A 1EZXC 1LPKB 2ODQA 3S0NA 1SB1H 2BD5A 1NS3A 2XC0A 1O31A 5EPYA 3F3BA 4NWLA 4IN1A 3B23B 2C8ZB 2PTNA 2ZC9H 2AGIX 1HAGE 1GI4A 5T6GA 1MCVA 1AFQC 3P70B 4B74A 4Q63A 4LOYH 3RC4A 5C17A 5JBBS 4FUDA 3RC5A 3GDSA 3E90B 2OK5A 4ABAA 3VB4A 1BTPA 2FI5E 1C4U2 1HB0B 1O3BA 2BD4A 5E0HA 4MVNA 3ZZAA 3ZZCA 2Z9JA 2H9HA 1NRNH 2GCTC 2ZF0H 2QF4A 3PMJA 5FXLA 3RXEA 3RM0H 4X6OA 2FX6A 1NFYA 1G32B 4Q7ZA 2FX4A 1YPJH 3OSYA 4X2XA 1G3CA 3FFGA 1OWKA 1WAYB 3SV2H 1AE8H 1GI8B 3KQ5A 3VB6A 3U98H 1IQHA 4NCYA 1BHXB 4UFFH 4Y8ZA 1GMDG 1LHGH 1TALA 1JMOH 1OOKB 1ZMNA 2FEQH 1ETRH 3ZZ9A 3E0NB 3UQOA 1G2MA 1HRTH 3LJJA 1TA6A 2QV1A 3SHCH 1T8OA 5BRRE 3LONA 2XCFA 2YMSD 1EQ9A 1OP8A 1GI0A 1XUGA 2PP6A 4MG3A 3EDXB 3LH3A 2O8WA 3GDUA 2AYWA 4ASHA 1GBEA 2F4LA 1DY9A 1UTKA 2ZGHA 1H8IH 1Z6JH 1BBRK 5C1YA 3KN2A 2JH5D 1K1IA 1Y3WA 3D65E 3DT0H 2UWOA 1O30A 3OE7D 1EATA 1G3BA 1BB0B 5C0UA 1BA8B 2GT7A 1D3QB 1NESE 1P01A 5GNDA 4XSKU 1EOLA 1YCPK 2UUFB 2ZHFH 2BLQA 2WPJS 1VCPA 4Y0YE 1T4UH 1O39A 3E0PB 1C1OA 4WWYA 4CH8B 1N6XA 4JYUH 2G4TA 1PJPA 1WQVH 1FY1A 4K1SA 4RKOB 1QJ1B 1C1MA 7LPRA 3M37A 1A0JA 1EOJA 4AFUA 1QL9A 4XE4A 3BTME 5DSFA 2PW8H 1MQ5A 1SL3A 2XNIA 1S6LA 3DHKH 3KYFA 3BIVH 3TU7H 4IN2A 3OU0A 2BOHB 3QLPH 1ZPBA 2F9BH 2H6MA 5FBEA 1AE5A 2A5AA 1SGTA 3LIWA 1P2NA 3ATIA 1UTOA 3A7YA 3NK8A 1UVPA 1HIAB 1SGEE 2OCVB 3UREA 5C5OA 1O2OA 4K5ZA 2BQ6B 4P02A 2C90B 3RU4E 1LHFH 1O2QA 2ZDMA 2A2QH 2XWAA 1GHBG 2ZPQA 1HNEE 4OGXA 3ZVFA 4DT4A 1S82A 1TRNA 1TA2A 3QGJA 2GCHF 2TBSA 2KX4A 3MU1A 4NIWA 3URCA 4DY7B 2VWMA 9ESTA 3AAVA 3BTHE 1GHVH 8GCHF 5SGAE 1V2ST 3U8OH 3EA7A 1TQ7B 1TNHA 2WPHS 5A09A 3ATMA 3M5MA 5DP6A 3SI3H 1W11U 3SU4A 3MU4A 4XRNA 1AZZA 4BTUB 1O2TA 2G52A 2VIQA 4U30A 1EPTA 3KNXA 1MTSA 1T7CA 2R3UA 3E1XB 1TGBA 2TGPZ 3VB5A 1O38A 2SNWA 3ZV8A 5FCRA 3TGKE 5L30H 1O5GH 3Q3KA 4TYDA 1V2KT 5EQQA 4GCHF 1C2HA 2C3SA 1SSXA 5A8ZA 3EAJA 1YCPH 3F6UH 1E79D 1ZRBA 1XUFA 5TCAA 4ZAEA 2OQUA 4K3JA 1TX7A 2CHAC 2FOEA 2BDIA 2FYRA 2CGAA 3VB7A 3STIA 1RRKA 2ZGCA 2AMPA 3DFLA 1YPKH 1MU6B 1GJCB 5DP9A 4CBOA 3URDA 3HK6B 1J14A 2BY5X 3T62A 1WSSH 1A0LA 2GGVB 3LGWA 3GCHC 5ETXA 5DJ7A 4F48B 2STAE 1DWCH 1UTLM 1GJ6A 4IS5A 5JBAS 2ZDVH 2QN5T 3OTJE 1GBDA 3SUGA 1KXFA 1MH0A 1PPZA 1Z8RA 2Y82A 4X8SH 2W5EA 3EGKH 3CS0A 1TABE 1CQQA 1NO9H 3F2FA 5EQSA 1VITG 2VVVA 2FOFA 3M35A 4MNWA 5AFZH 1LPGB 4MNXA 2ZTZA 3HKJB 1O3IA 3GY4A 4WH8A 3DD2H 1OWDA 1THRH 1G3DA 2BOKA 3S9BA 1GJ9B 3O8RA 4HZHA 4AFQA 1IQNA 1O3DA 1ELVA 3RXJA 1Y5UT 3TK6A 2B8OH 4YT7H 1BRAA 1P03A 2GMTC 3V7TA 3LGTA 2BDGA 2OXSA 1K1OA 1BOQA 5K7RA 1DX5M 3KEEA 2GD4B 3RXFA 4AC9A 2AERH 2W7SA 1FAKH 2Z3EA 5DPAA 1ANEA 6CHAB 1CU1A 4U01A 1BHXF 4I7YH 4YOGA 1EP5A 1VGCC 1AZ8A 1C2EA 1ZJDA 1ZPZA 4IW4E 2BD9A 4XBCA 4UONA 2BLWA 1SGRE 3A81A 2Y81A 5EIYA 1WBGB 1CVWH 2VGCB 1B0FA 2R3YA 1O3OA 5F8TA 5JBTA 1AIXH 2ZIQH 4JCNA 4KKDA 5HMAA 1O3GA 1YGCH 2OBOA 4Q7XA 1DY8A 2ANWA 4IBLH 2Q6DA 2XYAA 1E1QD 5IK2D 1G36A 3FOAA 1FIZA 5IDKA 1EZQA 5L2YH 2AHME 3F0OA 1W0JD 2JIZD 2ZHEH 2WZQA 1QQ4A 1K21H 1XM1A 3IITA 3M7QA 1F2SE 2QXIA 1C2JA 2GCHG 4Y8XA 2VGCC 2ZU5A 1DT2A 3ATKA 1P0SH 1SC8U 2CHAB 3QZRA 1Z71A 7GCHF 1TBRH 3SU2A 1Y3UA 2J38A 1HLTH 1UK2A 2GV6A 2FZZA 3SW2B 2ZCLP 4JZIA 1UVUH 1ANDA 1SI5H 3O8CA 1V2VT 2P3TB 2ZA5A 2GZ7A 3TITA 4ABJA 2C8XB 3P8FA 4FU7A 4Y7BA 2BQ7B 1TRYA 3I77A 2V3OH 3ELAH 1KMHB 1NC6A 3FZDA 1INCA 4A7IB 1A7SA 1AFQB 2F91A 4JMYA 2G00A 1K1LA 2FLRH 2BDHA 4GCHG 1G9IE 1TWXB 1GVKB 2ZI2H 3GYMA 3PV2A 1UMAH 1FONA 1VJAU 1EAWA 2BVSH 3TPIZ 3FKSD 4F55A 3VFEA 2ZNKH 3ZVAA 1C5SA 2FM2A 3BTKE 3FAOA 1O2SA 4CRDA 4K1TA 2O8UA 4GLYA 2ZHWH 1KIGH 1O2VA 3P92A 1QB1A 1AB9C 1PPEE 1E35B 1A5IA 2F9VA 1TAWA 1EFRD 1ETTH 2JDID 3GCNA 3M61U 4IC6A 3SZEA 4KGAA 4NSVA 4DG4A 3UNRA 1NN6A 1F5LA 1MD7A 1DICA 1C5ZB 2ZU2A 2AH4X 2W7UA 5EXLA 4OS4A 5JDUB 3BEIB 3HGNA 3T5FH 2Y80A 2JETB 2V3MA 3ZZDA 1HIAA 1O37A 2VIOA 1YYY1 4YT6H 2AS9A 4ABGA 2GTBA 4M9FA 5LPRA 2SGPE 1VGCB 4ZKRU 1NT1A 1A5HA 5E8EH 3TK9A 1GGDB 4FUFA 4FVDA 4GSOA 5DK1A 1DANH 4FUBA 4B6FA 2BLOA 4Q80A 2M2AA 4H6SB 3SJKA 1OPHB 1W12U 4YO9A 3SUDA 1U6QA 1MAXA 1O2NA 2ZHDA 1SHYA 1THSH 1A3BH 1J8AA 3P8GA 8ESTE 2V35A 1YKTA 2ESTE 1C5QA 3LGIA 4FVBA 2Z3DA 2ZO3H 3MOCA 1IAUA 2OD3B 4ISLA 1KXBA 1ARBA 3EE7A 2ZFFH 1BTHH 1OHHD 5HIYA 3SNEA 2BYAX 4CRBA 5C1XA 5FX6A 1F0UA 1WYKA 1WV7H 2ZQ2A 4ZKOU 1XUIA 2WPKS 3M5LA 5HKKD 2ZFQH 4FUEA 5CMXH 1Y3XA 2B0FA 3DFJA 5A0CA 3N7EA 1RIWB 1XKBC 3ZVGA 3N99A 2SFAA 3GY7A 3DSGA 2OC1A 1SGCA 3UOUA 1TOMH 1NZQH 5EW1H 5FX5A 1ARCA 5L2ZH 2VJ1A 4MDSA 2PSYA 3B9FH 4O03A 2J95A 4GPGA 1UCYH 1S6FA 4B76A 2PTCE 3QTOH 1S5SA 1QRWA 2CXVA 2D8WA 2B9LA 1W13U 2Q6GA 1C9PA 1JIRA 1QB9A 5FPYA 1ACBE 5C5NA 1XKAC 1MBQA 1SQOA 3H5CB 5EJLA 1W3CA 4ZH8A 4ZHLU 3V0XA 1PPFE 3RXTA 1EKBB 1E36B 2PKSC 4ACAA 1QTFA 3S7HB 3H7TA 5GCHF 4CRAA 2J98A 3VXEH 4YTAA 4KTUA 1V2JT 2ZDLA 2TGAA 4FUCA 2FOHA 2OC8A 3SHAH 1L0ZA 2F3CE 4UDWH 1OYTH 3RXGA 1AVXA 1VITH 1A0HB 1P3EA 1O36A 2XTTB 3SI4H 5EQRA 1GHYH 1O2ZA 1TNLA 2A7HA 3BG4C 1A3EH 3AASA 2B5TB 5DO4H 1LKBA 1MMJN 1O32A 1TNIA 1K2I1 1YPLH 4A5TS 3TH2H 1MAYA 2GJGA 1VCQA 2A4OA 2P95A 1C4Y2 2G55A 4XDEA 1GBBA 1WTGH 4ISNA 4MLFB 1A1RA 1UCYK 1DUAA 2ZU4A 2B7DH 3WY8A 4MNVA 1DE7H 1GMHF 3AVZA 1GL1A 1Z8JB 2ZQ1A 2WPLS 2VINA 1IQLA 1P8VC 5LPFA 1ZSLA 2ZFPH 1HBTH 3U9AH 3NCLA 2RA3A 2YOLA 1MD8A 2FDAA 1O2XA 1C9TA 1EAUA 2Z94A 1MU8B 1AVGH 4YLQH 3S69A 1AY6H 4H42U 1CT4E 1KLJH 2HLDD 3OFND 2BQWB 1UTPA 3MNCA 4YXWD 3GY8A 3PV5A 2OBQA 1NTPA 1GBLA 3RDZA 1G30B 2OQ5A 2AIPA 2ZZUH 4B2AA 2FTMA 3A83A 3PWBA 3BTWE 2A2XH 2F9NA 4WXVA 4B1TA 1J16A 3RMNH 1O5AB 1TYNA 1V6DA 2CMYA 1P2JA 3AW1A 1V2MT 4R8TB 3BV9B 4DW2U 4OS6A 2H1UA 4NIXA 5A2MH 5DKMA 4FU8A 1QCPA 1SGNE 1YF4A 1PQ7A 1WQSA 4CR9A 3U1IB 3QK1A 3A82A 2FP7B 1W0KD 2CJIA 4X1RU 3RU4D 3KF2A 1HAPH 3SJOA 1MABB 1K0HA 1OX1A 1BT7A 3NRLA 1WDIA 2FWWA 1P9SA 1DXWA 2ILNA 3A7TA 2Z9GA 1H8HD 3SV7A 1D3PB 2JJ1D 5CHAB 4SGBE 2F9PA 3A84A 1LCYA 3M7TA 3ODDA 1PQ5A 3FP6E 2UWPA 4TY6A 4Y76A 1O2UA 1SHHB 1OWIA 2YNAA 1ANBA 1OYQA 2FOBA 3KCGH 3QTVH 1Q2WA 1LKAA 1RXPA 2ZHQH 2WHXA 4ABHA 4BNRA 3U1JB 1HAVA 3QGNB 1RFNA 2WYGA 3TLOA 3U8TH 1THPB 3P95A 1CE5A 3TGJE 1C5UA 1RTFB 1TGSZ 2KCYA 2QF5A 8LPRA 1GI9B 2IPQX 1DXPA 3U8RH 1O3MA 2BZ6H 1GGDC 2G5NA 3KHVA 4TSFD 5I46H 3PTNA 5CHAC 5AF9H 2J34A 1S83A 3LKWA 2I6SA 2FXRA 1OWEA 5G4BA 5ABWA 2SGAA 1JXPA 4HI3A 4NA7A 1V2RT 3A8DA 2OC0A 4A92A 1K1JA 2THFB 2ZU3A 1DS2E 3TH3H 2GKVE 2ANKH 1COWD 2EI7A 3M7UA 1SGPE 1NRPH 3TK5A 1C5YB 2H2ZA 3RU4T 3RXBA 5LGOA 2WINI 2XBWA 1NY22 2F43B 1UW7A 3EA9A 1QZ8A 1YPGH 1ABJH 4FETA 4TWYA 3K6ZA 1BIOA 1C5XB 2HPPH 4X1NU 2UWLA 2P8OB 3MO9A 1GMCF 1C1RA 2Y6TA 5C94A 2ANMH 3BTGE 1GCDA 1TBQH 4CR5A 1QRXA 2FTLE 1AVWA 1P9UA 2A4QA 3ZZ7A 1GL0E 4AOQA 1RS0A 2DE9A 3QUMP 3A89A 3MYWA 2FI3E 1S84A 2BDCA 3WWBA 1N8OB 5AVDA 3PWCA 3TNSA 2PLXA 2GX4A 2R9PA 3RXIA 3SV9A 2CF8H 4GVUA 1GJBB 2OINA 1MBMA 1FZZA 4FUGA 1P57B 2KM0A 4WXIA 5GWZA 1IQMA 2BY8X 4ASUD 4UE7H 1W0ZU 3PV4A 2A7JA 5E0GA 2G8TA 5F03A 3F2GA 1CBWB 1KY9A 4JZ1A 1YLDA 4FUJA 3RXHA 1MKWH 3UNSA 4HTCH 4GHQA 3QN7A 1O3LA 2EA3A 1NBME 4E05H 3ZYEA 3UY9A 4NGAH 3PO1B 1F5KU 2XC5A 1AN1E 5F53A 1FQ3A 1MTNC 4UFEH 1CHOF 3Q77A 5EOKA 3SJIA 2STBE 2DE8A 2M5TA 1GBHA 1F0SA 1Q3XA 4FOUC 4ZHMU 2Q6FA 2GCTB 3LU9B 1MZDA 2EEKA 3MU5A 1TMTH 1AD8H 2CN0H 3F1SB 4I8GA 4XD7D 3TJVA 2BD7A 3A7XA 1BDAA 1MZAA 2FOCA 3OEED 1S81A 1EB1H 3DA9B 1FV9A 1TPSA 1UVTH 4Y71A 1KTSB 2FODA 2P93A 2PGBB 3P17H 4ABIA 4RN6A 4A1XA 1HAHH 2GV7A 5FBIA 1ZSJA 3PMBB 1VITF 2A4GA 1RGQA 1XVMA 2LP6A 3ZZBA 2W26A 3RXCA 1L4ZA 1ZOMA 4XBBA 5CDFE 1OSSA 1E1RD 2OC7A 5HM9A 2P8OC 3NXPA 1E34B 3SN8A 2VWNA 2A1DB 4K1EA 3KL6A 4CRFA 3V13A 3ZVDA 2P3UB 1H1BA 1SLUB 5DP3A 3WW7A 1C5OH 2A4RA 3MQKC 1CGIE 1YCPM 2D2DA 4TPIZ 1KXAA 1QFKH 1YPHC 2QAAA 3LDXH 1DPOA 4D7GA 1KLIH 4D7FA 1S6HA 1SGFG 1SFIA 2Z9IA 4HG6A 2ZFRH 5DG6A 3SNAA 7ESTE 1IQEA 1EP6A 3E16B 2BXTH 2SNVA 1OWJA 4I33A 2WV9A 3QX5H 4A1TA 1BMNH 3G01A 3PYHA 1BUIA 4I8HA 2EI6A 5FPSA 2J9NA 4AORA 1AUJA 1JRSA 1G2LA 2K0QA 4TPYA 4AX9H 1LQDB 1LMWB 1D6RA 3HK3B 4UFGH 5EXNA 4Y8YA 3A86A 4QT8C 1FUJA 2HRVA 3ZZ3A 3EYDA 2A31A 1QRZA 1CT0E 1GI7B 3TGIE 1SLVB 2F9OA 6CHAC 4JK5A 2LELA 2XBYA 5EW2H 1MKXH 3SUEA 1N8OC 3UR9A 3MU8A 3RMOH 1MCTA 1C1VH 4CHAB 1QL7A 3KQBA 5BPEA 1W2KH 2OTVA 5HXFA 3QWCH 2AIQA 4J1YA 2Y5HA 4OGYA 5L6NH 3VGCC 1C1TA 1EPTB 2R0LA 5GPIB 1ELBA 1ZZZA 1ZRKA 2FPZA 3SYJA 1Y5BT 3V3MA 3BG8A 4X6MA 3ZZ4A 2HLCA 1EZUC 4CREA 1B5GH 2RCEA 1D3TB 1GJ8B 2FOMB 1DOJA 3PO1C 5GDSH 1O2RA 4B75A 2BY7X 1TONA 4RT1A 3ZVBA 2HVYB 3ITIA 4X8VH 1PPGE 2CV3A 1RTLA 2KR7A 4JYVH 1F0TA 2BMGB 2EC9H 1UVSH 1C1WH 2HNTE 1NRQH 4RKJB 1HAZB 2IJOB 2FI4E 3OX7U 1IHSH 1K9OE 2RG3A 1GHAF 2DUCA 1PPHE 3GY2A 3NPSA 5DP7A 3UNQA 3MNSA 2VWOA 3MHWU 1J17T 2LPRA 1KXDA 2RDLA 5FPTA 4DGJA 1ZGVA 3QO6A 1O34A 1C5PA 4D9QA 1PYTD 3RLWH 1H9HE 1ZTLA 3M36A 1AUTC 2PWXA 3AW0A 3GYLB 2QE7D 3NUMA 1P2MA 1JBUH 1QURH 1SFQB 2A7CA 2BLVA 1GBTA 3SU3A 2ZDAH 1SLXB 4NFFA 1W0YH 1KDQB 1UJ1A 1QJ6B 2ZGJA 1EX3A 4Z1MD 1BMMH 4AGKA 4IC5A 3I78A 1C2IA 3UFAA 1YLNA 1ESTA 5I25A 3TJUA 1ANCA 2H5DA 1F0RA 1KXCA 1JOUB 4X1SU 1UTNA 1H8ED 4F49A 1AB9B 1DLEA 4JZEH 1BQYA 3UWIA 2C93B 2HOBA 1FN6A 1NROH 3GCTF 4X6NA 3T2NA 5F6MA 1SLWB 1SQRA 2JKHA 4AFZA 3MI4A 1O5DH 3SU5A 2R2MB 2FESH 2BD8A 1IHTH 3SBKA 4RSPA 3SZNA 3U28C 1T4VH 1O2GH 4AN7A 2TGTA 1GBCA 2ZCHP 3ATWA 4XBDA 3UQVA 2P16A 3ESTA 2WPMS 1LTOA 4YOIA 4I86A 3WWFA 2AFQB 2ZFSA 4LK4A 2ASUB 2G4UA 1ELDE 3D49H 1P2OA 2FLBH 3LT3A 4K8YA 1H4WA 1O5BB 1DWBH 2YMSC 4NG9H 1C2GA 2H9EH 2QXHA 1K1NA 1TNGA 1UK3A 1C5LH 4NIYA 4IGDA 4AGJA 2BB4A 3DSPA 4X8UH 3MO3A 4M7GA 3RMMH 1LVOA 1HAYB 3CNRA 2ZTXA 3PLPA 3M3SA 1O0DH 2NU0E 4ISHH 1NBMD 1DM4B 2TRMA 4X2WA 2JH0D 1LHDH 3CP7A 1EPTC 2XXLA 3LGUA 3LGYA 1EB2A 1DSUA 4OS5A 4WMFA 3LOXA 2AMDA 1O2KA 2ZP0H 3HGPA 1GG6B 2D26C 1YLCA 4MPWA 5EU8A 1Q31A 5TJXA 2PKAA 4Y79A 1SGQE 2ZFTA 3MH6A 1H8DH 1DSTA 2PKSB 1C4V2 3S7KB 3A8CA 1AU8A 2BVXH 5E0JA 4E06H 1AWFH 1HJ8A 4MPXA 1ABIH 3S9CA 2UUKB 1TBZH 1P02A 4INHA 4A6LA 1DDJA 2Z3CA 7GCHG 1TFXA 3T25A 2G5VA 3Q00A 5A8XA 6GCHF 1YPMH 3P8NA 1TGNA 3AK5A 4ABEA 1ELAA 3P8OA 5J4SA 1ZSKA 4BXSA 2XNDD 1OKXA 2LNCA 1HAVB 1O5FH 1W7GH 1KDQA 3PRDA 5FL7D 1HJAB 1B0EA 1TMUH 4O97A 4ZXYH 3W94A 5IYTA 2O8TA 3PMAB 3Q3XA 1TRMA 3PLBA 3R3GB 1FLEE 1FIWA 2NWNA 2H9TH 3U69H 1QGFA 3LPRA 1PQ8A 3NZIA 1EJAA 6GCHG 3A7VA 3UUZA 1UTMA 3OY5U 4WY3A 2VB0A 1QB6A 3UTUH 1C5RA 3SQEE 2FYQA 1A5GH 3LC3A 1L1JA 1QR3E 1SR5C 5C0TA 3NWUA 3RXQA 3RXLA 1V3XA 1F7ZA 1UTQA 1ETSH 3KQDA 2PSXA 4CBNA 1FXYA 1O3KA 1AMHA 1ELTA 3BTEE 1BZXE 1J15A 3F0PA 2Y7ZA 1PFXC 4YLUA 4FUHA 1YPEH 4WJG2 5C2ZA 1DFPA 2J98B 3RXDA 1A46H 4AG1A 1GCTB 2VIVA 1O2JA 3Q76A 1CHGA 5KGOA 4NWKA 3GDVA 1BJVA 1V2PT 4YOJA 1IQIA 3SU0A 5A0AE 4BXWA 1QQUA 1QA0A 3TJNA 2WUBA 4MQAA 3STJA 3LH1A 3BTDE 3IWMA 2JH6D 3SGBE 3SV8A 2KAIB 3A87A 3GY5A 1FI8A 1UHBA 1O2LA 2R2WU 1QJ7B 3O8BA 3SU1A 4TWWA 1O35A 1PPCE 1GMDF 1GBJA 5GXPA 1C5NH 1Y3VA 3H09A 1ZYOA 4NIVA 1B7XB 2PFEA 3SGQE 4DVAU 5HYOA
chains in the Genus database with same CATH topology
3A8BA 1AO5A 1UVOA 1D4PB 1ESBA 3HKIB 4GUXA 1AFEH 1SGFA 1C2MA 1O2WA 2J92A 1NU7B 4CRCA 1CT2E 2BX3A 2J4IA 4YM9A 1V2NT 1SQAA 3TIUA 2BTCE 1AQ7A 1GG6C 3M3VA 1PQAA 1C5WB 2ZGXH 2FS9A 1O3PB 2QYIA 1P12E 1Z6EA 1V2LT 2IOTA 1P06A 5K0HA 3T27A 1P09A 2ZDKA 3RXKA 1GI3A 1UK4A 1CHOG 1SOTA 2QXGA 1BRUP 2ZECA 1FDPA 4JZFH 1AWHB 4LZ4B 3I29A 1Y8TA 1EASA 1GBAA 4WMEA 2Y5FA 1K1MA 1G37A 4AG2A 1GHWH 1N1LA 1GVLA 1XUKA 5JB8S 3PTBA 1ZJKA 4OS2A 1P04A 2NU3E 4MTBA 1GCTC 1HDTH 2NU1E 1HV7A 3VPKA 3W95A 1P2IA 2PUXB 5EXMA 1TGTA 2AGEX 1UTJA 1CSOE 1F92A 4IMQA 1C5TA 2BY6X 4B2BA 4H6TA 2TGDA 3CENA 4U2WA 4E7NA 3PB1E 4ZUHA 4MPUA 1G3EA 4Z0KA 1ZHRA 3MNXA 1TNJA 3D62A 2A0QB 8GCHG 2UUJB 3RUOA 3T26A 3L3TA 1TQ0B 3TVJB 1GDUA 1DWDH 2ZTYA 4ZROA 3RXVA 2SGEE 3BEFB 2SGQE 1NFUA 2GP9B 3P6ZB 1K1PA 1IQGA 4AZ2B 3SU6A 1TPPA 1LVBA 1E0FD 1T8NA 2Z7FE 1O33A 3E3TA 3RP2A 1GBIA 2BDBA 1PYTC 5LH8A 4XOJA 3B8JA 1DITH 1GI5A 3RM2H 4INLA 5DGJA 2P3FH 3EA8A 1VJ9U 1JRTA 1OP2A 3ZV9A 3T29A 1S0QA 1OXGA 2NU4E 3PMHB 2VIPA 5T6DA 4X1QU 1ELGA 1AI8H 3M3TA 3ENSB 3D23A 3RXSA 1O3EA 4BOHA 3GCOA 1YM0A 2QC2A 3SQHE 1ZHMA 4NZLA 1VZQH 1BTZA 4H4FA 2ALVA 4E7RG 3FP7E 2ZG0H 2OP9A 4NFEA 1TPAE 1ZPCA 2ZU1A 3KIDU 3BG4B 3K9XB 2XC4A 4K69A 1HAXB 1HYLA 1C5VA 3F9EA 2Y5GA 3VXFH 2FOGA 4X1PU 1AHTH 4THNH 2V6NA 4OS1A 4DOQA 3RXOA 3H7OA 1MKWK 1GPZA 2ZCKP 4Y7AA 1GDQA 2XW9A 2Z9LA 5CE1A 3BEUA 4WF8A 1QHRB 1P2QA 2IN2A 5JYIA 1QY6A 3ZZ5A 1MUEB 1SBWA 3BN9A 1H9IE 2ODYB 1NU9A 4VGCB 4ISOA 1GMCG 3F9GA 3O8DA 3SO3A 1X7AC 2BHGA 2Q1JA 3OYPA 4KTCA 1DLKB 3RMLH 3FVFB 2QF3A 4YZUA 8KME2 4FXGH 4GAWA 2HPQH 1LQEA 1O5EH 2WYJA 4Y10E 4K60A 2XBXA 3RLYH 4Q2KA 4I8JA 1HUTH 4ABFA 1TMBH 4YESB 4ABBA 4K2YA 1AKSA 2C8YB 3SNBA 3TJOA 2ZDNA 2A5IA 1W14U 1FY3A 2PR3A 4J2YB 4BAKB 1L1NA 2ZPRA 4MNYA 1BBRH 5ESBA 2OUAA 1TLDA 1Z8IB 1HAOH 2C8WB 1BRCE 3RXUA 1FN8A 1NRRH 3V12A 4B71A 1HJAC 1FY8E 2ZKSA 1C2KA 4NA8A 3IG6B 1LVYA 3FANA 1E37B 4IMZA 4O3UA 2XWBI 2HNTF 1NM6A 4PROA 1S0RA 1T8LA 1FJSA 2O8LA 4O9VA 5J4QA 1TX8A 1LVMA 1EXFA 4AYVB 4UFDH 3ZZ6A 3MTYA 1HPGA 1SGIB 3MNBA 2GVFA 1O3JA 3RXAA 1GI1A 3SNCA 3VEQB 1SGDE 4ZXXH 2BY9X 1BJUA 3MH4A 1CBWC 4XFQA 1MTNB 2WV4A 3CS7A 4B73A 3M5NA 1GBFA 4D76A 3SJ9A 1ELEE 3BTQE 2ANYA 1RD3B 3MO6A 2P94A 4HGCA 1FAXA 3A85A 4JYTA 1K28D 1T8MA 2BD2A 4A1VA 1P3CA 1JWTA 1YP9A 4BANB 1GBMA 5T3HA 5TCCA 2VU8E 4DURA 2BDAA 3ZVCA 4BAHB 3RXRA 1V2UT 1O3FA 1XUJA 4K8BA 1Y5AT 4LZ1H 3QZQA 2ALPA 1BBRE 5B6OA 3N7OA 1GVZA 2V0BA 4X0WU 1C1SA 2I6QA 1BTWA 4B2CA 1O3CA 2VVCA 1D9IA 3MH7A 3GCTG 5DP4A 1FY5A 1KLTA 2QY0B 1HXFH 1FPCH 4Z6AH 1CO7E 1L1GA 2W3KA 3KQCA 3SUFA 3K6YA 4DJZB 2PKAB 2TIOA 2FO9A 4WVPE 1TNKA 2P59A 1ZR0A 5E2PA 2HALA 2HWLB 2ZWLH 1KSNA 1AGJA 1EZSC 1W10U 2WV5A 2XCNA 4KTSA 5JB9S 2FOAA 5JBCS 1C2DA 1GMHG 1NRSH 1YPHE 2BXUH 4ZMAH 4BAOB 1GI6A 1QL8A 1HAIH 4ESTE 5F8XA 1GHZA 2D1JA 2PHBA 1GHAG 2FMJA 1SVPA 1QBVH 1HJ9A 2VVUA 3C27B 2QCYA 2YNBA 4UEHH 3T28A 5EODA 2SGDE 3UWJH 1P05A 3SORA 4DIHH 2ULLA 1MTWA 1GJAB 3FZZA 3A88A 2SGFE 3MMGA 4NA9H 5AFYH 7KMEH 1ZMJA 1O2HA 5H4IB 2CF9H 2QF0A 4X2VA 5C3NA 6ESTA 3QDZB 2Z6BD 1EAXA 1P2KA 4AFSA 4AYYB 1O5CB 3K65B 2QGRA 3A7ZA 1Z8GA 1O3AA 1C5MD 4WH6A 3UPEA 2W3IA 4BAMB 4WMDA 3OY6U 1EJMA 3KQEA 1YBWA 2VIWA 1UCYE 2GDDA 1C1PA 1QBNA 2GZ9A 1CA0C 1D6WA 1WCZA 1HCGA 3LGVA 1BTXA 1Y59T 1ZTJA 1XMNB 2HVXA 1GDNA 4FUIA 4SGAE 1L4DA 1BTUA 3E8LA 2O8MA 5JPMH 1E38B 1IQFA 1BTYA 1C1NA 1GJDB 3MH5A 1ELFA 1C1QA 5LPEA 4KELA 1C2FA 1WOFA 3RC6A 2VH0A 3PROA 2G81E 1NFXA 3K2UA 4O3TA 1EAIA 1P10A 4I8LA 4INKA 1SQTA 1GHXH 1C1UH 2HNTC 1SG8B 2J2UA 3GCHB 4OS7A 4BTIB 4BAQB 3GICB 2BX4A 1OWHA 3HATH 1N6YA 5FHTA 1SMFE 2IPHA 1DUEA 5EG4A 1GHBF 4U32A 1DVAH 4VGCC 1UHBB 3EQ0H 4FU9A 3NKKA 3GOVB 1C2LA 1FMGA 5GIBA 1YC0A 1VCWA 5C67A 1F5RA 3ATLA 2PUQH 3F9HA 1QBOA 1TOCB 1ESAA 2ZEBA 1A2CH 1M9UA 1P11E 4LXBH 5A0BA 3UR6A 2VWLA 1LO6A 2V3HH 3GY6A 4JZDH 3UOPA 3RXPA 3E91A 4Y6DA 3EE0B 1NFWA 1RJXB 1O2IA 3TNTA 1MKXK 1CA0B 2AEIH 1O3HA 1SOZA 2PGQB 1CA8B 5DP8A 3L6PA 1W7XH 1DWEH 1BCUH 1S85A 2QIQA 2F83A 3MFJA 3ODFA 3HPTB 2VIDA 1TB6H 1XUHA 4HFPB 3MWIU 4CH2B 2A32A 4Y11E 5DP5A 1Z1JA 2F9UA 5FAHA 2AMQA 1IOEA 2OLGA 1HFDA 3ZVEA 4ZHAA 2GT8A 1A4WH 2GMTB 2JETC 1QA7A 5ESTE 4D9RA 1BITA 2FIRH 1TGCA 3MU0A 4ISIH 2O9QA 5GJ4B 3VB3A 3ZYDA 1GJ7B 1J9CH 2Y7XA 3GISB 1FNIA 5T6FA 3SJ8A 5E2OA 4KP0A 5GCHG 2K1QA 1KXEA 1MTUA 1EUFA 1ZLRA 2AGGX 1KTTB 1IQJA 1XXFA 1Z1IA 3R0FA 1CGJE 2PV9B 1HXEH 4AB9A 1T32A 1T31A 1O2MA 1WUNH 1MTVA 3F9FA 1Y3YA 4TY7A 1HGTH 2TPIZ 4I32A 5A8YA 2BDYA 4UD9H 1RTKA 4NSYA 2WUCA 4ZKNU 2XBVA 3LJOA 3S9AA 3KGPA 1LHEH 4NZQA 3VGCB 4F4OC 1TPOA 1Z7KA 1RIWC 1K22H 1XVOA 2Z9KA 3M5OA 3BSQA 4I31A 4I8KA 1ZMLA 1GJ4H 3A80A 1QNJA 1TIOA 1BRBE 4ZKSU 1PPBH 3BTTE 1ZGIA 4D8NA 5HM2A 1L2EA 1GBKA 1H9LB 5C1UA 1XXDA 1GJ5H 3TH4H 2UUYA 2GZ8A 1IQKA 1JIMA 3PLKA 9LPRA 1TX6A 1VR1H 3PM3A 4R0IA 1BMAA 3SV6A 1GI2A 4X2YA 1EJNA 2J94A 2VNTA 5C20A 1CGHA 2ZGBH 1ID5H 4MPVA 2GDEH 5EGMA 4X8TH 4DIIH 3SGAE 3E6PH 1GWAA 3SNDA 3BF6H 1O3NA 2FS8A 6LPRA 3JZ2B 3AAUA 1BMLA 3F68H 3A7WA 1FY4A 1V2TT 3GY3A 2ODPA 1ZTKA 4Q7YA 2EI8A 2NU2E 1LDTT 3DUXH 4DCDA 2QXJA 2G51A 1ELCA 2A45B 1FPHH 1UO6A 3RXMA 1XX9A 2KAIA 3C1KA 4DT7B 4Y0ZE 2RA0A 5FCKA 3SOSA 4GHTA 1V2WT 1V2OT 1W8BH 4CHAC 1V2QT 5AHGH 2XRCA 1TE0A 5HGGA 3ZZ8A 4JK6A 1KYNA 1WU1A 3A8AA 1SPJA 1WTHD 1MQ6A 2H5CA 1OS8A 3BIUH 1QIXB 4BTTB 3Q3YA 2R0KA 1O2YA 4AB8A 5EPNA 4ABDA 1NPMA 1OP0A 3LC5A 4X6PA 2WPIS 2BM2A 3JZ1B 1O2PA 1LPZB 1D3DB 4CRGA 1SGYE 2ZPSA 1AKSB 2VH6A 2HGTH 5PTPA 2C4FH 2QA9E 5F8ZA 3UIRA 2BZAA 1ORFA 1A61H 2A5KA 1LHCH 3FP8E 2BD3A 1ZHPA 3BTFE 2BVRH 3L33A 1EZXC 1LPKB 2ODQA 3S0NA 1SB1H 2BD5A 1NS3A 2XC0A 1O31A 5EPYA 4NWLA 4IN1A 3B23B 2C8ZB 2PTNA 2ZC9H 2AGIX 1HAGE 1GI4A 5T6GA 1MCVA 1AFQC 3P70B 4B74A 4LOYH 3RC4A 5JBBS 4FUDA 3RC5A 3GDSA 3E90B 4ABAA 3VB4A 1BTPA 2FI5E 1C4U2 1HB0B 1O3BA 2BD4A 5E0HA 4MVNA 3ZZAA 3ZZCA 2Z9JA 2H9HA 1NRNH 2GCTC 2ZF0H 3PMJA 5FXLA 3RXEA 3RM0H 4X6OA 2FX6A 1NFYA 1G32B 4Q7ZA 2FX4A 1YPJH 3OSYA 4X2XA 1G3CA 3FFGA 1OWKA 1WAYB 3SV2H 1AE8H 1GI8B 3VB6A 3U98H 1IQHA 4NCYA 1BHXB 4UFFH 4Y8ZA 1GMDG 1LHGH 1TALA 1JMOH 1OOKB 1ZMNA 2FEQH 1ETRH 3ZZ9A 3E0NB 3UQOA 1G2MA 1HRTH 3LJJA 1TA6A 2QV1A 3SHCH 1T8OA 5BRRE 3LONA 2XCFA 1EQ9A 1OP8A 1GI0A 1XUGA 4MG3A 3EDXB 3LH3A 2O8WA 3GDUA 2AYWA 4ASHA 1GBEA 1DY9A 1UTKA 2ZGHA 1H8IH 1Z6JH 1BBRK 5C1YA 3KN2A 2JH5D 1K1IA 1Y3WA 3D65E 3DT0H 2UWOA 1O30A 1EATA 1G3BA 1BB0B 1BA8B 2GT7A 1D3QB 1NESE 1P01A 4XSKU 1EOLA 1YCPK 2UUFB 2ZHFH 2BLQA 2WPJS 1VCPA 4Y0YE 1T4UH 1O39A 3E0PB 1C1OA 4WWYA 4CH8B 1N6XA 4JYUH 2G4TA 1PJPA 1WQVH 1FY1A 4K1SA 4RKOB 1QJ1B 1C1MA 7LPRA 3M37A 1A0JA 1EOJA 4AFUA 1QL9A 4XE4A 3BTME 2PW8H 1MQ5A 1SL3A 2XNIA 3DHKH 3BIVH 3TU7H 4IN2A 3OU0A 2BOHB 3QLPH 1ZPBA 2F9BH 2H6MA 5FBEA 1AE5A 2A5AA 1SGTA 3LIWA 1P2NA 3ATIA 1UTOA 3A7YA 3NK8A 1UVPA 1HIAB 1SGEE 2OCVB 3UREA 5C5OA 1O2OA 4K5ZA 2BQ6B 2C90B 3RU4E 1LHFH 1O2QA 2ZDMA 2A2QH 2XWAA 1GHBG 2ZPQA 1HNEE 4OGXA 3ZVFA 1S82A 1TRNA 1TA2A 3QGJA 2GCHF 2TBSA 3MU1A 4NIWA 4DY7B 3URCA 9ESTA 2VWMA 3AAVA 3BTHE 1GHVH 8GCHF 5SGAE 1V2ST 3U8OH 3EA7A 1TQ7B 1TNHA 2WPHS 5A09A 3ATMA 3M5MA 5DP6A 3SI3H 1W11U 3SU4A 3MU4A 1AZZA 4BTUB 1O2TA 2G52A 2VIQA 4U30A 1EPTA 3KNXA 1MTSA 1T7CA 2R3UA 3E1XB 1TGBA 2TGPZ 3VB5A 1O38A 2SNWA 3ZV8A 5FCRA 3TGKE 5L30H 1O5GH 3Q3KA 4TYDA 1V2KT 5EQQA 4GCHF 1C2HA 2C3SA 1SSXA 5A8ZA 3EAJA 1YCPH 3F6UH 1ZRBA 1XUFA 5TCAA 4ZAEA 2OQUA 4K3JA 1TX7A 2CHAC 2FOEA 2BDIA 2FYRA 2CGAA 3VB7A 3STIA 1RRKA 2ZGCA 2AMPA 3DFLA 1YPKH 1MU6B 1GJCB 5DP9A 4CBOA 3URDA 3HK6B 1J14A 2BY5X 3T62A 1WSSH 1A0LA 2GGVB 3LGWA 3GCHC 5ETXA 5DJ7A 2STAE 1DWCH 1UTLM 1GJ6A 4IS5A 5JBAS 2ZDVH 2QN5T 3OTJE 1GBDA 3SUGA 1KXFA 1MH0A 1PPZA 1Z8RA 2Y82A 4X8SH 2W5EA 3EGKH 3CS0A 1TABE 1CQQA 1NO9H 5EQSA 1VITG 2VVVA 2FOFA 3M35A 4MNWA 5AFZH 1LPGB 4MNXA 2ZTZA 3HKJB 1O3IA 3GY4A 4WH8A 3DD2H 1OWDA 1THRH 1G3DA 2BOKA 3S9BA 1GJ9B 3O8RA 4HZHA 4AFQA 1IQNA 1O3DA 1ELVA 3RXJA 1Y5UT 3TK6A 2B8OH 4YT7H 1BRAA 1P03A 2GMTC 3V7TA 3LGTA 2BDGA 2OXSA 1K1OA 1BOQA 5K7RA 1DX5M 3KEEA 2GD4B 3RXFA 2AERH