4WX2A

Crystal structure of tryptophan synthase from salmonella typhimurium in complex with two f6f molecules in the alpha-site and one f6f molecule in the beta-site
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
253
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Visualizing the tunnel in tryptophan synthase with crystallography: Insights into a selective filter for accommodating indole and rejecting water.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Transferase
total genus 95
structure length 253
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4wx2A00
3GYEA 2A2IA 3IIPA 3QW3A 1H7WA 2NX3A 3QJAA 3GNDA 5IBXA 1BEUA 4PEKA 1PL9A 3GDTA 4UFIA 5AB3A 4K7YA 3O16A 2GOUA 1NEYA 2E77A 2G97A 2BWGA 2VC6A 5A8GA 3MJYA 4E0CA 4FIQA 2QAPA 5HUOA 4QJ1A 5BNKA 3HG4A 3OA3A 3MUXA 1G69A 2FPVA 3BW2A 3U8GA 2DZWA 3L5LA 2A7RA 2C13A 4UIOA 4YCOA 4JTJA 4PL1A 4JN6A 3C2OA 4YWIA 3OEXA 4IMFA 5CPNA 3CPRA 4FX8A 2W79A 4CCCA 2CZ5A 1YLVA 3WJSA 1Z48A 1SZNA 3HMJG 5G2IA 1I2OA 4BI6A 3W7CA 2V5LA 3GR7A 3AO0A 3TUUA 3M5YA 5DBUA 1GVFA 4LUJA 3PY2A 3W85A 1ADOA 3W1LA 3NQ8A 1C8VA 3SZ8A 3FKKA 3L67A 4Z1AA 4TMCA 1TREA 2PRHA 2RDTA 4B5NA 1WQ5A 4AHQA 5G5IA 1KBJA 3DI0A 4LWWA 4NNCA 4BI7A 2YYTA 1DBTA 1QOPA 1Z42A 2ZA2A 5EL1A 4MYAA 1XM3A 3HGJA 2ZZ5A 1OJXA 2E6YA 4X22A 1W54A 4W9TA 5D04C 1OX6A 2JKPA 4WZHA 1ZAJA 5K7JA 3P61A 3L65A 3LHUA 1EX5A 1H7XA 1KFBA 1IXPA 4TO8A 3N2XA 4ZQRA 1SO4A 5EMUA 1OYCA 4HSNA 3C61A 2NWSA 4LNYA 5C54A 3G1VA 3BK0A 1IXOA 5F4SA 3HIJA 1NVMA 4O1AA 5FEXA 1ME7A 3G3MA 4FNPA 3T7VA 3EWWA 2X1TA 1OX4A 1TV5A 3LM7A 1W3NA 1SSDA 1DJQA 3OHIA 4PA8A 4O16A 4XBKA 2VELA 3SJ3A 3F4WA 4RKAA 3FIGA 3B0VC 4NZJA 3S8HA 3Q94A 2WOQA 5AOUA 1VLWA 1SW0A 3SFKA 3LCIA 3LLFA 1OFEA 2JKAA 2HMCA 3STFA 4TIMA 5TIMA 1W5PA 1KFCA 5AHIA 5AHLA 4ONVA 3W2KA 3D0CA 2DZUA 3BLFA 3MP5A 3CEUA 5BRBA 4N4PA 7TIMA 3PC0A 1X6UA 3UPBA 3ABOA 3KVKA 3NOEA 4K8HA 4GWEA 2DJXA 1OVDA 2H3BA 2NXHA 1AG1O 3CEPA 4GJ1A 3HG5A 4E2BA 4K6AA 3MI2A 4LUIA 4O8RA 3M6YA 2DORA 3P62A 1TIMA 3LTPA 4JICA 3LCXA 3M5VA 2ISWA 5DY3A 3SIZA 2YPIA 4AVFA 3W9ZA 4GRSA 5AYYA 4AWTA 4DEFA 3E9AA 3FA5A 5TBOA 5KINA 3I65A 1AW1A 4AAJA 3UWZA 5EYWA 1M6JA 3C2FA 4O28A 2HS8A 4L4MA 3M41A 4IX0A 3KVJA 3OVPA 4FX7A 3L5AA 4LS2A 4OBTA 1ME8A 5TQLA 2I14A 5KTLA 3S1WA 1E51A 3LHYA 5CZJA 3ZR4A 3OIXA 2VEMA 2LLEA 4DF1A 2WPBA 2X30A 2YFOA 3NQDA 4UFKA 3HPSA 3P80A 2CU0A 2ABAA 1KM5A 4AXKA 3STEA 1XBVA 3LCHA 1VS1A 4K7VA 4UTTC 4HNVA 2ZA1A 4ZVJA 2OX1A 2WV8A 4JX5A 5E1QA 1OX4B 4QIUA 3NQFA 1P0KA 1LOLA 3TJLA 4WD0A 5FEZA 2A6LA 3WJXA 3GIYA 4MJMA 3GX9A 3LHZA 1GQNA 4DELA 2YW4A 2FB3A 2FDSA 1JQVA 2H8XA 3G1HA 2NV2A 2RDWA 1L9WA 4LV4A 2ISVA 1F7BA 1K8YA 2CLKA 4U28A 5D2TA 3R8RA 3B0UX 3LERA 2Y85A 4MY1A 3PBWA 4UR8A 3TMQA 1RQHA 1VRDA 5FF2A 1OK6A 4FNSA 5HR7A 3G1SA 3N34A 5HNRA 4IJBA 5AC6A 6ALDA 1H63A 3HG3A 2YCEA 5HR6A 2O7QA 3P60A 1Z44A 1KM4A 3QW4B 1LBLA 3G24A 3EX2A 1OFBA 4MIMA 5K4XA 2ZA3A 3WK2A 3P84A 1K8ZA 3ZS4A 3UWYA 4O50A 3PB2A 2ZQ0A 4HKPA 5LGZA 4PFMA 4O4VA 2A0NA 4WY0A 3BW3A 5BOOA 5LHEA 3DZ1A 1LDCA 2QCEA 3QSRA 3KVMA 8TIMA 2CLLA 3UNDA 4Y90A 4NX5A 3TSDA 1I2NA 3S5YA 1XXXA 5I3IA 2QCDA 1TTPA 2QCMA 5EKYA 1LM1A 1IXQA 5FI8A 3LV5A 4FNUA 4BFAA 1QPQA 1G7UA 1WBHA 2ZZ3A 1XBZA 2E68A 4NXKA 5GVJA 5G4EA 3R13A 1XDMA 4Y9AA 3W7PA 5F2MA 3TKFA 3NQ2A 4RXFA 4H6KA 2DP3A 4UFJA 1AW5A 2ZZ6A 3B04A 3SY5A 1F2JA 2ZZ4A 3RLVA 4TMBA 1B4KA 3GAYA 3QPYA 3NO5A 2Y7EA 1NFBA 1K03A 3TE9A 5D37A 5F2LA 2F7FA 4RZ4A 2J9ZA 2WNNA 4WX2A 3TAKA 4UFHA 1R2TA 1X1ZA 2NZLA 1JUKA 1RVGA 4UR7A 1QWGA 3L5MA 3EX3A 4O53A 5DY2A 3SGUA 4XTDA 1KFLA 2I1OA 3NL5A 3W6YA 3GDMA 1H5YA 3IGXA 1QMLA 2GUUA 4LT9A 3BO9A 3W23A 1X8FA 3W1TA 3UXAA 1GZGA 4AF0A 4N02A 4R53A 5I3JA 1ZY9A 2DZSA 1OHLA 3PWAA 1FWTA 2AGKA 3W1QA 1VZWA 2RDUA 4HHPA 2XN2A 2C6QA 3HGRA 3TXVA 1LOSA 3A21A 3FOKA 4DO4A 1ICQA 1KBIA 4HN4A 5J5RA 3PVFA 1R47A 3TAOA 3NPVA 1G7VA 2P0OA 3IVSA 4LVAA 2WSYA 3I7QA 2CW6A 1NF0A 5AC8A 1WAUA 2C18A 1YTDA 2B7OA 4JTSA 4DPQA 3W2JA 3LTSA 1EWEA 4EIVA 4RZ6A 3ABQA 1VR6A 4IWWA 4FB7A 1EIXA 5HMSA 3NQMA 1W5MA 1GTEA 3S42A 3W73A 4WY0B 5LNWA 4JXCA 3C0JA 4QQ3A 3CTLA 3L68A 1DJNA 5LHFA 4JR5A 2Z6IA 4JY8A 3P5ZA 1XC4A 2J9XA 5F1VA 5I3HA 5G2HA 1BKSA 5KZEA 3TROA 3VNDA 1AW2A 1P1XA 1V5XA 1YYAA 2QCDB 4BR1A 4WOZA 5FESA 1JR1A 4R34A 1A53A 4QSHA 3BGJA 4A22A 2ZDRA 2E09A 3W75A 2Y89A 3S5ZA 1TPB1 3UD6A 3O63A 4N9EA 4LOCA 4K8EA 4A29A 1NSJA 2QDGA 2Y61A 4GFSA 1QR7A 4WJEA 1XDLA 3PBVA 2GQ8A 4GUIA 2XN1A 1FQ0A 3TU9A 3W7KA 3QZEA 3DFQA 2CLMA 1QPRA 5D05A 3R2GA 4HNTA 2E6AA 5K9CA 4UNKA 1TJRA 3NXFA 1I8JA 3ZWTA 2HSAA 4YL2A 3B06A 1H1ZA 3KRZA 5D02A 4O0ZA 1IXNA 1H7PA 5CSSA 1TSIA 3B4UA 4P61A 3V1PA 3LRLA 1S5TA 1ZFJA 2R14A 3LXAA 5DELA 2OCZA 4AF0B 3GXTA 4FNRA 3QSTA 2PRLA 3O15A 3T55A 2B7NA 1CI1A 4XZ9A 4C1LA 1PHWA 3W87A 5DBTA 1B9BA 4P2VA 1UJPA 4NUWA 4O52A 3W1UA 1MO0A 4PODA 4IX2A 1GOXA 4OE7A 3JS3A 4ML9A 2WSQA 1TPUA 1O95A 2V30A 4MFDA 3VI2A 1G6CA 2C19A 5BW6A 1OYAA 3ELFA 3WJYA 1TPH1 2G95A 3I68A 2Z6JA 5F2GA 3N73A 4NXSA 4PH6A 5K9DA 1IF2A 3F4NA 5KMYA 1TPC1 1LBMA 1WOBA 4AMAA 5CGQA 1EA0A 4KFPA 1TTQA 5SWUA 3T40A 3W07A 1P5BA 3GKAA 2BX7A 3MYPA 4JTUA 5DCDA 1O5KA 3BLEA 3W7MA 3BG5A 4YXGA 3G0UA 1RD5A 4UTMA 2C14A 3L0KA 3QM3A 2VFDA 2VEPA 2J6XA 1VYRA 3MWAA 3CQ0A 1F05A 5F1UA 1TPWA 1OFQA 3DENA 3NQAA 5LNVA 1Z41A 4WXZA 4KKXA 1B3OA 3S5OA 1SFLA 5D2XA 2H90A 3G22A 2QJHA 3C4UA 3QPZA 4JNMA 1KFJA 1KA9F 1EP2A 1JQXA 3CT7A 3I6RA 5K9XA 3H55A 3QMSA 3G0SA 1W0MA 5ABTA 4XUGA 3NL2A 3R5EA 1H7OA 5D03A 3T4CA 4O11A 3W7EA 1OFAA 3JRKA 1GVSA 1GG0A 4UTLA 1QOQA 1ML1A 3HGSA 1H60A 5KZDA 3O07A 1PV8A 3R12A 1PCWA 2Y63A 2J27A 4DBDA 1VQTA 1QNVA 1R46A 4OGZA 1OF8A 3I7RA 4K37A 3CLMA 4S2CA 4JTFA 5HJLA 3NR0A 2E5BA 4JIPA 3USBA 3W86A 2P1FA 4MJZA 3UWVA 4DPPA 3BG3A 1JUBA 2WJZA 3ZWSA 1KTCA 1MEWA 1GVRA 1WXJA 2EHHA 2KZHA 1O5XA 1KTNA 1J5TA 4UTIA 3TSMA 3R89A 4H3DA 5DXYA 1YDOA 2JK2A 2X1UA 5LKYA 3ATYA 1Q6QA 2E6FA 2Y88A 3N14A 3NZRA 3CIWA 3O6CA 3IV3A 4IOTA 2QR6A 1D3GA 1UUMA 5BMWA 3F1QA 3NA8A 2VEIA 3WJWA 4IMCA 1EP1A 5HWMA 3S6DA 1C29A 4O15A 3MHGA 3STGA 3MO7A 1VYPX 2FPYA 4UMCA 3RF9A 4KWVA 4MLRA 1DV7A 1R2SA 2W6RA 1QCWA 2BSLA 1DQWA 2QJGA 3M9YA 2QCCA 2FTPA 2V5BA 3G1AA 2OMAA 3MBFA 4AH7A 3FYOA 1P0NA 4LTSA 1T99A 1NAL1 3TC6A 3TSBA 1JRBA 5LNUA 1VCFA 1RV8A 1UASA 4O0KA 3RU6A 1SO5A 3LLDA 4GE8A 3GLCA 5D32A 2CLIA 2YFNA 5FEPA 3MI6A 4JYDA 2YR1A 3N19B 3W2NA 2GQ9A 3TQKA 1TPFA 2ATSA 1W3TA 2ZTKA 2VFEA 2JGQA 3W1XA 3DH7A 2NWRA 4UFMA 4FF7A 5DCEA 3TIMA 2H3DA 3ANYA 2PC4A 4NQ1A 5E93A 4MY9A 1LRQA 3THQA 3VCRA 4IXXA 5U7SA 3DHDA 3W3OA 1L6SA 2ZRXA 5E0KA 4JYEA 3W88A 1XFBA 1W1ZA 1TYGA 5FF0A 3PUEA 3DFOA 4JDYA 3A23A 4LVBA 5HQEA 4HPJA 4QAIA 1A5CA 1KM6A 2W0UA 5K4ZA 3UY8A 3TA6A 1NF7A 1GJPA 3RK8A 2QCGA 1FDJA 2EPHA 2NX9A 3DFNA 4UXDA 5I3GA 2QUUA 1JULA 2X1RA 3TFCA 2VXNA 1TPVA 4LS0A 2E1DA 2RKXA 5U4NA 1K7FA 3LHVA 2VKZG 4I7WA 1KLZA 4LS1A 1ZALA 1Q6LA 4WXYA 2QJIA 1ZNNA 1GVOA 3EWZA 3P81A 1FUYA 4AHOA 1FBAA 3OBKA 3LDVA 4BF9A 3S5NA 1DHPA 3O6YX 5H2ZA 3W7DA 1JCJA 1EPXA 1OX5A 2GVLA 4FX6M 3IGUA 1GWJA 4ADTA 3PAJA 3Q37A 2ZZ7A 1PS9A 2EAWA 5CSRA 3A5VA 2UV8G 1AMKA 3W7RA 4X2RA 2HS6A 1FDYA 3FEMA 1SO6A 4UC5A 3N9RA 3MMTA 4LV9A 4NJKA 3PM6A 3W7JA 1DOSA 5I3KA 5CKSA 2ZZ2A 1WDWA 3VE9A 3GDLA 1EEPA 3EX1A 4ZQMA 3W2LA 3W2UA 1W3IA 5F4WA 1I2RA 1ICPA 3G8EA 3E02A 1VHNA 3DHFA 4CQAA 1F73A 1FWSA 4IGHA 2F84A 1O4UA 4JTGA 3UWQA 2R91A 4M7SA 2FB2A 1SZFA 2OT1A 3LBMA 4ZZ9A 1VCVA 4Y8FA 3EKLA 3G1DA 3CWOX 1TCDA 3NQ6A 1GG1A 1YXDA 5BMXA 1LYXA 3A9IA 2TMDA 2EF9A 4XQ6A 4LVDA 2FPTA 4NNBA 2QDHA 3QH2A 3W70A 1D3HA 4OV4A 3CHVA 1OFRA 2P10A 3KAOA 5AYXA 2Q3OA 2FQIA 4GNJA 3P5YA 2X1SA 4Z0JA 1I2PA 1XBXA 5K2ZA 1YTEA 5FEWA 1FXQA 4NJIA 4KWWA 3DFPA 3K30A 5CZTA 5IM51 3WFAA 4XKYB 2NLIA 1L6YA 4M6QA 4XWUA 3M5ZA 2B4GA 4ORMA 3LBCA 1ZHAA 4MVAA 1RPXA 2ZYFA 2OJPA 1K02A 5DCBA 3LRKA 4NX0A 1TJPA 3S0CA 3C52A 1SU5A 2CZFA 5DN1A 1PIIA 3QRHA 2A85A 5LZLA 4HT3A 4O57A 4O18A 3N3MA 3EX4A 4CQ9A 2O7SA 1JVNA 1O60A 1HFBA 3HJZA 4POCA 2X16A 4JDBA 2FFCA 1LRNA 2C15A 2H8ZA 3W7QA 3C3NA 3F03K 1K3UA 2QAFA 1VCGA 1HO4A 1UCWA 3DAQA 2YZRA 1SO3A 1T8XA 4FHAA 2V82A 3NPUA 3DKJA 4N2YA 1O94A 1OG0A 3B8DA 3NPXA 3PUOA 2RH9A 4ALDA 4DXVA 2ZRUA 4FNTA 2BZNA 4N4QA 5D30A 3MBDA 4M6VA 4WQ6A 4S1FA 4JY9A 4UTWC 1OFPA 2VOMA 2GVGA 4IMEA 3OVRA 3BV4A 1TO3A 2Z1BA 3KFTA 1TRDA 4JX4A 3W74A 2VFIA 5CPOA 5D2VA 1FDZA 4Z1DA 3FKRA 1XUZA 3KVLA 1CX9A 3TMLA 1WX0A 2GJLA 4G1KA 2WSRA 3TJXA 2JKEA 3DI1A 4NT0A 1T0OA 3C56A 3JR2A 1KW1A 2CFFA 1VHCA 3LXCA 1N55A 3LTYA 1WOAA 3BG9A 4RCXA 3RFAA 4DO5A 4I7VA 2C3ZA 4O54A 4Z1BA 3TDFA 3QEZA 2ATMA 3E49A 1F6PA 1ONRA 3M43A 3HOJA 2TYSA 1QO2A 3N2MA 3V75A 3OG3A 1DORA 2JBMA 4EWND 4NNAA 2B7QA 2WKJA 1OYBA 1G4SA 4JTKA 5HINA 3G18A 1OK4A 2ABBA 4AEOA 4DF2A 1ZJIA 3LHWA 1V7YA 1YPFA 1PE1A 3TNOA 4NZFA 3M44A 1L6WA 1LLZA 3AJXA 4IQLA 4MPQA 2XN0A 3DBPA 4UUIA 2GVJA 1PHQA 1SUXA 1TPDA 5C55A 4M6PA 3LI0A 4TX9A 5H91A 4GXMA 2TSYA 2YGYA 1JRCA 3EWBX 1M5WA 3LGEA 3YPIA 4K36A 1JUEA 3O6DA 2Y62A 2HTMA 3L9CA 2NXGA 5G1YA 4N6FA 4K39A 4PTNA 2NUWA 3IEBA 5G2WA 1OFDA 1SZGA 3NAVA 1HG3A 1GVQA 3NL6A 3O1NA 5G1TA 1RQEA 2NUXA 4JX6A 2E5CA 5FF4A 1YTKA 3E96A 2ZRYA 4MYXA 4OU1A 2DJLA 4MZYA 3PUDA 1X7FA 4ZQNA 3RMJA 3U2OA 4UCGA 4A21A 1XUUA 4RXGA 3S9YA 3C8FA 3NVTA 1H51A 2Q8ZA 2H6RA 3LRMA 3SI9A 2ZCGA 1DL3A 1QAPA 1F5ZA 3W1NA 4CLMA 3NG3A 3H54A 3HG2A 1FXPA 4BK9A 2ZRZA 1QFEA 5IBXC 1QO5A 2A7NA 3M1ZA 1B57A 3PSVA 3NM1A 1FCBA 4DF0A 5MHBA 4MY8A 3P8JA 4RR4A 3W1MA 4GC4A 3C2RA 4AWUA 3TR2A 1QPOA 2E6DA 3DU0A 2B0MA 1TMHA 1IGSA 3W7GA 3B03A 3IVUA 5D2WA 2DU2A 4Q33A 2QF7A 2NXIA 1H50A 1KV8A 3NM3A 1W56A 4A3UA 3LV6A 1Q3NA 3CWNA 4A2SA 4ZQOA 2EGZA 4Q32A 4BWLA 3TV8A 4A2RA 4EF9A 2G96A 1H7NA 4FEZA 3FJLA 2VEKA 4X3ZA 3O05A 3W1AA 1FX6A 1FY6A 4MFEA 3QF0A 4UMBA 4ZL1A 5L6UA 3IIOA 2BTMA 3O06A 3SECA 2ZFAA 2WQPA 2I9EA 3WK3A 4CCDA 1UB3A 4XBSA 4R33A 3TQVA 3UY7A 4ADUA 5LSMA 1B4EA 3C6CA 1Q45A 3ABSA 3WJZA 2A4AA 1YXYA 4ADSA 3GZ3A 3A24A 3PSWA 1VPXA 2J9YA 5LNSA 1JCLA 5AN7A 1ALDA 3KHJA 3DKLA 6TIMA 4O1DA 3DFSA 4O1CA 3G8RA 1N7KA 4JTIA 4FO4A 1IIHA 3W22A 4OHQA 4HPXA 3L2IA 1PVNA 3W84A 5HWNA 1EUNA 3MHUA 3L66A 3GAKA 1F6KA 5EY5A 3RLUA 3KX6A 4ZQPA 3LXBA 5DXXA 1XCFA 2VFHA 3MI3A 4RX0A 1RQBA 3GXNA 4JS3A 3O8AA 3CB8A 4O4WA 2WNQA 5LNRA 1ICSA 4QM1A 2ZRWA 4BI5A 1G4EA 2V81A 1FWRA 3IVTA 3A22A 4NVTA 3EXSA 3M16A 2GPTA 2WO5A 4JTLA 2FLIA 3W7OA 3VFLA 5A5WA 4OWGA 5CZ0A 2CWNA 5FF3A 1SR9A 3W72A 1THFD 3S1XA 3IIVA 1ZAIA 1S5WA 2OZ0A 3IIXA 3P74A 5AC7A 1U83A 1Q6OA 4CNOA 2FJKA 1KFKA 2C16A 3M7WA 1AL7A 3LX9A 1JCXA 2EKCA 5HUPA 2QCHA 1J4EA 1RR2A 2BXVA 3VKJA 4OQVA 1TV8A 1KM2A 4LY8A 2YXGA 1VGAA 4N9DA 4GUJA 1OFOA 3HO8A 3SSJA 4WY0F 4ZMGA 1TTJA 3NDOA 3GDRA 3G1YA 5D38A 3MP3A 4FNQA 1L2UA 4NU7A 4UFLA 3BGGA 4JD4A 5LGXA 1AK5A 3C2EA 1H1YA 5AHFA 4HSOA 4N6EA 5HULA 3NQVA 4X9SA 3FYPA 3TC7A 4UTHA 4HNUA 4XTIA 3HF3A 4D2JA 4LC6A 3PBUA 1I2QA 5AYZA 1LORA 5D09A 3EXTA 2PCQA 3TH6A 4OV9A 5K3VA 3GDKA 4E38A 3TK7A 3GR8A 1S3HA 3LHTA 3KXQA 3W83A 1R30A 3HQ1A 3TW7A 4JGDA 3GB6A 2J88A 3U6WA 1ZAHA 3UPWA 2ZRVA 4DO6A 2CZDA 3BPWA 3E12A 1T96A 1VLIA 2CLHA 4IPIA 4FXRA 1IIGA 2YX0A 2TRSA 3IRDA 5CG7A 4LRSA 1QDSA 2QEZA 1LZOA 2ISSA 2X2GA 1SPQA 4GUFA 1KLYA 3QC3A 3P8IA 1GT8A 3NPWA 3I7SA 3INPA 3EKZA 3NEVA 3FJ6A 4XKYA 3TQ0A 3BARA 1JJKA 1VJIA 4IXHA 5D2YA 3BVJA 1YDNA 3L21A 3KRSA 2G5WA 4JTEA 3HBLA 1XI3A 1TV7A 1F76A 5T26A 3STCA 3RNDA 1H62A 2CZEA 2QKFA 4AB4A 2AQWA 2Q8LA 2BLEA 3G0XA 4O13A 4NJJA 2C0AA 4E2DA 1TTIA 1GYNA 4RV8A 4UTJA 1G4PA 2YW3A 3HGOA 1CW2A 4S2BA 2PE4A 2CLOA 3CC1A 4UTUA 2NUYA 3W7NA 4Z08A 3KRUA 1W5OA 3PR2A 2Y6ZA 3NQ7A 3W1PA 3CIXA 4Z0SA 1LTDA 4JIQA 3NQCA 4FXSA 4EVZA 5C5YA 1OABA 2Z2UA 1YADA 3IIZA 3KOFA 4UTKA 1HTIA 2VFGA 3BW4A 1LCOA 2DZVA 5EA9A 5EBUA 3EB2A 3QFEA 3C2VA 4KFOA 4UTTA 1W5NA 4R7JA 2YYUA 3NL3A 2DZXA 3GNNA 1JCNA 3UQNA 3CU2A 4O1BA 3GK0A 4RK8A 2RHGA 3W1RA 3M5XA 3TCEA 1U5JA 4O12A 1YPIA 4ZQCA 3VE7A 1HO1A 3QQ0A 1K8XA 5CPMA 1P4CA 3NZ1A 4QISA 1PCKA 3T44A 4MZ8A 1K7EA 1M7PA 4U4MA 2YSWA 3NQEA 3W7HA 4PC8A 3GVGA 3TFXA 3OVQA 2D73A 5DLCA 4C1KA 2JGYA 1HL2A 2QCNA 3EWXA 3FFSA 4O17A 2V8ZA 1LOQA 3Q2DA 4N9CA 4JTTA 1G67A 2Y70A 2Y7DA 3G3DA 1MEIA 4Y96A 1EB3A 5I3FA 3W7IA 4MOZA 3UWUA 4CNNA 4Q4KA 1DVJA 2PURA 1VYSX 2FIQA 2VFFA 4GUGA 5AHNA 1MXSA 3PULA 4ICNA 1LRTA 2PRMA 1W37A 1SFJA 2QCFA 1KTBA 3CM4A 4LC8A 3NGJA 4UMAA 3PS7A 3T78A 5KSWA 1ZCOA 1C9DA 5CPLA 2V2HA 2R8WA 1W31A 3UWWA 4LVGA 4GBUA 1QPNA 3NNTA 4I7UA 2A21A 3MYOA 4NJHA 2V2CA 3DGRA 1BWKA 2CLFA 4J9JA 3WK1A 3M0ZA 1XKYA 4CCEA 1EP3A 1GEQA 3PG9A 2Y7FA 1LLWA 3QYQA 2QUVA 3LOTA 1XBYA 2ZTJA 4FIRA 4YCPA 2J24A 3P67A 4IMGA 3Q58A 3LCWA 4EF8A 1MZHA 2V0TA 1W5QA 1A50A 4IPJA 4IMDA 1A5AA 3HB9A 2E5DA 1HUVA 5J5DA 5L9FA 1BTMA 2TPSA 3N9SA 4MZ1A 3W71A 5KZMA 5HWJA 2CLEA 4CNPA 4AWSA 3UZ5A 3LI1A 4EOUA 3EX6A 3MP4A 1WBJA 4Z1CA 3S1UA 1VC4A 5F2IA 3PBYA 5FF7A 2V2DA 4K38A 2NX1A 1KM3A 1S5VA 3QQ1A 5AHMA 3UZJA 4M19A 1H7RA 1LROA 3G1XA 2QUTA 3BLIA 3L0GA 2A5HA 3EWYA 4QNEA 4WUIA 4M7TA 3UYCA 1FCVA 5C2XA 3UXDA 1FWWA 2YDAA 4UTWA 4YLWA 3EEGA 3EWUA 1H61A 2V9DA 4O14A 3L0NA 1D9EA 3PG8A 4ORIA 1N8FA 4RLIA 3TX9A 3A5FA 4IUOA 4M5PA 3QMTA 3TW6A 2DZTA 2C1HA 1JCYA 5G4WA 3NQGA 1R2RA 3LCGA 3TXZA 1MEHA 2Z0IA 3HPZA 2VENA 1DKWA 3MHFA 3PF3A 3S1VA 4Y6GA 4AHPA 1SSGA 3W2MA 4RZ5A 1X1OA 1TPEA 2GJNA 1Y0EA 4YMZA 1LBFA 4WOQA 1GPWA 4LVFA 4QITA 1DQXA 1LP6A 3ATZA 3SGZA 1F74A 3P82A 4QNWA 1Q6RA 1GYLA 1FCQA 3FLUA 4RJEA 3G1FA 3B0PA 2DZPA 3HPXA 1A5BA 1AL8A 1M7OA 1YDVA 3ZFHA 1K7XA 1KM1A 1J2WA 4LRTA 3P7YA 1ZENA 4PCFA 1MSSA 2ZZ1A 1BWLA 1SQ7A 2XFWA 3EXRA 3LCFA 4JEQA 1OF6A 2A1YA 1JCMP 4HIBA 4PL2A 1RZMA 4H4IA 4GUHA 1ME9A 4MUZA 4KFNA 3DXIA 1FWNA 3THAA 2NV1A 4NJGA 4BWLC 2WNZA 3PB0A 2A7PA 4MLJA 4MKNA 1WA3A 2GQAA 4N9BA 4HNNA 1G4TA 3E0IA 3H53A 4JTHA 1KFEA 5F4XA 5AHEA 1WV2A 1EWDA 1KV5A 1I45A 4DBEA 3LB0A 2ALDA 3M47A 3DFTA 3NYZA 4L4LA 1TQXA 4O19A 1KM0A 1XL9A 4TR9A 2R94A 3B05A 1SZEA 2OT0A 1UBSA 1EUAA 1SW3A 1FCUA 5KITA 1TQJA 1YXCA 3WK0A 3LCLA 5EPDA 1TRIA 1SW7A 2Q3RA 2QCLA 5D33A 2A6NA 1UUOA 4OT7A 3SR7A 4LU0A 5C6MA 2ZBTA 3IGSA 1VH7A 3GKFA 3SW6A 2B7PA 3W76A 5AFDA 3GXPA 4I9AA 1TB3A 2Y7GA 1WYIA 1I4NA 3FS2A 1W8SA 2IQTA 4CQ8A 4DQWA 1GTHA 4TU1A 1A5SA 3ABRA 3MW7A 4O10A 4UNLA 4LW7A 4JYFA 3W7LA 2AAMA 5CZSA 3QMRA 2RFGA
chains in the Genus database with same CATH superfamily
1JGIA 4RNJA 3R0DA 3WH5A 1VPYA 2JEPA 1IZJA 1W17A 3VD5A 4LUSA 1ECEA 5B80A 1QXLA 1BEUA 1AJZA 1ONEA 3N4EA 4UFIA 1AD1A 1UC5A 2GOUA 1NEYA 3IACA 1JD7A 3CZGA 2EBNA 2E77A 2VGFA 2BWGA 2VC6A 1JDFA 5ABHA 4E0CA 4IQJA 5HUOA 1KKRA 4QJ1A 3PTMA 3ABZA 3HG4A 3MUXA 1US0A 3VABA 2QQ6A 4H19A 5JIWA 3MKKA 3U8GA 3I3BA 2DZWA 2A7RA 2C13A 4R27A 2GSEA 2XVKA 4JN6A 1IZKA 2G4FA 3C2OA 2A3LA 3OEXA 1VFFA 3ORWA 4URIA 1LJYA 3L4XA 1SZRA 3M5YA 2I9UA 6REQB 1ADOA 1RK5A 3L67A 1MFVA 4Z1AA 1J0JA 5I09A 4W8LA 3GTHA 3UCQA 4LWWA 4DXXA 1HVXA 4G9PA 2YYTA 1DBTA 2ZA2A 4QE5A 1XM3A 1XGZA 3DHUA 4X22A 1W54A 4WZHA 2HVNA 1Z89A 1HJSA 2VHLA 4AZBA 4OFCA 2ALRA 3GBDA 3P61A 5CLWA 3LHUA 1EX5A 2ZXBA 3MZ2A 1NJJA 2D3NA 4ZQRA 4HSNA 3C61A 4FP1A 2IXVA 3NYDA 1IXOA 1D3CA 1NVMA 5GNYA 4O1AA 3MZNA 4D6GA 2DSWA 2WC3A 4KGJA 2X1TA 3LM7A 1KC7A 1DJQA 1M53A 1Q7QA 1KXHA 3WLJA 4JNZA 2X0SA 3S8HA 1PAMA 3RM9A 3SUTA 5HMFA 1X97A 1O5QA 5AOUA 1SW0A 4DI9A 3LLFA 4IQDA 2HMCA 5BRQA 1T7LA 2VM8A 3STFA 2OG9A 2PD9A 4F8XA 5AHLA 3H12A 3W00A 1FWDC 3AFBA 1VFUA 2DZUA 3SRDA 3BLFA 2OEJA 3URQA 1LUCB 2PP1A 2O9RA 2FJUB 3CEUA 3CQJA 3UPBA 2WJEA 3ABOA 3KVKA 1EKOA 4OTKA 1OVDA 4P7NA 4JTCA 3HG5A 1PKYA 4LUIA 4O8RA 3SCNA 2DORA 3ZJ6A 3AC0A 2WLZA 5DY3A 2ISWA 5E09A 4H2HA 4J3ZA 4JKKA 2WC7A 3FA5A 5KINA 4Z1YA 3I65A 3KOWA 3UWZA 4Q7BA 5EYWA 3C2FA 1V77A 3CIVA 4DJDA 4L4MA 4IX0A 3L5AA 3GYCA 4OBTA 3VNYA 2GLKA 1ME8A 3BLDA 4HCHA 4ZODA 3S1WA 3ZR4A 5E9XA 2XTKA 2LLEA 4L4OA 3OO2A 4EX4A 1XYAA 1XYZA 1KM5A 4XAYA 1XBVA 1VS1A 2VZVA 2ZA1A 3DHPA 1MI3A 1QI4A 4QIUA 3TTQA 1DWHM 1MDRA 3SURA 2EXOA 4Q8WA 1UP2A 2ZVRA 1OM0A 5BROA 1ZSXA 4AIOA 3L2MA 3F2DA 3GIYA 4U3AA 4W84A 2W91A 2FHBA 1XPGA 2AGTA 3LHZA 1GQNA 5CAKA 1P6CA 3KLKA 3OJGA 3G1HA 3LN3A 1GCYA 2Z1VA 2RDWA 1K8YA 1V02E 5BOEA 4HBKA 3LUTA 4EPDC 3VKAA 3B0UX 3LERA 5E6YA 3GO2A 1EDTA 1VRDA 2GJXB 1OK6A 4HYRA 3GR4A 3G1SA 5ABFB 5HNRA 3G1RA 1XCXA 4C6CA 6ALDA 2XFRA 2J47A 4FXJA 2YCEA 1C9WA 3E74A 3C0SA 3LPOA 1Z44A 1KM4A 4FLSA 1LBLA 1UWUA 4KIEA 3G24A 3VGEA 1XIBA 4JNYA 1NP2A 1OFBA 3RRAA 3JZEA 1DHKA 2WZTA 4UQEA 1JDDA 3M46A 3CMFA 4WY0A 1P43A 3KVMA 2X7VA 2CLLA 4X2PA 3HURA 4CVWA 4C6JA 5BWFA 3S5YA 3GU9A 1E4NA 1Q65A 5I3IA 1R5YA 4AY7A 3LV5A 4BFAA 1VD6A 2WHMA 1C8XA 4UB9A 3NJ3A 4KWSA 4R3UA 3CPUA 3AS0A 3THCA 3CMGA 1EA9C 4P7OA 4IPNB 4RXFA 2OKTA 1WUEA 3B04A 3SY5A 3N2OA 5GPRA 4JFVA 2PA6A 4TMBA 1Q4WA 1B4KA 1J0KA 3EYPA 3NO5A 2Y7EA 1K03A 4QEEA 2F7FA 1XYCA 4TQTA 4WX2A 3TAKA 4MJ2A 4UFHA 1R2TA 4QRNA 3LPFA 1XQLA 3IK4A 3CHDA 4J7RA 4UR7A 4AC7C 3WLSA 4F66A 2I1OA 1H5YA 2A3CA 3WLIA 3VK5A 3W1TA 3CZJA 1IEVA 1OHLA 2OODA 1FWTA 4TVDA 1VZWA 4HHPA 3TXVA 3A21A 4UCFA 4DO4A 4CN6A 5D8WA 3PVFA 3TAOA 1G7VA 2P0OA 3IVSA 3GFYA 3M0JA 5DT5A 4LVAA 1NF0A 4FF5A 4DZIA 5DEZA 3W2JA 1H3GA 3LTSA 4RZ6A 2E28A 3M0HA 5HMSA 3NQMA 3EZ4A 3UF9A 2XG9A 3PNUA 1ZQ5A 4C6OA 3LMZA 3C0JA 2WZHA 2G37A 1BFNA 1W1A1 3H2EA 2J9XA 4O1FA 3B9EA 4ZFMA 3E2RA 3TROA 1P1XA 1YYAA 4HGXA 2B31A 4BR1A 1CEOA 4WOZA 5FESA 1HW6A 4J3XA 3PTQA 5GNXA 2ZDRA 3W75A 1QI5A 2FVLA 4GA8A 3LBOA 5LIUX 4A29A 2ZUVA 3MDWA 4JQ2A 2HQAA 2W62A 3T42A 1XDLA 2WMJA 3CNYA 2GQ8A 4GUIA 1O5RA 1FQ0A 4M1RA 3ITXA 4I6KA 4UOZA 3ES7A 1YPXA 5K9CA 4UNKA 4GYPC 2F6KA 1DJXA 5ABGA 3ZWTA 3W82A 3W4RA 1RP8A 1XJBA 2UZ9A 5D02A 4O0ZA 3THDA 1R8LA 3H2NA 3EDJA 3QFWA 1JL8A 1KR1A 2WPGA 4AD0A 4REQA 3GXTA 4ZTXA 3WD1A 1UP0A 3ID7A 3QSTA 3GIQA 3O15A 1CI1A 3RILA 4XZ9A 4MWAB 4C1LA 5DBTA 3LPPA 2VGGA 4IX2A 3JS3A 1MW1A 2QW5A 5F7UA 5A6BA 2V30A 1QNOA 4H6RA 5JH2A 4PB4A 1R9YA 2C19A 1UR4A 2OOFA 3NGFA 5CJMA 1DQUA 1Q4NX 1ISXA 2YLLA 3S2MA 1WOBA 3TN5A 2EO7A 1ZJHA 1XIFA 1AD4A 4OUIA 4JFSA 1FHUA 2BX7A 4OBRA 5DCDA 3W7MA 3N17A 3BXWA 4GVIA 2VEPA 1VYRA 3MWAA 5F1UA 1OFQA 3DERA 1EH9A 5LNVA 1B3OA 3C0QA 1SFLA 2H90A 3RDKA 3L4WA 1UIOA 3C4UA 4DJFC 3QPZA 4JNMA 3EEZA 1EOMA 5K9XA 3APGA 5ABTA 2CIPA 4M82A 4QQUA 4QBXA 3RCYA 4QAWA 5IHSA 1EZWA 1WPCA 2WMKA 4CD6A 3CPGA 4GFIA 3CYJA 1EIBA 4WEVX 5KZDA 2QUMA 2GK1B 2RDXA 2YXXA 3WEMA 1XLDA 2J27A 1KXVA 2BXYA 4DBDA 1VQTA 4L9YA 3SCWA 1OGGA 3L7RA 4K37A 3ANUA 3CLMA 4IT1A 2QYGA 1J12A 1XG3A 1J5SA 1US3A 4XZWA 3UWVA 4KRTA 3U4AA 1JUBA 2WJZA 1K6WA 4DZ5A 1KTCA 1E70M 1OZQA 4PCNA 1GVRA 2KZHA 1NWTA 1A5UA 1OD0A 5DXYA 4I8YA 2JK2A 2X1UA 3AMDA 2Y88A 3N14A 3N11A 3UG4A 3CIWA 4IOTA 1J10A 3EPMA 3PZUA 1D3GA 3B8IA 3F1QA 1HJQA 3GVRA 3WJWA 1C29A 4O15A 3NDZA 3STGA 2OELA 2E1WA 4MNKA 5LIKX 1XICA 3LENA 1O66A 1R2SA 3AOFA 2QJGA 1X1NA 4DBUA 3QYSA 3NCOA 3T0DA 3GFZA 3MT1A 1P0NA 3H2CA 3IJ6A 1KCXA 4QROA 3BGAA 3GBEA 2PGWA 1JRBA 5LXEA 5XINA 1LQAA 7ENLA 1BYCA 2Y8VA 4YWSA 3RU6A 2XVNA 4GE8A 3GLCA 4ZOBA 3LD5A 3RPMA 2YFNA 3F4VA 1MNSA 1PIFA 3N19B 3PZOA 3TQKA 1W3TA 4Z2GA 2IXUA 2Z1SA 3W1XA 2BY3A 2YBTA 4FF7A 1EF2A 2GGGA 1QT1A 2PC4A 1DIDA 1E15A 3WDRA 3IJ9A 4HZ7A 2HK1A 3KP0A 4HOXA 2HROA 4IG2A 3H4WA 3OTRA 4JYEA 3W88A 8A3HA 1O1ZA 2JF6A 1K9DA 1TYGA 4NZCA 3RUBL 3VZZA 5FF0A 4DBSA 1YBQA 5HQEA 4QAIA 3OGSA 1A5CA 1KM6A 4QS5A 2I57A 4K68A 1CGXA 3EB3A 2RGMA 2OQYA 5JBFA 4EXAA 2GSHA 2EPHA 3RJYA 3COTA 2NVDA 1MXDA 2V6AA 4MKVA 2E1DA 1G9HA 4JTRA 2BODX 4MKSA 1WZKA 4NIRA 3WO8A 1ZALA 1ZNNA 2WMFA 3P81A 1VBUA 3E2QA 3S5NA 1KWKA 4YHEA 1EPXA 2G3FA 1OX5A 1M7JA 3PAJA 3SQMA 4F48A 3Q37A 4B5VA 4XB3A 3QKEA 3A5VA 1JFHA 3MUY1 3LU2A 3VMNA 3CZ8A 3V18A 2E40A 4ENLA 2QHAA 3RGTA 3MMTA 1FFRA 3MTWA 2OYLA 3W53A 3AYTA 3W7JA 1DOSA 2ZZ2A 4GY1A 3AXXA 4ZBCA 2Q8XA 1EEPA 1JFXA 3PZ9A 3REQA 1FWCC 3A4JA 3AZTA 3H24A 1OCJA 3PAOA 3AWOA 4CQAA 1F73A 1FWSA 4XK2A 1O4UA 3ALGA 1JDAA 2VL4A 4KWOA 4EK7A 3EKLA 5JH1A 1UH2A 1LYXA 2EF9A 3ALFA 3PBMA 3PZIA 1IV8A 4OV4A 3WD4A 3CHVA 1FP8A 2PD5A 4UTFA 4GNJA 1P6WA 4IJRA 3AYVA 5HJXA 4IIFA 1EZ2A 2FZMA 3R0KA 2HISA 2J79A 3BAXA 3TA9A 3WBAA 4H8UA 1XIIA 3WFAA 1L6YA 3M5ZA 1OD8A 1GW9A 2B4GA 1GK8A 3VCNA 1B90A 4MVAA 1RPXA 3KS6A 3F2CA 3KCJA 2OJPA 1TJPA 2A85A 4WDXA 4K3ZA 4O57A 4EPEC 3EX4A 2Y8KA 3VD3A 3T0TA 4POCA 3HJZA 3ARZA 5C9ZA 4JDBA 3H23A 3VPLA 4YVVA 4FHAA 1BVNP 3SCVA 2ZXAA 1OG0A 4U10A 3B8DA 3URAA 1M3UA 3PUOA 3P3BA 4ALDA 6ENLA 4FNTA 2BZNA 4N4QA 3MJMA 1XIDA 4M6VA 2X8RA 4JY9A 2VOMA 1ZL1A 2GVGA 4IMEA 3GG0A 3OVRA 4JHMA 3AIUA 1KBBA 3NFUA 4JFTA 2Z1BA 3T0AA 3BAWA 2VFIA 2POTA 1QBAA 3AMGA 1FDZA 4BQ2A 3OGRA 3FKRA 1XUZA 1ZCCA 4PTDA 1CX9A 4H9MA 2CBUA 1EC8A 4G1KA 4UBPC 1LT7A 1FHDA 1TWDA 2DY3A 2JKEA 1BD0A 1VEOA 1OC5A 3JR2A 2CFFA 3ARRA 4PN2A 3LTYA 2GZXA 1PDZA 4GI4A 4H8NA 4LCRA 4DO5A 4P7LA 3ME3A 4I7VA 4O54A 3SCPA 4J5NA 4GO9A 3TDFA 1OC7A 1FH8A 1U22A 1B3VA 1F6PA 3EBVA 1XYFA 2TYSA 3PJTA 2D2OA 3OG3A 4Z42C 1DORA 4NNAA 3ZLGA 1HL8A 2J7DA 4HJFA 4JTKA 1BG4A 1UR2A 3G18A 1FKWA 2ABBA 1RA0A 4Q4RA 4DF2A 2DVTA 3K4AA 1MUCA 3S47A 1EPVA 4Q8PA 1ISZA 1WZLA 4XAFA 6TAAA 4A3RA 3AJXA 2XN0A 3DBPA 1OG6A 3FA4A 3WMLA 2GVJA 4RE4A 4AEEA 1OT1A 5DT7A 1EJXC 4GXMA 4H00A 4CEXC 4LYKA 1TV2A 4RNIA 2VC5A 4U33A 4K36A 3U0HA 4PMUA 1POKA 1W9UA 4XD4A 3LYEA 2BBFA 1AUSL 4PTNA 2NUWA 3IEBA 5G2WA 4D72A 3NAVA 4IF2A 3QR1A 1H11A 1R85A 4HOZA 3O1NA 5G1TA 2NUXA 4PULA 5BZAA 4L1GA 4QTGA 2DJLA 5CPSA 1X7FA 4M8UA 4UCGA 3O0FA 3OYZA 2X0YA 1XUUA 3C8FA 1JXJA 2H6RA 4EE9A 1DL3A 3H22A 3BL3A 2VD9A 4CLMA 4NHVA 4GYKA 3LZ3A 1FXPA 2WWDA 1MUMA 1QFEA 2PTDA 4Q8UA 3UR7A 3M1ZA 3PSVA 1EF3A 5MHBA 2D1ZA 3W1MA 1OCBA 3TR2A 3DU0A 2B0MA 4GKLA 3EMQA 4S3CA 3WFLA 4QE1A 1CDGA 2NXIA 4A3UA 3LV6A 1JD9A 1Q3NA 4ES4A 2X7WA 1ZBVA 2Y5JA 4TX6A 3TLQA 2EGZA 1I1WA 3O3RA 3AICA 1FFQA 3KL0A 1ZP4A 4EF9A 1F3TA 3FJLA 2VEKA 3O05A 4ZL1A 2QZRA 3UJEA 5BXSA 4KETA 2PEVA 1FWFC 2BVDA 4LBRA 3TQVA 4IFKA 1Z32X 3T81A 2GJPA 2A4AA 2PLKA 4PUKA 4GIAA 4JIRA 4YYFA 2XWEA 2QUNA 1KXTA 1VPXA 4NY2A 3JW7A 1ESWA 4HPNA 1SM9A 3G8RA 1VKFA 4L4PA 2VOTA 1C8YA 4KT2A 5IOBA 2MANA 3CQIA 1I6NA 1RHCA 3IPWA 1PVNA 5HWNA 3MHUA 1PEZA 3GAKA 1F6KA 4CD8A 4ZQPA 2NQLA 4QJ5B 3LXBA 1XCFA 1QWKA 2WAGA 5JVLA 2O9OA 4QM1A 3S2CA 4CU6A 4DAFA 1I0DA 1JZ2A 3TTYA 1XGEA 7CGTA 5DQPA 2ICSA 3SM0A 4HZ6A 3EXSA 5IDZA 5T91A 3M16A 2GPTA 2FLIA 3MQTA 4X63A 1GORA 3BJSA 3W7OA 3ARXA 3VFLA 1QNRA 3RXZA 4OWGA 3LQGA 5CZ0A 3VD4A 1OEPA 4H83A 1THFD 4G7EB 3C86A 1LL7A 3PBGA 1G0CA 3P74A 5AC7A 1U83A 4CNOA 4HHHA 1XFCA 4N7QA 3LX9A 1JCXA 4L6HA 3NTYA 4G5DA 4PMDA 1J4EA 3VKJA 5ABEA 4AYSA 3B8WA 4EPKA 4WVXA 2Z1WA 1YEYA 4GUJA 4CQDA 5C70A 3NDOA 4EANA 1ITQA 1JZ4A 1L2UA 1R3YA 4YNGA 2L5HA 1BYBA 4DJDC 4EXBA 1UZHA 3BV7A 4D71A 5FJTA 5I5RA 3FYPA 3SIMA 4UTHA 4INFA 4HNUA 3UR8A 1GQJA 2INFA 5D09A 1Q8JA 4OV9A 1EJTC 5K3VA 3GDKA 2QIIA 3TK7A 2BOGX 1IHIA 3GG8A 1S3HA 3LHTA 1R30A 3HQ1A 2GVEA 1S5MA 1B3XA 4JGDA 3U6WA 1BYAA 3FEQA 3V5OA 1VLIA 5XIMA 4FXRA 8CGTA 3IRDA 4MADA 3E2VA 2HDJA 3P8IA 1BXBA 2DFAA 3EKZA 2JFEX 1WKEA 2OZTA 4HHLA 1ONXA 3RAOA 5D2YA 3RJXA 4LEFA 1E4LA 3KZPA 2ZC1A 5BYWA 1TV7A 3C5QA 2Y5EA 1F3WA 5T26A 3STCA 3T2QA 1H62A 1R9XA 4TUFA 4NJJA 4E2DA 1TTIA 1TA3A 4AC1X 3E5BA 4S2BA 4GCAA 2PE4A 2CLOA 2G4JA 4UTUA 4EAYA 1W5OA 3NQ7A 3BZGA 4Z0SA 4GABA 3WF3A 4JIQA 3NQCA 2CEQA 3KOYA 2Z2UA 1YADA 4R7OA 3MV01 1E0XA 1EEXA 1HTIA 2TAAA 3PWIA 2Z2BA 3LNMA 5H8MA 4XD6A 2DZVA 4JL2A 2D2GA 2VUNA 3BSHA 3IAPA 4J27A 1BQGA 4CD5A 4KFOA 1W5NA 3M0VA 4R7JA 3OG2A 1Q8AA 3CGTA 1JCNA 3GNNA 2QF8A 3KWXA 2W5FA 2ZX8A 3W1RA 1JYXA 3EMZA 4GISA 3A9BA 3TW9A 1Q6FA 3QQ0A 4RDVA 2PODA 4JN8A 4U4MA 1XIMA 5BU9A 2R6OA 2YDQA 3LA4A 1X6LA 1EC9A 5EFDA 2V8ZA 2J75A 1CLKA 9RUBA 5I3FA 3SEPA 1QPKA 7TAAA 2CBVA 3QZAA 4QP0A 2FMNA 2BV9A 4FOJA 3MSGA 3UVAA 4Q4KA 1DVJA 1NARA 2PURA 2FIQA 5H1WA 5AHNA 1LRTA 1SFJA 2QCFA 4K1GA 4AX7A 3GHUA 1ZRQA 4JFWA 2FFIA 4LC8A 3G6LA 2Z26A 1K4GA 2YA1A 1VJZA 2XZ9A 4PBEA 1PZ3A 2F8QA 1R38A 2WJFA 2R8WA 3BWWA 2X41A 3S4TA 4NJHA 3QV9A 1OWQA 1BWKA 4U3CA 1J18A 2VX4A 4J9JA 3WK1A 3M0ZA 3UJRA 2Z7KA 1VENA 4IGNA 1PTDA 1KR0A 4JFUA 1GEQA 3PG9A 3QYQA 2YCLA 1WDQA 3AIEA 2ZTJA 1IE7C 3P67A 3LCWA 1CXFA 4D6HA 2V0TA 3RITA 1A50A 4H9ZA 5EMLA 3FX4A 3VNZA 4F0MA 1BGAA 1BTMA 3VIFA 4IHCA 5ECVA 5DMNA 3GVWA 4AD1A 1EX1A 4AWSA 4ZXLA 3UZ5A 3LI1A 3GSMA 1NTHA 1IWPA 1WO2A 2VDIA 4A8NA 4F0RA 4HU3A 3ZSTA 1Z7AA 4IFOA 3VUSA 1VB9A 1WBJA 5H6HA 2EG7A 1Q6GA 5F2IA 1TV4A 5FF7A 5EGRA 2WVUA 1J0IA 5AHMA 1NOUA 1UR9A 1H7RA 4H9XA 2D23A 1QHZA 4QNEA 4F0LA 3R11A 4RPQA 2G3JA 4JCMA 3D47A 2P8CA 2V68A 4AZCB 2YDAA 2PCEA 2OLSA 1CXEA 3L0NA 2BVTA 3W6MA 2WCAA 4CU7A 3A5FA 4J3WA 4L1WA 5M03A 3G2GA 1DKWA 3MHFA 2VVSA 2GGHA 4JBRA 1BSIA 4Y6GA 1TIWA 3ITCA 4XZMX 3DESA 1TPEA 3K1GA 4QITA 1DQXA 3ATZA 1XV8A 3AIRA 4QNWA 1V08A 1FCQA 2G3NA 3FNDA 4E8CA 3B0PA 4LANA 4ZFCA 1SR0A 2DZPA 1M7OA 1UD6A 4ZGYA 1KM1A 4MWAE 3FHAA 2A3EA 3P7YA 1ZENA 1BWLA 1SQ7A 3CS2A 2DVXA 1OF6A 1JCMP 5EMKA 1ME9A 4LH8A 3DXIA 4KCVA 3AQUA 4DLMA 4KQNA 2WNZA 4MKNA 4HNNA 3B9NA 4B5WA 2GYIA 3FHQA 5F4XA 3UZXA 5I2UA 2Y4SA 1CZ1A 1IEWA 4DBEA 3LB0A 1BVZA 3W26A 1PX3A 2WHJA 2F61A 2PMQA 3B3DA 6XIMA 3R1ZA 2OT0A 4HB7A 2QV5A 1EUAA 3GTNA 1JGMA 3FV9A 1CNVA 3DYOA 1YXCA 3FSUA 3KEHA 1V6WA 3AJ7A 4LU0A 2CHOA 3WN6A 2ZBTA 3GKFA 1TVNA 3N2CA 8XIAA 1O7AA 1HJXA 3GXPA 2XIQA 3FS2A 1I4NA 1G01A 2IQTA 4CQ8A 2PU1A 3U5YA 2PGFA 4TU1A 3VIJA 1A5SA 3QBUA 4O10A 3QMRA 2PFHA 2FVMA 1BSLA 3FGCB 2RFGA 3GYEA 4FZIA 3IIPA 5C8BB 3QW3A 1H7WA 2RJGA 1FKXA 3GNDA 4IM4A 4M80A 2ZE0A 1PL9A 5AB3A 1TE1A 3O16A 2G97A 1CT5A 3CBWA 3MJYA 3GTXA 2QAPA 3ZLFA 5JXQA 3VGHA 2FPVA 1OIFA 4UIOA 4Q8QA 2Z24A 3ONCA 2QMKA 4D8AA 2R9RA 4YWIA 4IMFA 2BOEX 4CCCA 4M24A 4YTQA 5CBJA 1XLFA 3WJSA 2YCKX 2Y5SA 1BF2A 1ECQA 3WLLA 3U7BA 4BI6A 3MVTA 3U2CA 5CZKA 1E43A 4ZB5A 5HAOA 3GC5A 3SDOA 4Q3MA 4CU8A 5A6SA 1Y8BA 3W1LA 1C8VA 1AFSA 4GG9A 1UZDA 3WNPA 5C2GA 2PRHA 2R1MA 4FPSA 1WQ5A 4HK6A 3ZO9A 1KBJA 2J13A 2VJXA 4S3FA 2Y0FA 5EL1A 3MANA 3HGJA 2D2JA 3XIMA 1OB0A 2E6YA 3UP8A 4CD7A 5HJYA 2JKPA 1Z3NA 3O2LA 5BXPA 3ITYA 4XUYA 4WHBA 4U5KA 1XKJA 4DJED 1X7IA 1SO4A 2P76A 3N18A 5EMUA 1OYCA 7XIMA 2NWSA 2YBUA 4IZGA 4RPPA 2C1IA 2P50A 4RW3A 4F2BA 2XYLA 3HIJA 4B3KA 5FEXA 1JYNA 1ME7A 3MKVA 3EWWA 4HPGA 4LUSB 1OCNA 1OX4A 2J66A 3PZMA 1W3NA 1SMAA 2ZX5A 1F8IA 3M6DA 4HMEA 3FIGA 3B0VC 2WOQA 3SFKA 2XVLA 3RRXA 2OFJA 2ZWYA 2PF8A 3NZGA 4TIMA 3PZVA 4W87A 4ONVA 3WQ4A 3VGFA 3GG7A 2HXUA 1YRRA 2INEA 5BRBA 2CKSA 1BPLB 3AAMA 2GOKA 5H8UA 4PZVA 3WD2A 1B1YA 4Q4SA 1XD0A 2DJXA 2NXHA 4GJ1A 4E2BA 4K6AA 3P62A 1TIMA 3LTPA 3L12A 4B5UA 4PMYA 3E1F1 3M5VA 4AVFA 3SIZA 2YPIA 3WLOA 2VR4A 4AWTA 5I7GA 4B3LA 4PRWA 3EOSA 1WXYA 1M6JA 2PDFA 4HCDA 5JQ9A 2V5DA 4I3GA 3AYSA 3T2PA 4AZGA 4U31A 4LS2A 1RK6A 3WLTA 1ODUA 2I14A 5TQLA 1E51A 5CZJA 3OIXA 1LG1A 3E0VA 1GKQA 2YLAA 4LX4A 2X30A 5I6SA 3NQDA 3P80A 2CU0A 2XVGA 4E2OA 4XBJA 3STEA 1JNEA 4UZUA 4C6EA 2E0PA 4UTTC 4RL3A 2EG8A 3IJ8A 4J1OA 4ZVJA 1VBGA 2OX1A 3R4IA 1LF1A 1KKOA 2WV8A 4NP7A 1P0KA 1CGTA 1R3WA 3FAWA 3WKZA 4WD0A 5A8OA 3CL6A 3GC4A 4MJMA 1XWYA 3TOYA 3GX9A 1JPKA 5FACA 4DELA 2YW4A 2FZ8A 4RV3A 3EA1A 2H8XA 2CXEA 2NV2A 1KQYA 4LV4A 3HPFA 4PSRA 1H49A 4OIFA 3CL7A 2YKKA 2W3ZA 4U28A 5I79A 3R8RA 1QK0A 3PBWA 4UR8A 2PZ0A 1RQHA 2QULA 4DZHA 1XIEA 2ZX6A 4FNSA 5HR7A 3HQOA 3N34A 1JI1A 3OB8A 4WKAA 5M3WA 3GUWA 2OGJA 5HR6A 4I6VA 1DJIA 1UQYA 1TUFA 1RP9A 1XIGA 4MIMA 3UWEA 5HQMA 5K4XA 1AQFA 3ZS4A 3UWYA 3WUFA 3BLPX 4FOKA 2A79A 1B3WA 3FVMA 4PFMA 3WCZA 3HJEA 3BW3A 3WYZA 2QCEA 3VVGA 4X61A 2XM2A 3A4WA 1I2NA 4Q6JA 1NDVA 1XXXA 3OHMB 2OWXA 3GVVA 5EKYA 3R79A 2NVCA 4FNUA 4DWSA 3S83A 1G7UA 1WBHA 4D6FA 2WK2A 5GVJA 1FWJC 3TTEA 3VOJA 1XDMA 2RUSA 1ZS2A 2HVMA 1XSIA 3TKFA 1XR2A 2ZZ4A 3WQCA 4ZO6A 1XRTA 4CQBA 1GONA 4RZ4A 2J9ZA 3SFWA 3GD6A 4D6CA 1JUKA 1RVGA 2I17A 3ONBA 3WF2A 4MB5A 4O53A 4LQ1A 3BQ5A 2PC8A 3BJTA 3LGGA 3IGXA 1K8CA 4ZOEA 2CC0A 3BO9A 1X8FA 4R53A 4DYJA 1XCWA 4CVUA 3UG8A 5I3JA 1GW1A 3W1QA 4ZENA 4E2VA 2ADAA 1KBIA 5J5RA 5TF0A 2WSYA 2HEJA 2Z25A 5AC8A 4NASA 3XISA 1EWEA 4EIVA 3W27A 4DXKA 3ABQA 4BQ3A 1VR6A 4IWWA 5FCZA 4FB7A 1W5MA 2FTYA 3W73A 3WUEA 4KS0A 4TVCA 1NOWA 4WY0B 4GIEA 3SRKA 4GGBA 4QQ3A 4JR5A 5BU6A 4JY8A 4GX8A 1XC4A 5F1VA 5I3HA 1CXIA 3CJPA 1AW2A 3TEVA 1BGGA 3C0LA 4IUGA 1UROA 4R34A 3BGJA 2I5GA 1EJVC 3NSNA 3N3TA 4H8VA 1K77A 4ATLA 3MS8A 3IUDA 1W2VA 4GFSA 1QR7A 4WJEA 2XGZA 3PBVA 3UXKA 3TU9A 3W7KA 2CLMA 3R2GA 1W3HA 2E6AA 3M64A 1IGWA 3UJSA 3DIPA 3B06A 3P93A 2ACUA 3MDUA 3CXOA 1YNYA 2J62A 2BXZA 1H7PA 5CSSA 6XIAA 3LRLA 1S5TA 1ZFJA 2R14A 5DELA 2PP0A 3V16A 1QASA 4ZEPA 2WSKA 3RMEA 2PRLA 1ADSA 2B7NA 1P7TA 1VBHA 3AIWA 2ASHA 4GINA 1PHWA 1J0YA 3W87A 4P2VA 1UJPA 1HJUA 1PUDA 4PODA 1GOXA 4OE7A 4I9TA 4DN1A 3IUIA 1TPUA 2I5IA 1O95A 2WZMA 3V7PA 5GJMA 4K1WA 1G6CA 1CWYA 2QDDA 1TPH1 4PUDA 2IKIA 2Z6JA 5F2GA 1S1RA 1W1TA 4E3TA 2HE8A 3S2JA 4PH6A 3F4NA 4GQQA 4PUNA 5KMYA 1TPC1 2W27A 4AMAA 5CGQA 1EA0A 4LAOA 2XH7A 3K46A 4QS6A 3URNA 2ACQA 3W07A 1P5BA 4PBGA 2V5CA 3MYPA 2WC4A 1E6QM 3VINA 1Q2SA 3G0UA 2CHRA 4UTMA 2C14A 3BZJA 3L0KA 3QM3A 3CQ0A 1TPWA 3TTSA 3FW6A 3ARWA 4WXZA 4KKXA 5D2XA 4HK5A 1NFPA 1UKTA 1KA9F 5FSEC 2QMJA 1W0MA 4GQRA 1XLBA 3NL2A 1HP4A 1UIPA 1H7OA 4W88A 3WUBA 4XKMA 2VC7A 4DUWA 5HBFA 1OINA 2ZX9A 4C65A 3HGSA 4REQB 3WD0A 1PV8A 4KWUA 2Z1KA 5HATA 1OF8A 3PPHA 4NG3A 4EP8C 4S2CA 1W9BM 4JTFA 4B5TA 5HJLA 3NR0A 4A8LA 2CKRA 2P1FA 1GHSA 3BG3A 4BF7A 2O4QA 1DE6A 3ZWSA 2OO0A 1CLXA 2OB3A 2EHHA 1O5XA 1J5TA 2WLYA 3IJDA 5FKYA 3R89A 1AMYA 3RLGA 1N82A 2WM0A 1DJZA 1Y5WA 2E6FA 4Z2LA 3NZRA 3O0KA 1TG7A 3Q65A 1MZRA 4PMJA 1UUMA 1X6NA 3VMOA 3NA8A 1NWRA 5I0DA 5HWMA 3MB9A 3S6DA 1JDCA 1CIUA 3DFHA 1GOIA 1SFSA 1DIEA 1VYPX 4UMCA 2RAGA 4PYSA 1U1UA 1R3QA 1HJWA 2CCRA 1J93A 1DJYA 2QGHA 1YMYA 1S5NA 1E3ZA 2QCCA 3G1AA 2V5BA 2D20A 1JPDX 3MBFA 4MWAD 3FYOA 4DX3A 3R43A 4LTSA 5IRPA 3PWGA 3TC6A 3S3GA 5LNUA 4FLOA 3UA3A 1UASA 3NO3A 3LLDA 3WNKA 1E5NA 2Z27A 3MI6A 3UU0A 1YX1A 1AQMA 3W2NA 2GQ9A 2ATSA 2ZTKA 3NIYA 2O9PA 3DH7A 3E38A 1NDYA 2H3DA 2D2HA 2UWFA 4TXEA 1LRQA 3THQA 3VCRA 3JZUA 4NI8A 4IXXA 3DECA 3HU7A 3VNJA 4AG0A 3VD7A 4LUTA 1L6SA 1ITCA 4LNCA 1FH7A 3DFOA 3P6LA 4GC3A 1FWEC 4JDYA 4HPJA 1K4HA 4I5RA 2W0UA 4QX4A 3UY8A 5HPCA 4QDWA 1NF7A 1GJPA 4G56A 1FDJA 3DFNA 2ZDSA 3H4XA 1K9TA 2ZUTA 1W3LA 4HU8A 2VXNA 1TPVA 4LS0A 3L4UA 1JYWA 4I7WA 4LS1A 2INZA 2CPUA 4WXYA 5DRIA 2QJIA 1I9CB 3EWZA 1S3TC 1FUYA 3CUZA 3OBKA 3WF1A 4QDPA 3O6YX 3GC2A 1A4LA 4UR9A 1GQKA 2GVLA 2DVUA 4FX6M 4CGTA 3IGUA 1GWJA 3XINA 2ZZ7A 1CXHA 1PS9A 5CSRA 1QRQA 1AMKA 4C6LA 2VQUA 2EPMX 2HS6A 1ITUA 1FDYA 1GZ1A 3FEMA 3LSCA 1CLVA 4AY8A 4LEQA 1PX4A 4DM1A 1IEQA 4NJKA 4RE2A 3PM6A 5CKSA 4B92A 3CT2A 5FJIA 3GDLA 4LF1A 3EX1A 3WQ5A 3W2LA 3S9IA 5F4WA 3G8EA 3ZXWA 1J79A 4PMVA 3VKBA 2NSOA 1VHNA 3DHFA 5CH9A 3ANVA 3UW6A 1AZ2A 1CB2A 4JTGA 2R91A 4IG2B 4M7SA 3V35A 3OLIA 1S2WA 1VCVA 3KTSA 4Y8FA 4ZZ9A 3CWOX 1TCDA 1B5TA 1GG1A 1YXDA 2REQA 1YE6A 2TMDA 1X98A 4LVDA 1UWIA 2FPTA 1Y65A 3WMCA 4NAEA 4S39A 2QDHA 2Q3OA 1AQ0A 1Z6KA 3WQPA 1L8PA 3W29A 2X1SA 1IT7A 2HRWA 4X60A 1XBXA 4ZR8A 4HA1A 1UHVA 1YTEA 4N42A 4NJIA 1JDEA 4Z2KA 4KWWA 2NVAA 3OU8A 4XKYB 1DXFA 4AISA 2XSAA 4A8IA 1A3HA 1DYSA 4H01A 1ZHAA 1UW9A 3BQ6A 5A94A 3R8GA 1F4AA 4E6MA 4XD3A 3LRKA 4NX0A 2FHCA 3C52A 2CZFA 4MMWA 5G4HC 2I56A 1PIIA 3K8KA 2IW0A 5LZLA 3N3MA 3IANA 3TC3A 4P8UA 1H1NA 4AD5A 7ODCA 3BAKA 1J6PA 1LRNA 4GI9A 2C15A 3ZR6A 1V8EA 2QAFA 3F03K 4ECLA 1UCWA 1MWOA 4XIAA 2V82A 2GQ3A 4HZMA 4KIRA 4OOZA 2VR2A 3DKJA 5I07A 2YCJA 4ZTYA 4KMQA 3BMVA 3REQB 2PP3A 3TYZA 2ZRUA 1W1IE 3B97A 1F3EA 1LG2A 1WE5A 4S1FA 1QI3A 1V93A 1OFPA 3AZSA 3BAJA 3QGAC 1VIWA 2ZUSA 3VNMA 3VFCA 3W6LA 1TO3A 4ERIA 1E6SM 3KFTA 4GXWA 3GXDA 1ZP3A 2Z7GA 5I3DA 2OEKA 3B0XA 3KP1A 3Q45A 5CPOA 4ROPA 4Z1DA 1TFVA 4PGLA 3KVLA 5AYIA 4AMCA 3T8LA 1GHRA 3AUOA 2WSRA 4RE3A 5CBBA 4NT0A 1T0OA 4AZIA 3C56A 1KW1A 4MB3A 4KERA 3RFAA 1L6FA 3TLLA 2NLYA 3T4WA 4R9OA 2VCCA 5CPTA 1R3VA 3NURA 1W9VA 3QEZA 2ATMA 3E49A 3T8QA 1ENUA 9XIAA 5A6JA 3ZJ8A 4LAUA 4LFYA 1QO2A 3KL3A 2BHZA 2DDXA 4MB4A 3FXGA 1MW3A 2XGIA 4EWND 2Q09A 3SUVA 2CBIA 5AZ1A 4KF1A 2AMGA 5EBAA 3VZYA 3FK4A 1YW1A 4QJ3B 4HJWA 3ARSA 1ZJIA 1DWIM 3SB0A 4CQCA 1YPFA 4LUYA 3TNOA 3CLWA 1RJQA 3M44A 4IQLA 3PJUA 4G6CA 4M6PA 5CC5A 3IJ7A 3ARPA 4FXFA 2YGYA 1JRCA 3EWBX 1M5WA 4KCUA 3YPIA 4LALA 1JUEA 3O6DA 2Y62A 4GBDA 2HTMA 1GEHA 2F6UA 3A3WA 4PEEA 1JPHA 3WNMA 2WKGA 4WIWA 1F3XA 1BAGA 4M56A 3U2ZA 1SZGA 1HG3A 3QGVA 1ITXA 1GVQA 1DTUA 4PSPA 4L1XA 1R6WA 3RX2A 2E5CA 3N25A 1QW8A 1MW0A 2JEQA 2ZRYA 4HSHA 4GD0A 4Z17A 2NQZA 1SVDA 4RXGA 5BXRA 3CASA 1DIKA 2Q8ZA 4R88A 1DJWA 3LRMA 1IZCA 5D9NA 2ZCGA 3P2VA 4GXPA 2E8YA 3V36A 2XZ7A 2ZRZA 3QV6A 2P5NA 2A7NA 5CXPA 2I16A 1FCBA 4DF0A 1A3XA 2PTXA 3C2RA 4AWUA 1Q2RA 2CLPA 1IGSA 3W7GA 1EDGA 1LWJA 3DFYA 1U30A 3OZYA 2X40A 1E0UA 2J74A 1Q63A 4HTYA 2AKMA 3TV8A 3UG5A 4D6DA 4QE4A 4CNTA 1FY6A 4MFEA 3WQDA 1SJBA 3DOPA 2BTMA 1XQKA 3R58A 3SECA 2I9EA 4CCDA 1UB3A 3QGKC 4R33A 4JTDA 3V3WA 1ZB5A 3ZT7A 3C6CA 5CQ1A 3VAVA 1YXYA 1EGZA 2WVSA 3A24A 3L4YA 1JCLA 2XINA 3DKLA 1FA2A 2C79A 5CC7A 3OPSA 4L80A 6TIMA 4O1DA 3ZVHA 1JNDA 1V3JA 5TNVA 1QJWA 2PPGA 1V6TA 4AD3A 3D3FA 3R0UA 3W84A 2J7GA 2PDIA 3WZ0E 1GOKA 2ZRWA 4B91A 4BQ5A 3QXBA 4BI5A 1EXPA 3SQLA 3EOLA 1WDPA 4M29A 3VXGA 1IT8A 1OC6A 2WBKA 4U2ZA 4GNKB 1EJWC 3A22A 5T9BG 4PUUA 2XIBA 4BCEA 3TN3A 1EYWA 4PTWA 4YPJA 3BSGA 4JIEA 3IIVA 4PUJA 4S3KA 1YE4A 2HWGA 1KFKA 2C16A 3M7WA 1Y7VA 5HA7A 5HUPA 3UJ2A 4A3YA 1RR2A 2BXVA 4OQVA 9XIMA 3UPMA 4H8HA 1ZU8A 4DRSA 2WMIA 4JCLA 4N9DA 1OFOA 1BVWA 4D1IA 3NQBA 1RJPA 3GDRA 3P14A 4AVNA 1MQPA 3BMWA 3IK2A 4HSOA 4N6EA 3NQVA 4X9SA 2PDMA 4LC6A 1I2QA 3VNIA 1LORA 2XIMA 3EXTA 3QVQA 2PCQA 4D8ZA 2PLMA 1RLDA 2YB4A 5EMYA 3GR8A 1XW8A 4GJJA 3KXQA 3ZT5A 1M1BA 1U33A 5FL1A 2QNEA 3UPWA 3ARUA 2ZRVA 3BPWA 4IPIA 1X39A 2DQWA 1RVKA 3KS5A 4IP7A 1IIGA 2YX0A 5C71A 2TRSA 4M51A 3PTKA 3IJQA 1QDSA 2HCVA 2X2GA 1C91A 4QHRA 2FHFA 4MPKA 3NPWA 3NEVA 3FJ6A 4C5ZA 1A0DA 3BH4A 2B81A 3TQ0A 4JQAA 2NQHA 3WDQA 4D6EA 1YDNA 3N12A 1W9DM 1DWAM 1CECA 2G5WA 3S6TA 1XI3A 5C0QA 2NV9A 2OGYA 1XPYA 3RNDA 4AB4A 2AQWA 2Q8LA 1JZ8A 2C0AA 1VAHA 4FI4A 3MO4A 4WDUA 2WWCA 4HP5A 2CETA 4M81A 3PZQA 1CW2A 4C6BA 1TX2A 3PHAA 4UNIA 5BRPA 2E9LA 2Z29A 3EWCA 3VYLA 3AXKA 2NQ9A 1UYQA 3TN4A 4ZA0A 4Z08A 1UG6A 1W32A 3V4BA 3PR2A 1YKWA 3APYA 3LLXA 1MRAA 4A3HA 4ACZA 1LTDA 1MNZA 2EPOA 2VT0A 4AY1A 1C7SA 5C5YA 3E0LA 1A5KC 2BY0A 3PUGA 4PMZA 1GJUA 1BRLA 1VFSA 3FVDA 1LCOA 4JQ3A 3UETA 1HX0A 3ZJ7A 1TCMA 4GIRA 4G1NA 5XIAA 2V5KA 3LMYA 3A12A 1CGVA 4GNVA 1TZ7A 5HOSA 4UQCA 4RE0A 3UQNA 1HXJA 3HM7A 1TJ0A 3GK0A 1YPIA 3TWBA 1XISA 1K8XA 1P4CA 3NZ1A 4QISA 1LL6A 3N6JA 5AKQA 2DIKA 4JTQA 1K7EA 1M7PA 2QXWA 1XP3A 3NQEA 3W7HA 3GVGA 3V5CA 3TFXA 3WUGA 3CAVA 4C1KA 3FDKA 2QCNA 3EWXA 3AHXA 4US5D 3FFSA 2C0HA 5C9RA 3Q2DA 3BOXA 3J7HA 1WNOA 3NVDA 3W7IA 4QXIA 3E0FA 3AZRA 3WQWA 1VYSX 1M41A 2PRMA 3QPEA 3R10A 3F5LA 2EPNA 4GQ0A 3KLLA 4UMAA 3PS7A 1DPMA 3ICJA 1GOQA 1PKNA 5KSWA 2PF0A 1W31A 2J78A 4LVGA 4GBUA 4DJFD 4I7UA 1JZ6A 5PTDA 1N8WA 2ZOXA 2F2KA 1XKYA 4JAWA 4BKNA 2XIJA 1EP3A 5C7VA 3SN0A 2XUCA 4B4FA 1NH6A 1IWBA 2AQVA 5A2CA 2QUVA 1TVLA 1LQ2A 5FL0A 1K9EA 5JUVA 2F38A 3UCCA 4GZIA 4IMDA 4J3VA 5L9FA 3SSZA 3ISIX 1TMLA 1QI0A 5HWJA 2ZWZA 4GZEA 4CNPA 4DB7A 1R7AA 3VILA 2ZKMX 4EOUA 3U2EA 3HQPA 3EX6A 3GTFA 2DT2A 3M0YA 4O0QA 4Z1CA 3PTDA 3S1UA 3CMJA 1TKKA 2NX1A 1KM3A 4TOQA 1XYLA 2DT0A 1KGUA 4C6NA 1LROA 1VFMA 5EMMA 2QUTA 4QG8A 4PMRA 1RAKA 4PE8A 2X2YA 5D9PA 2HNHA 3EDEA 3UYCA 5C2XA 2OZ3A 2VCAA 3EWUA 2ON3A 4AD4A 2V9DA 5D8ZA 3ZM8A 2EQDA 2HJPA 4Z2JA 4IUOA 1HKKA 2BOFX 3TW6A 1P1MA 1R2RA 1MEHA 4FLQA 3PF3A 3S1VA 3T0BA 3L4VA 5EFFA 4WCJA 1X1OA 2OWWA 2DV0A 1J6OA 3GXFA 4YMZA 5HANA 4LVFA 4TV5A 1LP6A 2OSWA 1C7TA 2WXDM 4S3JA 1KQZA 3AMLA 4E3VA 4JL1A 1F74A 2O9TA 2VTFA 1GYLA 4XSMA 1B3ZA 3FLUA 2YCLB 1UBPC 4RJEA 1HVQA 1HZYA 3B8TA 3TQPA 1HKVA 3SJNA 1A5BA 2G3IA 2PDLA 4L5ZA 4XVDA 3ZFHA 1K7XA 4PCFA 2OPJA 4I8DA 2XFWA 2A1YA 4MG4A 2YA2A 4WGHA 1NDWA 1RZMA 3UGVA 4KFNA 2NV1A 4NJGA 4BWLC 4ZE4A 4F0HA 1WA3A 2VRQA 4GOAA 3E0IA 1CXLA 4JTHA 3P0XA 4YU1A 2IPGA 5AHEA 3H8AA 4Y9OA 3M47A 3DFTA 4GYPA 4I9JA 2WYSA 2W66A 2V3DA 1S2AA 1FCUA 1DWJM 3RCMA 3K2GA 3WK0A 1TRIA 4L9ZA 3NSXA 4AX6A 2P3EA 3QLLA 2A6NA 2H9AA 3IGSA 3SW6A 4D9PA 5AZ0A 2B7PA 2ZC8A 1PWLA 2VZUA 5CG0A 4FOUA 5CJNA 1CTNA 3SRHA 4Y9NA 3ZVIA 5C9XA 4OZOA 1W8SA 4MJ4A 3G77A 3F5JA 2YDSA 4A8RA 3GNPA 4UNLA 4YVPA 5CZSA 1HNYA 2A2IA 1RXOB 4WLCA 4US5A 1LLOA 2NX3A 2WZIA 5IBXA 1SFTA 1RCXB 4K7YA 2Q6ZA 3CQHA 1GVEA 1UA7A 3B40A 5TD4A 3DG7A 5A8GA 1G94A 3UR5A 2GFTA 4OECA 4FA3A 2V3GA 4FIQA 1H0GA 4H7ZA 3CYVA 1D7FA 3OA3A 3I10A 2GWNA 1R3RA 4AZ6A 3BW2A 4JKMA 3L5LA 3GHTA 3U5UA 3OZMA 4JTJA 1ONWA 1XYMA 3CPRA 4FX8A 4RDWA 2W79A 2CZ5A 2XFYA 3MMWA 4HMCA 1Z48A 3BJFA 4DJFA 1SZNA 2OVLA 2WZEA 5G2IA 1I2OA 4NF7A 1WCGA 2V5LA 3GR7A 2BGNE 3S9ZA 1H4PA 4LUJA 3OLEA 3PY2A 3W85A 4S3AA 3SZ8A 3FKKA 1TREA 2OQHA 2RDTA 4B5NA 4AHQA 1MMFA 3DI0A 4NNCA 3ARVA 1Z42A 2PLJA 5A6TC 3SY8A 4LXFA 1UP3A 1ZAJA 1PZ2A 3L65A 4K2SA 2P0IA 5FJUA 2GUYA 1PTGA 1IXPA 2E9MA 4H7CA 3N2XA 4TO8A 2PTWA 3B8SA 5C54A 2YL6A 2O55A 5F4SA 4F3HA 2XH4A 4AEFA 3VOCA 2YBVA 3QV7A 3T7VA 2VO5A 3WF4A 4P8XA 4QJ4B 1GQIA 4PA8A 4B2DD 4O16A 2VELA 3ITGA 4J35A 4XZIA 3FCPA 4NZJA 2HZGA 2JKAA 1FVPA 3ZZ1A 5TIMA 1W5PA 4AXNA 3W2KA 3D0CA 4E4UA 3MP5A 1BXCA 1EQCA 4N4PA 4DAIA 3PC0A 3KBSA 3ARYA 4K8HA 1UMLA 4GWEA 5AY7A 2H3BA 1AG1O 1N8IA 3MI2A 3QTGA 4GMEA 3MUCA 3LPGA 2VDGA 3W9ZA 1V3MA 5AYYA 1V51A 2YL5A 4AIBA 3CUHA 3E9AA 3L23A 5TBOA 4XIMA 1Z69A 2CWXA 1A4MA 1AW1A 2HS8A 3KVJA 3OVPA 4FX7A 4LSBA 1PJ9A 4J3TA 5KTLA 1MDLA 1O12A 2R1KA 3LHYA 3NSMA 5D4YA 4DUVA 2WPBA 2YFOA 1JZ7A 4UFKA 2ABAA 3V0SA 3EOEA 4K7VA 4DWDA 4HNLA 3UZWA 1ISWA 4HNVA 1VFHA 1OX4B 4PRTA 3OZPA 1LOLA 4BA0A 2QVNA 2W63A 2J4GA 3TYAA 5FEZA 1DXIA 3DYPA 4ZO9A 4MNLA 2A6LA 3WLNA 1W9XA 3WJXA 4WSHA 2OR2A 4KEMA 2QT3A 2KAUC 4QLKA 2FB3A 2FDSA 4NL1A 3UXLA 2VX7A 3BLOA 1F61A 3CL8A 1L9WA 2ISVA 1F7BA 5D2TA 4ICCX 4ZXOA 5E6ZA 2Y85A 3DUGA 1DEDA 3CTTA 3TMQA 1T5AA 3TVAA 3CV2A 2IQ0A 4IJBA 4KBXA 4E4FA 3SN1A 5AC6A 1G5AA 1MYRA 1H63A 2R1NA 1ZGDA 4R85A 4CD4A 2MNRA 2O7QA 2PDXA 2VRKA 3D3AA 3QW4B 1TWWA 3AWNA 2CERA 1QHOA 2AL2B 2ZA3A 1K8ZA 2PDPA 4O50A 3PB2A 5RUBA 4HKPA 5CPQA 4O4VA 1UD8A 5LHEA 3QSRA 2HPIA 1S1PA 8TIMA 3UNDA 1L0PA 3EDFA 3DCPA 4Q4OA 2BS9A 5GJPA 1WDRA 4JQ4A 1SJCA 2QCDA 3NZQA 2WB5A 5FI8A 1KRBC 3T05A 5I00A 1QPQA 4H9UA 2VX6A 1MQQA 2ZZ3A 1XBZA 4KCTA 1XG4A 3ARQA 4CN1A 1YNQA 3R13A 4Y9AA 1VJSA 4UZSA 3NQ2A 3R25A 4H6KA 2DP3A 4UFJA 1AW5A 2ZZ6A 4W7VA 3FDGA 4HU4A 1UR3M 1F2JA 2UY2A 1U1HA 3RLVA 2PDUA 3C3UA 4XVEA 3GAYA 1NFBA 4CEUC 1N2VA 3B0YA 3CUGA 3BE7A 4GLEA 4J4KA 3CUXA 3CV6A 4HNCA 1QWGA 3L5MA 4E8GA 4US6A 4XV0A 3SGUA 4XTDA 3NL5A 3W6YA 2QPUA 4DIAA 1QMLA 3AS1A 4LT9A 3CH0A 3IJLA 3QTPA 1OSEA 1GZGA 4AF0A 4N02A 2XH0A 1ZY9A 4AUBA 5FIPA 3PWAA 2AGKA 2RDUA 2XN2A 3LSBA 1LOSA 3WQOA 2VZTA 3DC0A 1ICQA 3U3HA 4H2CA 4DVOA 1R47A 1VEMA 2CW6A 3N04A 2WKLA 1WAUA 4RZBA 5CC3A 4JTSA 8XIMA 4C90A 5AECA 1LL4A 1EIXA 1ODZA 2P8BA 3S42A 3WDHA 2VZSA 3BANA 5A95A 3M0XA 4JXCA 2G8ZA 1XINA 1XF0A 5BWAA 1DJNA 3H26A 2Z6IA 3VKKA 3MCMA 2HPMA 5G2HA 1BKSA 1FWAC 3VNDA 4AYGA 4FAMA 1V5XA 5M5DA 1MQRA 3VOIA 1JR1A 4AZHA 1A53A 4RUBA 4QSHA 4JEJA 4DWSB 3PNZA 3S5ZA 2GDQA 3NO1A 3O63A 2YL9A 4N9EA 4LOCA 1NSJA 2QDGA 3KTCA 3JU2A 4ROQA 4WJ8A 2VMFA 3VKDA 3RM8A 1W1YA 1P0DA 2PZNA 1V6VA 4GPNA 3QZEA 4LYPA 5D05A 3TCSA 4HNTA 1U1JA 1K9FA 2Q02A 1I8JA 1V79A 1E9LA 3O7UA 3F2BA 4DJDD 3UZZA 1H1ZA 3KRZA 1W1VA 1B2YA 3B4UA 1H2JA 1RCQA 3JUGA 2OCZA 4EXQA 3NEHA 4FNRA 1Z9AA 3H2FA 4IGMA 1UQZA 4GZJA 1UD5A 3POHA 1B9BA 4NUWA 4O52A 4WDTA 1MO0A 1OIMA 2Q71A 4GO8A 1IR2A 2WSQA 7PTDA 4F2UA 4QG9A 3VI2A 2OTDA 5JU6A 1OYAA 5MKGB 5T9CE 1C92A 4HOWA 2GUBA 1RD6A 5K9DA 1IF2A 2A3AA 4KFPA 1BYDA 3T40A 2PWUA 1IR1A 3IWPA 1R0MA 2Y8UA 3W25A 1O5KA 3ZLHA 4A4AA 3BLEA 3BG5A 1FHLA 4YXGA 4W7UA 1S2UA 2G41A 2VFDA 1T41A 1F05A 2DW7A 3DENA 3NDYA 3NQAA 4P8VA 3I4EA 1JCTA 4HNOA 1V0LA 4KW2A 2QJHA 1EP2A 3CT7A 3I6RA 3H55A 3QMSA 2VEGA 1NDZA 3G0SA 5A8NA 1UPMB 4YHGA 3U7VA 2WVVA 2XFFA 1Q85A 4CUCA 3AI0A 3T4CA 4O11A 1OFAA 3SRFA 2X05A 3RR1A 3QLDA 4GI8A 4ILSA 2V67A 1ML1A 3BSMA 3PN8A 2XPKA 3PFMA 4TVUA 5I02A 1P7TB 3HTWA 3NUKA 2Y63A 3AS3A 4AZ7A 4PCPA 3AALA 3D6NA 5C9WA 1QNVA 1R46A 3I7RA 3ZT6A 2E5BA 4JIPA 2Z28A 4MJZA 4DPPA 2QIWA 4Q8VA 4OKDA 3KZSA 3TSMA 1S2VA 4H3DA 2V5JA 4PB5A 2D22A 5LKYA 1QUMA 3CAWA 5M1TA 1RY8A 4QSFA 4AD2A 3IV3A 2ODOA 4A35A 1AVAA 2JF7A 2BGQA 2EKGA 5BMWA 2VEIA 4IMCA 1EP1A 1HKJA 3TJIA 4ASTA 1KBLA 3MHGA 4MB1A 3L2LA 3MO7A 1UKPA 2FPYA 4JHZA 2YOCA 4M3PA 2J77A 4KWVA 1DV7A 2W6RA 3GTIA 2BSLA 3WBYA 4EWJA 1DQWA 3M9YA 1RCOB 2FTPA 3KTXA 3ZOAA 1HN1A 1UMYA 1T99A 1RBLA 4L65A 2ZUWA 3G6MA 3SQSA 4QG6A 1CBGA 4O0KA 1SO5A 5D32A 5FEPA 4JYDA 2Z4GA 1JZ3A 2YR1A 2IPFA 2D69A 3WH7A 2ZADA 3PANA 5DFAA 1TV3A 2JGQA 5DMMA 2NWRA 4UFMA 3TIMA 1KB3A 4GX9A 4NQ1A 1PYFA 4JKLA 4MY9A 1HKWA 2OKOA 3DHDA 4S3EA 1E55A 4I9MA 3W3OA 1A5OC 4DY1A 1DJGA 1JYVA 1XFBA 1S2CA 1OADA 1V02A 1QTWA 4I90A 3ZMRA 1WKDA 4OOUA 1EXBA 5K4ZA 2J7BA 2DH2A 3TA6A 4Y8EA 1V0KA 5LA2A 3RK8A 4LAZA 4DBWA 2QCGA 4IISA 5I3GA 2X1RA 3MMDA 3TFCA 3QHNA 1V03A 2DSKA 1WKYA 3BTNA 1K7FA 2VKZG 1KLZA 1Q6LA 3VIMA 4C91A 7REQA 1E1CA 3WLRA 4P7QA 4AHOA 1FBAA 4YTRA 1DHPA 1E6RA 4LF2A 2GJRA 5JBEA 1JCJA 3SGGA 3H4GA 1GGOA 4X9YA 1Q6EA 2AL1A 4QEHA 4OUEA 2UV8G 3QZ6A 3RHGA 5GNZA 4PTVA 5A6BD 3D5HA 2YB1A 3N9RA 1XHGA 3OGVA 1MVYA 1B31A 3VIKA 3DEQA 1XLKA 1WDWA 3IGHX 3VE9A 3EDDA 3OLDA 1V4YA 1CGUA 3W2UA 1W3IA 4GH3A 2VI0A 2JIEA 2GWGA 4IGHA 2E3ZA