4WX2A

Crystal structure of tryptophan synthase from salmonella typhimurium in complex with two f6f molecules in the alpha-site and one f6f molecule in the beta-site
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
253
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing the tunnel in tryptophan synthase with crystallography: Insights into a selective filter for accommodating indole and rejecting water.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Transferase
molecule keywords Tryptophan synthase alpha chain
total genus 95
structure length 253
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4wx2A00
4WUIA 1IF2A 3PWAA 1UBSA 5FEPA 1XKYA 4M6PA 1GZGA 4RZ6A 5F1VA 3T40A 3NZ1A 3GAKA 1FXPA 5L9FA 1LROA 3N14A 4QISA 3I6RA 1TTIA 1A5SA 3FLUA 4XTIA 5F2LA 3FA5A 3NO5A 4UR7A 2I14A 3CPRA 3NL5A 5AYZA 2DZSA 4UTWA 5DCBA 1NSJA 4UTWC 3MI2A 3THAA 1YXCA 3A22A 3L67A 1I2QA 2Y89A 1N7KA 1KV8A 4UXDA 3W75A 4H6KA 3C2FA 3UXDA 3QPYA 1CI1A 4A2SA 2VENA 2DU2A 3W1UA 3W1XA 3PVFA 2UV8G 4A2RA 3MP5A 5D05A 1A5BA 2JKEA 5AFDA 3MYPA 1ZAJA 4OV4A 2V82A 4NJIA 3NDOA 4GWEA 1EIXA 3SIZA 1H7PA 4GUGA 3W88A 4DO4A 3G1SA 3WJSA 2CLFA 5U4NA 1FY6A 3W7EA 2J9YA 4LTSA 1N55A 2A7RA 1W8SA 1ME7A 5J5RA 3QYQA 2VFFA 1H7OA 4JDYA 2Y6ZA 4D2JA 4RCXA 4X22A 4BFAA 5D32A 3WJXA 1XM3A 2CLLA 1MO0A 5LNUA 3HPZA 4RK8A 1FCBA 2ZYFA 3INPA 1SFJA 3RK8A 2WO5A 3MHFA 5KITA 1JUKA 1XBYA 3IIVA 3HO8A 1WX0A 2NX9A 2Y7FA 1W5NA 4LV4A 5AHNA 3TNOA 3QQ0A 2JGQA 2FLIA 4JTEA 3UWUA 5C54A 5DELA 5K9XA 3GX9A 3HGOA 3ELFA 1IIHA 2A7PA 2V81A 4O13A 4LS2A 4O1DA 4JY9A 6TIMA 3QSRA 4JYDA 3W74A 3M5XA 4IMEA 4ZQRA 3W1RA 3M9YA 4YMZA 1TB3A 3R2GA 3BLFA 1X1OA 1WBHA 2VEKA 3IIOA 2V2HA 4PH6A 4GUIA 3B0PA 1KTBA 2VKZG 1QFEA 3H54A 2Y62A 2W79A 5AHMA 2YSWA 2AQWA 3O6DA 1TPH1 3FYOA 3UY8A 3W87A 3HMJG 3HJZA 2GVJA 4UUIA 2YXGA 1TJRA 5BOOA 1YDOA 3WJWA 3TC7A 1O4UA 3NYZA 3W83A 5BMXA 1QPQA 3LBCA 1KM4A 4EIVA 3HGJA 2QUTA 3EWBX 1OK6A 5C2XA 2R94A 2E09A 1QDSA 1OX4B 1QO2A 1OJXA 5CZ0A 4MUZA 1GVRA 4TMBA 3STFA 1XFBA 3L0KA 1NVMA 1C29A 3TE9A 5EPDA 4O17A 4Y96A 4DELA 2A6LA 4JX4A 3EB2A 1YADA 1JQVA 3DHFA 2DZWA 4PA8A 3W7IA 1DBTA 5D30A 4QM1A 5AC8A 3MBFA 2ZA3A 3DAQA 3LM7A 1H1YA 1UB3A 2QCMA 3W7MA 3TC6A 1YYAA 5HWMA 4IUOA 2A2IA 1K8ZA 3IVSA 1W3TA 4GXMA 3F4WA 3G1VA 3O16A 2YCEA 3NQEA 4MYAA 2VFDA 2WNNA 1LBFA 3W7GA 1O5KA 4GC4A 1TO3A 2GQAA 1FXQA 1YPFA 1H61A 3QMRA 5DY2A 4CQ8A 4O8RA 4JIPA 2X1RA 3M43A 1LOLA 1OFRA 1KM1A 3GDMA 1DJNA 4JR5A 1IXOA 4LV9A 2J24A 2P0OA 3N34A 3BG5A 3QMTA 2ZCGA 2FIQA 2WKJA 1G4EA 3YPIA 2J88A 1B4EA 3GDRA 2NWSA 3HF3A 4JICA 4OHQA 4WY0F 2ZBTA 3W7HA 3EXSA 1DORA 1O5XA 3FEMA 2RFGA 3BG3A 3U2OA 1GQNA 1FX6A 2DZXA 3LDVA 4UIOA 4UTLA 2CLEA 2JBMA 3RFAA 5DXXA 1Q6RA 3LLFA 3NG3A 4ALDA 3U8GA 5H2ZA 5ABTA 1X6UA 3Q2DA 5AHIA 2DP3A 1VGAA 5T26A 1TPEA 3IGXA 3LHZA 3NL6A 1S5WA 3ABSA 1A5CA 4XKYB 1W1ZA 5SWUA 2ZZ5A 4LW7A 4N4PA 3NA8A 4RXGA 3P61A 3W7LA 3QZEA 2P1FA 3EXRA 3TQKA 3LLDA 3S5OA 2GVGA 1ML1A 2XN1A 2TPSA 4MLJA 5HQEA 5CG7A 1JUEA 1JULA 1LRNA 3C2RA 1ZY9A 3L9CA 3LHTA 1AW1A 3IIPA 2E6AA 3QW3A 1ME9A 3W1NA 1HTIA 1BTMA 3WK1A 4WY0B 3TXZA 1LP6A 4KFOA 2YFNA 2CLKA 3BK0A 3QPZA 1G6CA 5G5IA 1EP2A 4N9DA 4LOCA 2Q3OA 3PBWA 3TFCA 3LX9A 1G69A 5K3VA 1MEHA 3LI1A 1JQXA 3HOJA 4Z1DA 3SI9A 1R2TA 2GJLA 2VFHA 3HG3A 2CLMA 3W7CA 3B04A 3C6CA 8TIMA 3LHUA 2ZZ2A 2CZFA 5G2IA 3GIYA 1OFEA 1P0KA 2R8WA 2Y7GA 3GDLA 4I9AA 1ICQA 7TIMA 4XBKA 1VLIA 4UTJA 1F76A 5DCEA 5CPOA 4UTTA 5HNRA 3PULA 1VHNA 4IXHA 3NPXA 5K7JA 3S8HA 3O6CA 2DORA 4O18A 1GEQA 3KVMA 4UTHA 2WNQA 3B8DA 1TYGA 3B0VC 3E0IA 4ORIA 4Q4KA 3QJAA 4M19A 1GTHA 3NEVA 1O95A 4QJ1A 2WJZA 4LVGA 5K4ZA 3IIZA 4LVFA 2ZZ4A 3CT7A 5DXYA 2TYSA 3N2XA 1T8XA 3KXQA 3LBMA 4JTKA 1TV8A 5K4XA 3W1AA 3W1QA 3UWZA 1S3HA 4JTJA 3TW7A 5TBOA 1M7PA 4XTDA 5AHFA 3KAOA 4N9EA 2NV2A 1GPWA 1HG3A 4OQVA 5EKYA 2NLIA 1C8VA 1SSGA 3P82A 3GKAA 3C52A 1QR7A 4HNNA 2Z1BA 1RZMA 3NQ2A 3M7WA 2FJKA 3QM3A 1GVQA 2PE4A 3TW6A 2C13A 3FOKA 5IBXC 2V5BA 4AWTA 3W76A 5CZSA 4GUJA 2DZPA 5I3JA 2H8XA 1W3IA 4W9TA 3H53A 1DKWA 4ZMGA 4O53A 3UWWA 5D2TA 4I7WA 2FDSA 1YDVA 1YLVA 3RF9A 4FX7A 4KFNA 5EA9A 4FIRA 3G24A 5HUPA 3N9SA 2GQ9A 1OK4A 3SJ3A 4NNAA 3GKFA 1MEIA 5J5DA 1QNVA 1GVOA 2CLHA 2E5BA 3WJYA 5KZEA 4NQ1A 1G7UA 2ZZ1A 1YTEA 4KWVA 4XBSA 1KLYA 5E93A 2B7QA 4NXKA 5D2VA 1BKSA 2AAMA 2CLIA 3N2MA 2QCDA 4MVAA 4J9JA 1DJQA 3PBVA 4DQWA 5G4EA 1XUZA 3TXVA 2JKAA 4PL1A 5IBXA 1B4KA 4QITA 3UWQA 1GYNA 4LWWA 5GVJA 5FEZA 1K3UA 5D2YA 1IXPA 3VE7A 4H3DA 1IXNA 5I3KA 1GJPA 2WSYA 2Y63A 5G2WA 1R30A 2G97A 3TAKA 4M7SA 1LCOA 4GRSA 1ZNNA 3LCWA 5I3IA 3WK0A 4AEOA 4O4WA 5D04C 3A24A 1HO1A 4GE8A 3ZS4A 3P5YA 1H62A 1W5MA 4CNOA 3NR0A 4QNEA 5FF7A 2ABBA 2A21A 4G1KA 3RLUA 3EX3A 1XL9A 3EWYA 4MLRA 4HN4A 3ZR4A 4K7VA 1W5PA 5AHEA 5F2GA 3F1QA 3GXNA 1J2WA 4EF9A 1PS9A 1K7FA 1ZAHA 4Z0JA 5LNSA 4NXSA 3BLEA 3CM4A 3RU6A 1YTKA 2C1HA 5DN1A 5AYYA 3EKZA 3P67A 4YXGA 1GG1A 2V2CA 4UTUA 3S9YA 4ICNA 2VXNA 4WJEA 1I8JA 3S1VA 1Q6QA 3SZ8A 2ZDRA 4LVDA 3LCLA 2J27A 1XBZA 4AHQA 3OEXA 5CGQA 5D33A 1F73A 3W7PA 1W56A 3DXIA 1VPXA 1H5YA 4CCDA 2B7NA 4A21A 4DO5A 4O0ZA 2C16A 3DFPA 4N6FA 3BGGA 5A8GA 4AAJA 5HJLA 1EWEA 3B0UX 2GVLA 1BWLA 4N9BA 2FPTA 3VFLA 3T4CA 5LGXA 1F74A 3PG9A 4K7YA 1K8XA 4UTTC 4O57A 2GUUA 4R53A 1JCJA 3W1TA 3CLMA 3EWUA 4ZVJA 1H51A 3TCEA 2OZ0A 3UYCA 1K7XA 1FWWA 1RR2A 1AG1O 3R5EA 3R89A 1ZCOA 3G18A 1KFKA 1KM3A 3N3MA 1TPVA 1ADOA 4NNCA 2I9EA 1THFD 3LTYA 4TX9A 1L6YA 3NQ8A 4PODA 3LB0A 3S1WA 4YCOA 4OE7A 1SZGA 5L6UA 4C1LA 4UFKA 3MHGA 1T96A 2NUXA 3QF0A 3PB0A 4IQLA 3IVUA 2QCDB 2ZRWA 3CC1A 4O19A 4DBDA 2H3DA 5DBUA 2DJLA 1EWDA 3G1XA 4MFEA 2Q8ZA 4M6VA 1KV5A 4RZ4A 5D38A 5KTLA 2CU0A 3FJ6A 3CTLA 3SGZA 1K8YA 3DFSA 1VHCA 4L4LA 3NZRA 1FWTA 2ZQ0A 2V5LA 1UJPA 1PL9A 5F4SA 5F2IA 1XBVA 3G8EA 2V0TA 2KZHA 2E6DA 4O4VA 3W9ZA 2YFOA 3LCGA 3MI6A 1GT8A 1DQXA 1D3GA 2Z6JA 1NF7A 2XN0A 3VE9A 1TCDA 2CZDA 4DEFA 2YX0A 3TSMA 2RDWA 1TV5A 3L2IA 2NUWA 3CEPA 1SPQA 4IMFA 4Z1CA 3NAVA 3T78A 4A29A 3LTPA 1LLWA 1TPWA 4E0CA 2C15A 1PIIA 1SQ7A 2WOQA 3I7QA 1XUUA 3IGUA 5E1QA 4DO6A 5AC6A 1H50A 3S5ZA 4IWWA 2B0MA 4UTMA 1TIMA 2B7OA 3H55A 4HSNA 4UR8A 3UWVA 5LNRA 2E1DA 4LU0A 1R47A 3PAJA 1Z44A 3W07A 2OCZA 1SO5A 2OJPA 1WV2A 4O52A 3NQCA 3VKJA 2QUVA 5G4WA 4Z1BA 5HR7A 1I2RA 2YYUA 4O15A 4XQ6A 4K8EA 4UFMA 1HUVA 4WOZA 2QJIA 5AYXA 5KZDA 3G1AA 3BPWA 1WDWA 1EUAA 5HMSA 1ZAIA 3OVQA 3S42A 4IMGA 2FTPA 2TSYA 3TA6A 2X1UA 3V1PA 4N4QA 5FF2A 3P7YA 4RR4A 1WA3A 1T0OA 3NQVA 4JXCA 3KOFA 4MY9A 2JK2A 4NNBA 2ISSA 1RPXA 3L68A 4AF0B 4QIUA 1F2JA 3O63A 1OFQA 3FIGA 3SFKA 2PCQA 2QCFA 4N6EA 1MZHA 1VH7A 3DZ1A 5CKSA 1ALDA 1KFLA 1QOQA 4NJKA 4A3UA 3E9AA 4Q33A 3DI1A 5HUOA 1EEPA 4JNMA 4CNPA 1SZFA 2EPHA 4R7JA 4C1KA 2VOMA 1VC4A 3UZJA 1DQWA 3O6YX 2E6FA 3TUUA 4R34A 1EPXA 1PV8A 4JTHA 4M6QA 3MWAA 1A53A 5H91A 1AL7A 2E6YA 4L4MA 2XFWA 1OFBA 1B57A 4TIMA 4TR9A 1TV7A 2VEPA 1QMLA 3EX4A 3L0GA 2ZA2A 3JRKA 4JTFA 1PVNA 1VS1A 3CQ0A 4PFMA 3T55A 3FYPA 3OIXA 4QAIA 2CZEA 2CZ5A 2QJHA 4I7VA 4K37A 4ONVA 2R14A 2OT1A 3TJLA 1TSIA 5MHBA 3A5FA 4DF2A 3SR7A 3HG2A 3CU2A 4AWUA 4I7UA 4K38A 5AHLA 5A5WA 4MZYA 4UMCA 2A85A 4LUJA 1H60A 2HS6A 3IRDA 4B5NA 1LM1A 4RZ5A 3LCXA 4HHPA 1LRTA 2Y85A 4IX0A 4FF7A 3VCRA 3L0NA 3NM3A 5FESA 1KBJA 2G5WA 4OWGA 2G95A 4RLIA 3MYOA 3KRZA 3W1LA 5LGZA 1FCVA 1XXXA 4JX5A 4RX0A 2V2DA 2EF9A 3HGSA 5F4WA 1IGSA 3HBLA 1KFCA 1KLZA 2EKCA 3FFSA 2J9ZA 3LI0A 4ZZ9A 1LBLA 5D02A 3UQNA 5LKYA 3BW2A 3F03K 4JY8A 4O1AA 3G1FA 1SO4A 1FWRA 3TROA 5FEXA 4NZJA 3UD6A 2ZA1A 3GXTA 1VLWA 3NVTA 4MJMA 2Y88A 3W22A 1I4NA 5K9DA 4GBUA 2JKPA 4DF1A 2E77A 3PSWA 3PUEA 4PL2A 4PC8A 4FX6M 1RV8A 3FKKA 4RV8A 5I3FA 1QAPA 4AWSA 2FFCA 5CZJA 5FF4A 2NWRA 2Q3RA 1PE1A 1KM5A 4E2DA 3M47A 3MP3A 3U6WA 4BF9A 3LXBA 3L5MA 1VCFA 3GR8A 5C5YA 2BWGA 5D37A 1W5QA 1OFDA 4K39A 4S2BA 3OVRA 3G1YA 1EX5A 3MI3A 2WSRA 3KRUA 4MJZA 1XC4A 3DENA 3STGA 4OBTA 4TMCA 2HSAA 4JTSA 3I65A 3G0SA 4FNPA 2C18A 1Y0EA 3O15A 3W70A 5BNKA 4JTIA 2GOUA 1GVFA 1DVJA 1X1ZA 4X3ZA 4YWIA 3DFNA 4ORMA 3EX1A 4MZ1A 1QWGA 1D9EA 3TR2A 1KTCA 3TQVA 1N8FA 2Y61A 3CB8A 1RQHA 4HIBA 4WX2A 3MW7A 2ZRZA 2ZRYA 5EY5A 3TKFA 3BW3A 2A7NA 4HPJA 3K30A 4MPQA 2OMAA 4QSHA 3QRHA 3GNNA 3O07A 4BI5A 2RDTA 2QCNA 3OBKA 2Z6IA 3PBYA 4ZQMA 1WOAA 1ZHAA 4CLMA 3S1XA 1TTQA 3G3DA 4WZHA 3LXCA 1P0NA 1XDLA 4UTKA 3C56A 1UCWA 3MJYA 1GYLA 4GUFA 3G0UA 3B05A 1SO6A 1OFOA 2V30A 4S2CA 2H90A 3FKRA 4WD0A 4BWLC 1OYBA 1MEWA 4JTUA 4KFPA 3S0CA 1MSSA 3KFTA 3S5YA 2EAWA 3PB2A 1QCWA 1R2SA 1LYXA 1UUOA 2PC4A 3W2JA 3C3NA 4IMCA 3MP4A 3SW6A 2IQTA 1RVGA 1FUYA 1U83A 4A22A 5LSMA 2DZTA 3W7JA 4IXXA 1U5JA 3L65A 3DGRA 2W6RA 2QCCA 2VFIA 1LBMA 1Q6LA 2YPIA 3N9RA 2I1OA 3NQDA 2PRMA 4JEQA 3EWWA 5CSSA 3BO9A 3C4UA 3USBA 1QPRA 1CW2A 1W3NA 3P81A 2Y7DA 5HWJA 2QAFA 1W0MA 3NQFA 5DBTA 1AW5A 5FF0A 5FF3A 4FX8A 1TPC1 1ME8A 2ISWA 3W3OA 3QC3A 1JCLA 3VNDA 3W7QA 1KW1A 3LCFA 3M0ZA 4FB7A 2B7PA 2X30A 3S5NA 1PHQA 3O05A 2WNZA 5EYWA 2NX1A 3PUOA 3C8FA 2QR6A 3UZ5A 3DFQA 1SW7A 1V7YA 3BARA 1R46A 2V9DA 4PTNA 4XKYA 1TMHA 2BZNA 4GUHA 1SW3A 1X7FA 2LLEA 3O06A 4O14A 2Q8LA 3EWZA 3AO0A 4NZFA 3EX6A 4P2VA 1NF0A 3W2UA 3BLIA 4WXZA 1IIGA 3NQ7A 3DFOA 1FBAA 3NOEA 1JVNA 3OHIA 3NNTA 2QF7A 1NEYA 4AMAA 1A50A 4MZ8A 5CPMA 2BX7A 2ABAA 3ZFHA 4ZQCA 1LOSA 2GQ8A 2ZRUA 4LS1A 3TH6A 4O50A 1J4EA 1FDYA 2RHGA 2YYTA 1OYAA 3LHWA 3NQGA 1Q3NA 3NQMA 1H7WA 3W86A 3HQ1A 3C0JA 3EX2A 4LNYA 4LS0A 3G22A 5DLCA 3A9IA 4NX5A 2E5CA 4BWLA 5FEWA 2HS8A 3T44A 1T99A 3I7RA 1W37A 3P80A 3PSVA 1F6KA 5AOUA 1H7RA 2EGZA 2YGYA 4AVFA 1TPUA 1FDJA 2CWNA 3NPVA 3S6DA 3P84A 4PEKA 1ZENA 3LCHA 2FQIA 1GTEA 2NXIA 5G2HA 3W2NA 2A0NA 3SSJA 4FO4A 4P61A 1G4SA 2OX1A 3EWXA 4FNTA 1I45A 2ZFAA 1VJIA 3GAYA 2Z0IA 1OX5A 4HNTA 5HWNA 5KMYA 3LHVA 3TMQA 3R13A 5LZLA 4UC5A 4IMDA 4N9CA 3NXFA 1K02A 1OFAA 1NAL1 4H4IA 3WJZA 2QCEA 3HG5A 3PG8A 4DPPA 4FXSA 4O0KA 3CIWA 3WFAA 2YR1A 3PR2A 2RKXA 1GWJA 4LC8A 3IGSA 3SECA 2DJXA 3M6YA 4ADTA 1M6JA 2FB3A 5AB3A 2QCHA 1I2PA 1TTJA 4AHOA 1EP1A 2A6NA 4DPQA 3GDTA 2QJGA 3BGJA 3TMLA 1DHPA 3N73A 1SR9A 4Q32A 2VEIA 2ZTJA 1LOQA 1JRCA 1RQBA 2X1TA 4EWND 1OFPA 3M44A 3G1DA 3PF3A 4NX0A 5D03A 5HULA 2FPYA 2H8ZA 4LUIA 1KTNA 2VFEA 2P10A 4LC6A 3FJLA 1FDZA 2J9XA 3OG3A 2HMCA 1XDMA 2FPVA 4U28A 1S5VA 3QMSA 4CCCA 2QUUA 3W7RA 4K6AA 1SU5A 1Q45A 3KHJA 3TDFA 2YDAA 3QQ1A 5U7SA 4DXVA 1P4CA 4M7TA 3G1HA 4OGZA 1KM0A 3GYEA 1QPOA 3JR2A 3GLCA 4JYFA 1ZALA 4HT3A 1LLZA 1LRQA 4MOZA 3RLVA 1LORA 2H6RA 3SGUA 3NL3A 4Z1AA 1OVDA 4IGHA 3I68A 2ZZ7A 4DBEA 3W1MA 2YW3A 2PURA 2QDGA 1FCQA 4UNLA 1K03A 1XCFA 5CSRA 4FXRA 3QEZA 4LY8A 1H63A 4N02A 1SFLA 1PCWA 1TJPA 2ZRVA 1L6SA 4U4MA 2Y7EA 3Q58A 1Z42A 4JX6A 2ATMA 4LRTA 4UCGA 3UNDA 4FNSA 1OF6A 1YDNA 5CPNA 3LHYA 2TRSA 4AB4A 5DY3A 5FI8A 4GNJA 1SW0A 3DKJA 3UPWA 3HGRA 2NZLA 4UMBA 1LDCA 5HINA 1DOSA 1C9DA 4OU1A 4KKXA 4QNWA 1TQJA 3RMJA 3DKLA 1KM2A 2C19A 1HL2A 1D3HA 4MKNA 2WV8A 1VYRA 3F4NA 1PHWA 1KFEA 4O11A 1F7BA 1WAUA 2QCGA 4IPJA 3W72A 5F4XA 1H7XA 4LVBA 4UFIA 4XWUA 4KWWA 4AXKA 1I2OA 3PC0A 3IEBA 4ML9A 3R12A 2QAPA 4HPXA 4WY0A 2X1SA 2CFFA 3L5LA 3Q37A 2GPTA 1RQEA 4ZQPA 4JIQA 1B9BA 1ICPA 2F7FA 2JGYA 3CIXA 1WQ5A 3IV3A 3EEGA 4LRSA 1KA9F 4JD4A 2QCLA 4HKPA 3LGEA 3ANYA 3GB6A 1O94A 1FWSA 5TIMA 1NFBA 3L5AA 1ONRA 2E68A 5I3GA 3PUDA 1BWKA 3ABRA 5CPLA 1VCGA 1O60A 2R91A 3QH2A 4WQ6A 5D2WA 3TSBA 3W7KA 4FEZA 1E51A 1UUMA 3M1ZA 3CWNA 3E49A 4E38A 4NJGA 3P74A 4NVTA 3E12A 1W5OA 3PY2A 3UXAA 3G3MA 3GDKA 1L6WA 1QPNA 3A23A 4POCA 4JTTA 4K36A 4CNNA 4EVZA 3R8RA 3DFTA 4X2RA 1P5BA 2C14A 1L2UA 3QSTA 5F2MA 5K2ZA 2A1YA 3GVGA 2X2GA 1WXJA 3IVTA 1XI3A 1EP3A 1PCKA 3C2OA 1TPDA 1JRBA 1KBIA 3NPUA 1JJKA 3GK0A 1OYCA 1LZOA 3LXAA 5LNVA 3LRMA 5I3HA 1GOXA 1AK5A 4FHAA 3A5VA 5BRBA 1FQ0A 2ATSA 1JCXA 1X8FA 3GXPA 4FNRA 3W23A 4QQ3A 4RJEA 4MIMA 5C55A 3Q94A 1SO3A 4UFLA 2NXGA 3HB9A 4BI6A 4O54A 5D09A 4O12A 2BSLA 4TU1A 3M5ZA 3W2MA 1M5WA 4BK9A 1V5XA 2NX3A 2QDHA 1LTDA 4JGDA 3HPXA 1G67A 4OT7A 4UMAA 3W2KA 6ALDA 4Y9AA 3RNDA 4O10A 1AMKA 2C0AA 1L9WA 2DZVA 4ZQOA 1KM6A 4IPIA 3BV4A 4WOQA 5D2XA 4NUWA 4ZQNA 3MMTA 1WYIA 3QW4B 5KINA 2XN2A 1VCVA 1VYSX 4UNKA 3TU9A 4NJJA 4FNQA 4PCFA 3UY7A 1GG0A 1AW2A 4HNVA 1TRDA 4JYEA 1VR6A 3NQAA 5CZTA 4O1CA 3TSDA 2X16A 3TV8A 3B06A 4IOTA 1JCMP 3LTSA 4O28A 3KVJA 1KFJA 3KVKA 5KZMA 5EBUA 4BR1A 3W85A 3PM6A 1SZEA 1SUXA 3ATZA 4IX2A 5K9CA 3CHVA 4MFDA 2ISVA 4YCPA 1F05A 1ZJIA 1VRDA 3M5VA 5TQLA 1M7OA 4JN6A 5G1TA 3SY5A 1EUNA 3KRSA 2A4AA 3EKLA 1W54A 4M5PA 2A5HA 4OV9A 2ZZ6A 3STCA 2J6XA 1G4PA 3B4UA 1YXDA 2DZUA 4GFSA 4TO8A 3P8JA 2BLEA 3LOTA 5LHFA 2EHHA 2QEZA 5LHEA 3PS7A 1JUBA 3ZWTA 3MHUA 3PBUA 2O7QA 3VI2A 4IJBA 3IIXA 4AHPA 1VYPX 4RXFA 3NM1A 4S1FA 4ZL1A 4JTLA 1DV7A 3HG4A 2VFGA 3TQ0A 4NJHA 3TFXA 2FB2A 3LV5A 3MO7A 3G0XA 4YLWA 1TRIA 4Z08A 2RDUA 3N19B 3ATYA 2WPBA 3P5ZA 4NT0A 1YXYA 2YW4A 4XUGA 1ZFJA 2B4GA 3NPWA 1FWNA 1MXSA 3D0CA 3GR7A 3LRKA 4LT9A 1EB3A 2D73A 2O7SA 1Z48A 4CQ9A 3GNDA 5EMUA 3DBPA 2TMDA 3W73A 2VELA 1SZNA 1CX9A 1J5TA 1WBJA 1VZWA 1TTPA 3LCIA 3M16A 1S5TA 1F6PA 4O16A 4K8HA 4Y8FA 3THQA 3WK3A 1GVSA 1KFBA 3G8RA 2NUYA 4JS3A 1TPFA 3CEUA 1WOBA 4RKAA 1TPB1 2OT0A 4EF8A 3STEA 4Y90A 2QKFA 2CW6A 3MBDA 2GJNA 3NGJA 4DF0A 3CWOX 3L66A 3DHDA 3QFEA 4AH7A 1Q6OA 3I7SA 2ZZ3A 4Y6GA 3C61A 4EOUA 1EA0A 3UPBA 3W84A 1HFBA 3EXTA 2WQPA 5BW6A 4XZ9A 2C3ZA 1FCUA 1QOPA 3DH7A 3HIJA 4HNUA 1YPIA 1TREA 5BMWA 3B03A 2ALDA 1P1XA 3W7DA 4BI7A 3M41A 4CQAA 3KVLA 2NXHA 4CCEA 1G7VA 2CLOA 1IXQA 2RH9A 3BVJA 1TQXA 2H3BA 3NQ6A 1SSDA 3TX9A 3P60A 5KSWA 1HO4A 3W7NA 5F1UA 3O1NA 4UTIA 3L21A 3OA3A 2W0UA 2BTMA 3C2VA 5LNWA 1RD5A 3DU0A 4N2YA 3MUXA 3LERA 3P62A 3C2EA 2WSQA 2HTMA 4UFJA 3V75A 2YZRA 4FNUA 1JR1A 1K7EA 1W31A 3P8IA 1G4TA 3T7VA 1OX6A 3TIMA 1A5AA 3HPSA 1AL8A 3TJXA 4JDBA 1YTDA 5AC7A 2C6QA 1QO5A 5G1YA 3E02A 4AF0A 2ZRXA 1UASA 2VC6A 1OF8A 2ZTKA 4ADSA 2PRHA 3JS3A 3LV6A 3KX6A 3OVPA 1DL3A 4JTGA 1H7NA 3E96A 4MY1A 5HR6A 2E5DA 4E2BA 4Z0SA 4MYXA 1OX4A 1VQTA 5DCDA 4GJ1A 3DI0A 2F84A 5C6MA 2BXVA 3W1PA 1I2NA 3TK7A 4ADUA 2NV1A 1B3OA 2Y70A 3M5YA 3BW4A 4WXYA 1F5ZA 1BEUA 2PRLA 1OHLA 3FS2A 1Z41A 5EL1A 4X9SA 3LRLA 3O8AA 4UFHA 1OABA 3ZWSA 3GZ3A 1JCNA 2VEMA 3W6YA 3S1UA 2AGKA 2V8ZA 3WK2A 1XBXA 3W71A 5AN7A 3TAOA 4HSOA 4MY8A 4R33A 2Z2UA 1JCYA 5E0KA 3AJXA 4O1BA 2G96A 3UWYA 3BG9A 4FIQA 1H1ZA 1OG0A 1R2RA 3ABOA 4LVAA 3A21A 3ABQA 3W2LA 3NL2A 1ICSA 4NU7A 5IM51 4YL2A 3W7OA
chains in the Genus database with same CATH superfamily
3JZEA 3PZQA 1L0PA 4WUIA 4H9TA 1GZGA 5F1VA 3VABA 3T40A 4TTGA 4ZSUA 5L9FA 4QISA 3WLLA 3I6RA 1TTIA 3FLUA 1E70M 5F2LA 2PP3A 3PZVA 3NO5A 4UR7A 3NL5A 2WYSA 3BOXA 2DZSA 4TVDA 4H01A 1XLHA 3CHDA 5ECVA 3MI2A 1JYXA 3PHAA 1OY0A 1JPDX 3NO3A 3CBWA 1I2QA 2Y89A 3RDKA 2E9MA 3WL1A 1KCLA 3U48A 5EFFA 3C2FA 3DDMA 3GC4A 1UWUA 1QT1A 2BVYA 1I0DA 2OSXA 3MP5A 2JKEA 5AFDA 2DQWA 3TONA 4JTDA 4PB3A 4UR9A 3NDOA 1NOFA 1E73M 5LIXX 1QTWA 2WMIB 3RX3A 3WJSA 5U4NA 1RJQA 5J5RA 3VDAA 2W61A 1Q66A 2VFFA 3NZPA 3LNMA 1H7OA 4JTRA 3EDEA 3FXGA 1UZ1A 1BD0A 4MM1A 2AOSA 2ACQA 1JIBA 1MO0A 1CENA 1FCBA 4GI4A 1P43A 4BQ5A 3RK8A 1I1WA 4JL1A 4YWSA 1WX0A 1Y5XA 1HP4A 3QKZA 4JTEA 1EJTC 4K8GA 5K9XA 3JUGA 4LJ3A 4GLEA 3ELFA 4AZCA 2A7PA 3C0LA 1TX0A 4CD8A 3WLIA 3M9YA 1V7AA 1F3TA 2HVMA 1X1OA 3AYSA 2Q01A 2V2HA 2D23A 2W62A 2FJUB 3B0PA 3SQSA 2VKZG 3KL5A 4V1XA 3H54A 3IGHX 2GVYA 1TPH1 3WYZA 3UY8A 3W87A 3WLKX 2Y2WA 1V3MA 1FFQA 2GVJA 1H11A 1VBHA 1O4UA 1J11A 1RJPA 2W66A 3G1RA 2QUTA 1XLGA 2R94A 1QO2A 4MUZA 1GVRA 4TMBA 2BGNE 2QJMA 1C29A 1GKQA 4O17A 4DELA 1AMYA 3UVAA 3VIIA 1Q63A 4W93A 1JQVA 5I00A 3K5XA 4XUYA 2ZA3A 3ABZA 3LM7A 3CK5A 3WBWA 3MSYA 4ERGA 2A2IA 1K8ZA 2PPGA 3F4WA 1QUMA 1B5TA 3WNLA 4DM2A 3RR1A 3VXGA 1EF2A 4Z2GA 3DX5A 1OCJA 3OBAA 2WNNA 2OYLA 1POKA 1TO3A 1H61A 5DY2A 2FGZA 3WQ8A 3WFLA 4CQ8A 1LF1A 4JIPA 2X1RA 3M43A 1LOLA 1OFRA 1KM1A 3GDMA 4FR6A 3W00A 1IXOA 4H8UA 2GVEA 4LV9A 1SFSA 1WAWA 4J28A 1ISZA 3E1F1 4GACA 2FIQA 3BV7A 4HU8A 2EPKX 2J88A 1B4EA 3GDRA 4OHQA 4WY0F 3V7PA 1DORA 1Q85A 3DG7A 3FEMA 1GZ1A 3BG3A 5JBEA 4UIOA 1JCTA 2JBMA 3LLFA 3R0UA 5H2ZA 3Q2DA 3BICA 3KLLA 3FY1A 1TPEA 1R86A 3LHZA 3NL6A 3EPOA 1ZB5A 2E25A 5SWUA 2ZZ5A 1KCKA 3NEHA 4N4PA 5T9CE 4DJFD 4JQAA 4C6KA 2GVGA 2I56A 4H8HA 4ZSTA 4MLJA 1JUEA 1JULA 1LRNA 3C2RA 1BG4A 3L9CA 2GJRA 1EHAA 4AUBA 3AHTA 1ME9A 3WQPA 3BE7A 3HPAA 3KOYA 1ZPTA 1XIGA 3TXZA 1LP6A 3ZJ7A 4KFOA 3D3AA 3KCJA 3ID7A 3BTNA 4AVOA 5G5IA 5IHRA 1L6GA 3ZVHB 3E2RA 3TFCA 3PBWA 3U4FA 3ZIZA 3GRIA 2YOCA 1J0KA 5JH2A 3EOOA 4S3KA 4HP5A 1R0MA 5DANA 2I7GA 3PNUA 1PWMA 3WQFA 4B90A 1DWFM 3CQKA 2VFHA 3F5LA 2ZZ2A 3GG7A 4CN4A 3LPGA 3GDLA 4I9AA 2PBGA 2VD9A 3H7VA 3UJ2A 3NOYA 1UKOA 3B8WA 4XBKA 1F76A 1FWCC 5DCEA 5CPOA 5HNRA 4IXHA 4HYRA 1HL8A 5K7JA 1E6ZA 3S8HA 3O6CA 1GEQA 4G5DA 3B0VC 4RNJA 4Q4KA 2PDHA 1DJYA 4M19A 4QJ1A 2BP1A 4LVGA 2VQTA 4LVFA 3FJ4A 1EX1A 2ZZ4A 3RIKA 2FFIA 3ZMRA 1EQCA 2TYSA 2D69A 2OQLA 3C86A 3GWQA 4JTKA 1IWPA 1S3HA 3TW7A 2FZ9A 1M7PA 3SCVA 3SADA 1E9LA 4XTDA 1UD4A 2PA6A 3IARA 4REQB 3T42A 3VCNA 1UP0A 3ZR5A 4LBRA 4NIRA 2XVGA 4OQVA 2YKKA 5EKYA 2HBXA 1C8VA 4FALA 4HNNA 1UMYA 1RZMA 3S83A 2FJKA 2VX5A 4KH2A 3GD6A 2C13A 4Z2IA 1C8XA 3CTTA 1XRVA 1W3IA 3H53A 2JIEA 4ZMGA 4O53A 3NZQA 1UP3A 4RNFA 2DVXA 4FX7A 5EA9A 2WVVA 4FIRA 3G24A 3SJ3A 1TX2A 1OD0A 1GVOA 3BMVA 5KZEA 1G7UA 1AA1B 1XD0A 3LK6A 3N1AA 2B7QA 3RLGA 4GQ0A 1KR1A 3M64A 3N2MA 1K9EA 1UJQA 4CN6A 1ZU8A 4K68A 4DQWA 5G4EA 2BODX 3GNRA 3VX1A 5IBXA 3PZIA 4AW7A 1S2VA 2FH8A 5ABEA 2QGHA 3VE7A 1K3UA 4G7EB 3FXYA 2X7VA 2VD8A 2WSYA 3U7VA 4JTQA 1UKTA 3ARWA 3TN5A 1ZNNA 5I3IA 3QC0A 5D04C 3A24A 3A9BA 4XBJA 3IJ8A 2HK1A 4EAYA 1GEHA 1RXOB 4DAFA 4HA3A 4QFUA 4G56A 4MLRA 4W7UA 3GTHA 3B97A 4TV6A 2YL9A 4BQ3A 4Z0JA 2YL6A 4KT2A 3ARUA 2C1HA 4QJ4B 3W0KA 4I5XA 4YXGA 3B9EA 2XH7A 4F8XA 1ZLPA 3HN3A 1D7KA 3THCA 2POZA 2E3ZA 3AI0A 5AYBA 7PTDA 1PYFA 3WN6A 1KFWA 5CGQA 3GH4A 2PGEA 4P7NA 4M80A 1POJA 4CCDA 4Z2HA 5I09A 3LPFA 5C9RA 4AEEA 5DEZA 2J47A 4IGNA 3CLWA 2ACUA 3N17A 3OB8A 1QI0A 4K7YA 4RDWA 4O57A 2VMFA 4A4AA 4B3KA 3RJXA 4R53A 1C91A 3GY1A 2OZ0A 1RR2A 2CESA 4J7RA 3N3MA 1WKFA 3DESA 3FHAA 4TX9A 3MUY1 3LB0A 3SCRA 3FSUA 1SZGA 2EPMX 3L4ZA 3CUIA 3MHGA 1T96A 1PZ0A 3CC1A 4C60A 4QEHA 3TEVA 2DJLA 3G1XA 4MFEA 4XSLA 2Z1VA 1KV5A 4RZ4A 2ZXAA 2VNCA 2VZTA 3FJ6A 3CTLA 1K8YA 4L4LA 3WQEA 5I24A 2V5KA 3A3WA 4YTUA 1Y7VA 1CECA 4GK8A 2O56A 3FVDA 2V5LA 3H24A 3RMEA 1UJPA 5F2IA 1XBVA 2V0TA 2E6DA 3N4AA 4ZENA 3F4CA 1GT8A 4OOZA 1D3GA 2Z6JA 1P7TA 3VE9A 4DEFA 4QG6A 4L64A 5DO8A 3VGDA 3NAVA 2WCAA 3VGGA 4HA0A 1LLWA 2CHOA 2IKHA 4MWAA 4ZO7A 3UJRA 4E0CA 1BXCA 3LS9A 2V3GA 5A8PA 2GGGA 1XUUA 3IPWA 2PTYA 1H50A 4IWWA 4WKAA 2XVLA 4NYYA 1A4LA 8CGTA 4YVVA 1MQRA 2FVLA 4UQDA 4TV5A 1XLLA 3VGEA 3AAMA 1Z44A 3W07A 4AZBA 4KCUA 1SO5A 2J7EA 2DSKA 4O52A 3BQ5A 7REQB 4UFMA 4WOZA 4CD6A 2QJIA 5AYXA 5LXXA 2QHAA 2OLAA 3DG3A 3F2CA 3WY1A 3CZGA 4ZTYA 2AGTA 2PF8A 1ZAIA 3TYAA 1D3CA 1KCXA 2TSYA 1PWLA 4J1OA 2GUBA 4BEQA 3TA6A 1EJVC 2X1UA 3V1PA 2DQXA 1V08A 1J6OA 3K8KA 3P7YA 4JEJA 2FVMA 2YCLA 1J5SA 4O8AA 4MWAC 1NWUA 3T2PA 4H9XA 2CETA 2NSOA 3VNMA 2F6XA 2V3EA 1F2JA 4DI8A 1DXIA 1VH7A 3TA9A 5CKSA 3PP7A 2OTDA 3OGSA 4NJKA 5A3HA 3TN3A 1GKPA 3E9AA 4Q33A 4LBUA 3DI1A 5HUOA 1JYNA 1XH2A 1LL4A 3N18A 1EEPA 2R6OA 4JNMA 5JMUA 2EG7A 1KBKA 3TW9A 3MB9A 4L9YA 3O6YX 3TUUA 2J78A 4GG9A 1EPXA 4JTHA 3UG4A 4J3WA 3ZT5A 1Q6FA 3GE7A 1S5NA 2PCEA 5AVNA 3N4EA 1OIMA 3E5BA 3L0GA 4PMDA 3JRKA 3UCQA 1PVNA 1E5NA 4PFMA 4BKNA 2CZEA 2WSKA 1Y5WA 3QR3A 2X42A 1TSIA 5MHBA 2ALRA 1DWHM 3R11A 3CU2A 4AZ5A 4I7UA 2A85A 3MVTA 3WNOA 3LY0A 2HS6A 3IRDA 2YCIX 2FZ8A 2GSHA 3W29A 4AZGA 5HNTA 2Y85A 4IX0A 5EBAA 3NM3A 3R0DA 1MZRA 5IHSA 3V18A 3W1LA 1YRRA 4RX0A 3HGSA 3N9KA 5F4WA 1IGSA 3HBLA 1KLZA 1X1NA 2RJHA 3A13A 2VUYA 3CNYA 1XLJA 5HAOA 4PULA 4DXKA 3MTWA 2OODA 3G1FA 4O1AA 4H7VA 4CNTA 4Q8OA 2P88A 3UD6A 4NG3A 3VNJA 2ZA1A 4QHRA 3GXTA 1P0DA 2OSWA 4QBXA 3QFWA 3ZLGA 2VM8A 4KWSA 4KWOA 1WE5A 4BCEA 2OWWA 2BVWA 3BDKA 3WNMA 4FR1A 1QI5A 3PUEA 4PL2A 5HMEA 3TJ4A 3GIQA 4FX6M 4PTMA 4DUVA 4RDZA 2FTWA 2MNRA 3KS5A 4JFWA 3M47A 3VC6A 3AWOA 4BF9A 1ZBWA 1WZMA 2WBGA 3L5MA 3POCA 3GR8A 3MJMA 2BWGA 1W5QA 1OFDA 3UNTA 4S2BA 3VM5A 4Z17A 3G1YA 1MRAA 4CQCA 2WSRA 4S23A 3LYEA 1TWIA 1V3KA 4UZSA 2HSAA 4JTSA 1W1VA 1Y0EA 3UERA 3O15A 3W70A 3IJIA 1WDQA 4M82A 1E5JA 3SUTA 1ENUA 4YWIA 3DFNA 5I02A 4PMUA 3OU8A 2Y61A 2AQOA 1OQFA 5HOSA 1Q13A 3MW7A 3EPNA 4HPJA 4MPQA 1GVYA 5D9OA 4QSHA 3GVWA 2DSZA 4F48A 4AC7C 2W4XA 2VX7A 1CNVA 1P0NA 4TX8A 4UTKA 3OGRA 1UCWA 2G3JA 4RE2A 4Y9MA 1VFTA 6XIAA 3B05A 5BRQA 1SO6A 4KRZA 3VIGA 4EXQA 1B3WA 4XZNX 3WL0A 3FKRA 4WD0A 1JXKA 2Z26A 1MEWA 4O1FA 3Q45A 4JTUA 2OB3A 1IEVA 1MSSA 4C6JA 4WRHA 4IMCA 3CL8A 4FLOA 4L5ZA 5HATA 2CBVA 1A47A 1GOKA 1KCZA 1R87A 1E71M 5LSMA 4IXXA 1U5JA 3L65A 1HZYA 2J77A 1LBMA 3RJYA 2HBVA 2YPIA 2PRMA 3CMGA 2R1LA 3EWWA 4CU7A 5ABHA 2P53A 1IWAA 5A6AA 4C65A 1QPRA 4ATWA 3PANA 1CW2A 2NQ5A 3B9NA 3P81A 4RV3A 4XVDA 2C8NA 3NQFA 2G0WA 3D3FA 5I7GA 1X98A 3AHYA 5DBTA 4F0MA 5FF0A 2Y0FA 2Y8UA 1FWGC 4FX8A 4HU0A 4GC3A 2ADAA 3VNDA 3LCFA 4J3XA 3SCSA 1XD1A 1K6AA 4GA8A 3M0ZA 4FB7A 2B7PA 3BOLA 2Z1KA 5LA1A 1ODUA 3O05A 5CC5A 3NZGA 1ZP3A 3C8FA 3L4VA 3BARA 1R46A 5GJNA 1A80A 1TMHA 3WQWA 2V68A 3GNOA 5FJOA 1M68A 1EO5A 4HMDA 1CGVA 1JZ7A 1S2WA 3EX6A 1UH3A 4FSAA 4MAVA 3BLIA 4WXZA 1IIGA 3NQ7A 3TLQA 3EOEA 3VIFA 5I06A 3NNTA 3VUPA 3W28A 5CPMA 2BX7A 3ZFHA 1TWSA 3S2NA 1FDYA 3IK4A 3H2MA 4HPNA 1Q3NA 3W86A 4DWSA 4CCZA 3B8SA 4DHGA 4W88A 3SBFA 3EX2A 1HXJA 1N2VA 3B9OA 5DLCA 4LAUA 1EBGA 2PDUA 4H7ZA 3UA3A 3M0JA 1UPPA 1VFHA 2HS8A 3VD3A 1EL3A 4KEZA 1HGWA 1LQ0A 5CAHA 4H8VA 3F2DA 4IPNB 1TPUA 1E9IA 2CWNA 3G6LA 3S6DA 3LCHA 2NXIA 2YXOA 1EZ2A 3W2NA 3OBEA 3SSJA 1YDYA 1BAGA 3M4HA 1GHRA 3HV9A 3U2EA 3A3HA 5KMYA 4DWSB 5DQPA 4Q8WA 3PG8A 3WCZA 4FXSA 5FACA 4GMEA 2RKXA 3IJ6A 4ERIA 5AKQA 3ARYA 4LC8A 3SECA 3AC0A 3PK7A 3T0DA 5I03A 1M6JA 4IP5A 4J40A 2CBIA 5AB3A 3VDGA 3DC0A 1I2PA 3WEMA 3HFTA 3GHSA 3W38A 3GDTA 2QJGA 3WFZA 5G1MA 1VRXA 1UZDA 3VAVA 2X1TA 1KKRA 1OFPA 5D03A 4NX0A 5HULA 1GW9A 4KMQA 4LUIA 1FWIC 4LC6A 1N82A 1ZTVA 1GQLA 3I10A 1TUXA 1MUWA 1IZCA 1JD7A 1HKMA 1E3ZA 3TDFA 3QQ1A 2I5QA 1BVNP 1P4CA 3WZ0E 2XINA 3PAOA 3GLCA 3S3GA 4HT3A 1LRQA 4MOZA 2H6RA 4NL1A 3SGUA 3NL3A 4WDTA 4IGHA 3U4AA 1FCQA 2XFFA 5CSRA 1CB2A 1BXBA 4JCMA 2Z00A 3ZYZA 1S2CA 3W82A 3I3DA 2X8RA 3MMDA 4LRTA 2BXZA 3EGJA 3WKZA 4YYFA 4LYRA 3UNDA 3OTRA 4FNSA 3BMXA 5HMFA 1PYMA 4GNJA 3DKJA 3UPWA 5MF5A 4M0XA 2I57A 3BXWA 2WMJA 1C9DA 2CHRA 1TQJA 3RMJA 3VX0A 1HL2A 3WSUA 4QE4A 2NV9A 1PHWA 2ODOA 4JAWA 3KL3A 3A4JA 1CGUA 4XZHA 1WAUA 5DFAA 3VU2A 3CHFA 1H7XA 1DHKA 4LVBA 4JN7A 3KTSA 4KWWA 3WEZA 3G77A 2QAPA 2OPJA 2PDKA 1J0IA 2OOFA 4F2TA 1M3UA 5DMYA 1SYTA 5GNXA 2GPTA 2ICSA 4JIQA 1JAEA 4LF1A 3BAXA 1QJWA 2F7FA 3URQA 3IV3A 3EEGA 4ICMA 1KA9F 2BOEX 4XK2A 1VFMA 1OC7A 2QCLA 3N04A 4H6RA 3N6HA 2PEVA 1FWSA 3PPHA 1W9BM 4LY4A 5TIMA 1ONRA 3F5JA 4DIAA 2J4GA 2XM2A 1BWKA 5BROA 1B3VA 2R91A 4PCNA 3W7KA 4B9YA 1UUMA 2C71A 3E49A 3B9DA 5JXQA 4NJGA 3WQ5A 3N29A 1T8QA 1IT8A 3OOQA 2J7FA 5CLTA 3GDKA 1EDQA 5HJXA 5LXEA 1UBPC 2ZX7A 2NVDA 8A3HA 4JTTA 4PBGA 4CNNA 5HPCA 4EVZA 5I23A 4X2RA 1P5BA 2VRKA 2EBNA 1L2UA 3IV8A 5K2ZA 2A1YA 3GVGA 2OKOA 3V16A 4JBRA 4CKQA 3USZA 3WUGA 4YS1A 1UQYA 1JRBA 1KBIA 1JJKA 6ENLA 1OYCA 3LG3A 3B3DA 3ZVIA 4XO6A 1AK5A 4FHAA 1FHVA 1DTUA 4ZOCA 4PSPA 1CT5A 1LLOA 4PUEA 1A3HA 2ATSA 1JCXA 3W23A 4JQ1A 4WIWA 1SO3A 3NJ3A 4NYUA 3UWEA 1R7OA 2NXGA 1RVKA 3ZLHA 4O12A 4TU1A 1B30A 2VURA 3VOHA 3ALGA 1LTDA 4JGDA 6ALDA 3RNDA 4O10A 2QDEA 5CCZA 4BEUA 2UY3A 4WOQA 1PIGA 5FCZA 4ZQNA 3AXIA 4LCSA 3C2YA 2GGHA 5KINA 1VCVA 3TU9A 3AUOA 4PCFA 1UHVA 2ZC1A 3ITTA 1GG0A 1XIFA 2NLYA 3K8MA 3GBEA 4U3AA 4PMXA 1YPXA 4K1WA 1JCMP 4XZLX 1LUCA 1HKJA 1KFJA 3KVKA 5EBUA 4BR1A 3BOFA 3W85A 2J13A 5E70A 3ZT7A 2ZUSA 3TYCA 4YCPA 2Z2BA 1VRDA 2ON3A 5D9NA 3AS0A 1M7OA 4Q8TA 5REQB 5CBJA 1JDAA 3KRSA 1W54A 4M5PA 1R3QA 4LUSA 1C7SA 1TJ2A 2DZUA 4ZA0A 2IPWA 1CIUA 3JW7A 1KC7A 3LOTA 4AIBA 3GVRA 1H41A 1OGBA 1T41A 1YEYA 1WZLA 4E2VA 1H09A 1DV7A 4IT1A 1XSIA 1ODZA 2WWCA 3ERPA 2UBPC 3AJ7A 3FVMA 3N19B 1RSCA 3ATYA 4YYCA 2OR2A 2YW4A 1UC4A 4XUGA 1ITQA 4GY1A 4JCLA 1FWNA 2VZSA 4DBWA 3FNDA 2O7SA 2CWXA 2WZIA 3W73A 2XGBA 2X41A 1TTPA 3LCIA 4IH3A 1S5TA 1US2A 4IIGA 4D6CA 3WD1A 3R94A 1XF0A 2NUYA 1A5MC 3QV9A 4WJ8A 2BBFA 4RKAA 4Q8QA 2QLYA 4AEFA 1UD8A 3SN1A 2GJNA 1P6WA 3NGJA 4DF0A 4QS6A 3L66A 2ZZ3A 4QDWA 4GY0A 4Y2WA 4F9JA 3UPBA 2WQPA 2X0YA 1UR0A 1UD3A 1FH8A 5C70A 5EU9A 3P14A 2DIJA 3TQPA 2G4FA 1TREA 2ALDA 5CJMA 5FL1A 4BI7A 4HNCA 3NSMA 2NXHA 3RPMA 3WLMA 3MS8A 4KCVA 4RE0A 3NCOA 1TQXA 3TWAA 2YL5A 3VIHA 1IGWA 3R1ZA 1V6XA 4L61A 5C7VA 3Q67A 2W0UA 1RD5A 3DU0A 3P62A 1XLEA 2OFJA 3JU2A 2HTMA 3MSGA 1W9DM 4DJFA 4FNUA 1W31A 3S6TA 4KCTA 1A5AA 1AL8A 1I9CB 2O55A 3TJXA 4GVFA 1YTDA 5AC7A 1MQQA 4JHMA 5G1YA 2X2YA 5CH9A 4AF0A 4KBXA 2FH6A 4MB4A 3VA8A 2PLCA 4LAMA 1HJVA 3TTSA 2OVLA 1H3GA 4KGLA 5HXMA 1I6NA 4GQBA 4MJ4A 3FYYA 1BVZA 5T8GA 2BXVA 3W1PA 3ZVHA 1P6BA 3W27A 1HJUA 2XISA 2X0HA 4MGGA 4WXYA 1F5ZA 3BCJA 1BEUA 1OHLA 2ACRA 1CDGA 2GZXA 5EL1A 3MZNA 5HQMA 3O8AA 2R82A 4UFHA 4PR4A 3RM4A 3GZ3A 4ZR8A 1AH0A 4NAEB 1XRSA 3S1UA 5B80A 4IG2A 5CG0A 5HBFA 1TELA 2ZVRA 4HSOA 3U5YA 4R33A 2Z2UA 4IICA 1JCYA 5E0KA 4O1BA 2HRWA 2PDNA 5CSYA 1H1ZA 3FSTA 1LQ2A 3VO0A 4LAZA 1HVXA 3ABOA 4LVAA 3A21A 4PUKA 3MUAA 1J0JA 3PWAA 5FEPA 1VBGA 3W25A 2PTZA 1R3YA 1FXPA 3N14A 2IQ0A 2J7CA 5CZKA 1W9VA 5ABGA 1QWKA 3SUWA 4GO8A 3CWHA 2X7WA 4GIYA 3SCUA 3IJ7A 1KNWA 1O6IA 4MDOA 1E40A 3OZPA 3EDKA 4UTWA 5DCBA 1NSJA 1XGDA 2Y5SA 3UCDA 1DWJM 4MWAB 1N7KA 1KV8A 4UXDA 3EB4A 4EXBA 4F0SA 3UXDA 2G37A 3RCNA 2UV8G 1TE6A 4A2RA 3DYPA 5D05A 1A5BA 3MYPA 1HKVA 3TLLA 1YQ2A 2NW0A 2V82A 4M1RA 1U2YA 4NJIA 3TWBA 3S47A 1H7PA 4GUGA 4DYJA 1R9XA 4DO4A 3PZMA 3W7EA 2J9YA 1IEXA 3LPPA 1W8SA 4C6IA 1V0NA 3O0FA 4R7WA 1DYSA 4AIEA 2BHZA 4BFAA 5D32A 4C5ZA 1XM3A 3N4FA 3URBA 3UW6A 3CPGA 2WHJA 5KITA 5GPRA 1XBYA 2NX9A 4OECA 3UGVA 2JGQA 3V0UA 1QNQA 2G41A 4GIEA 5GJPA 4I3GA 3GX9A 4P7LA 2JEQA 1TZ7A 4O13A 9XIMA 2Z2AA 4O1DA 4P5UA 6TIMA 3QSRA 3FGCB 4KEMA 3E38A 4C7GA 3WD2A 3R2GA 3I6TA 3NVDA 2VEKA 4PH6A 3H2FA 2WJEA 3FK4A 2F61A 1TCMA 1QFEA 1C90A 1B54A 3QHNA 4CQBA 2VC5A 5I77A 5AHMA 9XIAA 3WO8A 2QF8A 4IZGA 3QKEA 3HJZA 3WG6A 4UUIA 1R5YA 4C91A 2BVDA 3LGGA 5BOOA 1RJRA 4XG1A 1OSEA 3W83A 3F5KA 1RHCA 2XIBA 3BLOA 3IANA 2VEGA 3O3RA 3LBCA 1KM4A 4EIVA 3FDKA 1OK6A 2IKGA 4M1BA 4P8XA 4XIMA 2E09A 1QDSA 1UC5A 4GQGA 1OX4B 3UP8A 4S39A 3KOXA 3L0KA 3L4XA 5IFTA 3TE9A 1XGEA 2OO6A 4JX4A 1B3XA 3EB2A 1YADA 3HM7A 1E72M 1REQB 5AC8A 5HDRA 3DAQA 2YIHA 1H1YA 2ZUUA 3W7MA 3HMCA 1W3TA 5FAJA 1QK2A 5FIPA 3VOJA 1RBOB 2YCEA 3NQEA 4MYAA 5DMLA 1OINA 1LBFA 2GQAA 2E8ZA 3AIQA 3QMRA 3DYMA 4A35A 1O5RA 1V51A 4KW2A 3CUHA 4DYEA 1JZ4A 4E5TA 2WANA 1DJNA 1WO2A 4JR5A 4EPBC 2HROA 3JZUA 2P0OA 3BG5A 4GH3A 3VZXA 4HA4A 2WKJA 1G4EA 3YPIA 2CYGA 1BQGA 2J7HA 4JICA 2ZBTA 3N25A 4L6DA 3A47A 1FFRA 1FX6A 2DZXA 3ABXA 3LDVA 4UTLA 4X2PA 1Q6RA 3SSZA 1ZSXA 4AZIA 1AH3A 3OLGA 3UJSA 4D6EA 2HQAA 3RO8A 1XDJA 1XIIA 3IGXA 3M46A 3ABSA 3A64A 4GXWA 2O4MA 1W1ZA 3NA8A 4RXGA 4YPJA 4V15A 5KETA 5HJYA 3QZEA 3EXRA 1M03A 4ZOAA 3LLDA 2OU4A 2GJPA 5C9ZA 3GIPA 2XN1A 1V03A 5HQEA 4O0QA 5D9PA 1J12A 1C9WA 4E2OA 3LHTA 3QV7A 1AW1A 2V5CA 1AODA 3W26A 1PKYA 6REQA 4XAGA 3MCMA 3W1NA 1HTIA 5I79A 4G1NA 2CLKA 3BK0A 3LN3A 4A3HA 1IR1A 2C7FA 1EP2A 5A69A 2QQ6A 3H12A 1VFLA 1V02E 4S3GA 2NT1A 4DJDA 1W1PA 1A0CA 3HOJA 4LAKA 4Z1DA 1FWHC 2GJLA 3W7CA 3B04A 4DBUA 3LHUA 3L4UA 3K4DA 1H0GA 4J3UA 4GCXA 2WLYA 1OFEA 1ZZMA 2OEJA 3VFCA 1CGYA 1ICQA 4MSSA 7TIMA 2VZUA 3TTQA 1VLIA 4LUYA 1MNZA 3SGGA 3NFUA 3V3WA 2TAAA 3E0FA 3PULA 3NPXA 2V38A 3AYRA 2BASA 4UTHA 2WNQA 1TYGA 3WUEA 3EA3A 4UQAA 3E0IA 1K9FA 3QJAA 1O95A 3PUGA 1PJ9A 4L4OA 5K4ZA 1EFZA 4E3VA 3R58A 3CT7A 2ZADA 4XAZA 1E55A 1T8XA 3H70A 1KQZA 1XIHA 2PDCA 4WGXA 1QK0A 3RPDA 3U2ZA 2WJDA 1TG7A 1JNEA 1D7FA 1WUEA 4ECLA 3QPEA 5AHFA 2PWHA 3GNPA 4JHZA 3KRBA 3OQ8A 2HVNA 2NLIA 2DUAA 3QHOA 5G4HC 5BXTA 1IT7A 2X09A 4J3TA 3GVQA 5CAKA 4HHMA 4AWTA 3WLJA 3NURA 4LAOA 1ISVA 2XVKA 3HZ3A 3ENLA 5D2TA 3WDRA 1YDVA 1YLVA 4ZGYA 2YA0A 1AZ2A 2DH3A 3PZ9A 1NDVA 1OK4A 3GKFA 1AD1A 2E5BA 3WJYA 4QCFA 4W85A 3IUDA 2PF0A 1YTEA 2XH2A 3O6AA 3V1HA 5E93A 1W9PA 2PFHA 4IF2A 4C6PA 3SUUA 2NVCA 4W5ZA 4J9JA 1JDDA 3CB3A 3UGRA 4PL1A 4QITA 1GYNA 2FYMA 1LWIA 4LWWA 1K70A 4AD2A 1EH9A 1IXNA 3SCQA 1UIOA 2Y63A 4GH1A 4R88A 3KWXA 1LCOA 4M7SA 3TAKA 3LCWA 4AY1A 3ZT6A 4HOXA 1XKJA 3EA1A 4G2DA 5A8MA 4O4WA 4ZB5A 4PTWA 2BNJA 4GE8A 3P5YA 1W5MA 5FF7A 4Q22A 4G1KA 2WM1A 3EX3A 1XL9A 3I3BA 4HN4A 1UKPA 2BS9A 1RH9A 1W5PA 3F1QA 3WNNA 1ZAHA 1XLFA 2A79A 5LNSA 4X61A 4NXSA 3CM4A 3RU6A 2HNHA 3WF0A 2OZ3A 4LFYA 1JEZA 2AQVA 5DN1A 3AZRA 3P67A 4I6KA 2V2CA 4EACA 2WZMA 4UTUA 2BG5A 3S9YA 1I8JA 1RPKA 3MY9A 1BYBA 1D2KA 5FJRA 3WH6A 2Z7KA 3T4WA 5ABFB 4A05A 4AHQA 4HTYA 2INEA 1JI1A 4C6EA 7REQA 3R10A 4ZOBA 4PB4A 5LIWX 1UR3M 1VKFA 1C7TA 4O0ZA 5AVHA 4IG2B 2PDPA 3W6MA 3VKDA 4BHYA 3AFBA 4IMAA 2JF7A 1Q7MA 4PMJA 5LGXA 4H1ZA 3IS4A 3R6IA 4PEEA 4US5D 5FJJA 5JU6A 2GUUA 1JCJA 2E7FA 3EWUA 3LQGA 3RCMA 2PLKA 4F66A 4ZVJA 4L56A 1K7XA 4GGHA 3R89A 1QNPA 1ZCOA 3E5PA 3G18A 2NQJA 3ZOAA 2VGIA 4GJJA 4NNCA 1BSLA 1THFD 3LTYA 3M0HA 4ATDA 3NQ8A 2D0HA 3PPFA 4OE7A 4MADA 4MKVA 4WLCA 4UFKA 4C1LA 2DSUA 4IQLA 1N8IA 2H3DA 5DBUA 1EWDA 5TNVA 5D38A 2CU0A 1W3LA 3DFSA 3NZRA 3KZSA 1JF6A 3DFHA 2UY5A 3BC9A 4H6EA 1FOBA 5T91A 1PL9A 4U3CA 2BXYA 4O4VA 3W9ZA 3LCGA 3MI6A 3FA4A 1E6SM 1RK5A 3SRFA 4WSKA 2CZDA 2YX0A 3TSMA 3ZXWA 1SJAA 3KL0A 5BWFA 2NUWA 3OO2A 3PJUA 1SPQA 4Z1CA 3FN9A 4GQRA 2AL1A 3T78A 4MAZA 3EZ4A 2C15A 4OZOA 4EX4A 1SQ7A 3VOGA 3EMQA 5E1QA 2PTWA 5AC6A 3S5ZA 2D20A 3H55A 4JPGA 2QZRA 4BJHA 4UR8A 5LNRA 2E1DA 1DJGA 4DWSD 2QGYA 3CV1A 3HQPA 4JN8A 4LU0A 1R47A 1TJ0A 2XGIA 4P8UA 2HCVA 2OJPA 1WV2A 3HFYA 4KIEA 3NQCA 4HZMA 3VKJA 5G4WA 4PUJA 1HUVA 4HK7A 2P5NA 5HA7A 3NSNA 4WSJA 3BPWA 4KEUA 1WDWA 3S42A 1XSJA 3KOWA 2EKGA 1KWGA 1S38A 4IISA 2Q8XA 3ITGA 1DJZA 1WA3A 3NQVA 4MY9A 3WLPA 2SFPA 2JK2A 4WDUA 1UWTA 1RPXA 3O63A 4YHGA 2QCFA 4B2DA 1MZHA 1LWHA 4LYKA 1ALDA 3VDHA 1KFLA 3RILA 3DG6A 2ZC8A 4GZIA 2H9AA 1HP5A 4A3UA 1DIEA 2EPHA 4R7JA 4R5EA 2ZE3A 1M9HA 1JGMA 3ZM8A 2E6FA 1PV8A 1JDCA 2Y8KA 1XLCA 3ZJKA 1AL7A 3Q65A 2E6YA 2VR4A 4GX9A 3N13A 1FH9A 1JYVA 1OFBA 3VINA 1UR4A 3FDGA 4HK5A 4V27A 3TN4A 3CXOA 4MB3A 4JTFA 2XUCA 3CQ0A 3T55A 4KETA 3FYPA 4F0RA 1UD6A 4HNLA 4I7VA 4K37A 1BQCA 4ONVA 2J62A 4IIDA 2R14A 2PSNA 3TJLA 3MSRA 4GZJA 1K1DA 5H1WA 4B5VA 3SR7A 1R3TA 1ECEA 4MTVA 5AHLA 5A5WA 2E1WA 2IPJA 4DJEC 3VGFA 3VK5A 3ANVA 1P0BA 1Z69A 4B5NA 3B0YA 4GYPA 1LM1A 4RZ5A 4EPDC 1R3WA 4HHPA 4W8LA 4H00A 4OWGA 3MYOA 1UROA 5LGZA 4YTQA 2QT3A 4OIFA 2OEMA 4A3YA 4F0HA 3FFSA 3U3HA 3LI0A 2PTXA 3UQNA 4JY8A 1SO4A 3RN6A 3HV8A 4JTCA 3K8LA 2VI0A 1QRQA 4MJMA 2YB4A 2XSBA 4PUUA 3ARXA 4IPLA 3VIJA 3PSWA 3COTA 1EBHA 1RV8A 4AWSA 5CZJA 3II1A 3RU8X 2Q3RA 1PE1A 3QR1A 2J7DA 3H21A 4E2DA 3WD4A 4D8LA 2V5JA 4OJYA 1VCFA 3NQBA 1X6LA 3IK2A 2QXWA 3DYOA 2QUNA 4K39A 5A2CA 1J0HA 3KRUA 2YA2A 4MJZA 3DENA 4B5WA 3I65A 3TP4A 4FNPA 2C18A 4D1JA 3IJQA 5ABFA 4JTIA 2GOUA 2X05A 5CPQA 1DVJA 2WM0A 4RE4A 6REQB 1KTCA 3PTDA 3MT1A 3TQVA 1EC8A 1IR2A 4AG0A 2Y24A 4GYKA 1RQHA 3VOIA 2ZRZA 2ZRYA 3GSMA 1K4HA 1BGGA 3TKFA 3BW3A 1JFHA 3WUFA 3KTXA 2RDTA 3HA1A 2QCNA 1UOKA 3CIVA 3PBYA 4B5UA 4CLMA 3S1XA 3G3DA 4HN8A 3DGBA 3LXCA 3CGTA 1GVEA 1B0IA 3MJYA 3KBNA 3THDA 1GYLA 2WJFA 1YX1A 1XIBA 1O12A 4S2CA 5FKYA 1EGVA 3FHQA 1OYBA 3CPUA 3ICJA 1GONA 3PB2A 1DIOA 1LYXA 3AXXA 5HQLA 1UUOA 3OP2A 3W2JA 4PUWA 4I9TA 3SW6A 4MKSA 4IGMA 1FUYA 3KEHA 3WNPA 3SO7A 1LT7A 2DZTA 1EJUC 3DGRA 1MDRA 4I8YA 2VFIA 3CAVA 1TZ9A 4PGLA 3ZSSA 3N9RA 4CVUA 2I1OA 3NQDA 4D72A 2C1GA 4JEQA 3UETA 3KOZA 5LIKX 3BO9A 1CLVA 3RUBL 1A5UA 2VRJA 3PJTA 2QAFA 4HPGA 4KS0A 4CEXC 4HHHA 3CHCA 3VIMA 3PPGA 3KW3A 1TPC1 1BF2A 2VGFA 4W5UA 1Q65A 3RM8A 3D5HA 3QC3A 1JCLA 2QIIA 1E43A 1RBLA 3AZTA 4EP8C 4PN2A 2GSEA 4Y8EA 1UKQA 3S5NA 3VPLA 3BAJA 4L65A 2HVOA 5EYWA 2EJ1A 3OZMA 4DUWA 3UZ5A 2G4JA 2V9DA 4QSFA 3ZJ8A 1BTCA 3O7UA 4GUHA 1SW3A 1E1CA 2NQLA 4HCDA 4P2VA 1XLBA 3UF9A 1ELSA 2VDHA 3OHIA 3VD9A 1CXKA 4AMAA 1G0CA 2RJGA 2ZRUA 4LS1A 1UH4A 3TH6A 4O50A 1WXZA 4S3FA 1ZBKA 2RHGA 4EKJA 1OYAA 1D8WA 3H4WA 5BU9A 3LHWA 1VJSA 3NQMA 2D0FA 4RL3A 4QS5A 3HQ1A 3FAXA 3V0TA 2O4QA 2EPLX 2XIOA 3LSBA 1KXQA 1EOMA 4WEVX 4BWLA 2YDSA 2PBOA 4IFRA 1FA2A 1AFSA 1P6CA 1T99A 5FJUA 3P80A 3PSVA 3APGA 1F6KA 1H7RA 1J9YA 1FDJA 3SRKA 3NPVA 2PGFA 2XIIA 5DRCA 1AVAA 3P84A 3TYDA 3CQHA 4PEKA 1NIUA 1GTEA 3T0BA 3VYLA 3K13A 4PMVA 3MUZ1 4WR3A 5BRPA 1GVIA 2QPXA 4FNTA 2GL5A 2WZEA 2ZFAA 1JL8A 1OX5A 4HNTA 3UXKA 5AC4A 5C9XA 4UC5A 4N9CA 1FHUA 3H7RA 1K02A 1NAL1 1V3IA 2QCEA 3D46A 2QJNA 4IP7A 2QPSA 4O0KA 3CIWA 3LZ5A 1XG3A 2YR1A 3PR2A 4GIRA 1EPVA 2DJXA 3M6YA 1XPYA 4ADTA 4FK9A 2FB3A 4Y9OA 2QCHA 4AHOA 4FI4A 4MNMA 2A6NA 1DHPA 3S9ZA 4GKTA 3N73A 1XJBA 3R7MA 2QYGA 2OELA 1LOQA 4EWND 3M44A 4DXXA 3MDWA 2VFEA 4GNKB 3RRXA 3FJLA 4QQUA 1IEIA 2FPVA 1FH7A 5CGMA 3QMSA 3W7RA 3ARSA 1Q45A 3RITA 3UZWA 2OO0A 1PX4A 3AS1A 1OG6A 5EMKA 4M7TA 1MW0A 1Q6GA 4CN1A 2W9MA 2J25A 1KM0A 3GYEA 1CYGA 1EOKA 1ZALA 4C90A 5XIAA 2RGLA 1W8GA 1W1IE 4C6DA 4Z1AA 1OVDA 4U2YA 2ZZ7A 4DBEA 3W1MA 1WZKA 3MPGA 1KRBC 4RPQA 4S3AA 1XCFA 1X96A 2Z1XA 4RNIA 1PX3A 4MB5A 3QEZA 4LY8A 3ITCA 4PRRA 1TJPA 1FP8A 1Z42A 1E4NA 4U33A 4JX6A 3S2JA 1PZ1A 4S38A 4QAWA 4Z42C 1OF6A 1YDNA 5A2AA 2ZIDA 5CPNA 1JPIA 4UMBA 1O66A 5HINA 4OU1A 4QNWA 3IJLA 4IL2A 1GZJA 5M2FX 4DVOA 2F2HA 1D3HA 1EYEA 4L6HA 5JVLA 1DJXA 2FZBA 1ZUAX 1IE7C 4LH8A 1PTDA 3GFXA 5F4XA 1I0BA 3SN4A 4UFIA 1W17A 3WQGA 4WSHA 1JG9A 4HPXA 5A95A 3Q37A 2FZDA 3ITVA 3UESA 1B2YA 1B9BA 2IQDA 2WLZA 2JGYA 4I8DA 1IZKA 2YCLB 4ACZA 4RDYA 4DLMA 1O1ZA 4DN1A 3LGEA 1CCWB 4N42A 2YXXA 5DMNA 4US6A 3AALA 3STPA 1UZ4A 4NZ3A 1MW2A 3WEOA 3PUDA 5CPLA 1VCGA 1NU5A 3WLTA 3N6QA 3QH2A 2WCGA 4FOUA 4FEZA 4OUIA 2XU2A 1GOOA 3M1ZA 3BMWA 3N2BA 3T09A 3TYUA 4NVTA 3GG1A 3FV9A 4L6OA 3E12A 3SUSA 4Q7BA 3VIOA 4ZE5A 3PY2A 2PD9A 1R8LA 7XIMA 3WNKA 3GU2A 4ROQA 4POCA 1E3XA 3WQVA 3PZTA 2PS2A 4I5UA 2F6UA 5HANA 3R8RA 1V93A 1M1BA 3MV11 2C14A 4JIIX 4NZ5A 4GI8A 2OGYA 4NHVA 1W1B1 4D71A 2GDVA 3SFWA 1EP3A 1NOUA 1PCKA 2JEPA 3C2OA 1TPDA 1LZOA 4GZ7A 4CD5A 4L1WA 4D1IA 1W1A1 2FTYA 3V35A 1AQMA 4U5IA 4CEUC 3GXPA 2DIKA 4RJEA 4DJEA 3A6OA 1HJWA 1ZBVA 3ECQA 2XIMA 4O54A 4BI6A 1K6WA 2BSLA 3CUFA 2CC0A 3W2MA 4HU3A 2QDHA 3LENA 3OHMB 4G8TA 1T5AA 2C0AA 4IJRA 1L9WA 4RDVA 1CBGA 3N2OA 4ZEPA 4IPIA 4FAMA 5D2XA 1A49A 5I2UA 2HE5A 2JFEX 4JIHA 1WYIA 1B3YA 4B91A 1VFUA 4UNKA 3T6CA 3BCFA 4EPKA 5GNYA 2UWFA 1DWGM 1CB7B 1I60A 1X7IA 4HNVA 1TRDA 2Y5JA 1VR6A 4O1CA 2R9RA 3TSDA 4KRUA 3AICA 4L4PA 3LA4A 1X38A 4C7FA 4O28A 1CPUA 3KVJA 2G50A 5KZMA 3PM6A 2Q71A 5JH1A 3ATZA 1DPMA 5K9CA 2WW5A 2W3ZA 3DEQA 3M5VA 4JN6A 4L80A 2OSYA 1UH2A 4M6UA 3EKLA 2A5HA 4OV9A 1GOMA 1G4PA 1YXDA 2XFRA 1ISYA 4TO8A 3GHRA 2R1NA 1R9ZA 4NY2A 5LHFA 2EHHA 2QEZA 5LHEA 3PS7A 4MUPA 3VI2A 2JE8A 3IIXA 4AHPA 1XQKA 1VYPX 3NM1A 4ZL1A 4W7VA 3ME3A 1VBRA 2PGRA 4QE1A 3BSGA 2INZA 1S3TC 2BY3A 3G0XA 1RP9A 5DT5A 5EMLA 4HYWA 3M07A 1HJQA 5H6HA 3P5ZA 4MMWA 2B4GA 1EGMA 1IZJA 3NPWA 4FS9A 3OYZA 2HK0A 4J27A 1Z48A 2GK1B 3MUIA 3M0IA 4GVHA 5EMUA 2HJPA 3E3HA 3XIMA 2DW6A 1CX9A 4ZTXA 5A2BA 1J5TA 3OGVA 3WK3A 3MA8A 4GXPA 1YHTA 3REQA 2XYLA 4QJ5B 3T8QA 3B40A 3B8VA 4I9JA 3SCWA 4TQTA 1P0EA 3STEA 2QKFA 3MBDA 1UA3A 3CWOX 1KWKA 1Q6OA 1MI3A 3T08A 4Y6GA 3C61A 2Z4GA 1DIKA 4V33A 5BW6A 4EK7A 3H2NA 3WENA 1FCUA 2XPKA 5CC6A 5MKGB 3FCPA 5BMWA 3B03A 1SJDA 3ARQA 1SFTA 4JTAA 4PRTA 3MMWA 4BZYA 3UG8A 2E8YA 3O0KA 3TC3A 4Q4SA 3WMLA 3UG3A 3BVJA 2GGEA 3NQ6A 1EHNA 6PTDA 1ONWA 5IDZA 4F4RA 2PWGA 3W7NA 5F1UA 3H7UA 2BTMA 3V36A 5CXPA 3MUXA 3KTCA 1IQ8A 3C2EA 2FMNA 3GR4A 3V75A 3GH5A 4P8VA 3P8IA 4IIBA 1OX6A 3PN8A 3LZ3A 1Y8BA 4DJDC 4J2MA 5IDIA 5I5RA 2KAUC 2PDQA 2VDGA 2J7GA 3LUTA 5IXEA 2VC6A 1OF8A 4ADSA 4PUMA 2J75A 4IP4A 3AIVA 3LV6A 4JTGA 3OVPA 1DL3A 1H7NA 3E96A 3HJEA 2E5DA 5DCDA 4GJ1A 4GD0A 2NV1A 3CAWA 3RAOA 3BW4A 4ZE4A 2PRLA 1HF6A 4B5SA 2DT1A 1OZQA 3LRLA 1OABA 1JCNA 1TVPA 1WDPA 4Q8PA 3M0VA 1XBXA 3W71A 1DJIA 1GNXA 2AL2A 3TAOA 2A3HA 1XYBA 2G96A 4ZB2A 4FIQA 4MJ2A 4A8IA 1BXNA 1QBBA 1R2RA 3ABQA 4WDXA 3NL2A 1ICSA 1OEPA 4JQ3A 3W7OA 3ITYA 4UQCA 1T40A 1UBSA 5AZ0A 4RZ6A 1G94A 1NARA 2Y8VA 3BCDA 3GAKA 5D9MA 4WHBA 3WQDA 1A5SA 1CXEA 4IM4A 2D1ZA 3FA5A 3UXIA 2VRQA 2I14A 5AYZA 5E9XA 3UYIA 1IYXA 2WVSA 3GTIA 4O1EA 3DERA 3RPTA 4C6NA 4PCTA 1W1YA 1CEOA 4NRRA 4A6GA 1TA3B 1YIXA 4GO9A 3A22A 3L67A 3QTPA 4HZ6A 4JFSA 1PSCA 4MWAE 1QNOA 1VJZA 3OODA 2O9TA 4H6KA 2VVNA 3QPYA 4A2SA 2OWXA 2DU2A 3G6MA 5REQA 3B0XA 1BRLA 3AXHA 1ZAJA 4OV4A 3U2CA 4GWEA 2JQXA 3SIZA 3TVAA 3G1SA 2CLFA 1FY6A 4Q4PA 1NJJA 4LTSA 3GUWA 1N55A 2A7RA 2C79A 3UPMA 4BS0A 2CCRA 4F2UA 2D2GA 3AIUA 1MXDA 1XISA 3KCLA 5LA2A 4U5KA 4D2JA 4RCXA 4X22A 3WJXA 1XWYA 4CVWA 4RK8A 4DWDA 3N3TA 3XISA 1SFJA 2WO5A 3MHFA 1LQAA 1Z7AA 2HXUA 2OWCA 1PKLA 3HO8A 1ZJHA 5AHNA 3TNOA 3QQ0A 4PMRA 4NP7A 3E2VA 3UWUA 5C54A 2ZUTA 4GI9A 2W67A 1E0TA 4HJFA 2BHYA 4JY9A 3SCPA 3W74A 4LF2A 5FOOA 4M8UA 3W1RA 4ZQRA 4JQ2A 3IIOA 5E9AA 1KTBA 3ZSTA 4H2CA 3VUSA 3MANA 1HKWA 3CZLA 2EPOA 2BY2A 3MKKA 2Y62A 1MRQA 2YSWA 3CV2A 2YXGA 1SJBA 3BLPX 1YDOA 3WJWA 1LG1A 3TC7A 4GY7A 1OGGA 4HPHA 1QPQA 3E0WA 1FWJC 1ZJBA 2VYOA 3DIPA 5CPSA 1UWRA 3EWBX 3OW1A 1F8IA 3XINA 4AYSA 1DQUA 1OJXA 4Q8VA 1PO9A 1XFBA 2PDFA 3AROA 3WH7A 1XSKA 3M0XA 5M1TA 5EPDA 3WD0A 2A6LA 6TAAA 1KXHA 1LG2A 1WZAA 2DZWA 1DBTA 5D30A 4EANA 1NQ6A 4KGJA 2OYKA 3N6JA 1YYAA 5I0DA 1J2BA 5HWMA 2FGBA 2XM1A 3IVSA 2GWGA 1F3WA 1SJCA 3O16A 1NQKA 1QNRA 4S3EA 3K4AA 3W7GA 2VWSA 4X0NA 1NFPA 2C91A 3LMZA 1M01A 4O8RA 1DXFA 3C8NA 3NSXA 3VZYA 4F3HA 4XAYA 3IJ9A 4S3CA 1NELA 1YBQA 3OPSA 1OT2A 2ZCGA 4N7QA 3PBGA 2PP1A 4R7OA 1RCQA 3HF3A 1MW3A 2PDXA 3EXSA 1VFOA 1ZP4A 1GQNA 3P6LA 1JI2A 5DXXA 5E0CA 4GHRA 3NG3A 3NGFA 4ALDA 1US3A 3U8GA 2Q6ZA 1X6UA 5BOFA 1UA7A 3FW6A 3E0LA 5AHIA 1Q8AA 1Y65A 5T26A 1S5WA 4XKYB 4LUSB 3ARTA 2POTA 4B16A 3P61A 3W7LA 2A3EA 2YA1A 3S5OA 3UFYA 1NDWA 2GK1A 2OQYA 2V3FA 2TPSA 4IFKB 1V0MA 1ZY9A 2ZX9A 1VEPA 4Q4RA 5EMYA 5TAOA 3QW3A 4A8RA 3KDOA 1BTMA 2CXEA 3M0KA 1Z32X 4WY0B 2IUZA 3TN6A 2REQB 3PTMA 3QPZA 4RZBA 4IIHA 4XV0A 3SN0A 1CWYA 4N9DA 4LOCA 1NWTA 4H7CA 5ENLA 4BF5A 3LX9A 1G69A 2QW5A 5K3VA 4JQ4A 3TCSA 2C1IA 3MVIA 1JQXA 3BWWA 3SI9A 1FVPA 2RGMA 2O9RA 4FPSA 1VP5A 3HG3A 8TIMA 3TTEA 2CZFA 5HNNA 3S5SA 3GIYA 3FEQA 2R8WA 5I07A 2BB0A 6CGTA 4LEQA 3CV7A 4NF7A 4AX6A 4D6FA 3VNIA 2YZ5A 4UTJA 2OLSA 3EMCA 1N8WA 1XQLA 1VEOA 1TVNA 4UTTA 1MFVA 2GQ3A 1VHNA 3HPFA 4JIEA 3L2MA 3WLRA 3ITLA 2DORA 4O18A 4YTTA 3KVMA 2HE8A 3WLHA 2XH0A 3TYBA 4Z1YA 4AFYA 1RK6A 1B9ZA 1UUQA 5DXYA 3U7BA 3TYEA 2YDRA 3LBMA 1J6PA 2P3EA 5K4XA 3A4WA 1XLKA 3W1AA 3UWZA 3GDBA 4NZ1A 1S1RA 3KAOA 4N9EA 2XFYA 4JKMA 1GPWA 2OOGA 3N12A 3E2SA 3BAYA 4HBKA 1EEXA 3C52A 1QR7A 2Z1BA 3MV01 3NQ2A 1E1CB 3M7WA 1MWOA 3KZPA 3QM3A 2PE4A 2GUYA 4H41A 3TW6A 3PTKA 2VTFA 5IBXC 3WDPP 2V5BA 3WLQA 2Z25A 5CZSA 4GUJA 2DZPA 5I3JA 2H8XA 1TKKA 1DKWA 3UWWA 4I7WA 1ISXA 2FDSA 1YNPA 3RF9A 4AYGA 2BY1A 4QCEA 2GQ9A 4NNAA 1G5AA 1QNVA 3MMUA 2CERA 3BLKA 3QBUA 4NQ1A 2ZZ1A 1V6VA 3ORWA 4KESA 1KLYA 4XBSA 3VD5A 4NXKA 5D2VA 1BKSA 3EWDA 2UY2A 4FLSA 2DZAA 1R3SA 4MVAA 3L4TA 3OG2A 1HN1A 1UIPA 3PBVA 1Q8JA 3AUJA 1XUZA 3WBAA 2JKAA 3WH9A 2D2JA 2PZ0A 4LEFA 4GZEA 5FEZA 4MB1A 3PNZA 5D2YA 4H3DA 4INFA 5I3KA 3EDFA 4BF7A 4CU8A 2EO7A 2G97A 4GRSA 3WK0A 4GGBA 4AEOA 2D24A 2VR2A 2E40A 4CNOA 3MKCA 4QNEA 2ABBA 2A21A 3EWYA 4W4QA 1KXVA 1S2UA 1DE6A 5F2GA 3GXNA 1J2WA 4EF9A 1PS9A 1KRAC 2HXTA 3GW0A 1J79A 3EKZA 1GG1A 1NDYA 9RUBA 3SZ8A 2ZDRA 1EYWA 4LVDA 3LCLA 2J27A 4D6HA 3OEXA 1TWWA 3T0TA 1F73A 3W7PA 2ACSA 2PDLA 3C0SA 4LYQA 1W56A 3DXIA 1KO0A 4W84A 3AMDA 2B7NA 4N6FA 3BGGA 4JHOA 5A8GA 5HJLA 2FVKA 1EWEA 5A8NA 1EO7A 2GVLA 1VIWA 2RDXA 3KS6A 3VFLA 4PMOA 3PWIA 3T4CA 1OCNA 3WF3A 2VVSA 1F74A 2IKJA 2CZVA 2J79A 4GNVA 1K8XA 4AZHA 2YJQA 1UWAA 3W1TA 2ZDSA 4C7DA 1BKHA 1H51A 3UT0A 1W91A 1FWWA 2Y1HA 1KFKA 1KM3A 2OXNA 2ZOXA 1TPVA 2I9EA 2V5DA 4PODA 3VOFA 5L6UA 3PWGA 3M7SA 4YNGA 2BFGA 4KEVA 1XINA 1UZHA 2ZRWA 1VF8A 4O19A 3CUXA 2ISDA 2J6VA 3WMCA 5CGTA 2V6AA 4B3ZA 3HU7A 3K46A 5KTLA 3QYSA 3FA3A 4GKLA 1GPFA 2W27A 1EJRC 3PPCA 3WELA 5F4SA 3G8EA 2WKGA 2WWDA 2YFOA 2FDMA 1TZZA 1BSIA 1DQXA 3R43A 2WCSA 1WDRA 2L5HA 1M53A 4LCQA 1XFCA 1TCDA 2WK2A 2RDWA 3EPMA 1PIFA 1TV5A 5A6JA 1JPHA 4B3LA 4RW5A 1TPWA 1SZRA 1VPQA 2OZ8A 2PLMA 2VX6A 1PIIA 1DTNA 1CXFA 3WMSA 3I7QA 3IGUA 4XAFA 1KGWA 2GYIA 5TD4A 4DO6A 1JD9A 3T9PA 4PCPA 3QN3A 4UTMA 4E4PA 4HSNA 2W5FA 3UWVA 3AMGA 1Z6KA 1B90A 2E4TA 5I78A 3E0VA 1UWQA 3CL6A 4LQ1A 3A12A 3EA2A 2QUVA 1Z9AA 4Z1BA 5HR7A 1I2RA 5BCAA 2YYUA 1K4GA 1QPKA 4K8EA 4XQ6A 5M3WA 5A6SA 3N2CA 1WUFA 4B15A 1EZWA 4MNKA 4X63A 3CZKA 4IMGA 4N4QA 1JYWA 5FF2A 4RR4A 1T0OA 4JXCA 4M56A 4UCFA 1M65A 4LX4A 4NNBA 2ISSA 4QIUA 3S46A 1IT0A 1XIDA 1HKKA 3SFKA 2DSWA 2PCQA 1A5NC 1WDSA 2Z7GA 1EXBA 1XLIA 3DZ1A 3OVGA 3MSDA 1QOQA 3ALFA 5FSEC 1GQJA 5DF0A 3EYPA 3KHDA 2J74A 3R8GA 4CNPA 1VC4A 1G9HA 3UZJA 2V63A 1JZ8A 2NVAA 1J93A 1UKSA 4R34A 4M6QA 4HA1A 5H91A 1VPYA 2YCKX 1Z8AA 4L4MA 1FTXA 4D6IA 3QV8A 3TTYA 2REQA 2Z1WA 1B57A 4TIMA 4TR9A 1TV7A 2VEPA 4AXNA 3S2CA 3EX4A 3GTNA 2ZA2A 1VS1A 4E4FA 4QAIA 1W32A 1ADSA 2QJHA 1AJ2A 2OT1A 3A5FA 3WF1A 1HJXA 2EQDA 4DF2A 1TR9A 4MZYA 1XIJA 4UMCA 4LUJA 3ONBA 3RX4A 1GCYA 1H60A 1R9YA 2FHCA 2W91A 3VCRA 3BANA 4XB3A 5FESA 1AQ0A 1KBJA 1QOXA 4RLIA 1FCVA 4JX5A 2V2DA 2EF9A 3K2GA 3AWNA 1KFCA 1J18A 4ZZ9A 5D02A 2DV0A 5LKYA 3F03K 3RLHA 3HTWA 1FWRA 3TROA