4WX2A

Crystal structure of tryptophan synthase from salmonella typhimurium in complex with two f6f molecules in the alpha-site and one f6f molecule in the beta-site
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
253
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing the tunnel in tryptophan synthase with crystallography: Insights into a selective filter for accommodating indole and rejecting water.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Transferase
molecule keywords Tryptophan synthase alpha chain
total genus 95
structure length 253
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4wx2A00
5CKSA 4UTLA 3WJWA 3QM3A 3HPXA 1GYLA 5J5DA 3FJLA 2Y62A 3LCGA 1TO3A 3NL2A 1Y0EA 4UMAA 1SW0A 1WDWA 3MI6A 4H6KA 1R30A 2WSQA 2ZRZA 2CWNA 2BTMA 3DHDA 2WQPA 3MP4A 1P5BA 3W7IA 3GB6A 4FX8A 1NFBA 4AF0B 3INPA 2FFCA 4AWUA 2QDHA 3M7WA 3UWQA 5TIMA 1OHLA 1K8XA 1VQTA 4S2BA 3VKJA 3CB8A 1F76A 1K8ZA 4HNVA 1O4UA 3PG9A 3TK7A 5EBUA 5HR6A 4LC8A 3FA5A 1SSDA 1WBHA 1MEIA 3W7EA 1Q45A 2VELA 3I7SA 2YR1A 2J9XA 3S1XA 1L6YA 1KBJA 1XBVA 2R94A 3E49A 1LP6A 1NVMA 2BXVA 3A5VA 4AF0A 2DORA 4UNKA 1D3HA 3W88A 3C6CA 3LTPA 4QJ1A 1IIHA 3CEUA 1TTQA 2YPIA 4LY8A 5AC8A 4C1LA 5K9CA 3NVTA 2OZ0A 2VFHA 3EWZA 5I3JA 4TU1A 4JTIA 3STFA 5AHLA 3TAOA 4UXDA 4ML9A 4BF9A 5F4WA 1I45A 2X1RA 1YADA 2H90A 4NNBA 4WJEA 3MP3A 3BLEA 4AHQA 3TQVA 3SZ8A 3TQKA 2ZRXA 4XKYB 3K30A 5IBXC 1W5NA 3D0CA 1H7PA 3SGUA 1XCFA 4JYEA 3TC6A 3L9CA 1GG1A 5LHFA 2ISSA 4NXKA 3BG3A 4RZ6A 2Z6IA 2QEZA 3DBPA 1IXOA 4NJKA 2J88A 1LOLA 2C6QA 3SJ3A 1JCNA 5K4ZA 2YCEA 4A22A 2CLHA 2NV1A 4O14A 3DENA 4O17A 3TFCA 5D2WA 3H53A 1SZNA 1X6UA 2C18A 4UFKA 4E0CA 4N02A 1ZNNA 5LNSA 2P10A 3A5FA 3EKZA 3P61A 1DQWA 5G2HA 1R46A 3I65A 1FCUA 4IXXA 1FDZA 2V9DA 2OX1A 1XUZA 3IEBA 3VFLA 4JX5A 1FQ0A 2I9EA 4LVBA 1OVDA 3TNOA 2ABAA 1IIGA 3DU0A 3OBKA 2JKPA 2QAPA 3HBLA 1LM1A 4UTWC 4EF9A 4S2CA 4CQ9A 2YYUA 4JN6A 1LBMA 4A3UA 4LTSA 1X8FA 3LTYA 3ZWSA 1GVOA 1KFBA 3W22A 3DFSA 4B5NA 1W56A 2CZFA 3TUUA 2QUTA 2I14A 4JNMA 1TQXA 3W83A 2J27A 3O1NA 3NAVA 3GNNA 4RK8A 3W1NA 1I2RA 2GQ9A 4O1DA 3LHUA 3T55A 2C14A 3W1RA 1GJPA 2ISVA 3UPBA 4MVAA 4QISA 4GC4A 3W7MA 5FI8A 5HUPA 1JCYA 1FXQA 3ABRA 4GUJA 4Z0JA 1OFAA 5FF2A 1ZAJA 5CGQA 1SUXA 4JD4A 3SSJA 3WJXA 2A5HA 2ZBTA 3W1QA 3LBMA 3PC0A 2NX3A 2ZRUA 3UWZA 1JUEA 3SI9A 4BI7A 2QCEA 3TDFA 5G2WA 1Z41A 2GVGA 3A9IA 4Y6GA 1PHQA 5CPNA 3W84A 1SZEA 2YW4A 2ZTJA 2H3DA 5F2LA 4RCXA 1WOAA 1LBFA 3DXIA 2C13A 1QCWA 1QO5A 1I4NA 2ZZ2A 3LHYA 3NQEA 3SGZA 5I3HA 3NR0A 4M6PA 1VJIA 3R5EA 4JEQA 1B3OA 4X22A 4NUWA 5FEWA 5AB3A 4UFJA 5G1TA 1PVNA 1SO4A 4JTKA 5GVJA 2A6NA 3DI0A 3UY7A 4HSNA 1TPVA 1RZMA 4Y8FA 2DJXA 4QIUA 4LS2A 4K7VA 4WQ6A 4FEZA 3TFXA 3PB0A 4FNPA 3TSDA 3LCIA 4UTTC 2QJGA 4DBDA 1N8FA 1ZENA 1ZAHA 2Y7FA 4QITA 1DQXA 2OT0A 2KZHA 2E6FA 3KHJA 1VZWA 2Y85A 2QCMA 1ZJIA 1XBZA 3FKKA 5DY3A 2C19A 2A4AA 1DJQA 3C56A 3W7RA 5K2ZA 1JVNA 3BW4A 5D37A 2RDUA 3AJXA 4O4VA 2Z0IA 3QEZA 1T8XA 4CNOA 3C8FA 1VCVA 2Q3OA 2J6XA 2VXNA 3W70A 1CI1A 1TPUA 3LOTA 3THQA 4IJBA 1AG1O 4XUGA 2GPTA 4Z0SA 1F73A 1XBXA 4AHPA 3HO8A 3OA3A 1T99A 3TSBA 3W6YA 3JS3A 4U4MA 1LOQA 4N9BA 3IIXA 1GVFA 4LS0A 1GOXA 1PCKA 1RV8A 2H8ZA 3G8EA 4DBEA 2CZDA 3NA8A 2YSWA 1W5OA 3NGJA 4M6VA 2VKZG 5D02A 3TAKA 3R2GA 2RKXA 4DEFA 1ZAIA 4ONVA 5KZDA 2HMCA 3PM6A 4KFOA 4IPJA 3EWXA 3PY2A 3C2FA 4N2YA 4G1KA 1H1ZA 4UMBA 2ABBA 1LTDA 3JR2A 2XN0A 2BWGA 5CSRA 1V5XA 4IX0A 2DZSA 4GFSA 3MYOA 1JRBA 2E68A 4ALDA 5LZLA 5HWJA 2A6LA 5FESA 1F6KA 4UMCA 3V1PA 4LC6A 3P74A 1KLZA 2TYSA 3BO9A 4FNTA 4IUOA 2YW3A 1QAPA 3M5ZA 2TMDA 2WJZA 2VEKA 1FWRA 3QMSA 3W1XA 4FNQA 1FWTA 2ZZ7A 1ICPA 3RK8A 4CCEA 4CCDA 3LBCA 1OABA 4GE8A 1KM5A 4D2JA 3P7YA 2C0AA 3HGRA 5HWNA 4O19A 2NUWA 3A22A 2ZFAA 2CZ5A 3EKLA 1V7YA 4KFPA 4K37A 1H7WA 1G69A 1CX9A 5LSMA 3EX6A 1F05A 4AB4A 1TTPA 1U83A 3STGA 5BNKA 4LNYA 3W23A 2QCNA 3NM3A 2YYTA 4FIRA 1FDJA 5CPMA 3C2EA 4JTEA 4QQ3A 4O11A 3HF3A 1THFD 2PRLA 3L5AA 4ZL1A 1MEHA 3CC1A 3LCHA 1K7XA 4MUZA 3LI1A 3IVUA 1KFJA 4JS3A 1BWKA 1HO4A 1TREA 1KBIA 4MY8A 1ALDA 1VHCA 3S6DA 4JDBA 2ZQ0A 1EP1A 5KITA 3GNDA 2WOQA 4RZ4A 2C3ZA 1OFDA 5K7JA 3NQFA 1AL7A 1TPB1 3Q58A 4FNUA 4I9AA 2WKJA 1I2PA 3LDVA 5LNRA 2B0MA 3MHGA 3G0UA 1S3HA 3RU6A 3BARA 4NJHA 4NJIA 3I68A 4DF1A 1PV8A 4O1CA 2DZWA 5D33A 2WNZA 1TV8A 3A23A 4KFNA 1TB3A 1TV5A 2ZRVA 1W3NA 4YLWA 3W1MA 1QPQA 1LOSA 1X7FA 1I2NA 2JBMA 3UYCA 1P0KA 3M5VA 3QSRA 3QMRA 4A29A 2VEMA 3IIVA 1L9WA 4O0ZA 3KX6A 4ZQNA 4WZHA 2C15A 5CG7A 1OX5A 2E5CA 4O52A 3DFOA 1AW2A 3SECA 4CQ8A 4Z1BA 3VNDA 4Y96A 1MSSA 1Q6LA 5F1UA 1FWNA 5EY5A 4MYAA 4KWWA 2P0OA 1O5KA 4JTHA 1OFEA 1K3UA 2Y89A 1RQBA 5D04C 4YL2A 3UWVA 4H3DA 3QH2A 4HPJA 1H51A 3HG5A 1TPWA 2TRSA 1FBAA 3EX1A 1YYAA 4JTUA 3STEA 3L68A 2X16A 1LLWA 3DFQA 4O13A 4QAIA 2ZA3A 1EP2A 3UXAA 1OFRA 1JUKA 1SSGA 3B4UA 3GKFA 1OYAA 1ONRA 2WNNA 3KFTA 3FFSA 2GJNA 4Z08A 5C2XA 4FXSA 4O1AA 4NJGA 3FLUA 4Y9AA 4WUIA 1G4PA 4ZMGA 5FF3A 1D3GA 1VS1A 4YWIA 2EPHA 4MLRA 3VCRA 4M5PA 1QPOA 2NXHA 3WJSA 3PF3A 2J24A 3EXSA 2C16A 5AHNA 4FF7A 3MBDA 3O06A 1TPC1 3UWUA 1W31A 4POCA 1A5CA 5ABTA 2VEPA 1IXQA 2J9YA 3DFNA 5CZJA 5L6UA 4AH7A 4X9SA 3P81A 1ML1A 1QPRA 3H55A 1DOSA 3NQDA 3LB0A 3TW6A 4OU1A 4ADSA 3LCLA 5HQEA 1J4EA 3EWYA 3UPWA 4EVZA 4QM1A 5CZSA 3CM4A 4P2VA 1N7KA 3ZWTA 5TQLA 3GDRA 2FB3A 4PL1A 3GR7A 5EKYA 2YXGA 3C2VA 3SFKA 1OYBA 3W07A 2LLEA 2GJLA 1SO6A 3L5LA 3THAA 4EOUA 2OT1A 3MBFA 4JDYA 4WX2A 4WOQA 3W7PA 1KFCA 1TRIA 1XXXA 3DFPA 5IBXA 4Q33A 2WPBA 2OMAA 4ZQPA 5DELA 1NAL1 3KRZA 3HG2A 3PS7A 4RXFA 3LGEA 3NQAA 2QR6A 4MY1A 4WY0B 3S42A 2AQWA 3NQ7A 3T40A 1F2JA 3U2OA 4E38A 1TV7A 4NVTA 3PSWA 1SO3A 4JTFA 2PURA 5LNVA 1CW2A 3TCEA 3TKFA 1M7OA 2R91A 3MHUA 3KVKA 1P1XA 3M5YA 3VE7A 1X1OA 5C55A 5BRBA 3RFAA 3DAQA 2QDGA 3KAOA 4JTGA 1EUAA 1ADOA 3NEVA 1GVQA 4IWWA 2Z6JA 3RMJA 2ZRWA 4HPXA 5CSSA 4FO4A 3MO7A 4HKPA 3GK0A 1KTBA 1UJPA 2NWSA 1KW1A 4DXVA 3NOEA 1VLIA 3OVPA 4HHPA 1PS9A 4MFEA 3S9YA 2GQ8A 4K7YA 2B7OA 5H2ZA 3T78A 2DU2A 1Z42A 2WSRA 1OFQA 3Q37A 1UUMA 1A5AA 3WK2A 3TR2A 2ZA2A 2W79A 4JTTA 4L4LA 3S5NA 1C29A 1NF0A 1QR7A 1T96A 4LVGA 5HWMA 1K02A 1YXYA 3O07A 4GWEA 1G4TA 2QKFA 5G1YA 3BVJA 3L21A 3PULA 4A2SA 3DKLA 3G1SA 1LRNA 1EB3A 3LXAA 5AHIA 1LRQA 2ZZ1A 1W1ZA 3EX4A 1VCGA 3PUDA 1GPWA 1FCQA 2IQTA 1RQHA 2E1DA 5D30A 1VRDA 3KOFA 1TJRA 1LCOA 2NV2A 5LGZA 4MZYA 4EWND 4FIQA 5J5RA 2QCGA 4WOZA 3PBVA 1QMLA 1TTJA 2ZRYA 1H7OA 5G2IA 1VCFA 1ZALA 4OBTA 3P82A 3S1UA 4JGDA 4JTSA 1FY6A 1H50A 2QJIA 3PG8A 4X3ZA 4NQ1A 1H7XA 3WJYA 1HUVA 1S5TA 4DELA 3GKAA 1JCLA 4O57A 3P62A 1QOQA 2O7QA 4QNEA 1WX0A 1BEUA 1DVJA 2QUUA 3ABQA 1FCBA 4EF8A 3OVQA 4UR8A 2ZA1A 3R89A 4N4PA 4DQWA 1XI3A 5LHEA 4EIVA 2NUXA 4FNSA 4WY0A 3GXTA 3G1DA 3KRSA 1RQEA 4IX2A 3QQ1A 1AL8A 1ICSA 3AO0A 4PA8A 1VHNA 4TMBA 3SW6A 4AAJA 3MHFA 1L6WA 1OX4A 4R7JA 5F1VA 5AN7A 1GVRA 1JCJA 2A7RA 1RR2A 1EA0A 3RF9A 5F2GA 2DJLA 3N73A 4OQVA 4UFLA 4GUHA 1GT8A 1R47A 2RH9A 1QO2A 3QW3A 3FS2A 1JQVA 1OFOA 3TJXA 3QRHA 1AMKA 3C0JA 2UV8G 2V8ZA 1WA3A 3LHWA 2R14A 2BSLA 2ATMA 3CT7A 1TPEA 2GQAA 4MZ8A 4OE7A 3N2MA 1A5BA 1KM2A 2Z2UA 1WXJA 3S8HA 1J5TA 3OHIA 3MW7A 3GDKA 4ADTA 3ZFHA 4RZ5A 4QSHA 3ATZA 3QPYA 4QNWA 3GDLA 1NF7A 1G6CA 1VLWA 5FEZA 3KVLA 5DLCA 3DGRA 4HNTA 1DBTA 4IMCA 4TMCA 4DPQA 5F4XA 3L2IA 2EGZA 5U4NA 4NZFA 1ZFJA 3I7RA 2OJPA 3O05A 1ZHAA 3P8IA 3DFTA 5EL1A 2YZRA 2RDWA 4O1BA 2E77A 5HULA 4N9EA 1PHWA 1W5QA 1JCMP 2B7QA 1I2OA 3OVRA 3USBA 1SW7A 4AWSA 3W7KA 4GJ1A 2Y7GA 5LNUA 1FX6A 4UUIA 3CWOX 4PFMA 4UTTA 1G67A 3HPZA 4WY0F 3W87A 1O95A 5D32A 1FWWA 3MYPA 1WYIA 3LRKA 2I1OA 3NPXA 3GXNA 1G7VA 3MP5A 2Y61A 3L65A 3YPIA 1KM3A 3BGJA 1S5WA 4HT3A 2NXIA 3C2RA 3W1AA 2G97A 5AYYA 5H91A 1FUYA 3B05A 4RX0A 4NT0A 3QQ0A 1KFEA 3TSMA 2ZYFA 4N4QA 4DPPA 2VFEA 4FB7A 3GAKA 4PL2A 4R34A 4JX4A 1DJNA 3GX9A 4XBKA 1XC4A 3MI3A 1GG0A 3LXBA 3EWUA 3WK3A 2XN1A 3G1AA 1C9DA 2FJKA 1SU5A 4A2RA 1O5XA 1SPQA 3BK0A 3M0ZA 3PBYA 4O16A 2FB2A 5AHMA 3NZ1A 2YFNA 4Q32A 3KVJA 3TU9A 2V5BA 4GNJA 1F5ZA 1AW1A 3BLFA 4RKAA 1IF2A 1SFJA 2PE4A 1A5SA 1XFBA 1YTEA 3CEPA 5F4SA 3BV4A 1W3IA 1FDYA 2JGQA 4O10A 2RDTA 1HO1A 3O8AA 4YXGA 2H8XA 4Z1CA 1VC4A 4I7WA 1KM6A 1L2UA 4IGHA 4HNUA 1DL3A 2QCDB 4MJMA 7TIMA 1AK5A 4WD0A 4IMEA 3RLUA 3CHVA 2ZCGA 1R2TA 3HPSA 1X1ZA 1PIIA 1SZGA 3R12A 4AXKA 3N19B 2Q3RA 3UY8A 3BLIA 1H60A 1KTNA 1B4EA 3P5ZA 4K39A 2YFOA 2DZXA 3HG3A 3O6DA 5C5YA 3B04A 1M5WA 4LVDA 3NL5A 1OFBA 4UTMA 1KTCA 3W74A 3ANYA 3P8JA 3LX9A 2QCDA 4IPIA 1OYCA 2X1UA 2ZZ3A 2ISWA 4MJZA 1IGSA 4UC5A 4R33A 2YX0A 3SR7A 2W6RA 3IVTA 2GUUA 3G3DA 3V75A 3NQMA 1EUNA 2H3BA 2ZZ5A 3G1YA 1LYXA 1UCWA 2QJHA 4UR7A 4LV4A 4LRSA 3QYQA 1D9EA 1B4KA 1TSIA 3P5YA 4DO5A 3TXZA 4IMGA 4JYFA 3L66A 5DN1A 1W3TA 2XFWA 2DZUA 3S1WA 2J9ZA 3B03A 3MI2A 2O7SA 3W7NA 3UXDA 3MJYA 1O60A 1OF8A 3A21A 2G95A 3W7QA 1YDNA 3LHZA 4BFAA 4GXMA 5D2VA 2CLLA 4Z1DA 1B9BA 4BI6A 3L67A 3ELFA 1YPFA 2B4GA 3M43A 1XL9A 2Y7EA 3LRMA 5DXYA 4IXHA 4LOCA 4MFDA 4NXSA 3S5ZA 3M9YA 4DF0A 1IXNA 4I7VA 1YXCA 5LNWA 4GUFA 2Y70A 3FOKA 1RD5A 4Q4KA 3OEXA 3O63A 4IMFA 5SWUA 3UZJA 2C1HA 1Q6QA 1M6JA 5G5IA 2VFFA 1IXPA 2FPVA 3M44A 4O8RA 3TQ0A 5D2YA 3HG4A 2CFFA 1EPXA 4X2RA 5HUOA 1FCVA 5EYWA 3LXCA 3MWAA 5KZMA 1TJPA 1YPIA 3N34A 3WK1A 1TPH1 3GLCA 3GAYA 1XDMA 3O6CA 2EKCA 3M16A 4GRSA 5KTLA 1K7FA 3L0NA 4C1KA 1JCXA 3G8RA 3N9RA 3NPUA 5HINA 1H62A 1JUBA 5DBTA 2QF7A 1SO5A 3EX2A 1HG3A 4HIBA 4N9CA 1QDSA 1C8VA 1NSJA 5I3KA 3ZR4A 2GOUA 3EXRA 2A7NA 2E5DA 1YDOA 5G4EA 4M19A 2CLMA 2NUYA 3GXPA 1SR9A 3W1UA 3F03K 5F2MA 2A1YA 1HFBA 4J9JA 3CPRA 4HSOA 5FEPA 2R8WA 3W2KA 3NL6A 1EWEA 1BKSA 2AGKA 2BLEA 3UNDA 1W54A 1LBLA 2A0NA 3GVGA 3C3NA 3T7VA 1RPXA 4K6AA 4BWLC 4YMZA 3PR2A 4S1FA 1R2SA 3E12A 3M1ZA 1MZHA 3EWWA 3CWNA 3IGSA 3H54A 2G5WA 4DF2A 2ZZ4A 3QJAA 2FTPA 3B8DA 3UZ5A 1QPNA 5CZTA 5LKYA 5KINA 2FIQA 3G1FA 5HJLA 3S1VA 1DHPA 2HTMA 1U5JA 2DP3A 2GVLA 4TIMA 3NQ6A 3P80A 1G4SA 3W7OA 2NLIA 3C2OA 4WXZA 3NO5A 1P4CA 5K3VA 5D03A 2WSYA 4N6EA 2H6RA 4O12A 3W2JA 3W85A 4DO4A 3BPWA 1LROA 5K9XA 4CCCA 1T0OA 3HGJA 2VEIA 1F74A 3I6RA 1OJXA 4OT7A 1YDVA 3L5MA 4R53A 2PCQA 3ABSA 3S0CA 5I3GA 3LCXA 1TMHA 1YXDA 3F4WA 1KV8A 3IVSA 4MKNA 4PEKA 3QPZA 4LT9A 3NG3A 2RHGA 2V2DA 1Q3NA 4LV9A 1TYGA 3UQNA 1I2QA 5KSWA 1L6SA 1JJKA 4XBSA 3M41A 4O4WA 2JKEA 3UD6A 1OFPA 3UWWA 1W5MA 3PWAA 6ALDA 2X2GA 4GUGA 3VE9A 3E0IA 5K4XA 1VPXA 2A7PA 3E9AA 3TMQA 4BR1A 4LVFA 3PVFA 3W7CA 1O94A 2A2IA 1R2RA 5C54A 1W5PA 3KXQA 3RNDA 3W9ZA 1XKYA 1HL2A 4UNLA 3BG9A 3IV3A 1LLZA 2B7NA 3FKRA 3W2MA 3NNTA 4JIQA 4UIOA 3HMJG 2V0TA 1EX5A 3MUXA 3LV5A 5D05A 3P67A 4OHQA 2G96A 2CW6A 2NX1A 3G0XA 1ZCOA 3EEGA 4ORMA 3GDTA 4MLJA 3W2UA 1QOPA 2Y63A 1YTKA 3U8GA 3JRKA 4CNNA 4E2BA 2HS6A 2WV8A 3CIWA 4M7SA 4LUIA 3HGOA 2XN2A 3LRLA 3N14A 2NZLA 3DH7A 4P61A 5AOUA 5I3FA 2FPYA 3EB2A 3GYEA 3NZRA 4JX6A 2E5BA 2WO5A 4XTIA 1WQ5A 5FEXA 2TPSA 4GUIA 4N9DA 2GVJA 3IGUA 2CLIA 4NNAA 1TCDA 3G1XA 4LS1A 4ZQOA 1GQNA 1B57A 4IQLA 3P60A 4O50A 3HB9A 3WJZA 5G4WA 3QMTA 5AHFA 3TC7A 1F7BA 1XBYA 2BZNA 2PC4A 1BWLA 1PE1A 4JY9A 4LVAA 3SIZA 3LHTA 4TO8A 1DORA 1QFEA 5AHEA 3PSVA 4BK9A 2E6YA 5DBUA 3GDMA 4UTWA 4O18A 1G4EA 4PODA 5DY2A 4UTUA 1G7UA 3PUEA 3N9SA 5DCBA 3IGXA 4CQAA 1WBJA 4MOZA 5EMUA 4JY8A 4W9TA 3DKJA 3TV8A 1S5VA 1XUUA 3W1TA 4A21A 3TROA 3EWBX 3A24A 1NEYA 3CTLA 5AC6A 2HSAA 3W7HA 4MY9A 1A50A 1OX4B 3QC3A 2X30A 3QSTA 3DI1A 2ZTKA 3NQGA 3UWYA 1GWJA 3BG5A 1H61A 1H5YA 1OG0A 4MYXA 3STCA 4UCGA 5L9FA 4RLIA 3G22A 3S5YA 2F7FA 3ATYA 3ZS4A 3GZ3A 5MHBA 3S5OA 2NXGA 1VYPX 1GTHA 1MEWA 2EHHA 3TW7A 3Q2DA 1VGAA 2RFGA 2DZVA 3LLFA 3RLVA 4UFIA 1Q6RA 2TSYA 2JGYA 5HMSA 3U6WA 3CLMA 2OCZA 3O15A 4ORIA 1ME7A 2QCLA 2VFIA 5DXXA 4XKYA 3QF0A 1K7EA 3WK0A 4MPQA 5FF0A 3LV6A 4K8EA 4N6FA 3QW4B 1BTMA 5EA9A 3FIGA 1K03A 4O0KA 5EPDA 5E0KA 4JICA 5DCDA 3E02A 3B0PA 3NQ2A 4XQ6A 3LLDA 1EEPA 4ZQCA 2PRHA 4JR5A 1TPDA 3HQ1A 4WXYA 4HNNA 2V2CA 4FHAA 4UFHA 1JQXA 1W0MA 3TE9A 4CNPA 4YCOA 3KVMA 2AAMA 5IM51 1TIMA 1UUOA 3OIXA 3G0SA 3F4NA 1VYRA 1JRCA 3TMLA 2F84A 1ICQA 4OWGA 3G24A 4NNCA 3BW2A 3LHVA 1DV7A 3W73A 1W37A 3W76A 5AFDA 4GBUA 5KMYA 3HOJA 5AYZA 1UBSA 1Z48A 5BMWA 1WOBA 3W86A 3B0UX 3N2XA 3HJZA 3TXVA 2ZZ6A 2CZEA 1H63A 2E09A 1OF6A 5D2TA 5E93A 3LM7A 4O15A 4NJJA 4AEOA 1QWGA 4FX7A 3QZEA 4HN4A 1GVSA 1Z44A 2X1SA 4FX6M 4AWTA 1XDLA 2X1TA 1JULA 3NQCA 2WNQA 3L0KA 1GTEA 2EAWA 1TQJA 4I7UA 4M7TA 4BI5A 4AMAA 1VH7A 1LZOA 3I7QA 4NZJA 1KM1A 1DKWA 3LCWA 5DCEA 1KM4A 5HR7A 1FWSA 1KFLA 2V82A 1SFLA 4H4IA 1KLYA 4JXCA 5FF4A 1KFKA 1TPFA 4CLMA 1UASA 1UB3A 1GEQA 4XZ9A 2YGYA 4FXRA 4FNRA 1YTDA 4UTKA 1KA9F 3FEMA 4AVFA 5D38A 5BOOA 1Q6OA 1A53A 4ZZ9A 1QNVA 5T26A 1WV2A 4UTHA 1YLVA 1P0NA 2CLOA 2QUVA 4AHOA 4RJEA 3BW3A 2W0UA 1H7RA 2Y6ZA 5CPLA 5C6MA 3LCFA 2A21A 2D73A 4OGZA 4TR9A 2DZPA 3TH6A 4UFMA 3Q94A 1SZFA 4LUJA 3PAJA 3B0VC 1KV5A 1J2WA 1MXSA 3LERA 4ZVJA 3DZ1A 2FPTA 4JTJA 3G1HA 4OV9A 5BMXA 3KRUA 3M6YA 4PCFA 1RVGA 3PUOA 1EWDA 4YCPA 3P84A 3TA6A 2VC6A 3W7JA 4Y90A 1OK6A 2JKAA 3MMTA 3O6YX 1JR1A 1WAUA 3HGSA 1TTIA 4NX0A 3B06A 2Q8LA 3W1LA 1E51A 4XWUA 1OX6A 4XTDA 4JTLA 4NX5A 1SW3A 5E1QA 3W71A 4Z1AA 1FXPA 3FYPA 2CLKA 2FDSA 4IOTA 1ZY9A 3HIJA 2VOMA 3CU2A 4O54A 5CZ0A 4RV8A 3SY5A 1H1YA 5A5WA 2BX7A 3C52A 3VI2A 1GYNA 3R8RA 3O16A 3EXTA 2V81A 2VFDA 2P1FA 1H7NA 4PC8A 4LW7A 2QCHA 1PCWA 1SQ7A 3LI0A 1K8YA 4UTJA 1ME9A 2QCCA 2CLEA 2VFGA 2NX9A 2ALDA 1XM3A 2Y7DA 5A8GA 4LWWA 5AYXA 2PRMA 4IMDA 3TX9A 4BWLA 4ICNA 5D2XA 2FLIA 4NU7A 3M47A 3BGGA 4M6QA 3PB2A 2NWRA 8TIMA 2CLFA 1ME8A 5KZEA 3T44A 1EP3A 3CIXA 4K8HA 5TBOA 4PH6A 3G1VA 3NXFA 4MIMA 1N55A 2V30A 6TIMA 4DO6A 5K9DA 3W2LA 3FYOA 4LRTA 3GR8A 5BW6A 4L4MA 2QCFA 4O53A 5I3IA 3FJ6A 5D09A 3IRDA 3IIOA 2JK2A 1LDCA 2Q8ZA 2A85A 2V5LA 3N3MA 3W75A 1EIXA 2HS8A 3W72A 1MO0A 2E6AA 3NPVA 4LU0A 3M5XA 3W3OA 3GIYA 4PTNA 5F2IA 3PBUA 1GZGA 3NQVA 4RXGA 2ZDRA 3NM1A 3R13A 4TX9A 5HNRA 4KKXA 4MZ1A 5FF7A 4JIPA 3TJLA 2QAFA 3NL3A 4ZQMA 1PL9A 3G18A 4O28A 3DHFA 3T4CA 2E6DA 3NQ8A 4ADUA 3WFAA 3ABOA 3EX3A 3F1QA 1TRDA 1VYSX 2VENA 1I8JA 3QFEA 4OV4A 2CU0A 4U28A 1VR6A 3PBWA 1HTIA 1AW5A 1LORA 3C61A 2ATSA 4KWVA 5U7SA 2YDAA 2FQIA 3G3MA 2EF9A 5AC7A 2Y88A 4JYDA 3L0GA 1M7PA 2DZTA 4K36A 3OG3A 1W8SA 1F6PA 3W7LA 3C4UA 3W1PA 3W7DA 3W7GA 3W2NA 3NPWA 3NYZA 5CPOA 3E96A 2B7PA 2V2HA 3LTSA 3IIPA 1OK4A 4ZQRA 5LGXA 3TIMA 3CQ0A 4UTIA 4K38A 4E2DA 3IIZA 2Z1BA 1LRTA 4RR4A 3NDOA 1KM0A
chains in the Genus database with same CATH superfamily
3NIYA 3GNXA 2DW7A 3VU2A 3K1DA 1JDDA 2Y62A 3IK4A 4NG3A 3GVRA 1TO3A 4PMQA 3SQSA 3NL2A 3USZA 2WSQA 1FH7A 1NOFA 4H6RA 1V6VA 1ITCA 2BTMA 3DHDA 4IM4A 3W7IA 4HZMA 5TIMA 1OHLA 2QXWA 2QV5A 4FXFA 4J2PA 1QI3A 4LEFA 5EBUA 5HR6A 1BRLB 4D8LA 1SSDA 4DLMA 2VELA 1RY0A 3I7SA 2YR1A 2VC9A 1KBJA 1XBVA 3WCZA 4MTVA 4AVNA 1JZ8A 4NRSA 1XSKA 2YL5A 4R85A 4AF0A 2DORA 4UNKA 1DJIA 1D3HA 2P0IA 1IT8A 3C6CA 4K3ZA 1UD4A 1IIHA 3CEUA 1WCGA 2YPIA 2GWNA 5K9CA 1N2VA 2DH3A 4XSMA 1R86A 2BY3A 4HD5A 2HPIA 2ZICA 3LSCA 3R79A 2OELA 1PYFA 2ZOXA 5AHLA 4DY1A 5A6LA 4L1XA 3SFWA 2H90A 4NNBA 4EE9A 1V6XA 3LBOA 2X05A 4AHQA 2A3CA 3GWQA 3OLIA 2BASA 2NQ9A 2ZRXA 3K30A 5I09A 2VM8A 5LHFA 1SYTA 4LYPA 4QG9A 4Z1YA 3BG3A 4HJWA 2BP1A 4B15A 3VKBA 3ZVIA 5K4ZA 2YCEA 4QBXA 4A22A 4O14A 4O17A 4CQDA 4CCZA 3PPGA 1SZNA 3DC8A 4N02A 3GTXA 4XD4A 1UWTA 5LNSA 2P10A 3MO4A 5G2HA 4MNMA 1XYLA 5E6ZA 4MB5A 2D20A 2UWFA 2X40A 1FDZA 3V0UA 2OX1A 3VFLA 1E4IA 3H2OA 2V68A 2J7DA 2ABAA 4HOXA 2JKPA 2QAPA 4CQ9A 2P88A 3BSHA 4S3AA 2PWDA 1LBMA 2VT0A 4LTSA 1X8FA 3B9AA 4WSHA 5HMFA 1GVOA 3QTPA 3A3WA 4JNMA 4MB4A 4EXBA 3W83A 1GW9A 3GNNA 3AOFA 3EB4A 1MI3A 1I2RA 2GQ9A 4O1DA 3LHUA 5KZ6A 3W1RA 4WDUA 2W5FA 2GGIA 4GUJA 2X2YA 3TN5A 1EFZA 5CGQA 4PRRA 1M3UA 3SSJA 3W6MA 2ZBTA 3T09A 3OBEA 4YTUA 3U4FA 1WP6A 2ZRUA 2FDMA 4BI7A 2QCEA 1E0UA 4U3AA 1BGGA 1A3XA 3KCLA 1P43A 3W84A 1SZEA 4CQCA 4RCXA 1PKNA 1Q8JA 1QCWA 4HYWA 1CTNA 1Q6DA 3MY9A 1EHAA 3R5EA 4HB7A 4X22A 3QV6A 3POHA 4B5XA 1F61A 1S5MA 4JTKA 4M24A 1LLOA 2DEPA 4Y8FA 1P0DA 3NWRA 2HK0A 1OGGA 3CO8A 3OHMB 3TSDA 1O68A 1REQB 1ZENA 1RK6A 3C0SA 4KWSA 5CH9A 1BXBA 4QITA 3ZJ8A 2OT0A 1HGWA 3KHJA 2Y85A 5DY3A 1ZJIA 3PZNA 2C19A 3A64A 4UQDA 3AIVA 3B97A 1DJQA 2Q01A 2Q6ZA 1TWIA 3BW4A 4ASTA 3WLHA 4IHCA 4FLOA 5D37A 1CYGA 2C0HA 1W9BM 3QEZA 4IGMA 3NUKA 3C8FA 1VCVA 3SBFA 4IJBA 2XFRA 1AG1O 3GUWA 2GPTA 3N17A 1F73A 1QHPA 3DG3A 3PZIA 4AHPA 5I00A 1XLMA 2A79A 2ZWZA 5A6SA 3GW0A 1LOQA 1JZ6A 1OQFA 3WD4A 3F4DA 4LS0A 1J8VA 5IHSA 4F8XA 1GEHA 4MWAD 3G8EA 4DBEA 2VRJA 3P6LA 2YSWA 3M6DA 1W5OA 3NGJA 4JHOA 1I75A 1PZ3A 1REQA 2IPGA 1NDWA 2RKXA 4DEFA 1X6NA 1ZAIA 5CJNA 1ZP4A 3VGFA 4DJDD 3SUUA 1VENA 2V5JA 2XVGA 5IDIA 4N2YA 4AC7C 1QNRA 2HV5A 1LTDA 1UWUA 3VM7A 2JIEA 4XD6A 3JR2A 2XN0A 2BWGA 5CSRA 3MYOA 2BFGA 5LZLA 2NVDA 3TJIA 4ZB2A 2Z7KA 1POJA 1EOMA 3KRBA 1PUDA 3QGKC 4C6LA 1LG2A 4Q8NA 4H6QA 1FVPA 1KLZA 2TYSA 2Y5EA 3BO9A 4AG0A 3M5ZA 2R1KA 1L8NA 3AZRA 3C0LA 3MA8A 3AYSA 2ZZ7A 4IH3A 5DMYA 4CCDA 2BHYA 4GE8A 4D2JA 3P7YA 2ZX9A 1KGXA 1XRVA 3QZ6A 2NVAA 2FMNA 2JIWA 2OGJA 5A8OA 3S6OA 3B9NA 3VPLA 4MGGA 4JTDA 1F05A 1TTPA 2QULA 4HA3A 3STGA 3UF9A 4EKJA 3V1HA 1NARA 3C2EA 4FXJA 4JTEA 4QQ3A 4Q8UA 1I6NA 3HF3A 4ZL1A 1J01A 1MEHA 3P3BA 1ADDA 3IVUA 1KFJA 3AZTA 2DPEA 2PEVA 1HJSA 1TREA 2GDQA 2HE8A 1V08A 4CD5A 1HIZA 3W37A 4FOUA 3S6DA 4E8CA 5EMLA 1PIFA 1EP1A 4HVXA 2W67A 2WOQA 2C3ZA 4ZA0A 5AZ0A 7ODCA 3WUFA 3Q58A 2WKJA 3KZSA 4PB3A 5EFFA 3VZXA 5LNRA 3H4WA 3G0UA 4H8NA 1ZBWA 2RGLA 4NJIA 1US2A 3LNPA 4B2DA 1LG1A 1NDVA 7PTDA 5TD4A 1I0BA 1DIDA 4NAFB 4FLRA 4MM1A 2ZRVA 1W3NA 3SQLA 4GIEA 5FSEC 4QE4A 4GY7A 2Z00A 3QSRA 2DSVA 3QMRA 3WD2A 3RX3A 3U7BA 5DEZA 5AYBA 4WZHA 4CQ8A 3TYBA 5I5RA 1ISVA 3GD6A 5HATA 4MYAA 1TUFA 1XSIA 4NF7A 1O5KA 2PGFA 4QS6A 1K77A 3AFBA 2QLYA 4YL2A 4YVPA 4PTMA 1KC7A 3PNUA 3T9PA 5HJXA 4C60A 1R3RA 2PDLA 1V51A 3L68A 1VJSA 3H6OA 3H2FA 4WKAA 4QAIA 3K5XA 1DWAM 4GISA 1TV3A 1JUKA 4AISA 4WSKA 2XGZA 3WQ4A 3KFTA 1U33A 2WNNA 3KE0A 1J0HA 1HKIA 4Z08A 1E6ZA 3VKKA 2PDGA 1G94A 4HNCA 3E74A 5FF3A 1VS1A 2EPHA 3LPGA 4L9YA 3MUIA 3VCRA 1OCJA 2E7FA 4MPKA 2NXHA 4RDWA 4XBJA 3KP0A 4RL3A 5AHNA 4H7CA 2PBGA 3WQWA 3SDOA 3SURA 5GQBA 1W31A 4IGSA 1XG3A 5ABTA 1JPIA 1IXQA 5IHRA 1WZKA 2J9YA 4C6IA 1EJTC 2H9AB 4X9SA 3SADA 1QPRA 4JPGA 1KCXA 1FFRA 4JTQA 4ADSA 5FJJA 5HQEA 3CT2A 3CM4A 3HMCA 4P2VA 1N7KA 3KL5A 2DZBA 1XGEA 2FB3A 2ZVRA 3GDRA 2PLKA 5TQLA 3N2OA 4RE4A 2ZXAA 3AC0A 4Z17A 5AKQA 3SFKA 3CHFA 3ARPA 3THCA 4EOUA 2OT1A 4TTUA 4IJRA 2GVYA 1C8QA 2ZXQA 4CQBA 4Q33A 2G0WA 5CGMA 1NAL1 3N13A 3FSTA 4WY0B 2AQWA 3NQ7A 4C6BA 1ONXA 3A4WA 3T40A 1F2JA 4UZSA 1T7LA 3U2OA 4E38A 2YCLA 3FJNA 3PSWA 1SO3A 3WLSA 1TZ9A 2GJXA 3TCEA 1JYNA 3MHUA 4LAUA 1P6CA 5BRBA 4PULA 3A3HA 2V69A 4IIFA 2QDGA 2XVLA 4JTGA 4AZ7A 7ENLA 1E55A 4HU8A 1LWHA 2E9BA 2Z25A 4FO4A 2HVMA 4U5IA 3GK0A 4TV6A 1KW1A 4DXVA 3NOEA 1VLIA 4HHPA 4J3ZA 3RPDA 1XWYA 1PS9A 2VGFA 2Y8UA 2GSHA 4K7YA 3VIPA 2B7OA 3LS9A 2DSWA 4OECA 2WSRA 3Q37A 3WK2A 3OZMA 5GJMA 2PWHA 3S5NA 3EEZA 3IJ6A 3EMZA 1E6QM 4MDPA 3ZMRA 1G4TA 1UP2A 4FR6A 3DKLA 1LRNA 3SUVA 1EB3A 1LRQA 3EX4A 2YIHA 1BFNA 3NO3A 3PUDA 1FCQA 4DBWA 2PDPA 3UJSA 1E72M 3KOFA 4EPEC 1KR1A 3D5HA 3DFHA 5LGZA 2OEKA 4M8UA 1JYWA 3ZOAA 4D6FA 1Q6EA 1TX0A 3WLKX 3P82A 3S1UA 3KDOA 1WDQA 4X0NA 3NSXA 3RCYA 2QJIA 2IPWA 2QS8A 2IXVA 4W5UA 1E4MM 2O0TA 2Y2WA 4NQ1A 1H7XA 3WJYA 4GG9A 3GKAA 3TTOA 2VX6A 5C9ZA 4AEFA 4QNEA 1WX0A 4M80A 1DVJA 4LAZA 4PBGA 4YIWA 3OVQA 4UR8A 4MKVA 4DQWA 4AFYA 1PX8A 3NSNA 4FNSA 5E70A 1LQ2A 4R7OA 3QQ1A 1WDSA 1V0NA 3WMBA 3WLTA 4GXWA 3RF9A 2QF8A 3WQVA 1JNDA 4P8VA 5A6JA 4OQVA 2CHNA 3ZYZA 1DYSA 1R47A 1WZMA 2R1LA 4V33A 3WD0A 1OFOA 3SUSA 5DMNA 3C0JA 1WA3A 3B9DA 1H2JA 1Y5VA 5I77A 1A5BA 1J2BA 4NZ4A 3WG6A 3S8HA 1WKDA 1Y7VA 3JUGA 3RYSA 2QUNA 4XZWA 1BLIA 4HK7A 3E2RA 5AECA 4CKQA 2EEXA 1Q6GA 3GDLA 4S3CA 3UBPC 4EACA 2DGAA 1VLWA 1X1NA 3KVLA 5DLCA 5HBFA 1V4YA 3DGRA 4XZIA 4HNTA 1DBTA 4IMCA 2JEPA 4JIIX 4DPQA 1W1YA 3RCMA 1JCTA 3LSBA 2D0GA 4Q4OA 2HCVA 4WIWA 2OJPA 2D1ZA 4I6KA 4DAFA 4I9MA 1EJUC 4CU6A 5HULA 4N9EA 1PHWA 3S9ZA 1JCMP 1EQPA 1NH6A 3W7KA 2Y7GA 1ZCCA 3GXIA 3EWDA 1UD5A 1G67A 3W00A 4KESA 1FWWA 1E0TA 5AYIA 3LRKA 3K4WA 3NPXA 4DZHA 1KM3A 2QHAA 1GOKA 1V3JA 4HT3A 4RV3A 4ICMA 1QRQA 4TX8A 2HJPA 3QTGA 3B05A 5JXQA 2OZ3A 2D23A 4DJFC 1ECEA 2ZYFA 4R34A 5JH2A 3GX9A 4DZAA 1EJVC 1JAKA 1I9CB 3MI3A 3ARVA 3DECA 3EWUA 1V3KA 4C5ZA 1PO9A 4AMCA 3G1AA 3T42A 1NIUA 4MHBA 3SAZA 2FJKA 3GYCA 3KW3A 1SU5A 4EXAA 4A3QA 2YFNA 4Q32A 3TP4A 1IT7A 3TU9A 2X7VA 4GNJA 3KWXA 2HZGA 3BLFA 3UU0A 3L4ZA 1XFBA 1FDYA 1VFUA 1YHTA 5M03A 1Z9AA 3E0VA 1FP8A 4YXGA 5JMUA 3VILA 1VC4A 4I7WA 4GZIA 2W61A 2QCDB 7TIMA 4M82A 4WD0A 2FZNA 3VGHA 3BSMA 2X0SA 4AZCA 1V02E 1WDDA 4H8HA 1FH8A 4V27A 2Q3RA 3UY8A 2Y1HA 3S2MA 1J10A 2XINA 4L6OA 4PMVA 1KTNA 1B4EA 3P5ZA 2VCCA 4UQEA 3BICA 4HZ7A 5DF0A 5C5YA 3I3EA 3B04A 1OFBA 3O0FA 1XLLA 1W9DM 2YLLA 4E6MA 4MJZA 1IGSA 3MSDA 1ADSA 2OOFA 3IVTA 3NQMA 3I10A 4DM2A 4B9YA 2NSXA 4F3HA 1DPMA 3QYQA 4W5ZA 1B4KA 1E5NA 1TSIA 4DO5A 4IMGA 4JYFA 4JL1A 1FWCC 4B2DD 1QNOA 4CD4A 3W7NA 1VBJA 5A2BA 3ZLGA 1LT7A 2OTDA 4BFAA 4GXMA 1OIMA 1UQYA 2CLLA 3DIPA 4BI6A 4HHHA 1Q6CA 4L65A 2Y7EA 3QQWA 4U10A 1MQRA 1Q2RA 3UERA 4CN1A 4GUFA 3CUJA 4IZGA 1W9XA 1W3KA 4JHZA 4TX6A 4IMFA 4AIBA 2WKGA 1DIOA 1BD0A 5CZKA 4WHBA 5G5IA 4FAMA 2J74A 2FPVA 1A5NC 3IV8A 2XVNA 1EPXA 4X2RA 1FCVA 1KCLA 5EYWA 3VMPA 1TJPA 3VIJA 1K8CA 4GCAA 3VD3A 3PJTA 3CAWA 1XDMA 3MUAA 3VAVA 3M16A 1B3VA 4GRSA 3U57A 5IOBA 3ZVHB 3RM8A 2BODX 3RO8A 1JCXA 3LQGA 1XGZA 5DBTA 1HW6A 4HMDA 2QF7A 3WIJA 4J3SA 3GHSA 1RLCL 4HTBA 3LN3A 4PSPA 1FWJC 1QDSA 1NSJA 1LUCA 2VNCA 2E5DA 3AMKA 4L9XA 3SCTA 3KS5A 3P2VA 2NUYA 1OCBA 3W1UA 5F2MA 4PCPA 3FAXA 1S2CA 4HSOA 2R8WA 3W2KA 2EPKX 1QI0A 1MNZA 1WAWA 3UR2A 1JZ4A 1LQAA 2XU2A 3OIHA 4YMZA 1R2SA 3E12A 3M1ZA 1E1CB 2O4MA 2FTPA 1I1XA 3CL6A 3K2GA 4DJEC 2F6KA 3H2NA 1M68A 5LKYA 3BC9A 1DHPA 1OC7A 2WZMA 4F0LA 2DSUA 1UC5A 4C6CA 2WZEA 3L4XA 4PSRA 3OU8A 4HMNA 1Q85A 3T07A 1O7AA 4O12A 1C92A 3SCRA 3W85A 4WCJA 3HZ3A 3VKAA 4CCCA 3CO4A 4JFSA 2VEIA 5T91A 1VIZA 2IW0A 3WEOA 1OJXA 4OT7A 2PCQA 3C86A 3S0CA 5I3GA 4DUXA 3LCXA 1TMHA 3F4WA 3BLDA 1KV8A 3V7PA 3CJPA 2VX4A 1TYGA 3GW3A 3V5CA 3UQNA 1QVBA 1M7XA 1M9HA 2VP8A 1S1RA 1W5MA 1IR2A 2V6AA 3VE9A 2WNWA 1GHSA 4D71A 4G56A 2OO6A 4CNTA 2YA1A 4DUVA 4L9ZA 2W66A 2A2IA 3R4IA 5C54A 3RNDA 4IL2A 3VIGA 2F9RA 2VGGA 2DUAA 1ZS2A 2J7FA 3OZOA 4F0HA 4W84A 1D8WA 4JOMA 4BQ2A 4JIQA 4UIOA 4P7LA 4PMZA 4PGLA 4XISA 1LT8A 3LV5A 5D05A 2HWGA 3QHMA 2G96A 1O5QA 2NX1A 1XPGA 4LAOA 1PWMA 1HL9A 1QOPA 1R9XA 3TONA 4DAIA 4KF1A 2DT1A 3H2CA 3CIWA 3HGOA 2FPYA 3TYEA 4ZSTA 5H8UA 1V8EA 2E5BA 2WO5A 2VRKA 2CKRA 3PWGA 3AS0A 4N9DA 5BRQA 2WMHA 2XWEA 3UGVA 3QPEA 4YHGA 3LPFA 3WEMA 2G37A 3ECQA 1W3LA 3R0UA 1KD0A 3W25A 1FHLA 5T9CE 5AVNA 2VEFA 4IQLA 3P60A 2WMFA 3FAWA 3SSZA 1RY8A 2PGEA 5HQLA 3ZQ9A 4GD0A 1F7BA 2BZNA 2DVXA 4YNGA 2OLSA 2I57A 5TF0A 3MPGA 4IG2B 1ZJBA 4QXIA 4GYJA 3LHTA 4QLJA 5DBUA 3S47A 3PUEA 1DJHA 1VIWA 1VPQA 4MWAC 1H49A 1PTDA 2WMJA 1S5VA 3TV8A 1FKXA 1XUUA 1IEQA 4WEVX 3MQTA 1MDRA 1QBAA 1XD0A 3SRKA 2QUMA 4I5XA 4MNLA 3RUBL 3CHCA 3F2BA 4UZUA 1OG0A 4MYXA 4D6EA 4RLIA 3R25A 3G22A 1Y8BA 2PODA 3GZ3A 5EU9A 1VYPX 5T8GA 1MEWA 2EHHA 1TA3A 1J0IA 1DTNA 1EF2A 4U3CA 2J47A 1Q6RA 2OG9A 4GABA 5HMSA 3CLMA 4W86A 2OCZA 1XLGA 4GH1A 4LUTB 1S2WA 4XKYA 4MJ2A 4JFVA 1DP0A 3WK0A 3LV6A 4N6FA 1BTMA 5EPDA 4RNJA 4PMYA 1PXGA 3LLDA 1JF6A 3IS4A 4C91A 1TPDA 3HQ1A 1XV8A 1JQXA 3AAMA 1W0MA 1YNPA 4QEEA 3GTNA 5HXMA 3CIVA 3CYJA 2VR5A 4BCEA 1UUOA 3EAUA 3IUIA 2EKGA 2Z26A 2JE8A 1VYRA 1JRCA 1DEDA 4PBEA 1W3HA 4Q7BA 4WSJA 4CEXC 4E4UA 3PWIA 3W76A 2PDUA 5AFDA 5KMYA 1UBSA 3HFYA 2CZVA 3AS1A 2PP3A 4HU0A 4Q6XA 3W86A 3ZJ6A 2R82A 4ZR8A 5H8MA 2CZEA 2VCBA 3VUSA 5D2TA 3MVIA 4AEOA 4FX7A 1GVSA 3G2GA 2X1SA 2I56A 4ILSA 4ZO9A 1KCZA 3PBMA 2X1TA 3GHUA 2ON3A 3F4VA 2FTYA 3WY1A 2VRQA 4G9PA 2EAWA 1EOKA 2ZXBA 3APYA 2ZUSA 3I7QA 3GG1A 3ORWA 1DKWA 3LCWA 4PTWA 1KFLA 1SFLA 1T5AA 3C8NA 4H4IA 3BGAA 1KLYA 3I3DA 3QV8A 1EO7A 3MDWA 1KFKA 4M6UA 4Y9PA 1X96A 2YGYA 4LBSA 1YTDA 2V3EA 1KA9F 4AW7A 3V4BA 1XIJA 5FD0A 1XLIA 1A53A 1FWDC 4ZZ9A 5LIUX 3AZSA 2ZE0A 4GK8A 1XKJA 2IUZA 4AHOA 3BW3A 2W0UA 1OCNA 2XGBA 4RUBA 2DZPA 4ZOAA 1EJRC 4GI9A 3I6EA 3H4GA 3Q94A 1SZFA 4J3VA 1KV5A 3AXKA 1MXSA 3FA4A 4JTJA 5BMXA 3M6YA 3OG2A 3OPSA 2A3LA 4PCFA 1QWKA 5CXPA 3APGA 2JKAA 3JVAA 1JR1A 1WAUA 2POTA 4ECLA 1ZBKA 4NX0A 3W1LA 3BCJA 4XTDA 1VB9A 4JTLA 3O9NA 4DWSD 4Q4QA 1ZL1A 3T0CA 2E0PA 4NILA 4Z1AA 4Z2HA 1FXPA 3NFUA 2YL9A 1UKQA 1MFUA 2VOMA 1CB2A 1DHKA 3U0HA 3RM9A 5A5WA 1H1YA 3M0JA 3BV7A 3MCNA 7REQA 3HQOA 2I5IA 1BKHA 3C52A 4OOUA 3VI2A 2NW0A 2WJFA 4W4QA 5I07A 3WDHA 3EXTA 1CGVA 2V81A 1KB3A 4FMVA 4QCEA 3UZXA 2QZRA 1PCWA 4Q8WA 1ME9A 2QCCA 2CLEA 1XW8A 5I03A 3TW9A 3GVWA 2NX9A 1TMLA 2OPJA 2PRMA 2FLIA 3M47A 1TX2A 3ITTA 3PB2A 2NWRA 8TIMA 4HHMA 3GXMA 4P8XA 4DJEA 2BHZA 1R8LA 3CIXA 5TBOA 1KBBA 4MIMA 1N55A 2V30A 3B8UA 1C9WA 4DO6A 5K9DA 1A80A 4LRTA 3V18A 3UG4A 4HCHA 5A3HA 2IS7A 1LDCA 4XAYA 3VX0A 3VIKA 3WF1A 3II1A 3FCPA 2D24A 3W75A 3WQGA 4OJYA 4Y9OA 4JCMA 3E6EA 3M5XA 1MVYA 4NAEA 3M0LA 3GIYA 1RBAA 3PZ9A 4G7EA 4PTNA 4GX8A 3AMDA 3WDIA 4UWMA 3NQVA 1EPVA 6REQB 3SO7A 4Y8EA 1RP8A 1LJYA 2QAFA 3EDFA 2F61A 1ZTVA 3N2BA 2HDJA 4F79A 2RAGA 1E15A 2POZA 2F38A 2PZ0A 3IARA 4O28A 4J2MA 2E6DA 3NQ8A 4BY3A 3FN9A 1HKJA 1LL4A 3GC2A 4W8AA 2XIQA 2OOGA 1I8JA 2DSKA 3TTQA 2VX7A 2BMBA 4A3YA 3CH0A 1Z32X 5B7ZA 1TR1A 2FQIA 3G3MA 2Y88A 3L0GA 1M7PA 4KRUA 1W8SA 4LCRA 4KIEA 1WUFA 3E96A 5CC5A 5REQA 1OK4A 4ZQRA 3ZLHA 1LWJA 3UYIA 2WMKA 3KLLA 4GC3A 4EAMA 1Q7MA 3PFMA 3FY1A 3QN3A 5CKSA 4UTLA 3WJWA 3ZR6A 2DVUA 1E6XM 4PYSA 1GYLA 2YCKX 1P6WA 3LCGA 1Y0EA 5I24A 1BYAA 1SW0A 1WDWA 4H6KA 2ONEA 1R30A 3N6JA 4QDWA 1YPXA 2ZUTA 2CWNA 2ZUVA 3ZIZA 3GTFA 2AMGA 3QHOA 4B5WA 3TWBA 3E0LA 2J8GA 3PJXA 4WDTA 3WKZA 1TWZA 1VQTA 4OUIA 1SGJA 3GDBA 4ES4A 1K8ZA 1UKOA 2GVEA 3TK7A 2ALRA 3FDGA 3BJTA 2O9OA 1R3SA 3WUGA 1WBHA 1MEIA 1MUCA 1A5KC 1W9PA 2CYGA 3KWSA 3ARYA 5PTDA 3M64A 1TE6A 4C7GA 5ABEA 4A05A 4QHRA 3VM5A 5FJOA 2X7WA 4PB5A 5M2FX 3GO2A 2YB4A 3WLRA 3CH9A 1TJ0A 3W88A 4AYSA 1KWGA 2WW5A 4PZVA 3KHDA 2XIBA 1EX1A 1TTQA 3QLLA 4LY8A 3V3WA 4R88A 4U2ZA 3NVTA 2OZ0A 4D6CA 1U5HA 2VFHA 3ARWA 3RG6A 3GIQA 4HZ8A 4TU1A 3T81A 3S6TA 1WE5A 4GLEA 3TAOA 4UXDA 1E9YB 3UEQA 4ML9A 1OG6A 2QIIA 5AVHA 2PZNA 1UA3A 3TTYA 1T8QA 2YDSA 3SZ8A 3TQKA 4XKYB 1H7PA 3SGUA 2JF7A 4DN1A 5DRCA 3L9CA 3CUGA 4OFCA 4JN7A 1LWIA 4NXKA 4HJFA 4RZ6A 3B9OA 3D47A 2BY0A 4NJKA 1JCNA 3RRAA 2NV1A 3TFCA 3DENA 3LGDA 1W91A 2PB1A 1GYMA 3H53A 1SFTA 1ZNNA 1OSEA 2PA6A 3LU2A 3WX7A 3EKZA 1D7FA 1PX3A 1R46A 1FCUA 1ZBVA 4IXXA 2V9DA 3FDKA 3IEBA 2JFEX 1FQ0A 2I9EA 3PUGA 4LVBA 3TNOA 2JF6A 3IUHA 3OBKA 3W82A 3SQMA 1T6MA 4C7DA 2R6OA 5JBDA 4JN6A 4A3UA 1A3WA 3NZPA 4IP5A 3LTYA 4IISA 3TTEA 4YHEA 3RX4A 3DFSA 4H6EA 3TUUA 1JYVA 2I14A 2QW5A 1TQXA 4HGXA 3VFCA 4LGXA 3NAVA 4RK8A 4TUFA 2DFAA 2PTZA 2Q8XA 3PJUA 3EOUA 4MVAA 4GC4A 4TVDA 1JCYA 1FXQA 4D8ZA 5FF2A 3CLWA 1SUXA 3WJXA 3QV7A 6CGTA 5HNTA 2NX3A 2O92A 1XG4A 3UWZA 1JUEA 3SI9A 2GVGA 3A9IA 5CPNA 1PHQA 4PUNA 5EMMA 4E3TA 1JDEA 1WOAA 2RJGA 1LBFA 3DXIA 2C13A 1QO5A 3KTCA 4P7NA 3SGZA 5DFAA 4W7WA 2FGLA 2IQDA 2WZTA 3CYVA 3TN3A 3UG5A 1XLCA 1RBOB 4YTRA 4R9XA 2DQWA 2HK1A 4XK2A 1E9IA 1PVNA 3AIBA 3BQ6A 1XLKA 3DI0A 3UY7A 4F0SA 1XLFA 4QIUA 3VD7A 4K7VA 4WQ6A 1RD6A 1NU5A 2QYGA 5LA0A 1TV4A 3Q45A 1Z69A 2QJGA 4X63A 4UTTC 3MVTA 4RE0A 2XFYA 3AHZA 2E6FA 1VZWA 3H26A 2A4AA 3C56A 2X0YA 3N4FA 5K2ZA 2ADAA 4R9OA 3APTA 5BOFA 2RDUA 1QHZA 3CB3A 3CNYA 3WDRA 4O4VA 2Z0IA 2FTWA 1T8XA 2Q3OA 2VXNA 1KRMA 3W70A 1CI1A 4F0RA 3THQA 5B7YA 1O6IA 4XUGA 4Z0SA 4AX7A 1RP9A 2EO7A 3DCPA 1EZWA 1U1JA 1XBXA 2DT0A 4PCTA 1QJWA 3F5LA 1KNWA 4ZE5A 1T99A 3JS3A 3F5JA 5C0QA 2OEMA 2D2HA 1PCKA 2BG5A 4YS1A 3URQA 4HMCA 3EDDA 2CZDA 1TMQA 1ECQA 2O4QA 4M6VA 1XIBA 1Q63A 2VX5A 1S3TC 1RPKA 4J3TA 5BYWA 2W4XA 3LD5A 2HMCA 1J93A 4OKDA 3EWXA 3PY2A 3KCOA 5CAKA 2CIPA 4H2HA 3WBYA 2J78A 2DZSA 4GFSA 1JRBA 4GGBA 3HQPA 1F3EA 4JQ1A 3VDGA 2PWEA 4MB1A 3LA4A 3QYSA 3SCUA 3P74A 1L0PA 1XCXA 2YW3A 1A3HA 2YCIX 1XRSA 2B31A 1FWRA 2VEKA 2G3JA 3W1XA 1J11A 2MANA 5REQB 4CCEA 3LBCA 1OABA 1R3QA 2C0AA 4YU1A 3G1RA 3HGRA 3BLPX 4E3VA 2ZFAA 2Z1SA 3EKLA 1V7YA 3L12A 2REQA 2C1IA 4OIFA 2FH6A 1I60A 4EWJA 4AB4A 4ERIA 3MANA 2A3BA 3W23A 5ABFB 4FIRA 4O11A 5CLTA 4WVXA 3CC1A 3LCHA 4IQJA 1CGTA 4GI6A 4JS3A 2YB1A 1TVNA 3REQB 1UR9A 1KBIA 1VHCA 4I90A 2PLCA 2ZX5A 4GQ0A 3UCQA 4RPPA 5KITA 2R1MA 1OFDA 2VVSA 1BTCA 3NQFA 1TPB1 4FNUA 4I9AA 3LDVA 2XG9A 3TYZA 2PDXA 3MHGA 2VDIA 4CVUA 3SIMA 3AWNA 2Y8VA 4DF1A 4O1CA 3AUOA 4P8UA 4A6GA 2V63A 3FHQA 1TV8A 3ITCA 4KFNA 2G41A 1UZHA 1VFHA 4YLWA 3CZGA 3BANA 1QPQA 5ABFA 1I2NA 2XYLA 2JBMA 3UYCA 2J13A 3M5VA 3A3XA 1H11A 4B90A 4NYYA 3IJQA 4A29A 3IIVA 2R1NA 4O0ZA 3KX6A 2WKLA 3LMYA 1E3XA 4M1RA 1AW2A 3UGRA 1AFSA 1MSSA 4LALA 1FWNA 1J18A 5EY5A 4KWWA 2Y5SA 1K3UA 3WBAA 2Y89A 3ANUA 4LFYA 2WJEA 5D04C 5D4YA 2E25A 4H3DA 3QH2A 3LNMA 3VMNA 1FBAA 1WZLA 3K8MA 3EX1A 1CB7B 4O13A 3V36A 4F48A 2ZA3A 4UOZA 3EOSA 3UXAA 3FW6A 4QG8A 3GKFA 4MMWA 3FFSA 2PAJA 1VRXA 2D2OA 5C2XA 1OT1A 4O1AA 4REQB 5C9UA 1UH4A 3FLUA 3OOQA 4WUIA 3UXKA 4YWIA 2WC7A 2ZC1A 1IZKA 2VYOA 1QPOA 4ZXLA 2J24A 4I5UA 1K9EA 2C16A 2CITA 3DOPA 1QPKA 4FPSA 3O06A 1BQGA 4GYPC 3N11A 1W1PA 4AZHA 5A8MA 5L6UA 4FLSA 3OQ8A 4LSBA 5JIWA 3NQDA 1BG9A 1M01A 2CKSA 5LIKX 1GW1A 3NCOA 5CZSA 4C6FA 2CCRA 4IQEA 1UC4A 3SN0A 1L2QA 3L5LA 3THAA 2G50A 2GDVA 3PAOA 1IT0A 2ZWYA 4JDYA 4WOQA 2W91A 1KFCA 2W92A 3AXXA 4AD1A 4ZQPA 3E0WA 5DELA 2Z7GA 2VD9A 3ITLA 1XLBA 3I6TA 1E4LA 2OO0A 4A8RA 4BKNA 1RSCA 1CGUA 1TV7A 4JTFA 3QY7A 1CW2A 5FAGA 2R91A 3DG7A 3E5PA 3KVKA 2QVHA 3CV1A 3KAOA 1H5VA 4R5EA 4PTXA 4JKLA 1GVIA 5DANA 2PDYA 3EMCA 1DWJM 2AKMA 2QIWA 5HMDA 1QI2A 4TQTA 3TCSA 1KGUA 3MO7A 4HKPA 1YW1A 4QJ3B 3DHUA 2NWSA 1TZ7A 4JIHA 4BQ5A 3T78A 1F8IA 1OGBA 2VEGA 1A5AA 2W79A 4JTTA 3KDNA 1W8GA 2FJUB 3DC0A 2O9PA 1W17A 1R9ZA 4LVGA 2E67A 3GU9A 5FL1A 2GGHA 2J7CA 1T41A 1YBQA 2BVYA 1G1YA 3VZZA 1IV8A 1QHOA 2ZZ1A 3H4XA 3UCDA 4NZ5A 1KKOA 1RQHA 4AXNA 1XYZA 4Q3MA 1VRDA 1TJRA 3RJYA 5A6BD 4MZYA 4FIQA 5J5RA 2QCGA 1OT2A 4ERAA 1H7OA 4WDXA 3BOLA 1VFMA 3TNBA 1G01A 4XAPA 1JD7A 4RDVA 1PJ9A 3GHTA 5A6BA 1FY6A 3UFYA 1I1WA 3GFZA 2PP1A 3UESA 1HUVA 4UR9A 2YXOA 1YE4A 1VD6A 4O57A 1B31A 1AQ0A 3L7RA 3OYZA 4AY7A 2PDIA 3I4KA 3R89A 2FZMA 3WQ5A 5LHEA 3PZMA 1A49A 4WY0A 4V1XA 3G1DA 3KRSA 1VKFA 4KWOA 4IX2A 1AL8A 1ICSA 2VWSA 4PA8A 1VHNA 4TMBA 3SW6A 3IGHX 1L6WA 1Z6KA 3LUTA 4R7JA 5F1VA 1RLDA 1EA0A 3ZVHA 3B8TA 3QFWA 3RLHA 1K9DA 2J66A 3JW7A 2DJLA 1ZP3A 3MCOA 3FV9A 1DE5A 6XIAA 2HVNA 4NRRA 1PDZA 2XSXA 4PUWA 1X98A 4GY0A 1AD1A 3EYPA 1BRLA 2V8ZA 3RR4A 1UR2A 3ONBA 3M4HA 3FYYA 2H9AA 3CT7A 3VVGA 5G1MA 2GQAA 3CHDA 3MKCA 3HV8A 3PTKA 2Z2UA 3K8LA 4ROPA 3UW6A 2QDEA 1J5TA 5CGTA 1UZ1A 4ADTA 3AALA 4HHLA 5HMEA 3L4UA 4L4PA 4QNWA 2XWDA 1W1TA 1VJZA 4JTAA 4Z42C 4IL0A 1VP5A 4HA1A 3MSYA 3VNIA 1GK8A 2GK1B 5F4XA 4WJXA 5U4NA 1F4AA 4LEQA 5JU6A 5TNVA 4QSFA 4ZO7A 1JZ2A 3URNA 3CUFA 3DFTA 1FWGC 5EL1A 1UKTA 2VI0A 2D3NA 3QGVA 2E77A 4AWSA 2B7QA 1W5QA 1SW7A 3LZ5A 1E73M 4HP5A 1J6PA 3HPZA 4FOKA 4WY0F 4XB3A 3VGEA 2WHKA 5HPCA 3MYPA 3VKCA 4D6IA 1AA1B 2I1OA 1E5JA 3GXNA 3MP5A 1PWLA 1UWIA 3UNTA 4Y7EA 2E8YA 1S5WA 4J3UA 2NXIA 1LUCB 5A6TC 5AYYA 1FUYA 4RX0A 3M0YA 3VIIA 4XX6A 4DO7A 1OY0A 1K4GA 4N4QA 1EC9A 4FB7A 1VFOA 4PL2A 4XBKA 1XIHA 3LXBA 3WK3A 1K4HA 1E1FA 4KQNA 1C9DA 3WEZA 1QK2A 4GBDA 4A2RA 1IR1A 1SPQA 3M0ZA 1J12A 3PBYA 2FB2A 4U2YA 4M3PA 2DV0A 4RKAA 1A5SA 3CEPA 4A8NA 4C6MA 1K6AA 4EK7A 1GQJA 1GHRA 1ZU8A 2H8XA 2WCSA 4LANA 4Z1CA 3EOEA 2ICSA 1DL3A 4MJMA 4CN6A 4XZMX 1V3HA 3RLUA 3WDQA 3CHVA 1ZUAX 3HPSA 3R12A 2PUZA 2FVLA 1B3XA 1P7TA 1H60A 3SEPA 4IF2A 1MUMA 1W2PA 4G2DA 2EJ1A 3UJRA 3AMLA 3AUJA 4NY2A 2YFOA 2DZXA 2YA2A 3HG3A 1M5WA 3PPHA 2HXUA 2Z1XA 2VGIA 4W7VA 4UTMA 3W74A 1A5MC 2ZZ3A 2PDCA 2YX0A 2OWCA 2W6RA 3G3DA 4UOJA 3V75A 1W32A 2BNJA 5C8BB 3KL0A 3WQEA 1D9EA 2YDRA 3TXZA 1BWVA 2O56A 3L66A 2XFWA 2J9ZA 3SGGA 3UXDA 4PRTA 1XJBA 3GC5A 3W7QA 1W1VA 1JZ7A 1AJZA 1IEXA 1YDNA 3LHZA 3WQPA 1KQZA 3N9KA 1P7TB 3FEQA 2WB5A 4GYKA 4K2SA 1OCQA 5E5CA 1QXLA 3ELFA 4DYJA 4TVUA 1J6OA 1YNYA 1XL9A 3LRMA 2WM1A 1QU4A 3VTRA 3SCOA 3ZR5A 3S5ZA 4DF0A 3LLXA 1IXNA 4I7VA 1UZ4A 4Y2WA 1YXCA 4WF7A 1RD5A 3BCFA 3O63A 2Z29A 1VEPA 4IJCA 1M6JA 4LY4A 4IUGA 4US5A 3LQLA 4O8RA 3TQ0A 4ZTXA 2QJJA 2GK1A 5HUOA 5CBJA 3LXCA 3MWAA 4J4KA 2E8ZA 1NOWA 3N34A 4ATLA 3GAYA 3T6CA 3AISA 2EKCA 3QLDA 5KTLA 1I0DA 5AC4A 3HV9A 3N9RA 1YBQB 3NPUA 3OB8A 5C71A 5HINA 3PNZA 3BTNA 1QOXA 4GO9A 1HG3A 4HIBA 4BHYA 1S39A 5E9AA 1SM9A 1PZ1A 3DERA 4R7WA 4D9PA 3GZAA 5I2UA 4F2UA 4KIRA 5J8LA 1HGYA 2CLMA 4XVEA 3F03K 1F3WA 1HFBA 4C90A 1ZRQA 3N4AA 4J9JA 3CPRA 1J0ZA 3NL6A 1E6SM 1OINA 1YEYA 1BKSA 1B54A 4L6HA 4X0VA 3UNDA 2AAAA 3EA1A 4GVIA 1W54A 2A0NA 3T7VA 4KRTA 1RPXA 3PZTA 4PEEA 2XH0A 3CWNA 3IGSA 2DUZA 1RA5A 1H0IA 4D72A 3QJAA 3GH4A 4AZ5A 7XIMA 4DVOA 2QJNA 5CZTA 2FIQA 5HJLA 4OBRA 5CBIA 1FH9A 1G4SA 3W7OA 2NLIA 5BWFA 4F0KA 1QASA 4WXZA 3NO5A 3WUEA 3AXHA 2WSYA 1XIFA 2D22A 2H6RA 4ZXOA 4FA3A 2EQDA 4DO4A 3S2LA 2O55A 1V93A 2PMQA 5K9XA 3CL7A 3TLQA 2PU1A 1T0OA 4KGJA 4Q7IA 4D6DA 1F74A 2JALA 3L5MA 4R53A 3MC5A 3ABSA 2FZ8A 4XIAA 1YXDA 2WCAA 3NG3A 2RHGA 2V2DA 6ENLA 2QQ6A 1CBGA 1L6SA 1KBKA 3VUPA 3OYXA 3B8WA 4O4WA 1TVPA 1OFPA 2IKGA 1HKWA 3UWWA 3A9BA 4DZIA 6ALDA 2X2GA 3E3HA 1BVWA 3S2CA 3UXLA 2GYIA 2C91A 4QE1A 1JEZA 4C6OA 4AD0A 3FVDA 4FR1A 5BXRA 3TMQA 5BWAA 1V79A 2NQLA 2NVCA 3PVFA 3W29A 5ABGA 3KXQA 1PZ2A 4PTDA 5TAOA 2YBUA 3QXBA 2ZXDA 1XKYA 2VZUA 1AZ1A 2FH8A 4L56A 3ARXA 4UNLA 1CT5A 3EOOA 3W2MA 3NNTA 4YTTA 4HCLA 3P67A 2CW6A 3U3HA 3V0TA 2E4TA 2PFHA 3G0XA 5E0FA 3VD5A 3OP2A 3HQNA 2Y63A 4FK9A 3U8GA 4DM1A 4CNNA 5ECUA 1ZBCA 1FWEC 4JFTA 2WV8A 2EXOA 4LUIA 3LRLA 3N14A 1C91A 4P61A 3GYEA 1A5LC 4PTVA 3GM8A 2VUYA 4H04A 5FEXA 1V3LA 4B3KA 1QTWA 2WVUA 1H3GA 3R7MA 3TA9A 4YYFA 4PUJA 3PJWA 3G1XA 4C1NA 1F4HA 4MF4A 3PN8A 2BVDA 3URAA 4AD3A 5G4WA 5AHFA 4QGCA 3F2CA 3VDAA 3B8SA 3LG3A 1U2YA 2FHCA 1PKYA 1BQCA 1V6YA 4H00A 5CAHA 1HZYA 2XIJA 4LVAA 3SIZA 2P8CA 2FVKA 4FALA 3PSVA 2E6YA 1G4EA 4PODA 5DY2A 2GL5A 1G7UA 1X8CA 4KEZA 4JY8A 4JKMA 5C9WA 1J9YA 3VNLA 1WDRA 1VBGA 1E40A 5AC6A 3CTLA 1Y5XA 4HU4A 1O12A 1A5OC 1A50A 1OX4B 2PF0A 3QC3A 2X30A 4AWEA 4QRNA 3DI1A 4I3GA 3IRSA 1UWRA 3JZUA 3NQGA 4LNCA 2X0HA 5L9FA 4DHGA 1K70A 4XD3A 3RDKA 2J8TA 2F7FA 3ATYA 3B8VA 3XINA 3ZM8A 5MHBA 4A8IA 4QTGA 5A2CA 1AD4A 3MV11 3TW7A 5H6HA 3KUMA 2DZVA 3UJEA 3MUZ1 4UFIA 4MWAE 1DWHM 2TSYA 4S3JA 3E2SA 3BWWA 1GPFA 1ME7A 2BOEX 4C6DA 5FF0A 4MPQA 1UPPA 1MDLA 5EA9A 5E0KA 4GQQA 2C71A 3NQ2A 4IT1A 4ZQCA 1UD2A 2PRHA 3HA1A 3N04A 2V2CA 4UFHA 4G1NA 2NSOA 4KS0A 1LF1A 1HP5A 4YCOA 5JIPA 3NDZA 1TIMA 3H24A 4JBRA 3NZQA 4XD5A 2ZDSA 3FSUA 4ZO6A 2HPMA 1R85A 1Y5WA 2OQHA 4HZ6A 2ZX6A 1E9LA 4NNCA 5DMLA 3BW2A 1EJXC 5MF5A 4NI3A 4GINA 3WLMA 2PBOA 1RBLA 4NKCA 3B0UX 4XKMA 1CGWA 2ZZ6A 4IGNA 1H63A 2E09A 1OF6A 3LM3A 5J04A 4ZSUA 1QWGA 3T05A 4HN4A 3ARSA 1O1ZA 4AWTA 3KS6A 1XDLA 2ZX8A 2INEA 4HOZA 1GTEA 3IJ8A 3KBJA 4I7UA 3WUBA 4BI5A 1UWAA 4AMAA 3Q67A 1DIEA 4NZJA 1KM1A 1KM4A 8CGTA 3RLGA 4JXCA 4IP4A 5FF4A 1RK5A 1TPFA 1UD3A 1FOBA 1UB3A 4J7RA 3M7SA 4FXRA 1DWFM 2ZVIA 1MW2A 2O9RA 1YLVA 4I6VA 5LA1A 4U33A 3OGRA 2WHMA 4RJEA 4H8VA 5CPLA 5C6MA 2D73A 4OGZA 2AOSA 1GOWA 4TR9A 2DIEA 3EDEA 4DUOA 3WQOA 4B9ZA 3MU7A 2W63A 3PAJA 3B0VC 1J2WA 3NEHA 2FYMA 4ZVJA 2PDBA 2FPTA 3L4TA 1RJQA 4OV9A 3G1HA 1UHVA 1NOUA 1RVGA 3PUOA 1EWDA 4YCPA 4DWSB 3W7JA 1OK6A 2XSAA 3O6YX 3PFRA 3HGSA 1E51A 3LMZA 4NX5A 1SW3A 3W71A 4YJ5A 4QAWA 3FYPA 4L61A 3N6QA 2V3FA 5CSUA 2QDDA 3HIJA 2VZVA 4GJIA 1AUSL 3GNPA 5CZ0A 4H9TA 3SY5A 2QGYA 4AC1X 2BX7A 4HCDA 4D1JA 1XICA 1GYNA 1N8WA 1XLDA 5AY7A 2VFDA 4DUWA 4PC8A 4LW7A 3OA5A 2QCHA 4PMRA 3WYZA 1SQ7A 1Z3NA 2WHJA 3WBXA 1XS2A 1K8YA 3OVGA 2ALDA 5D9PA 3VABA 4IMDA 1JDCA 5D2XA 2HQAA 3ENLA 5FAJA 4CN4A 1D8CA 3ANVA 5KZEA 2GUYA 4K8HA 2X1IA 2XGIA 4PH6A 3G1VA 3STPA 1UWSA 4J35A 3W2LA 1CXEA 2BXYA 3AIQA 5BW6A 1C8XA 2QCFA 2J25A 1QNSA 3IIOA 3WFLA 3B8IA 3BAYA 4XSLA 4URIA 1MXGA 2V5LA 3N3MA 3OQEA 4AD4A 1FKWA 1YIXA 3W72A 4LU0A 5RUBA 3WSUA 3W3OA 1FHDA 1UR3M 2NT1A 4PMOA 3CQHA 2BS9A 4H41A 1GZGA 4D8AA 3H7VA 4MZ1A 4S3EA 3NL3A 4GXPA 3EPMA 4ZQMA 1QT1A 7CGTA 1OIFA 3KTXA 1CDGA 1PL9A 4US5D 3G18A 4ADUA 3WFAA 1XD1A 3EX3A 1HXJA 3F1QA 1TRDA 4BJHA 1Q5MA 2VENA 3U2EA 3OJGA 1ITUA 3QFEA 4OV4A 3I3BA 1L6GA 2WHLA 3W0KA 4L80A 2ATSA 2OLHA 4XZNX 5U7SA 3V16A 4Q8MA 2EF9A 4BS0A 3WLJA 3AIUA 4JYDA 3OG3A 1F6PA 1VFLA 3AJ7A 3W7DA 3W7GA 3NPWA 2NV9A 3SRDA 3TIMA 3FVMA 4UTIA 4K38A 3IIZA 2YA0A 2SFPA 1KM0A 3QM3A 4H9MA 1VEMA 5J5DA 3FJLA 4UMAA 5D8WA 5KEZA 3IWPA 2BGSA 4AEEA 1W9VA 3MP4A 3GB6A 4AF0B 1NQKA 3T0AA 1OB0A 4AWUA 2WVSA 5A2AA 2HNHA 1K8XA 1R3WA 3CB8A 1F76A 2GJRA 3GHRA 4GIAA 2XJ7A 1MWOA 3ARTA 3AU2A 4MSSA 2V5CA 3WLLA 3FA5A 3S9IA 5HJYA 3LK6A 3W7EA 1Q45A 4PUDA 3V0SA 2J9XA 4HYRA 1L6YA 4NZCA 4H9VA 3AXMA 2R94A 1LP6A 2BOFX 3U2CA 2BDQA 1UPMB 4PUMA 1FFQA 4NYUA 1GOOA 3LTPA 4QJ1A 2P53A 1IZJA 4C1LA 1KXHA 1UD6A 2FVMA 2E1WA 3CPUA 3T1GA 2WLYA 1XGDA 3WNOA 2P5NA 2REQB 3STFA 4BF9A 5F4WA 3L4WA 5LA2A 1I45A 1X38A 4LBRA 3AIRA 1KQYA 1D2KA 4WJEA 3MP3A 4KH2A 2IPFA 2CBUA 3WQ8A 1DJGA 1NELA 1XCFA 3GSMA 3TC6A 1WZAA 1GG1A 5BROA 2Z6IA 2QEZA 3EA2A 5EFDA 4D6JA 1B5TA 1IXOA 4BEUA 2PU0A 1MQQA 2C6QA 3SJ3A 3TOYA 3CQIA 3GG0A 3BQ5A 4UFKA 3OGVA 1EC8A 2UY5A 3H7RA 3A5FA 2V5DA 4IIEA 1E9ZB 3P61A 1R9YA 3I65A 3AIWA 4DWSC 1XUZA 1UR8A 4ACZA 1IIGA 5LIXX 2UBPC 3DU0A 3BAKA 1AQMA 1LM1A 3PPFA 4UTWC 4S2CA 4Q7NA 2YYUA 2PDWA 4GKTA 4FI4A 4US6A 2OWWA 1JNEA 1B1YA 3MUCA 3R8GA 4RNFA 4EPBC 1NFPA 4CD8A 3W22A 4HTYA 4B5NA 1W56A 4AZIA 3O1NA 2Z4GA 2QGHA 3F5KA 2C14A 1F6YA 3UPBA 5A69A 1R5YA 1B90A 3W7MA 5FI8A 5HUPA 2XH2A 4X61A 4Z0JA 3T2QA 1ZGDA 1OFAA 2BV9A 1ZAJA 2A5HA 4EXQA 3PC0A 3GS6A 1QI5A 2V3DA 4QROA 4W8LA 4QR6A 3T8LA 4Z2LA 4Y6GA 4F66A 2ZTJA 3MDUA 3LZ3A 2BOGX 1RXOB 1WKEA 3NQEA 3VNZA 4Q8TA 3ARZA 2ACRA 3VIMA 3NR0A 4M6PA 1VFSA 1VJIA 3L4VA 4KEVA 1W2VA 1B3OA 1MFVA 4GO8A 4AZBA 5FEWA 1QW7A 3DFYA 5G1TA 3BAIA 4KRZA 5GVJA 5FSDC 5A6MA 4HSNA 1RZMA 2DJXA 3GBDA 2ACSA 4LS2A 4P7RA 4FEZA 3TFXA 5C9XA 3LCIA 2PWFA 3EPNA 4DBDA 1N8FA 2Y7FA 3J7HA 2KZHA 4QS5A 4ATWA 4UQ9A 2Y0FA 3W7RA 5FCZA 3GNOA 3BL3A 3AJXA 2UY3A 5FACA 3W02A 4DJFA 1UUQA 4GVGA 2XTKA 3LOTA 1RH9A 3M0KA 1ZB5A 2Z1KA 3EMQA 3H21A 3VD4A 1GNXA 1S1PA 3HO8A 3RITA 4ZTYA 3I4EA 3TSBA 3W6YA 2CPUA 4N9BA 3IIXA 1GVFA 3M0HA 1GOXA 1KFWA 1RV8A 1NJJA 4MG4A 3NA8A 3SN1A 1JDFA 2WAGA 4PMDA 3VA8A 3CUXA 4Q8PA 5GNXA 2VKZG 1EBHA 3N25A 4KWUA 1JPDX 3WN6A 3WELA 2XM2A 4PMXA 3BZGA 1ZSXA 3PM6A 2XIIA 4KFOA 2XVKA 3C2FA 4UMBA 1H1ZA 4J27A 2ABBA 5CPSA 3SUTA 2YXXA 1M03A 3ZO9A 2XH7A 1V5XA 4IX0A 4NP7A 1UW9A 1B0IA 2PTYA 2E68A 4ALDA 3VDHA 1E1EA 3U48A 4DB7A 2A6LA 1S2TA 4WR3A 3CXOA 3V1PA 4E4FA 4C65A 4LC6A 4C1NB 5M3WA 2WM0A 4LUTA 1QAPA 3QMSA 1ITXA 2VL4A 1AMYA 4YTQA 1FWTA 3RK8A 4JFWA 2YDQA 1CIUA 2W27A 2NUWA 3PANA 4IIGA 3WLOA 4LAKA 4GOAA 4KFPA 4K37A 3RRXA 1Q8AA 1H7WA 3WLIA 3TEVA 1CX9A 5LSMA 4H9XA 3VCNA 3OODA 5BNKA 2QCNA 3NM3A 1FDJA 1ZPTA 1ELSA 3H2EA 3TLLA 5CBBA 4K1GA 4QJ4B 2Z2AA 3LI1A 3FGCA 2OVLA 4H8UA 4F4RA 1BWKA 1M04A 3SCWA 1S2AA 1EDGA 1XDJA 1MZRA 3BDKA 3GBEA 3PTDA 1ALDA 1CXHA 2WSPA 4WKFA 2C8NA 1WKYA 1QW9A 3D3AA 2PDKA 4JDBA 2ZQ0A 1GVYA 1S5NA 4WRHA 4Q8VA 2VHLA 3GNDA 4RZ4A 5K7JA 5JUVA 1I2PA 3KEHA 3NYDA 1OZMA 2B0MA 1S3HA 4NHVA 1UOKA 3RU6A 2X09A 3BARA 1ZJHA 1PV8A 2CWXA 4RE2A 3BOXA 2DZWA 5D33A 2WNZA 3A23A 3IUDA 1JD9A 3OZYA 1TV5A 1V3IA 3VC6A 3W1MA 4CUCA 1LOSA 2HBXA 2CESA 1X7FA 1P0KA 1V02A 2HBVA 2VEMA 1FWHC 2VURA 2INZA 4ZQNA 2C15A 5CG7A 1OX5A 2E5CA 4O52A 2J4GA 1YX1A 3SECA 3V5FA 1Q6LA 5F1UA 2P0OA 1OEPA 3V35A 1OFEA 1XIGA 2WANA 2VZOA 4GNVA 1TPWA 2TRSA 1UIPA 3STEA 2CBJA 1TWSA 3AIEA 2X16A 1LLWA 3NOYA 2D2JA 3KLKA 1LQ0A 2OSYA 1OFRA 4ENLA 4RW5A 4DLFA 1GQLA 1OYAA 5IFTA 4S3FA 2GJNA 5GNZA 4FXSA 4ZFMA 2VC7A 2Y8KA 3WMLA 3RXZA 4Y9AA 4ZMGA 3CMFA 4GX9A 4MLRA 4K8GA 4M5PA 2EPMX 1XLHA 1CNVA 2OYKA 3WENA 3WJSA 3EXSA 3VOIA 1D7KA 2OLAA 1JF5A 1TPC1 2VDHA 3UWUA 1C8YA 1A5CA 3AICA 3DFNA 5CZJA 3GR4A 4AH7A 3P81A 3H55A 1DOSA 5BXPA 4H9ZA 4XAGA 4OU1A 2XUCA 1MRQA 3LCLA 4GIYA 4EVZA 4QM1A 4AVOA 1ISWA 2AKZA 4J1OA 4PL1A 3ZWTA 1GGOA 1TR9A 3GR7A 4XVDA 4I9TA 5EKYA 3C2VA 4QFUA 5JH1A 1OYBA 3ALFA 3ZXWA 1ONWA 2LLEA 1UROA 2GJLA 3K1GA 5I7GA 1SO6A 2I9UA 3VNMA 2ACUA 3PPCA 4F2BA 1EGZA 1TRIA 2WK2A 3DFPA 4Q4RA 2OMAA 4IFOA 3KRZA 3HG2A 3ES7A 4KERA 4B3LA 4RXFA 3AI0A 5EMYA 3LGEA 2QR6A 3NQAA 4MY1A 3TQPA 1N82A 4NVTA 3SUWA 2PURA 3ES8A 1W3JA 5M1TA 1P1XA 2VOTA 1X1OA 3S2NA 5C55A 1M1BA 4Z2KA 3RFAA 3DAQA 1CGYA 1ISZA 1JGIA 3S83A 1EUAA 1ADOA 1GVQA 4IWWA 3R94A 2Z6JA 4DWSA 4W93A 3RMJA 4D6HA 4XZLX 1V6TA 4HPXA 5CSSA 1O1HA 1HJUA 4B5TA 3VX1A 2XM1A 3S9YA 2GQ8A 5H2ZA 5M5DA 3ZT7A 4CNSA 1Z42A 2QVNA 3KBNA 1OFQA 3GU1A 4L64A 3TR2A 5A1AA 1JZ3A 1HP4A 4L4LA 1C29A 4INFA 1NF0A 5HWMA 1YXYA 1NM9A 2RJHA 3CS2A 7REQB 2PDNA 2VWTA 3OZPA 4PN2A 5FJUA 1HX0A 5G1YA 2WMIA 3HM7A 3PULA 3BJSA 2GJXB 5JBEA 2Z24A 4R27A 1W1ZA 1HJXA 1VCGA 4MAVA 4RZBA 2IQTA 3AYRA 1E70M 2PDFA 3H7UA 4PBFA 3ABXA 1LCOA 2G8ZA 4AX6A 3AMGA 4FS9A 1H09A 2ZE3A 5JBFA 1QMLA 1TTJA 4W7UA 4LUSB 3CZJA 5DT5A 2PLJA 1ZALA 3HTWA 2WVVA 4UQAA 4JGDA 3WF2A 1RCOB 2NQZA 4X3ZA 5A95A 3GVQA 3LEPA 4DELA 1VBUA 1JCLA 2J6VA 1QOQA 5BRPA 2VUNA 9XIMA 3ABQA 3U5YA 1E4NA 4EF8A 3KOXA 2ZA1A 1KXVA 4YWSA 4N4PA 2VJXA 1XI3A 4EIVA 2NUXA 1RVKA 3GXTA 4JL2A 4LUSA 3AO0A 3VDCA 4NZ3A 4AAJA 1KKRA 3SCVA 4GJJA 1GVRA 1RR2A 4NAFA 4A35A 4CEUC 6REQA 3ABZA 1EGMA 3ME3A 1ODZA 2D3LA 4GUHA 1GT8A