4WX2A

Crystal structure of tryptophan synthase from salmonella typhimurium in complex with two f6f molecules in the alpha-site and one f6f molecule in the beta-site
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
253
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Visualizing the tunnel in tryptophan synthase with crystallography: Insights into a selective filter for accommodating indole and rejecting water.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Transferase
total genus 95
structure length 253
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4wx2A00
2GQAA 3NG3A 4N9CA 4K36A 1AL8A 1OYAA 2RDUA 3LB0A 1JJKA 4O52A 2A7RA 3SECA 3RU6A 1OFDA 4N02A 3B0VC 2VFIA 4Q4KA 3LRKA 3W7KA 2Q8ZA 2FPVA 5DXXA 4MJZA 5FF0A 5U4NA 3ZWSA 2ZBTA 3W7LA 3W1RA 1VHCA 3BK0A 4I9AA 1TSIA 3F03K 4FIQA 3LHVA 3G1FA 3N3MA 3NPUA 3NPVA 1SZEA 3LTYA 3TSMA 1G4PA 2XN0A 3L0KA 3QQ1A 2BSLA 3L2IA 1IXOA 1X7FA 3G18A 4RK8A 4MUZA 3CWOX 1RQBA 1NEYA 3EKLA 1SR9A 3S5ZA 2FQIA 2X1RA 3UWQA 3QEZA 4OE7A 3P60A 3HGSA 4BR1A 1H7NA 1GYLA 4FF7A 4KKXA 3QSTA 4XQ6A 3QPZA 4Y96A 3O06A 5E0KA 5LZLA 2HTMA 3FKKA 3LRLA 4O57A 1XKYA 3HG3A 3TKFA 4XBKA 4M7TA 3NPWA 4JY9A 4UC5A 5CKSA 3H54A 4LWWA 3W1QA 4O1BA 4CQAA 8TIMA 1QPRA 1TMHA 3W7HA 4FB7A 1KFEA 4N6EA 3DKLA 2TMDA 4UFHA 2CLKA 3TH6A 1I2OA 4PFMA 1QPNA 3W84A 4UTJA 2NX3A 1Z48A 3G3DA 5IBXA 4NX0A 2P10A 2QCCA 1SO5A 1TB3A 3IIZA 4FXSA 3NL2A 5FEZA 3OVRA 2A4AA 3ABRA 2PRHA 3OVPA 2YFOA 1B57A 4MYAA 1GVQA 4LVGA 3M5ZA 4JDBA 1QOPA 3A24A 1IF2A 3BV4A 1TTPA 5LGXA 4LC8A 2B7QA 2A21A 1W5NA 2WKJA 1CW2A 1ZNNA 3Q37A 1A5BA 4HSNA 2R94A 1G7UA 1KBJA 4IUOA 1TRIA 2J9ZA 2H90A 3S1WA 3DFTA 4ZQRA 3HOJA 4IMEA 2Y70A 2WOQA 4UMCA 2TRSA 5G5IA 5LNVA 3NEVA 3OBKA 1IGSA 4O16A 4LNYA 3F4NA 4M19A 4JTTA 3T7VA 3P5YA 4UR8A 3BLIA 5KITA 4AHQA 5DN1A 4IQLA 4WY0F 2E6AA 3T40A 1LRNA 1AG1O 4POCA 2I9EA 2QAFA 1EA0A 1YDVA 3QZEA 1LBMA 1FDYA 3NM1A 1K7EA 3KOFA 1ZY9A 2ZRYA 2YZRA 4DF0A 2RDTA 1XC4A 5KZEA 1GVFA 3SW6A 3DGRA 5AHEA 2DZUA 3TK7A 2CLEA 1TTIA 5D05A 2ZCGA 5FESA 1VPXA 3BPWA 4GBUA 3MYOA 4FNUA 3W2NA 5G1TA 1W0MA 3TXVA 1NSJA 4WQ6A 4O53A 2C14A 4HNUA 3UPWA 1H62A 3TX9A 1P4CA 1TPVA 1Z41A 3QSRA 2ZDRA 4ADTA 2GQ9A 3PBUA 2WSRA 3HO8A 1SO3A 3EX2A 3O15A 1H51A 3GLCA 5I3JA 4OGZA 1L6YA 4PCFA 1UCWA 1B4EA 3TMLA 4FO4A 5K2ZA 4FX6M 2B4GA 2GVJA 3PM6A 3M1ZA 1A53A 4JX6A 1C29A 4LRSA 3TFCA 4ZQOA 3PBVA 4UMAA 3G1SA 3SIZA 4L4MA 3LHUA 1S3HA 4O13A 4LRTA 3W7RA 3TJXA 3NQ6A 5FF7A 3EX6A 1XM3A 3C2FA 3B05A 3TSBA 3CEPA 3O63A 3LTPA 3S9YA 3CB8A 2X30A 2NZLA 2RHGA 2XFWA 1R2SA 1XL9A 3EX1A 1OX4A 4I7UA 1YDNA 1YTDA 4ICNA 1QO2A 4O0KA 3T44A 1KA9F 1SO6A 4BF9A 1DVJA 2YW3A 3W1LA 4M6QA 2C3ZA 3TV8A 2J27A 4RZ4A 5LHEA 3C8FA 4OBTA 3W70A 3GKAA 3MHGA 1FCBA 4X22A 3EWXA 4A2RA 5AC6A 3C2EA 3N9SA 3MI3A 1LROA 1TV5A 1G7VA 3BG9A 1PL9A 1R2RA 3FA5A 3BO9A 3G1HA 1PIIA 1DJQA 4NU7A 3LXAA 1D3HA 5DY3A 1VH7A 1ME8A 2ATMA 1TPWA 3L0GA 2GPTA 3TAKA 4LOCA 4XTIA 1KM1A 3B06A 4PA8A 4GNJA 1P5BA 3KVKA 3B0PA 1XBVA 3HMJG 3ABQA 4RX0A 1G6CA 3C56A 3LERA 4JDYA 4NNAA 5K9XA 4UTKA 1QOQA 3QFEA 4BI7A 2Y7GA 3GK0A 1LCOA 1R30A 4MFDA 3T55A 1L6SA 3BW4A 3M43A 5SWUA 1EUNA 4A29A 4H4IA 4JTGA 4O4WA 3PBYA 4UTTC 2A2IA 1OHLA 4ZQCA 3QPYA 1L9WA 4KWWA 1VC4A 2OCZA 3W7CA 3IIXA 3PB2A 3G0XA 4JS3A 4PODA 4JYEA 1OFEA 3GB6A 3GVGA 4K38A 3DI1A 3L5MA 1VRDA 4C1KA 5HINA 3NM3A 4M6VA 1P0NA 2OT1A 3EWZA 3LCWA 1OFAA 1KV5A 2C15A 3LBCA 2GVGA 4UMBA 4LS2A 1O60A 1H1YA 4O10A 4OWGA 4ADSA 1ME7A 1FWWA 3PSWA 3UNDA 1RD5A 4NVTA 1B9BA 3C0JA 2EPHA 1WAUA 3O8AA 4QITA 4BI5A 3DFOA 1SZGA 1W3TA 1OVDA 3EXTA 2ISVA 2FDSA 2HMCA 1X8FA 3QJAA 4LVFA 4NT0A 3KRUA 1XDLA 3A21A 3HPXA 1OG0A 3W83A 3GDMA 1W1ZA 2J24A 1JCYA 3IVUA 1P1XA 4FHAA 1Y0EA 5C55A 1EP3A 3MBFA 2GUUA 2PE4A 5AHLA 3CIXA 2NV2A 3MYPA 3W23A 4AHOA 1H7PA 3R12A 5G2IA 5DELA 1G4TA 5LNRA 4BK9A 2F7FA 3L5AA 2CLFA 3STGA 2J6XA 1ICPA 4O14A 2G5WA 4BI6A 3HGJA 3DKJA 4GUFA 2A7PA 1ME9A 1GYNA 3FJ6A 3MWAA 3NAVA 4RV8A 1GT8A 5EBUA 1YTKA 3M44A 3LI1A 3TW7A 2OJPA 5D09A 2NUWA 4Z1AA 1XDMA 4YWIA 3ZR4A 2XN2A 5A5WA 5A8GA 5ABTA 1FWRA 3LHYA 3G1VA 1TPEA 4N9EA 2Q3OA 4Z0JA 5D37A 3FFSA 3TUUA 1MO0A 1H61A 4P2VA 1J2WA 4JD4A 4JNMA 1J5TA 3V75A 3VE9A 4PH6A 1EWDA 3CLMA 4O1AA 4I7VA 5EKYA 3TJLA 4JEQA 4DPPA 1LP6A 1VYSX 3NVTA 5DY2A 3W87A 1I2QA 3DHFA 2HSAA 1GZGA 4PC8A 3CHVA 2C1HA 2R8WA 3P7YA 4YL2A 5G2WA 3VCRA 3PR2A 2YX0A 5LGZA 1T99A 4D2JA 5D03A 2RKXA 4JGDA 4MLJA 1QDSA 3O6DA 2X1UA 3E0IA 5CPOA 3BARA 2G96A 3IEBA 1ZFJA 2DZWA 4E2BA 1YXYA 5DCEA 2CW6A 4CCCA 3LCIA 3KVJA 4XKYB 3W6YA 3A23A 1FWTA 2A6NA 5AC7A 1QR7A 3R5EA 1TTQA 1JCJA 4PL1A 1W31A 4O54A 3P74A 4TIMA 1SQ7A 1MSSA 1QPOA 2VEMA 2ZZ5A 1VJIA 3ZWTA 4S2CA 6TIMA 3WK1A 2HS8A 3QH2A 1RQHA 2O7SA 3LHTA 4UTIA 5BOOA 3LGEA 5HULA 1EWEA 1IIGA 2E5DA 5EL1A 3G0UA 3LXBA 4RR4A 2QDHA 2Y89A 5F2GA 3HGRA 4OU1A 1PCKA 2PRMA 3NPXA 5LSMA 4AWUA 3QRHA 3MJYA 1QAPA 4NUWA 4YMZA 3N19B 3C2OA 1K8ZA 4ML9A 4MVAA 3LLFA 1LBLA 4ORIA 1GTEA 5HWJA 2ZRWA 3W7OA 4CCDA 3I6RA 3W86A 5J5DA 1JQXA 3EXSA 3NQGA 1FXQA 2WNZA 4CNOA 2GJLA 1TQJA 1GQNA 4NNBA 1LOSA 5AB3A 4N4QA 4AB4A 5DCBA 2VELA 3WFAA 3BW3A 2ABBA 1OFQA 5FEPA 2QUUA 1I2NA 3UY7A 2CLOA 3NNTA 1K3UA 3IVTA 3IVSA 4LV4A 4UIOA 1SFLA 3OA3A 3S1VA 1S5TA 1N55A 5C54A 1H5YA 1EIXA 4O4VA 3W2LA 1W5OA 1H7WA 2JKEA 1FCUA 5K9DA 1TO3A 2GVLA 2DZSA 1O4UA 1X1ZA 4CQ9A 3JR2A 1HL2A 4UTTA 3MBDA 3MP3A 1LORA 4XTDA 2NXGA 5HUPA 4IX0A 4DXVA 2QCGA 3KXQA 1O95A 2C18A 4QJ1A 3PG8A 3S1UA 2I14A 2QCDB 2AQWA 4GXMA 4UUIA 3S5YA 2YCEA 2V5BA 3W7NA 1BKSA 5AC8A 5CSRA 5EMUA 4LY8A 3NGJA 4FEZA 3KVLA 2ABAA 4DPQA 1KFCA 1WOBA 2EAWA 4X2RA 3LLDA 4K39A 1SPQA 5F4WA 5AYYA 1FUYA 2CZEA 3LCXA 4LS1A 3B04A 3L66A 4KWVA 2XN1A 3PULA 4H6KA 2E1DA 5CZ0A 5G1YA 4NNCA 3MP4A 1F6PA 2Q8LA 1H7RA 1O94A 4UXDA 1JCXA 1VQTA 4G1KA 4O50A 5D02A 3EWBX 1DHPA 3GKFA 5CPLA 3O16A 3HJZA 4IXHA 4EIVA 1AW2A 1ZHAA 4IXXA 3GR7A 2FFCA 4J9JA 2H3BA 3VE7A 3WJSA 2C6QA 2V2HA 1EX5A 2H6RA 2ISSA 1YXCA 3FOKA 2WPBA 4IMGA 1O5XA 2QKFA 2ZQ0A 1SSGA 3HQ1A 2ZA3A 4MIMA 1OF6A 3MI2A 1VZWA 2JKAA 1YXDA 1LLZA 4ZVJA 3NQ2A 2ZZ1A 4N9DA 4MZ8A 3G1DA 4FX7A 3K30A 1SW7A 1WOAA 2W0UA 1OYCA 1EUAA 2ATSA 5EYWA 1VCFA 3QW4B 1PHQA 4JR5A 3PF3A 4XUGA 1RPXA 1EEPA 2CWNA 5CPNA 1KM4A 2FPYA 3WJWA 3G22A 1DBTA 1TREA 4UTLA 4X9SA 1JUEA 2C0AA 1KLYA 2YR1A 3UXAA 3W7PA 4JIPA 3QW3A 1WA3A 1FBAA 5KZMA 1IXQA 4U4MA 3BW2A 4PTNA 4FNRA 1F73A 4RZ5A 1KM6A 2ZA1A 3P8IA 4UTWC 1TYGA 1WXJA 2IQTA 5J5RA 5HMSA 4MY1A 1K7FA 3TC7A 1OX5A 4QNEA 3TQKA 1SU5A 4UFMA 1P0KA 2YPIA 5FF4A 3CEUA 3HG4A 1KW1A 4XKYA 3GDKA 1DL3A 1TV8A 1SUXA 1Q6RA 3IIVA 5D32A 3W1AA 4PL2A 4E0CA 1EPXA 5T26A 3GX9A 3GNDA 3NYZA 1W5PA 2P0OA 3TQ0A 3UZ5A 3DFNA 3KAOA 5KZDA 4A22A 1DJNA 2Q3RA 2CLIA 1W3IA 2V2DA 2ZZ4A 5TQLA 3IIPA 3CPRA 3JRKA 4Z1BA 3LXCA 4N9BA 4ZQPA 1SFJA 3NQ8A 3LM7A 5KTLA 5KSWA 1WX0A 1KM2A 1QMLA 3S5NA 4GC4A 3KHJA 4WOQA 3S0CA 2B7OA 4YLWA 2C19A 2VENA 3TROA 4M6PA 4N6FA 5LHFA 3FJLA 4N2YA 4DO5A 3N2MA 1UBSA 4RZ6A 4RXGA 4GUHA 3TFXA 2W6RA 3DFQA 5D2YA 5AN7A 1VYPX 1I2PA 3GAKA 3EX4A 5GVJA 5H2ZA 3NL3A 1PVNA 2YFNA 2Z2UA 1JR1A 4L4LA 3T4CA 1C9DA 1FXPA 3OIXA 1R47A 4MZYA 1TPB1 5D30A 2Y62A 3ATYA 4WZHA 2V8ZA 2OMAA 5LNSA 1AW5A 2FPTA 3W1TA 4LS0A 3R8RA 4Q33A 4IJBA 4R33A 2ZTJA 3BVJA 2CU0A 2WNQA 1B4KA 4MY9A 1A5AA 4O15A 3NR0A 3P8JA 3E12A 3LX9A 4Z1DA 5AHMA 3UQNA 4AF0B 1GEQA 1LOQA 2C16A 1MZHA 5I3KA 3EB2A 3M16A 2Z0IA 4OV4A 1AL7A 2D73A 1LYXA 3LBMA 3ANYA 3S1XA 4GUGA 4LTSA 4LUIA 4WD0A 4MYXA 3W71A 2EGZA 1PV8A 1W54A 3M5YA 5D2VA 4DF2A 3SGUA 1EP1A 2QJHA 2QCDA 4X3ZA 3DAQA 3NQCA 4NZJA 1W5MA 1D3GA 4MFEA 1ZALA 3CQ0A 3NQEA 2ZTKA 1LDCA 3LRMA 4TX9A 2QAPA 2DP3A 3ABOA 2FIQA 2VEPA 3W74A 2Y88A 1GJPA 5D2TA 2NLIA 3MW7A 4UTMA 2VFEA 1GG1A 3N2XA 2V81A 3Q2DA 1NF7A 3GDRA 2R91A 1TPUA 1A50A 3C3NA 1EP2A 3DU0A 3NQAA 3BGGA 2VXNA 2J88A 3A22A 4FNSA 1JUKA 3N14A 1PHWA 5F4SA 1OF8A 3PS7A 1M7OA 2VFDA 3E96A 5I3HA 3P67A 4RJEA 4IPJA 4JX5A 4FIRA 4QIUA 1QO5A 3CU2A 3ABSA 1O5KA 4JXCA 3NQVA 1LOLA 2NX9A 5DXYA 3TC6A 2CZDA 2LLEA 3OHIA 4MLRA 4CNNA 2QJIA 1DORA 2X1SA 2CZ5A 1VLIA 3TE9A 4NXSA 1B3OA 3UWYA 1WDWA 3NL5A 1ALDA 1T96A 3A5VA 3S42A 3WJYA 5CZJA 2ZA2A 3W88A 3HPZA 5BW6A 3EXRA 4ZZ9A 4JTIA 1HUVA 2BX7A 3NQMA 3ZS4A 3GYEA 4GUJA 1JQVA 5HNRA 4JTJA 4LUJA 1N8FA 1A5SA 4LW7A 1GWJA 1IIHA 1VGAA 4KFPA 4OV9A 2Y7FA 3PBWA 4QNWA 3M6YA 3DBPA 3RK8A 3ELFA 1KM0A 1M7PA 5D38A 3ZFHA 5G2HA 1FDZA 3KVMA 4LVAA 4FNPA 1HTIA 3PWAA 1TPH1 3W9ZA 1OFOA 2Y7EA 4BWLC 5FEWA 2KZHA 1T0OA 3DZ1A 4JTUA 3UWUA 2QCLA 3NL6A 3S5OA 2W79A 2NWSA 3FYOA 1QNVA 3CIWA 2WSQA 3LTSA 4ZQMA 1TV7A 1F76A 1F7BA 2QCMA 5CGQA 5DBUA 4O19A 1XI3A 5TBOA 2ZRUA 7TIMA 4ONVA 1X6UA 1I45A 4DEFA 3C61A 5K7JA 3UWVA 4K8EA 3TSDA 3O07A 5IM51 1DQWA 1YPFA 1AW1A 1KFKA 2UV8G 3UY8A 2A85A 4LU0A 3W7IA 1V5XA 1WYIA 2JGYA 4B5NA 1Q6OA 2CLMA 1XUUA 2QJGA 2ISWA 4K7YA 4M7SA 5HWNA 1KTCA 3PVFA 4NJIA 2ZRXA 2WO5A 3PG9A 2A7NA 5D2XA 5HR6A 1JULA 3MUXA 4NJJA 5DBTA 1GVSA 1QFEA 5BNKA 1I8JA 3MI6A 5F2MA 1G4SA 2Y7DA 1S5VA 3I7QA 3C6CA 3EX3A 1KBIA 3C2VA 2ZFAA 2YDAA 6ALDA 3H55A 5BMXA 3O1NA 1R46A 2PRLA 4XBSA 3STEA 1GOXA 1L6WA 2GJNA 3BG5A 3EWYA 5LNUA 2YW4A 4DBDA 4NJKA 2A5HA 2DZVA 2E5BA 3WK0A 4AWTA 4EF8A 4JYFA 1NF0A 5K3VA 2OZ0A 3LHZA 1LM1A 3LCGA 5U7SA 1KM5A 1ZENA 1VS1A 2AGKA 1XBXA 1S5WA 1KTNA 1WBHA 4LT9A 2YYTA 2BWGA 4QISA 2X16A 3RMJA 3A9IA 3HB9A 2WJZA 1JVNA 4JTSA 1NFBA 1SW0A 4DO4A 4E2DA 1GG0A 3G1YA 3LI0A 1RQEA 1XXXA 2VOMA 1VYRA 3W07A 4WXZA 4AH7A 1QWGA 2Z6JA 3HPSA 4NJHA 4XWUA 1F6KA 2NX1A 2ZZ2A 1GVRA 2E77A 3QMTA 1LZOA 2QEZA 5C2XA 3PUEA 3OEXA 3PC0A 1OX6A 5FEXA 3W7MA 1TQXA 4O0ZA 3DFPA 3TNOA 3VNDA 3W3OA 3N73A 4O28A 2JGQA 4AF0A 4LVBA 1ICSA 1RZMA 3IGXA 4P61A 3TMQA 2EF9A 4JTEA 2C13A 3PB0A 3DI0A 4HNNA 3QQ0A 4NXKA 1I4NA 5AOUA 3FKRA 3M5XA 1L2UA 4DBEA 3C2RA 2WSYA 3P61A 3THQA 4HNTA 1MXSA 2QR6A 3SFKA 2WQPA 2VC6A 1OK4A 3MO7A 4RXFA 4JX4A 1HG3A 4HIBA 3KRZA 2HS6A 2G95A 5F4XA 3P84A 3LCLA 2CLHA 3HGOA 1JRBA 1OFBA 1JCMP 2QCHA 5G4EA 1LLWA 1VLWA 3NQFA 1YTEA 3UYCA 3HIJA 3TQVA 3OVQA 1H63A 3W22A 3OG3A 1DQXA 3GXNA 4Y6GA 1KLZA 3G8EA 3HG5A 3SR7A 1G69A 1BTMA 1OFPA 3NOEA 3W7QA 1DOSA 1Q6QA 3UD6A 1ADOA 5C6MA 1H7XA 1K02A 3U2OA 4IMFA 3W7JA 2YGYA 3W1NA 3AJXA 4GWEA 1VR6A 2VKZG 2V9DA 3RLVA 3TA6A 2V30A 3A5FA 4K37A 4NJGA 4Z1CA 5EY5A 5HWMA 2Y85A 4Y9AA 1WV2A 2V2CA 5K4ZA 3TCEA 1AMKA 3W1XA 1UUOA 2WNNA 3AO0A 3M41A 1OABA 3CWNA 2I1OA 3NQ7A 3B8DA 4TU1A 3SSJA 3TR2A 2V5LA 2BXVA 3CT7A 4O12A 4YCOA 1A5CA 2DORA 3O6YX 3GIYA 1TJPA 3NA8A 3USBA 1MEHA 2J9YA 2NUYA 3BLFA 3PAJA 5CPMA 3V1PA 1XUZA 4WY0B 2ZZ6A 5D2WA 4UFKA 3TW6A 3L5LA 4UCGA 1KFBA 4JIQA 4S2BA 2JBMA 1JCLA 1W37A 3M7WA 3W72A 5I3IA 1W5QA 1PCWA 3WJZA 1FQ0A 1SO4A 4IMCA 2G97A 1G4EA 1XCFA 4OQVA 2BLEA 3F1QA 4AMAA 2A1YA 4AAJA 2B7PA 4R53A 4IWWA 1CI1A 4BWLA 1HFBA 3KX6A 4MJMA 3W1UA 3L68A 3W2UA 1LTDA 5AHIA 3I68A 3NZRA 4WJEA 3GAYA 5CSSA 4UTHA 1V7YA 5HQEA 4AXKA 3N34A 2NXIA 1LBFA 5DLCA 3SJ3A 1W3NA 4FXRA 3U8GA 4H3DA 2Z6IA 5DCDA 2ZYFA 2ALDA 4XZ9A 5EA9A 2BTMA 4TO8A 2Y6ZA 4DO6A 4ZL1A 2JKPA 3L67A 4ADUA 4O1DA 1ONRA 3UWZA 3D0CA 3IV3A 2PC4A 3LV5A 1MEIA 4AVFA 1WQ5A 2VEIA 1UUMA 2QF7A 4GFSA 3UXDA 4HT3A 4LV9A 3FS2A 1ICQA 2QUTA 2FB3A 2DZXA 2J9XA 4R7JA 2VFGA 1FY6A 1M5WA 4HPJA 2NXHA 4FNTA 1ZAJA 3E9AA 3LDVA 3P80A 4ALDA 2A6LA 3O05A 3INPA 4KFOA 3M5VA 4IGHA 4W9TA 3O6CA 4CLMA 5LKYA 3EKZA 3NQDA 4IOTA 4JN6A 4HKPA 5H91A 1TTJA 2EHHA 4Z0SA 3KRSA 3GDTA 4JICA 4JTKA 2CLLA 4JYDA 4K7VA 3JS3A 5HUOA 4Z08A 1PE1A 2E6FA 1F05A 2RH9A 2FJKA 3G3MA 5D04C 3SI9A 3IRDA 3FIGA 4EOUA 3GR8A 2TYSA 3QC3A 2YXGA 2ZRZA 3G1XA 1F74A 1SSDA 1TRDA 3UZJA 2E6DA 3M9YA 4MZ1A 5F2IA 4EF9A 5F1UA 4TR9A 5K4XA 5AFDA 2NV1A 3B0UX 2OT0A 3IIOA 4HSOA 3THAA 3BLEA 1H7OA 3W2KA 1U83A 2RFGA 4IX2A 3STCA 4IMDA 3W7DA 3R2GA 2RDWA 2H8ZA 2VFFA 3DHDA 3E49A 4NZFA 4NQ1A 4GRSA 1Q6LA 3NZ1A 4HPXA 1K03A 1VCVA 4ORMA 4AEOA 4AWSA 3HG2A 1BWKA 1Z44A 2P1FA 3L9CA 4IPIA 3G0SA 3QMSA 1RV8A 3LCFA 3CM4A 3YPIA 1TPC1 3RLUA 2Y61A 4C1LA 4WX2A 1QCWA 2F84A 3NXFA 3U6WA 5D33A 1ZAIA 2VEKA 1OFRA 4JTLA 4LC6A 3CC1A 4UFIA 5HR7A 4M5PA 1HO1A 3PUOA 4FX8A 3Q58A 3GDLA 4HNVA 4E38A 3BG3A 5HJLA 1F5ZA 4KFNA 2WV8A 4QQ3A 2BZNA 4JY8A 4RKAA 4AHPA 3G8RA 1SZFA 2FTPA 3TXZA 4PEKA 3NDOA 3G1AA 4O11A 5F2LA 3MHUA 4YCPA 1JRCA 3I7RA 3PUDA 2E6YA 4O8RA 1FWNA 5E1QA 4CNPA 5F1VA 1ML1A 2AAMA 1N7KA 1KFJA 3F4WA 3H53A 5L6UA 3WK3A 4ZQNA 4LVDA 5AHNA 3E02A 3N9RA 4UNLA 4MKNA 2PURA 3VKJA 5CZTA 3W7EA 2A0NA 1FCVA 2PCQA 2QDGA 1SW3A 5KMYA 1M6JA 1TJRA 4U28A 4A21A 3LCHA 3R89A 1JUBA 3SGZA 1OYBA 2FLIA 3TAOA 3LV6A 2NUXA 5FF3A 2OX1A 5AYZA 4S1FA 3GXPA 5BRBA 3S6DA 1AK5A 1TPDA 3TIMA 4N4PA 1F2JA 3FYPA 4OT7A 5K9CA 3W75A 1K7XA 3QM3A 4OHQA 3IGSA 1J4EA 3FEMA 1OJXA 2TPSA 3R13A 5I3GA 3P5ZA 2B0MA 1THFD 1XFBA 3FLUA 1K8XA 2DJXA 2X1TA 4R34A 3SZ8A 4DELA 1HO4A 4BFAA 1BWLA 4UFJA 4EVZA 1ZCOA 1YYAA 1EB3A 3QMRA 2JK2A 4UNKA 4Y90A 1T8XA 4WY0A 1WBJA 1IXPA 4CQ8A 4TMCA 1NVMA 1KFLA 3RFAA 3L65A 3B4UA 4K8HA 4CCEA 2H8XA 2V82A 5FF2A 3KFTA 3P82A 3EWWA 3RNDA 5IBXC 1KTBA 4MPQA 3STFA 5L9FA 5EPDA 2DZPA 2V0TA 3I65A 1ZJIA 2NWRA 3DENA 4HHPA 4DQWA 1QPQA 3LOTA 5BMWA 4A3UA 3IGUA 3W76A 2GOUA 1KV8A 1I2RA 2E09A 1FWSA 1YLVA 2QCEA 3MP5A 5G4WA 3UWWA 4GE8A 1UJPA 1LRTA 3DFSA 3VI2A 1R2TA 3W2MA 5C5YA 1Q45A 4UFLA 3QF0A 3T78A 3S8HA 3C4UA 4Y8FA 1YADA 4UTWA 3P81A 1SZNA 3CTLA 3NO5A 4RCXA 3W73A 1YPIA 3GZ3A 3WK2A 3RF9A 3TU9A 1E51A 5CG7A 2Z1BA 3GXTA 4JTFA 2O7QA 4Q32A 3W1MA 3W85A 2EKCA 1UASA 3L21A 1H1ZA 4O17A 3DXIA 3UPBA 1BEUA 3M47A 5AYXA 1K8YA 4MY8A 1XBZA 3W2JA 2QUVA 3SY5A 2TSYA 4TMBA 1KM3A 3W7GA 1OK6A 1W56A 2X2GA 1PS9A 3WJXA 1FCQA 2YSWA 3I7SA 4O1CA 4WOZA 4EWND 5MHBA 4NX5A 2ZRVA 1UB3A 4MOZA 3DH7A 3BGJA 3L0NA 2FB2A 4I7WA 3PSVA 2B7NA 1FX6A 3EEGA 2QCFA 3B03A 3C52A 1NAL1 1JCNA 2E68A 1XBYA 2H3DA 1GPWA 5E93A 1RR2A 1TCDA 4QSHA 1FDJA 4O18A 1YDOA 1H50A 2DZTA 3MMTA 3Q94A 4QM1A 4UR7A 1C8VA 1VCGA 4K6AA 2DU2A 3HF3A 4YXGA 5FI8A 4FNQA 2GQ8A 1GVOA 5AHFA 2DJLA 1TPFA 2E5CA 3G24A 1TIMA 3ATZA 3MHFA 3HBLA 4WXYA 1H60A 5TIMA 1MEWA 2YYUA 4JTHA 2ZZ7A 3LHWA 1RVGA 1G67A 4GJ1A 3W1PA 5KINA 1VHNA 1GTHA 5CZSA 4RLIA 4DF1A 1W8SA 4HN4A 3GNNA 1D9EA 4QAIA 1CX9A 2VFHA 1LRQA 4ZMGA 2CFFA 2Y63A 3VFLA 1X1OA 4WUIA 3M0ZA 1IXNA 1DV7A 1OX4B 3TDFA 1Z42A 5LNWA 3P62A 3EWUA 4GUIA 1U5JA 2R14A 1DKWA 3QYQA 2ZZ3A 4UTUA 3PY2A 2CZFA 5I3FA 1ZAHA 4A2SA 1Q3NA 2QCNA
chains in the Genus database with same CATH superfamily
3NG3A 2WVSA 4M56A 4N9CA 4K36A 2D2JA 1OYAA 2RDUA 2HV5A 1AUSL 4R3UA 2A7RA 2FMOA 4E8GA 2AMXA 1UZ1A 4Q4KA 2PODA 4C6MA 1J0ZA 2J7CA 2ZBTA 3N4AA 1I6NA 1L2QA 1LUCA 4I9AA 3F03K 1IT0A 3WQ5A 3GE7A 3H4WA 1XRTA 1SZEA 5ABHA 2ISFA 3L0KA 3GWQA 3QQ1A 2BSLA 4Z17A 3G18A 2BGNE 1EOKA 4ZE4A 3CWOX 4IGNA 3EKLA 3PPFA 4CNSA 1ITXA 2X1RA 3FSTA 5BXPA 5ENLA 4FF7A 4KKXA 4GZ7A 2P50A 3L2LA 4CU8A 1B3XA 3GRIA 1N82A 4PEEA 5I23A 1XKYA 4XBKA 1TWZA 4Q8PA 4UC5A 2GGGA 4IMAA 4XZIA 4ERIA 2EKGA 4CQAA 2OOGA 2PC8A 3CQIA 4FB7A 1UIOA 4Z2HA 1BG4A 4N6EA 3DKLA 2TMDA 3B4YA 3GHTA 4XO7A 4FLRA 5DRIA 4NX0A 3SUSA 2QCCA 9RUBA 4O1FA 4KGLA 4AIBA 3MS8A 5FEZA 3MQTA 2XFFA 2A4AA 1I75A 4M0XA 5FL0A 4L65A 1A3WA 3EDDA 1CDGA 3FX4A 2PSNA 4LVGA 1QWKA 4YTRA 3FW6A 3E3HA 5LGXA 3E2SA 4LC8A 4A05A 2A21A 1W5NA 4WEVX 1CW2A 3REQA 2R94A 1Z7AA 2VVSA 3V5CA 3T9PA 2V5JA 2H90A 3S1WA 4ZQRA 2TRSA 4H9TA 4H7CA 3MDWA 2ESCA 3OQ8A 4L6DA 4MWAA 3F4NA 3GFXA 2PUZA 4M19A 2NT0A 5DN1A 1V3JA 3FAWA 4WY0F 3T40A 1RY0A 1NDZA 1K6WA 4PMQA 3BLKA 2PDKA 4C1NA 1ZUAX 5AHEA 1IE7C 2DZUA 2CLEA 2J4GA 5CJNA 4ZR8A 3UCCA 3BPWA 3N18A 3S9ZA 4DNHA 1CGUA 3MYOA 1MUCA 2OYKA 1XISA 5G1TA 4O53A 3UPWA 1AQHA 3W01A 4ADTA 2HBXA 2GQ9A 3M64A 3HO8A 1SO3A 3O15A 1H51A 2Z1SA 1TV2A 4OGZA 3TMLA 4HHHA 5K2ZA 3CTTA 5LA2A 4G56A 3PM6A 3M1ZA 1NJJA 1EF2A 1W2VA 4LRSA 3HU7A 3PBVA 3G1SA 3SIZA 2GGHA 3LHUA 3SN1A 1KQZA 4FLSA 1XLFA 3DECA 2AKZA 2OZTA 2A3LA 1I0DA 3C2FA 2ALRA 2Q09A 4L5ZA 3LTPA 2X30A 3TLLA 2WZEA 4CVUA 3XIMA 4I7UA 1YDNA 2PGWA 2FDMA 3PAOA 1QO2A 3TOPA 4RE4A 1OGSA 5A8OA 3LA4A 2V68A 3CHCA 2VWSA 2D24A 2R1MA 3JUGA 4OBTA 3GKAA 3MHGA 1FCBA 2ASHA 3GNPA 5I03A 5LIKX 4IP5A 1AZ2A 2DDXA 2XTKA 5AC6A 3WQWA 1ONWA 3BG9A 1PL9A 2VP8A 1R2RA 1PIIA 4AX6A 3G6LA 4YTSA 1ME8A 2PCEA 2X0YA 3WLKX 2GPTA 4Z1YA 1UR0A 3TAKA 4LOCA 1KM1A 2XSBA 2Y5EA 1E6QM 3ABQA 4JTQA 2PTDA 3AS0A 4JDYA 5K9XA 2B81A 4UTKA 2WMGA 1LCOA 1R30A 2OTDA 4M3PA 2ZXAA 5SWUA 4H4IA 1IZKA 1Z6KA 2QVHA 3VTRA 5GJMA 3XINA 3QPYA 4KWWA 2OCZA 3IIXA 3PB2A 1IYXA 3G0XA 5CEWA 4JS3A 3COTA 4JYEA 2PTWA 3TLQA 1OB0A 3GFYA 1X1NA 1OG6A 1UMLA 1K9DA 1QI4A 3DI1A 1J96A 1P0NA 3LCWA 3WEZA 3TP4A 3U57A 2GVGA 4K1GA 4ZB5A 1O60A 3PPGA 3QTGA 3CGTA 1KXQA 2CCRA 1RD5A 1TR1A 4NVTA 4P7LA 1B9BA 2NLYA 3H2OA 2IKHA 3LZ5A 4XSMA 4BI5A 4YVVA 1OVDA 3ARZA 3QJAA 3AUJA 4JL2A 4LVFA 4Q8TA 3GIPA 3A21A 3EBVA 1IHIA 1OSEA 3E5BA 3VIPA 4IIGA 1JCYA 3OYXA 3SRKA 3U2ZA 2WQDA 3IANA 4FHAA 3QR1A 4MB4A 2Z1WA 2DSVA 3W23A 4R9OA 1ZPTA 4GO9A 4BK9A 3L5AA 3ZT7A 2J6XA 1HL8A 4O14A 5EB8A 2HCVA 3IJQA 2FZDA 5LIXX 1GYNA 1UWAA 3FJ6A 5AVHA 3GTIA 1GT8A 1E3XA 3UNTA 1B30A 1PO9A 3UW6A 3B8IA 3B9EA 1PTAA 4TVDA 1R5YA 5ABTA 1TE6A 1P48A 3KUMA 1H61A 2HBVA 3VE9A 3CLMA 5EKYA 2CPUA 3TJLA 4DPPA 4DYKA 9CGTA 1MW2A 3RCMA 3KP0A 3DHFA 2HSAA 4PCNA 1CXEA 4JKMA 1D2KA 2C1HA 2ZX8A 4KETA 4YL2A 1NFGA 3B8SA 3A47A 2XZ7A 2RKXA 4JGDA 3HV9A 1QDSA 3FEQA 5CPOA 3EOUA 1MMFA 4XAZA 4E2BA 4HGXA 3TONA 2E28A 3KVJA 3W6YA 4DI8A 4NSBA 1QR7A 1NOUA 3R5EA 2WYSA 4O54A 1EL3A 5CC3A 1O12A 4HZ8A 8RUCA 1A49A 5CGTA 7REQB 3FGCA 4Q4MA 6TIMA 1FVPA 3K4WA 4UTIA 1PPIA 3HJEA 2E5DA 5EL1A 3DG7A 3WYZA 3ITXA 1YHTA 2Y89A 3E0WA 4MPKA 3HGRA 4CD6A 3U4FA 4OU1A 3NPXA 1D7KA 4R7WA 4INFA 3QRHA 2BDQA 3R0UA 1EBGA 1XH1A 5EGRA 3N19B 3UJEA 4ML9A 1CGWA 1M3UA 3UPMA 1EOMA 3LLFA 1LT8A 1GTEA 3NO1A 3N6QA 2P8BA 2WSKA 4G1NA 1ONXA 1UD6A 2V3DA 4HOWA 2WNZA 5DMYA 4C6BA 5AB3A 3T2QA 4I8YA 4DO7A 2QUUA 4CVWA 1PDYA 4BS0A 2CLOA 1K3UA 4WKFA 5I02A 1OC5A 4UIOA 3SRFA 3S1VA 3VD7A 1H09A 3V36A 1H5YA 5C54A 1EIXA 3W2LA 2I57A 4Q4OA 3UWEA 3KWXA 1E56A 1H4PA 4BQ2A 4PUKA 3AIWA 9XIAA 3KLKA 5JIPA 2IKJA 4B9ZA 3NSMA 4LH8A 1AQMA 4UTTA 1GEHA 1L8NA 2NXGA 3SCVA 4LYRA 4IX0A 2QCGA 3KL0A 1O95A 4PRTA 1RUSA 2C18A 1JIBA 1EZ2A 1XP3A 1QTWA 4FAMA 2AQWA 3C0QA 4DXKA 4UUIA 2VD8A 4LY8A 1ZRQA 1XIFA 4DYEA 1MW1A 2WMHA 2XHYA 5I00A 2EAWA 4X2RA 3LLDA 2VDIA 1OT1A 1SJDA 5AYYA 3S2MA 1FUYA 3LCXA 4I5XA 2OR2A 5CAKA 4L4OA 1XW8A 5G1YA 5A69A 4FXFA 1JXKA 1Z69A 3MP4A 3CH9A 1Y5VA 1RALA 1F6PA 5T8GA 1E6PA 3T08A 2Q8LA 3OA5A 1JCXA 3GC2A 1DHPA 3GKFA 1R8LA 4LYPA 5ECUA 1YQ2A 1NY1A 3V1HA 1SVDA 5BRPA 4AD5A 2D3NA 4A3YA 4HTBA 4W88A 3OGVA 3W38A 3VE7A 4AG0A 2C6QA 1EX5A 4H2CA 2ISSA 1CXLA 1YXCA 2D0HA 4IMGA 4DHGA 2JKAA 2PP0A 1YXDA 1LLZA 1IWPA 1B1YA 1VIWA 3NQ2A 2V3EA 1ZTVA 3B3DA 1KQYA 1DJGA 1W9UA 2W0UA 3GH5A 3N25A 4F0MA 4C7DA 2OWWA 1R86A 2OU4A 3MWCA 4XUGA 1RPXA 1EEPA 3UYIA 4P7NA 1J0KA 3WJWA 1W17A 1DBTA 1TREA 4UTLA 1Y7VA 4X9SA 2GK1B 1JUEA 1KLYA 3BQ5A 2YR1A 3W7PA 3USZA 1YEYA 2EG8A 1WA3A 3B9AA 2ZXBA 2VRKA 3WX7A 3UBPC 3WNLA 3BW2A 3V3WA 4FNRA 4HBKA 4XAGA 2ZA1A 3WLSA 5FJIA 1Z8AA 4UTWC 2VGIA 4Z2GA 1WXJA 5C0QA 5J5RA 4UZSA 2POZA 1DJHA 3SCPA 1OX5A 1IEVA 3PZVA 3UGRA 4UFMA 3LG3A 2EO7A 3BANA 1VFOA 2G50A 3WDJA 4I5RA 1WXYA 2YCIX 4XKYA 3ARSA 3GDKA 4B5XA 1Q6RA 3W1AA 1NFPA 4PL2A 4E0CA 1EPXA 3MMWA 1IWAA 5T26A 2FVKA 3H23A 2DEPA 3G2GA 3TQ0A 3DFNA 1SJAA 2CLIA 1W3IA 1BWVA 4PBGA 3IIPA 1GOKA 4LY4A 4QE1A 3AISA 4N9BA 1JPMA 2ONEA 4ACYA 4BQ3A 4KGJA 1QMLA 2GDVA 4QLKA 1OM0A 3KHJA 3H2MA 4Q4QA 3S2CA 1BAGA 4D1IA 3FJLA 4UZUA 5I24A 4GUHA 3TFXA 1CENA 1JDEA 1Q4NX 4RNJA 2WMFA 5H2ZA 4R9XA 2YFNA 4L4LA 2Z2UA 1JR1A 3T4CA 4IM4A 1R47A 4MZYA 1TPB1 1Z32X 2QZRA 3H6OA 2GYIA 3EGJA 3ATYA 2V8ZA 4J3SA 4LS0A 4PMRA 4PUUA 1JPKA 4Q33A 4IJBA 1BD0A 5CXPA 2ZTJA 2UY2A 2XISA 3WLTA 4O15A 4OBRA 3NR0A 2WCAA 1R3VA 3FSUA 3IGHX 4Z1DA 4AF0B 1LOQA 1BSLA 1MVYA 4UBPC 4Q8VA 1AL7A 2D73A 4NAFA 3EA2A 4JHMA 3AFBA 3LBMA 4S3EA 3KWSA 1GKPA 4WGXA 1NTHA 1V0LA 1HGWA 3BAXA 2VDGA 4AZ6A 1JI1A 3H2FA 4V28A 3S2LA 2QCDA 2Z1KA 3HN3A 1BGGA 3W00A 3MB9A 4S3KA 1W5MA 4IIFA 2IUZA 1LDCA 2QAPA 3FJ4A 2IPJA 2FIQA 3AIEA 3DYPA 3W74A 4RE2A 4WIWA 4C7FA 2YLLA 3MW7A 4UTMA 2VFEA 3VMPA 1CGVA 3N2XA 3Q2DA 1AQFA 1DXEA 2R91A 1UKQA 3QHOA 1E9YB 3C3NA 3RJXA 5IOBA 4IFKA 3BGGA 4RE3A 3WD4A 4FNSA 1JUKA 3N14A 4IPNB 3N15A 3T8QA 1HN1A 1M7OA 4B90A 3E96A 4V1YA 1REQB 1W3LA 5I3HA 4WRHA 1POKA 3QV7A 3KBSA 3K4DA 3CU2A 2DVXA 1LOLA 2GGEA 3VGDA 2CZDA 1V4YA 2HJPA 2QJIA 1K9EA 4QX4A 1WDWA 2I16A 1ALDA 4CD4A 1XH2A 3BH4A 2Y8UA 3A5VA 1AVAA 1GCYA 1Z9AA 1PZ0A 3WJYA 1RBAA 2CYGA 4QDPA 3HPZA 3I10A 4JTIA 3V5FA 5IFPA 1HUVA 4QROA 4GLEA 3ZIZA 5DANA 3B0YA 1X8CA 1JQVA 1EJSC 3LYEA 1OCBA 4MMWA 1RK5A 4LX4A 3A4AA 4PGLA 1M7PA 3KVMA 2YB4A 1UWSA 3ANUA 2XSAA 1OFOA 3ALFA 3VNLA 1DJYA 2E0PA 1AZ1A 1E9ZB 4V1XA 1T0OA 2QCLA 1WUEA 4FI4A 1YBQA 1DIEA 3SCNA 1XLGA 4E4PA 3M0YA 3C5QA 4ZQMA 3VABA 1ISYA 1F7BA 5DT7A 5CGQA 3UZYA 1GZJA 1XI3A 2I17A 1XYFA 3PN8A 4K8EA 2PDCA 1DQWA 1P6CA 5CC5A 1S39A 2UV8G 3UY8A 2GJPA 3GQYA 3GFZA 4LU0A 3W7IA 1V5XA 1Q6OA 2CLMA 5GPRA 1OIFA 4MB1A 4AZHA 2QJGA 4AIEA 4M7SA 2E8YA 3PVFA 2HPIA 1CB2A 1KO0A 2WO5A 2A7NA 2PDPA 5D2XA 3THCA 3ARWA 1JULA 2PF0A 2Y24A 3GTHA 4MUPA 1C8XA 2RGLA 3MI6A 1W1VA 3UCDA 1V3LA 1AD4A 4NZ1A 3ZLFA 2YDAA 1V6UA 1MRQA 3VA8A 2PRLA 4UQAA 2GJNA 3EWYA 5LNUA 3R8HA 3ORWA 2NVCA 3P6LA 2E5BA 3U2EA 4LFYA 3WK0A 1GVYA 5M1TA 4AWTA 3QFWA 2CWXA 1V0KA 1LM1A 5FJPA 1JAEA 5U7SA 1KM5A 1UOZA 5TNVA 1S5WA 4W7VA 2QYGA 1TWWA 5GQBA 2GVEA 2ADAA 2WJZA 1DWFM 1J9YA 2V6AA 1G5AA 4E2DA 3G1YA 1A0EA 4A6GA 1UD4A 4WXZA 5JUVA 4M29A 4XWUA 1F6KA 1IWBA 1GVRA 2E77A 3QMTA 1S2UA 5J8LA 2QEZA 1E3ZA 3PUEA 1OX6A 5GNYA 4DNMA 1EJVC 3W7MA 1F3XA 3VNDA 3N73A 3SN4A 2JGQA 5EU9A 4P61A 3TMQA 4JTEA 2WW5A 1Y5XA 4UOQA 4ES4A 3PB0A 3DI0A 2DUZA 4L6HA 4RW3A 3QQ0A 5MF5A 4NXKA 8XIMA 3TZNA 3ID7A 4CD5A 2GQ3A 3RM4A 1OEPA 3ZQ9A 3LPPA 1O66A 2WQPA 2VC6A 2GJXA 2X40A 3MO7A 1JYXA 4JX4A 4PUEA 4JIEA 1E6ZA 2PFHA 1JCMP 5BXTA 1O1HA 1VLWA 3NQFA 1YTEA 3GSMA 2EXOA 5H8PA 3MC5A 3F2BA 3OG3A 3GXNA 4L9ZA 2G3FA 3W6LA 2POTA 4CN1A 3GVQA 3SR7A 4B92A 1BTMA 4C6NA 3EOOA 3TTYA 3W7QA 4GD0A 5C6MA 1H7XA 1E15A 3WL1A 4B5WA 3IJ8A 2DPEA 2QMJA 1VR6A 4LAZA 3BUVA 3ENLA 2V9DA 3R25A 2V30A 4K37A 1VD6A 4NJGA 4QDWA 2Y85A 3UR2A 1OT2A 1W1IE 5K4ZA 3TCEA 4KW2A 2VNCA 5E5CA 2WNNA 1XYAA 3NZQA 3RRXA 3CT7A 4YCOA 1W9XA 1A5CA 3W82A 4DJDC 3B9OA 4WKAA 3SB0A 1TJPA 4ATWA 2EEXA 3USBA 3R1ZA 3OOQA 2VC5A 4PN2A 4IGMA 2PDFA 3W53A 2OQYA 2WXDM 3V1PA 2YL8A 3PZUA 2ZZ6A 2KAUC 3TEVA 3L4TA 2WM1A 4UCGA 1KFBA 1UD3A 4S2BA 1FHUA 2GUYA 4JTRA 3W72A 5I3IA 4NYYA 4DUWA 2BOGX 1C7SA 5E0FA 5AVNA 3AWOA 3ONCA 2G97A 5LYRA 2BLEA 3NO3A 2B7PA 2XH2A 1DIOA 3A9BA 1CI1A 2JIWA 5B7ZA 4YNGA 4F0RA 3KX6A 5A3HA 3L68A 1FH9A 4H6EA 3NZRA 3ZR5A 5IHRA 3WL0A 5D9PA 5DLCA 4H3DA 4GVIA 5JXQA 1RPKA 1XQKA 1E5NA 2REQB 1ONRA 3I6TA 1VFUA 3T0CA 1E1CA 4AVFA 4CQCA 4F40A 2VEIA 3THDA 3UXDA 4V15A 1BHGA 2CBIA 3ITGA 4CN4A 2XJ7A 1ISXA 4HA3A 1RJQA 3DG6A 4LUSA 6PTDA 1W1A1 3T6CA 3DYMA 1ADSA 4QE4A 4JCMA 1ZAJA 2EG6A 1SZRA 3P80A 4I8DA 2A6LA 1XKJA 3M5VA 4L9YA 3O6CA 3DDMA 4IOTA 4JN6A 4HKPA 1TTJA 3TTOA 2DH3A 3L7RA 3GDTA 4JICA 2D2GA 4JTKA 2J78A 3H24A 4CU7A 1TX2A 4K7VA 2D69A 1PEZA 5HUOA 2PDBA 4Z08A 3ZT6A 1PE1A 2RH9A 4QAWA 5D04C 5LA1A 1PX4A 3GXIA 4IIHA 3EWCA 3FIGA 4WSHA 1XD1A 3DOPA 3GR8A 1MDLA 1CGTA 2GSJA 1TRDA 4MAZA 1S2AA 3M9YA 4MZ1A 5F2IA 3U0HA 3BMWA 2VUYA 5K4XA 3SQMA 1MYRA 3L4YA 4D6EA 1JXJA 2XFYA 1Q66A 1QT1A 3BLDA 4IMDA 3W7DA 3R2GA 4NZFA 2IKGA 1Q13A 3NYDA 3NZ1A 3VILA 1K03A 3N6HA 4QGCA 1Z44A 3AS1A 4UWMA 3G0SA 3H2CA 2OX4A 3YPIA 3CM4A 3RLUA 3DBNA 4WX2A 3V0TA 1AJ0A 2PLMA 2VEKA 3SM0A 4XD4A 2PDXA 4JTLA 3CBWA 4M5PA 1ZLPA 4FX8A 3Q58A 2AQOA 3GDLA 4HNVA 3BG3A 2WV8A 4JY8A 3WNOA 4IT1A 1SZFA 3LU2A 5CPSA 3TXZA 4PEKA 2HVNA 4QR6A 3G1AA 3ECQA 5F2LA 4LCQA 2CEQA 2WJEA 3FY1A 5E1QA 1JI2A 1EJWC 3WK3A 1LUCB 3GIQA 3E02A 4MKNA 2PURA 3H26A 3CV6A 5CZTA 3W7EA 1FCVA 2PCQA 2YKKA 1XYZA 4HMNA 4H9MA 5KMYA 1M6JA 4A21A 4AVNA 4IF2A 1XLDA 3TAOA 3LV6A 4AZBA 5AYZA 3EOLA 2HNHA 2FYMA 4DZ5A 1A5OC 4LQ1A 1F2JA 3FYPA 4OT7A 5K9CA 3QM3A 4Y7EA 1PZ3A 1R9XA 3L4XA 1OJXA 1WDQA 3AZSA 3SUUA 4DXXA 1THFD 3C3UA 2DJXA 3CO8A 5BCAA 4DBUA 2BMBA 3WEMA 4JHZA 1WDDA 2G41A 3GNOA 4EVZA 1WPCA 2JK2A 4UNKA 1T8XA 4WY0A 1WBJA 1MZRA 1HP5A 1EH9A 1KFLA 3TNBA 1RCOB 3T09A 2PTXA 2BS9A 3MT1A 1KXVA 4CQDA 3GM8A 2OGJA 2H8XA 2V82A 5FF2A 3P82A 2FHBA 4A3HA 3EWWA 4Q22A 5D9NA 5IBXC 3MMDA 2WK2A 3STFA 1GOIA 2DZPA 3PZMA 3VOHA 3MSDA 5E6YA 1V79A 4QP0A 1JZ4A 3N2CA 3GG8A 3PBMA 1UH3A 1E6SM 3BJSA 1QNSA 1QPQA 4NL1A 3S6TA 3IGUA 1KV8A 3RHGA 4RNHA 2ZVRA 3KZPA 1FWSA 1BPLB 3MP5A 3REQB 3PBGA 3DFSA 4NZ5A 4V2XA 1SMAA 3T0AA 4G7FA 5M3WA 1Q45A 4UFLA 3C4UA 4Y8FA 1YIXA 3OODA 3P81A 4MWAB 5CG0A 1E51A 3AUOA 1JYVA 3M6DA 4Q32A 1XCWA 1HIZA 1EJ7L 1K8YA 4EXAA 5T9BG 4C1NB 1XBZA 3W2JA 4LF1A 4H9ZA 2AGTA 4QJ4B 3IUIA 3WLJA 3I7SA 4O1CA 1UB3A 5BU9A 1OY0A 4MOZA 3L0NA 2Y8KA 4KWSA 1H3GA 1A5LC 2QCFA 3EWDA 4HU3A 1BF2A 2G3MA 3QY7A 3MY9A 3TN3A 3FVMA 1JZ8A 1FFQA 4XAFA 1TCDA 5HA7A 3AZTA 1BXNA 1J0HA 2VZOA 2A79A 2J8GA 2XSXA 1H50A 2DSUA 3WCZA 4UR7A 4QTGA 5ECVA 4L7ZA 1C8VA 1J11A 5HANA 4FNQA 3TN4A 2DJLA 1TPFA 2E5CA 3G24A 4PUWA 1MEWA 2YYUA 1F8MA 1UP0A 2EPKX 1VKFA 1RVGA 1G67A 4GJ1A 3VD3A 3W28A 1PSCA 3VM7A 3VIKA 4QAIA 1CX9A 2VFHA 4Q8WA 2AL1A 2UZ9A 2Y63A 4ZO9A 1V03A 3VFLA 1QHOA 4PMVA 1Z42A 3UCQA 4WJXA 5AC4A 1U2YA 3R7MA 5DRCA 1EPVA 1U5JA 4MKVA 2CZFA 4JQ4A 5GNXA 3LI0A 3VCRA 3WQVA 2YOCA 4LCRA 1AJZA 3C2YA 1DEDA 1UKSA 4KF1A 1RBOB 3LB0A 1JJKA 1JDAA 4N02A 3B0VC 2VFIA 2PS2A 3W7KA 3EDJA 2Q8ZA 2VX5A 3N2BA 4DWDA 3ANVA 5U4NA 3SRDA 3OPSA 3GVRA 4UCFA 4HK5A 3KBJA 3W1RA 1VHCA 5C9WA 1TSIA 3TN6A 2IKIA 1E0WA 2O55A 3LHVA 3NPVA 2QUMA 2Y1HA 1V3IA 2UY4A 3UEQA 1X7FA 1ZJAA 3LEPA 2GJRA 4DM2A 2X42A 3S5ZA 1UZHA 2V5DA 2Z28A 3UWQA 3SCWA 4J3WA 2QUNA 3WBWA 1H7NA 1R38A 3N12A 3QSTA 1OADA 2VOTA 4PR4A 2AL2A 2XYLA 1ZQ5A 5E0KA 4DWSD 5LZLA 3LRLA 5AECA 3Q45A 3HG3A 1CECA 4OOZA 1W9VA 4JY9A 2B31A 3WLOA 3RX4A 4LWWA 4O1BA 2QLYA 8TIMA 4PRWA 1XRVA 2VR5A 4D6JA 5M2FX 4KRZA 3DFHA 1I2OA 4PFMA 5CSUA 5IDIA 2WC7A 3LM3A 4ZOCA 4AYGA 1V6XA 1A80A 5FIPA 4UR9A 2L5HA 4AY1A 4C6DA 1SO5A 3SFWA 1EC8A 3QLDA 3CL6A 3NL2A 1WZLA 2Y2WA 4LEFA 3O6AA 2YFOA 1NWSA 1B57A 2F2KA 4JDBA 3M0XA 2W62A 1TTPA 1LLOA 3Q37A 1CYGA 2HDJA 1G7UA 1E71M 3EPNA 4IQDA 2E1WA 2J9ZA 2OKOA 1UD5A 4IMEA 1D8CA 1OCNA 2WOQA 4F66A 4HZ7A 1S2CA 1XLHA 4OVXA 4MKSA 2XGBA 1W2PA 3H7VA 4JTTA 2F6KA 4QJ5B 4R85A 5KITA 4AHQA 4GXPA 1AJ2A 1VFHA 3CPUA 1LRNA 4POCA 4JN8A 2J7BA 1EA0A 2VGGA 1G1YA 1YDVA 1RHCA 3MSRA 3EEZA 4JZ5A 3WQOA 4E2VA 2RDXA 4D8AA 2F2HA 1ZY9A 1IQ8A 2YZRA 4XV0A 3NUKA 4D6FA 4DF0A 1XC4A 3SW6A 4LBSA 3TK7A 3FXGA 5D05A 4CNTA 4L61A 1Q6CA 1UD8A 1W0MA 1GVIA 2C14A 5AKQA 1P4CA 1V02E 3QSRA 4L9XA 2ZDRA 2HE5A 3EX2A 3SN0A 4Z2IA 2MANA 4QSFA 4DUXA 1XLLA 1HXJA 4IPLA 4FX6M 1KBBA 2GVJA 4JX6A 4XIAA 1C29A 4OZOA 4ZQOA 5M03A 5HAOA 2XM1A 4UMAA 4AZIA 3SCSA 5FF7A 3FGCB 1CZ1A 3EX6A 4GX8A 4ZBCA 4PSRA 3B9NA 4NZ4A 3CEPA 1RY8A 3GG1A 2NZLA 3URAA 3SY1A 1V93A 7TAAA 2QULA 3WN6A 2ON3A 3CMGA 1AH4A 1RLDA 1X6LA 1YTDA 4IIEA 1KC7A 4GVGA 1H49A 3N11A 4O0KA 3T44A 4BF9A 4GFIA 2OSYA 4NASA 2E4TA 2HZGA 5CGMA 2YA1A 2Z7KA 5FSDC 1ZBCA 5JH2A 3WNKA 3QVQA 4RZ4A 5LHEA 4AZGA 3R0KA 3W70A 1RSCA 1U30A 5HPOA 5DF0A 2VUNA 3UP8A 1JAKA 4PBEA 1XIIA 4C5ZA 3QPEA 4QS6A 1LROA 4NU7A 3LXAA 1D3HA 4ERGA 4RW5A 1OD8A 2F6UA 3TTQA 4PA8A 1P5BA 3DERA 3HMJG 4M1RA 4RX0A 4J2PA 3C56A 1QOQA 4BI7A 3GK0A 3CHFA 4PBFA 1BQGA 1G0CA 1EXPA 3HQNA 2YDSA 1ISWA 1OHLA 1VC4A 3W7CA 4BEQA 3VUSA 1JNEA 4PODA 4UQ9A 3WF4A 3GVGA 2BB0A 3L5MA 3NM3A 3THUA 4M6VA 1JGIA 2HQAA 2OT1A 3EWZA 4HHLA 1YKWA 2C15A 3TYBA 3WQCA 1XSJA 4QDMA 4LS2A 2GUBA 3TW9A 4YTQA 4O10A 3F5JA 1FWWA 3VNIA 1HNYA 4F0LA 1WAUA 2XVPA 1J01A 2FDSA 3KRUA 1XDLA 1PZ1A 1CXHA 4W87A 3W83A 1W1ZA 2HE8A 1PIGA 2BXYA 1P1XA 3E74A 2PE4A 3KP1A 1AH3A 1P7TA 3VCCA 4KBXA 4IJRA 5AHLA 2NV2A 3C0SA 3TCSA 4AHOA 5G2IA 2BVTA 4P7OA 2CLFA 1ICPA 4GUFA 1ME9A 3B8VA 3KW3A 3VIFA 3D47A 1OGBA 1MQRA 2QQ6A 2OLSA 5EBUA 3VOIA 1YTKA 2RJHA 3M44A 1OBAA 5KEZA 4HCLA 5D09A 3QBUA 2NUWA 1J93A 4Z1AA 1TELA 4S3GA 4YWIA 3GTFA 3ZR4A 2WVTA 1R7OA 5A5WA 3MZNA 1VENA 3TYUA 1TPEA 2Q3OA 4C6IA 3QZAA 4JD4A 4JNMA 4LYKA 1J6OA 2XH4A 3V75A 2XWDA 4PH6A 1EWDA 4O1AA 1TMLA 2GWGA 2WHMA 4QEHA 1I1XA 2GSEA 3AHZA 2D22A 3NVTA 3WQGA 3CXOA 3AC0A 3L2MA 4WSJA 3V16A 1GZGA 3CHVA 4ZODA 2R8WA 3P7YA 3R43A 5A6JA 1UKOA 2VR4A 3E1F1 1UA3A 4KWUA 1ITQA 2WZIA 5DO8A 4DM1A 2X1UA 2RJGA 2WCSA 1X96A 1XLAA 4CKQA 4CCCA 3CMJA 3ARRA 4XKYB 1FKXA 1XD0A 3P0WA 1JCJA 4PL1A 1W31A 3DUGA 1MSSA 5DMNA 2WVVA 3EKGA 3F7JA 3RJYA 4DX3A 3CAQA 2X0HA 1NU5A 2CNCA 2HS8A 5A6KA 4QFUA 2BG5A 4Y9MA 2C0HA 5CPTA 4W5UA 1CWYA 7A3HA 1EWEA 3ZSSA 3G0UA 3LXBA 3LMYA 2OELA 3U3HA 1Y8BA 3E6EA 3JVAA 3KL5A 4AWUA 5C7HA 5E09A 3RITA 1X98A 1U5VA 3MJYA 1QAPA 4YMZA 1QU4A 4F0HA 1K8ZA 4C7GA 5CJMA 1W32A 3RIKA 4ORIA 2ZRWA 4CD8A 1BGAA 3EXSA 3AJ7A 3VKKA 4ZO6A 7CGTA 4NNBA 3FDGA 4N4QA 4GISA 2VELA 4B5TA 2PLCA 3WFAA 3NSXA 4I5UA 2BOFX 3NNTA 5A95A 3IVTA 1SFLA 2J8FA 1T5AA 1VPYA 4XB3A 2HK1A 3WQ4A 3OZYA 2D0GA 4JBRA 3CL7A 2FHFA 1R0MA 2C7FA 3RCYA 4PTMA 3K5XA 1O4UA 3KTXA 4CQ9A 3S2NA 4HNOA 4NAFB 1I60A 1KCKA 4GCXA 4RUBA 3V4BA 2XVLA 1Q4WA 3F4VA 3MP3A 5HUPA 1M1BA 4DXVA 3KXQA 2RAGA 4QJ1A 3S1UA 3W37A 1A5MC 3DYOA 2BY3A 1K70A 2QCDB 5CQ1A 4FPSA 4J4KA 2YCEA 4RZBA 3OLIA 3F2DA 2J77A 3NGJA 4YTTA 4FEZA 3UG3A 2FGLA 1KFCA 3IJ6A 2CBUA 4K39A 3CQJA 3RDKA 3ZMRA 4LS1A 3B04A 3L66A 1DP0A 1YPXA 2XN1A 3PULA 4QCFA 2E1DA 2PA6A 1F4AA 3ONBA 4NNCA 4HOZA 3RX3A 4IFKB 1W9BM 2PU0A 1J0YA 3RM8A 3A3HA 4Q7BA 5BOFA 4UXDA 4KPLA 3OZOA 4GINA 4O50A 3O16A 5AC5A 4EIVA 1AW2A 4REQA 3UETA 1FHVA 1GJWA 3K8MA 2DW7A 2WZHA 3GR7A 5JBEA 4J9JA 2V2HA 1SFTA 3FOKA 2QKFA 5AY7A 4GHRA 3EZ4A 2ZWZA 3MI2A 4NRRA 4ZVJA 4GO8A 2ZZ1A 4CEUC 4N9DA 3G1DA 3U4AA 3GYCA 3K30A 1SW7A 1W9PA 1CTNA 2GFTA 1EUAA 1CXIA 5EYWA 2DQWA 3GXFA 1VCFA 2G4FA 1PHQA 3VGHA 4JR5A 5FACA 4GQRA 1RLCL 4GKLA 3QV6A 4DJEC 2A3AA 4W84A 1US2A 3QR0A 2CITA 3GG7A 1F9CA 2FZ8A 5LIYX 1DIDA 3EYPA 3UXAA 2OSWA 1XIDA 4I9MA 2P3ZA 3PZOA 1YBQB 4PTNA 4BF7A 3CNYA 2VZVA 5HJXA 3T2PA 2ZX6A 4Q4PA 1AMYA 1TYGA 2IQTA 1LL7A 3R10A 2P88A 1SU5A 3PJUA 1P0KA 5JU6A 2ZC8A 3JU2A 4HA0A 8CGTA 1HKJA 1KW1A 2CC0A 5BWFA 1RP8A 5D32A 2XIOA 3T4WA 3PZIA 3E2VA 4A3QA 1IR1A 2P0OA 4IPPA 4A22A 1QNOA 2PAJA 1U1HA 4Z1BA 2VCBA 4ZQPA 3NQ8A 2R24A 3LPGA 3NSNA 4NP7A 1VBGA 2HVMA 1Y5WA 4HZMA 3S0CA 2XIQA 5F7UA 4ATLA 4XZWA 2VENA 2ZX5A 4C60A 4M6PA 1GONA 4DO5A 3N2MA 1M68A 1BVNP 2ZUVA 1CXKA 1A0DA 1TV3A 2W6RA 1B3YA 2R9RA 4D1JA 1I2PA 2V3GA 3EX4A 4QG6A 2F6XA 2NV9A 3PFRA 2PP3A 1TJ1A 5D30A 1A4LA 4WZHA 4KCVA 2H9AA 2J7GA 4IP4A 2AKMA 2FPTA 3V0SA 1AH0A 4PMDA 3R8RA 3VZZA 4UQDA 4IL2A 4R33A 4JTDA 1JNDA 4PMYA 5H8MA 1NARA 1EO7A 3K2GA 2PD5A 1DJXA 2PF8A 1B4KA 4MY9A 3ZJ8A 3E12A 3TR9A 2C8NA 4XZHA 3UQNA 2UY5A 5RUBA 1K1DA 1EQCA 1MZHA 1AA1B 2I5IA 4U33A 2BHUA 3PJTA 4TTGA 2XIJA 1RH9A 3S1XA 1W91A 3W71A 2EGZA 2GJXB 3NTYA 4OIFA 2OO0A 4KEMA 4Q8MA 3NQCA 3GW0A 4NZJA 1D3GA 1ZALA 1BF6A 5IXEA 3TWBA 1JDFA 2DP3A 3ABOA 2VEPA 1DE6A 1GJPA 5D2TA 2FTWA 1V6YA 4FOKA 1YNQA 3BSHA 4M6UA 1NF7A 1HJUA 3T07A 2O9RA 2GVYA 2CXGA 4LAMA 1PHWA 1A47A 3PS7A 2EJ1A 3CZ8A 2VFDA 3UR5A 3BAJA 3P67A 4RJEA 1UWUA 4PB4A 1US0A 3NQVA 5DXYA 2DY3A 2LLEA 3OHIA 2YJQA 4FS9A 1ZBVA 5CSYA 3TTEA 4PTVA 3TE9A 1YNYA 3EMZA 3BGAA 1LG2A 1T96A 1HQTA 4W7WA 1L6GA 1GW9A 5BW6A 3AIRA 4M80A 3WQPA 2VO5A 1LQ0A 2F9RA 1IEIA 3GYEA 4IQEA 1F07A 5IDZA 5HNRA 4JTJA 1HJQA 4LW7A 2F61A 3NIYA 4G7EA 1FWCC 2Y7FA 3KRBA 2ZXQA 4QNWA 4H41A 5CBBA 1Z89A 3K46A 1WZAA 3BDKA 1V51A 3UESA 2W66A 1UR3M 1HTIA 1TPH1 3H21A 4QBXA 3SCUA 2VHLA 1VBHA 4D9PA 3NL6A 5T91A 3MKCA 2OXNA 3FYOA 1QNVA 3KL3A 2NQLA 2TODA 4H6RA 4ZFCA 1F76A 5TBOA 3BWWA 1U1JA 2ZRUA 7TIMA 1E1CB 1I45A 3C61A 1X97A 1X39A 3TSDA 3O07A 1AW1A 2Y0FA 1XIMA 4OTKA 1PWMA 3ZVHA 2PWEA 1B90A 3UG5A 4LUSB 1WYIA 1XUUA 3MKKA 3T81A 4K7YA 4R27A 1KTCA 2X7VA 3EPMA 3U9IA 3WH7A 3CUHA 1HJWA 4ERAA 3PG9A 2EQDA 5HR6A 4NJJA 1GVSA 1E4NA 1KCXA 4OUEA 1S5VA 2OKTA 1XLEA 3C2VA 3IS4A 1V3MA 1KXTA 3TWAA 5BMXA 1WDRA 1R46A 4XBSA 3STEA 4Z2JA 3CPGA 2VDHA 3ZZ1A 2HISA 2EPOA 2FVLA 3TA9A 5G1MA 3VM5A 4NIRA 3WLNA 2YYTA 3RMJA 4CD7A 3A9IA 2J7EA 2EG7A 1F3TA 1SR0A 3VD4A 4KH2A 4Q7IA 1RQEA 4NG3A 1DPMA 4AH7A 2WMJA 1QWGA 3UXLA 3U7BA 4NI3A 1QI3A 3UZXA 1LZOA 3LLXA 5C2XA 1KBLA 1E1EA 3OEXA 1E0UA 3HFYA 5FEXA 2CBJA 1TQXA 2BBFA 4GZEA 2DT3A 3SUVA 4CQBA 4A3RA 1EJXC 1QI2A 2FZBA 2VX7A 1JZ2A 4HNNA 5I3DA 1K77A 2PZNA 1CLKA 2QT3A 3POHA 3THQA 4HNTA 1MXSA 4GGHA 4IGSA 4B16A 1IZCA 1E5JA 2G37A 3SEPA 3LCLA 1U1UA 4KWOA 2CLHA 1XYCA 4BA0A 2XIMA 1ZZMA 4UOZA 1XG3A 4G9PA 2P3EA 1YNPA 4PMJA 1H63A 1DQXA 3MO4A 1PTDA 4MADA 3VOCA 4H9VA 3PK7A 2FKPA 1Q6QA 3K4AA 4GI6A 1K02A 4U3AA 3W1NA 4Q3MA 4GCAA 3AJXA 4F2TA 4H9XA 2PWVA 4M51A 3RLVA 4F4RA 3A5FA 1KRBC 4UTFA 1XYLA 1GJUA 2O4MA 1AMKA 3W1XA 1UUOA 2P8CA 3BMXA 1OCQA 3CWNA 3NQ7A 1DXIA 1Q6FA 3TR2A 2V5LA 2BXVA 1M01A 2DORA 1HGYA 2FZ9A 1S2TA 2ZX9A 1MXDA 2J9YA 1EDQA 4WY0B 4E8CA 1A5NC 1DXFA 1HKKA 1LJYA 2I56A 4UFKA 3TW6A 1C8YA 3KCLA 1HJXA 3L12A 4LAOA 2BY1A 3RX2A 3M7WA 1W5QA 1GQKA 3WJZA 1RJPA 1FQ0A 2BY2A 4GYPC 3FN9A 3G1RA 1E4IA 4AAJA 2J74A 3UJ2A 4IWWA 2J47A 1HFBA 2ZC1A 3W2UA 4MJMA 2DT0A 5AHIA 3I68A 4TTUA 4B5VA 5HMDA 1V7YA 5HQEA 1ELSA 4AXKA 3N34A 2NXIA 3UVIA 1Z3NA 4D8ZA 5DCDA 4ASTA 4J5NA 1RBLA 5EA9A 3WELA 2Y6ZA 3KTSA 3PNZA 3ITTA 1QHZA 4F9JA 3D0CA 2IPWA 3A4XA 3LV5A 5HOSA 4MWAE 3EPOA 3MMUA 1UUMA 4GFSA 4A35A 1V02A 3OIHA 5I2UA 2QUTA 2GOKA 2FB3A 2V69A 3AYVA 1Q8AA 2WB5A 4DAFA 2VFGA 1FY6A 1M5WA 5C7VA 3VNZA 3E9AA 3LDVA 1KKRA 4MJ4A 3INPA 5HNNA 4GY7A 4NY2A 4C6QA 2W92A 4S38A 4MNMA 3VK5A 4DWSC 1ZP4A 2CLLA 4RDZA 1TJ0A 5G4HC 5HQLA 1FWHC 2E6FA 3VNJA 1F05A 3H2AA 3G3MA 3U5YA 3SI9A 3EA3A 2TYSA 3GXDA 4JQAA 1VEOA 2XVKA 2ZDSA 3QC3A 1SSDA 4FR6A 2E6DA 4ZXLA 4EF9A 4XUYA 4X63A 4TR9A 1E73M 2J13A 4QCEA 5AFDA 3SRHA 1KD0A 2NV1A 3TC3A 2OT0A 5PTDA 3THAA 3BLEA 3VINA 3L23A 4J3VA 1U83A 2RFGA 4IX2A 1AFSA 1YMYA 4BY3A 3DHDA 3BXWA 4GRSA 1HKVA 3BCFA 2YCKX 4AWSA 3HG2A 4H00A 4F2BA 4JFTA 1EJRC 1RV8A 2W27A 5I07A 3TYAA 3UZWA 1TPC1 4C1LA 1QCWA 2QGHA 2BHZA 5A8NA 4J3UA 4GQ0A 3V18A 1KRMA 4LC6A 3CC1A 5HMEA 5HR7A 1HO1A 3WBAA 4P7QA 4US5A 4QQ3A 2BZNA 4RKAA 4A8NA 4AHPA 3G8RA 1HZYA 2EPLX 2ANUA 1CGXA 4O11A 3MHUA 1R3QA 1VB9A 3UG8A 4YCPA 3I7RA 3ME3A 1VF8A 3WUBA 1KXHA 2G3NA 3MUCA 3CUFA 4M82A 1ML1A 3VX0A 1N7KA 2E9MA 1KFJA 3F4WA 2FMNA 3B8TA 4ZXOA 4C6OA 4LJ3A 3ITCA 5AHNA 2OVLA 3N9RA 1GKQA 1QK2A 5CPQA 1M53A 1SW3A 2D23A 4U28A 3A6OA 1OYBA 2FLIA 4GMEA 4XG1A 2Z7GA 1DWAM 1UC4A 4KEVA 1S1PA 1UHVA 1QNRA 4ZSTA 3VIJA 2PDHA 3S6DA 1FKWA 3TIMA 4ZB0A 4N4PA 3M0KA 3W75A 2PBOA 2YXOA 3ISIX 4OHQA 1BG9A 2AL2B 2TPSA 2ODOA 3P5ZA 4KCWA 4AWEA 1XFBA 2R1LA 2INFA 3VIOA 2X1TA 4DJDA 1ADDA 4K1WA 2GL5A 3OZMA 4JFVA 1ZBWA 5C2GA 1H5VA 1HX0A 3M7SA 1YYAA 1EB3A 3QMRA 1G94A 1IXPA 4HU4A 1NVMA 5A6BD 1GORA 1BRLA 4B5SA 1PKLA 3I4EA 4CCEA 1MDRA 4H8NA 3KFTA 4YYCA 1JDDA 3W0KA 1KTBA 4MPQA 3XISA 5EPDA 4LANA 2DZAA 2V0TA 4GACA 3VDHA 2NWRA 2BVYA 3LOTA 4LUTA 2VX4A 1XLIA 3AMKA 2E09A 4B5UA 3VYLA 4YVXA 3UWWA 3ABXA 4GE8A 1R2TA 5C5YA 3OG2A 3ITLA 3QF0A 3T78A 4TV5A 3AAMA 1JDCA 4NAEA 3MKVA 3CTLA 3U48A 1YPIA 3KCJA 3RF9A 4ECLA 3TU9A 2Z1BA 4JTFA 3PANA 1L8PA 4J1OA 1TVPA 2P0IA 3SGGA 1UPPA 3VOGA 3B8UA 3UF9A 4O17A 3UPBA 3CQHA 3CHEA 3E0LA 4TMBA 4WSKA 1OK6A 1PS9A 1X38A 3B97A 3KS5A 3WJXA 2DVUA 2X05A 3I3EA 4EWND 4NX5A 2ZRVA 3BGJA 4IZGA 4GIRA 4I7WA 4QJ3B 3P2VA 1FX6A 3EEGA 4X60A 1V3KA 2VQUA 5HBFA 1XR2A 5C71A 2E68A 4GNKB 4NRSA 3ARQA 2WJDA 1FDJA 3LQGA 2DZTA 3L4WA 3MMTA 2O0TA 4HP5A 4I9JA 1DQUA 4WXYA 5TIMA 1TKKA 5LXXA 4JTHA 2ZZ7A 3ZR6A 5REQA 3W1PA 1VHNA 4GC3A 1FP8A 4BEUA 1W8SA 4AEEA 4LSBA 1VBJA 4I90A 2ZUMA 4GVFA 4E8DA 1FH7A 2X41A 2X1IA 3BCDA 1X1OA 4WUIA 4BCEA 4H2HA 3TDFA 2E8ZA 3KBMA 3EWUA 3APGA 3QYQA 4MDOA 4B3KA 1EGMA 1Q3NA 4CNNA 2QCNA 3VAVA 3GZAA 2JALA 3I3DA 3BSGA 3P0XA 3LNPA 4O52A 3SECA 1OFDA 4LAKA 1JF5A 1KRAC 2WZMA 2FPVA 5A6TC 5DXXA 1MQPA 4H19A 4GI8A 5FF0A 3AYRA 4EPBC 1R9ZA 3OBEA 3VOFA 1YDYA 1PB0A 4FIQA 5C9RA 2VQTA 4HPGA 4DJFD 5ABEA 1GVEA 2UWFA 3O7UA 4FXJA 4TOQA 3RO6A 5LIWX 4AEFA 4N42A 1UP2A 3TSMA 1G4PA 3II1A 1EXBA 2XN0A 3CASA 4DUOA 3B40A 3L2IA 1RCQA 3DGBA 4ZA0A 4RK8A 4MUZA 1PTGA 3FAXA 1NEYA 3CHDA 1SR9A 4W8AA 4WDUA 1LWHA 1RP9A 1HF6A 1Q6EA 1RVKA 3EB3A 3QEZA 1XSIA 3HGSA 1B31A 3GR4A 4EXQA 3QR3A 1GYLA 1Q6DA 4L56A 4XQ6A 2UBPC 4CU6A 4W5ZA 3QPZA 1XFCA 3O06A 3A4JA 2HTMA 1KBKA 4O57A 3TKFA 4PB5A 1LT7A 5JBDA 4M7TA 3NPWA 4HA4A 1NOWA 3H54A 5HNTA 3MDUA 4HHMA 5GJPA 3W1QA 1FP9A 4LXFA 3IJIA 2IW0A 1TMHA 4DB7A 2WJFA 3VKBA 1Q2RA 4UFHA 2CLKA 1YX1A 3DC0A 3W84A 4UTJA 1UKPA 3BOFA 1TZ9A 4KS0A 4H8UA 1Z48A 3G3DA 5IBXA 2PEVA 3IIZA 1ENUA 1S5MA 4GVHA 4FXSA 4PCPA 3CAVA 2PGEA 3OVRA 3ABRA 2PRHA 3OVPA 4MYAA 1P7TB 3QZ6A 3R8GA 3M5ZA 1QOPA 3A24A 2PWGA 3HZ3A 1IF2A 3BV4A 3ZJ7A 4DI9A 3HFTA 1UP3A 3TOYA 1N8IA 3M0MA 3H8AA 3WNPA 3W25A 4LBUA 1ZNNA 2V5CA 4HSNA 4X2PA 1KBJA 3WEOA 1UH4A 4IUOA 1TRIA 4S23A 4F79A 3RU8X 2WZTA 3HOJA 2Y70A 3EMCA 6ENLA 3VMOA 4ICCX 1XLCA 1V6TA 3NEVA 5EMLA 1IGSA 4O16A 4LNYA 5I5RA 1CBGA 1E6XM 1EA9C 3T7VA 3WQEA 4BKNA 3MV11 4EE9A 3DG3A 3H70A 1AG1O 2WNWA 3AIQA 2I9EA 2QAFA 1XLKA 3QZEA 1LBMA 2GGIA 3HPFA 4MSSA 3NM1A 1R7AA 5H1WA 1JGMA 3VGEA 3KOFA 4YPJA 1TA3A 1TIWA 3SDOA 1NWTA 1GVFA 5KZEA 3DGRA 2O92A 2BOEX 4H9YA 2ZCGA 2FH8A 3WD0A 1VPXA 2RGMA 4HU0A 5FESA 4GBUA 2JQXA 3W2NA 1UWQA 3S47A 4WQ6A 4HNUA 2YBUA 3TX9A 3VD9A 1TPVA 1ZU8A 1Z41A 2ZUSA 4C65A 2DIJA 4R5EA 1XIHA 3STPA 2X0SA 4RNFA 1EHAA 4PMOA 3FCPA 3QN3A 3PBUA 2WSRA 4EPDC 1PYMA 4E4UA 1L6YA 4PCFA 1EDGA 3SCQA 1XPGA 4KESA 1FWIC 6TAAA 1MW3A 3Q4DA 3TFCA 2W91A 3SQSA 5A6BA 3KBNA 4L4MA 1S3HA 4O13A 4LRTA 2WVVB 2J7HA 4JN7A 1FWDC 1DE5A 1XM3A 4MJ2A 3WIJA 3TSBA 4ZTYA 1T8QA 3O63A 1WKYA 2RHGA 3L4VA 4B91A 2XFWA 1R2SA 1XL9A 3EX1A 4PUMA 4XZMX 3WMSA 3AXMA 1V0MA 3ARVA 3R6IA 4S3AA 3RO8A 4Y2WA 1KA9F 1SO6A 3EDEA 3T05A 9XIMA 4W8LA 2J27A 4JHOA 4C6EA 1B3WA 4X22A 5CLWA 3WKZA 1D3CA 4ZFMA 4WCJA 3C2EA 3MI3A 1X6NA 1TV5A 1G7VA 3BO9A 2CHNA 1VH7A 2ATMA 1TPWA 1V6WA 4FOJA 1XCXA 2V3FA 2I5GA 3B06A 4GNJA 3KVKA 3B0PA 4WF7A 5D9OA 4MWAD 3LERA 4WJ8A 3NQBA 2W5FA 3QFEA 1VEMA 2Y7GA 3RAOA 3T55A 4QG8A 1XSKA 1UIPA 1VPQA 5A6MA 1ITUA 2XVNA 3PBYA 2MNRA 2A2IA 4ROQA 1VJZA 4EWJA 4GH1A 1KWGA 3CV1A 3NGFA 4PFHA 2WSPA 4FR1A 1GK8A 1OFEA 3AIUA 4O8AA 3GB6A 3WLLA 4WKHA 2HNEA 4AX7A 4HCHA 5JMUA 3WFZA 4EK7A 1KV5A 3U5UA 4UMBA 1S1RA 3NCOA 4EANA 4I6VA 1Q2SA 1LL4A 1QOXA 2ZOXA 1ME7A 2PLKA 3GBDA 3TJ4A 1R85A 2J79A 4B15A 3C0JA 2EPHA 4PMNA 4QITA 3DFOA 3N6JA 3P93A 1S46A 3I4KA 3HURA 3N04A 4MNLA 3BCJA 2HMCA 4NT0A 2NQ5A 3PNUA 1NQKA 1UD2A 2OLHA 4U5KA 2A3BA 3ITOA 4RDYA 3GDMA 2VJXA 2J24A 3CO4A 4PTXA 3IVUA 3N4EA 1Y0EA 1EP3A 3RR1A 3MBFA 3GUGA 2GUUA 1J8VA 4REQB 1UBPC 3CIXA 4LEQA 3SCTA 3JZUA 1WZMA 1H7PA 3BC9A 5DELA 5LNRA 2F7FA 2BHYA 1C3FA 3WF3A 3DKJA 1QW8A 3BZGA 4FSAA 4RV8A 1D8WA 1M7XA 3LI1A 4RDWA 1BTCA 2OJPA 5FJRA 1XDMA 2SFPA 1XH0A 3QGAC 5HDRA 5A8GA 1UWRA 1FWRA 3LHYA 3TUUA 1MO0A 2R1PA 4MB3A 1J5TA 1E43A 1V77A 2WKLA 1HW6A 3M46A 4JEQA 4AC7C 3I3BA 1E70M 2O4QA 2Z29A 1VYSX 5DY2A 3W87A 1NP2A 4C6FA 3AXHA 4PC8A 3R4IA 1DIKA 4JPGA 1XGZA 3PR2A 1T99A 4MLJA 3CL8A 3DCPA 4H8VA 3AALA 3E0IA 2G96A 2DZWA 3C86A 1YXYA 5DCEA 3UR7A 3SUWA 2E67A 2CW6A 4EXBA 2O9TA 1FWTA 1PYFA 2A6NA 3E0FA 1ONEA 1FA2A 5JVLA 3DC8A 2YCLA 1QPOA 2VEMA 2ZZ5A 1VJIA 4S2CA 3WK1A 1XV8A 3GW3A 3LBOA 1GOOA 1RQHA 2O7SA 3WLIA 5BOOA 1IIGA 3CH0A 1VFTA 1O7AA 4TV6A 5F2GA 1I0BA 4PZVA 1XJBA 1BLIA 3OJGA 4EACA 4NUWA 3W6MA 3C2OA 3EDFA 2C1IA 3PZNA 4MVAA 3M0VA 1E72M 1QVBA 1GPFA 2DUXA 5C8BB 1LBLA 3AXXA 3I6RA 1JQXA 4CNOA 2GJLA 2H9AB 1LF1A 4ZO8A 4H04A 5FD0A 1LOSA 4AB4A 5FOOA 3BE7A 4OKDA 2WMIA 4ZSUA 3W27A 4I9TA 3BW3A 2BY0A 1GQIA 3IVSA 4LV4A 2E3ZA 3OA3A 4IG2A 1S5TA 3HA1A 1FCUA 1TO3A 1XINA 3HPAA 4JAWA 2J62A 3S3GA 4DJED 3LN3A 1X1ZA 4IFRA 3JR2A 1QW9A 2VC7A 1LWJA 3FDKA 2WHJA 4XSLA 3VX1A 3MBDA 1Q5MA 3DHPA 3AHTA 4XTDA 2PTZA 4D6CA 4YWSA 1E1FA 1UG6A 4L1GA 3PG8A 5BZAA 5EMJA 4EKJA 7ENLA 1VFFA 3S5YA 5E6ZA 1BKSA 1EO5A 1KGUA 3ZSTA 2D3LA 1PX8A 5CSRA 4S3JA 5EMUA 3D3FA 2HXUA 3KVLA 4DPQA 1WOBA 1TWIA 1SPQA 4KWVA 5CZ0A 5A1AA 3AICA 5TF0A 2OEKA 1K8CA 2PDGA 1UZDA 4B2DD 1O94A 2P5NA 4JFWA 2P76A 5D02A 1RA5A 1DYSA 2C1GA 2JEQA 2PD9A 2XUCA 5CPLA 4IXXA 2E40A 2H3BA 4S3DA 3WJSA 3OTRA 4BHYA 2OQLA 3N3TA 3RXZA 2BVWA 2C91A 1O5XA 1SSGA 3HQ1A 2ZA3A 4I3GA 3ZYZA 3KEHA 3MV01 3MUZ1 3UG4A 4EAMA 4AW7A 4G7EB 1GZ1A 2P53A 1WOAA 4V33A 3CV2A 1EQPA 1HT6A 3U7VA 2ATSA 3QW4B 4GI4A 4F9DA 4KCTA 1AQ0A 1WE5A 1GW1A 2CWNA 1EC9A 3MCNA 3S1GA 1QJWA 2FPYA 1L6FA 3G22A 4LNCA 2C0AA 5JQ9A 4Z42C 3D46A 3QW3A 1FBAA 1QUMA 2DUAA 4P5UA 1M7JA 1YRRA 1IXQA 4U4MA 4M8UA 1F73A 4RZ5A 1MW0A 3P8IA 5HMSA 3AMGA 4MY1A 1CLVA 3WMCA 4JNYA 1TV4A 4QNEA 1H1NA 4U2YA 1ODUA 2YPIA 3UU0A 3CEUA 3HG4A 3ZVHB 2VRJA 1XICA 5HPCA 1KKOA 1DL3A 4W7UA 2OEJA 1SUXA 3IIVA 2XPKA 5DEZA 3GNDA 3ZXWA 1VFLA 3CZJA 4JQ3A 1VAHA 6REQA 3NYZA 2D2OA 3C8NA 3OU8A 2QJJA 3UZ5A 2WC4A 2CXEA 1DJNA 2V2DA 1R3YA 5TQLA 3JRKA 3WDQA 3LXCA 4FF5A 1SFJA 3LM7A 4XZLX 5I0DA 1WX0A 3VZYA 2GWNA 3S5NA 3MA8A 4Q6XA 4YLWA 1HKIA 3TROA 2WBKA 3VD5A 5LHFA 3ICJA 3CZGA 1UBSA 2IMRA 1LQAA 4RXGA 1NDYA 2YB1A 5AN7A 4S3BA 1VYPX 3TZFA 3GAKA 3VXGA 1W6TA 5GVJA 1C9WA 1JFXA 1VEPA 3NL3A 2WCGA 1FFRA 1MNSA 2JIEA 1XPYA 2Z27A 3VFCA 3KHDA 4HPNA 3A13A 3WD2A 5E0CA 1TR9A 1U22A 2OMAA 1LQ2A 5LNSA 2YLAA 1XLBA 3FNDA 3OGSA 3LSCA 5JBFA 3KZSA 2ZE3A 1BYBA 2CU0A 4XVDA 3CYVA 2PWHA 3WQ8A 3P8JA 2INEA 5AHMA 1GOMA 5A94A 2C16A 4P8XA