4WXBA

Crystal structure of serine hydroxymethyltransferase from streptococcus thermophilus
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
410
structure length
410
Chain Sequence
DYKAFDPELWNAIDAEAERQQNNIELIASENVVSKAVMAAQGTLLTNKYAEGYPGKRYYGGTAVIDVVETLAIERAKKLFGAKFANVQPHSGSQANAAVYMSLIQPGDTVMGMDLSAGGHLTHGAPVSFSGKTYNFVSYNVDKESELLDYDAILAQAKEVRPKLIVAGASAYSRIIDFAKFREIADAVGAYLMVDMAHIAGLVASGHHPSPVPYAHVTTTTTHKTLRGPRGGLILTDDEDIAKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPAFKEYGENVIKNAAAMADVFNQHPDFRVISGGTNNHLFLVDVTKVVENGKVAQNVLEEVNITLNKNSIPYEQLSPFKTSGIRVGSPAITSRGMGEAESRQIAEWMVEALENHDKPEVLERIRGDVKVLTDAFPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine hydroxymethyltransferase
publication title Engineered L-Serine Hydroxymethyltransferase from Streptococcus thermophilus for the Synthesis of alpha , alpha-Dialkyl-alpha-Amino Acids.
pubmed doi rcsb
source organism Streptococcus thermophilus
molecule tags Transferase
total genus 150
structure length 410
sequence length 410
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.1: Glycine hydroxymethyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00464 SHMT Serine hydroxymethyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4wxbA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4wxbA01
2BIEA 2YOBA 2R5CB 1D7VA 4M2KA 4ADBA 2CJHA 4EB5A 1WSTA 1C7GA 1YIZA 3NU7A 3QGUA 1OHYA 1ORDA 2JG2A 1C9CA 3K28A 1MDXA 1EG5A 2W7MA 1KL1A 3RCHA 4DQ6A 1RVYA 2DOUA 3EIAA 4ZWMA 3QM2A 1GC4A 1KKJA 3GSBA 2VMVA 3PJ0A 3KGXA 4WLJA 4WD2A 1X0MA 4EMYA 4WBTA 4DGTA 2CJDA 2VYCA 3GBXA 2HOZA 4Y0IA 4Q31A 4IX8A 5JAYA 1S06A 1W7NA 3GR9A 2VGZA 3H7FA 3IF2A 1M0QA 4ITXA 4R5ZA 5LH9A 1BW0A 2C0RA 2W7EA 4O6ZA 4MQPA 3I16A 1ARHA 4K2MA 1SVVA 4JEZA 4W1VA 4P3MA 1UU1A 2EZ1A 5M4DA 4OBUA 3A9ZA 4IY7A 2C7TA 1H1CA 3HBXA 1FG7A 1J32A 4F5JA 4J5UA 2D7YA 1GEXA 2W8TA 3LY1A 3HMUA 4AO9A 1DFOA 1AICA 2V0YA 2W7DA 2Z9XA 1LW5A 4F5HA 3NDNA 4WXGA 1DGEA 4M2JA 2VGWA 2VGTA 3VP6A 1S08A 2VMZA 3GZDC 1IVRA 1BKGA 4JEWA 4W91A 1O61A 2W8VA 2AY1A 1WYUB 3ATHA 4DBCA 4MKJA 2Q7WA 1MLZA 1TOIA 2AATA 4CBSA 1BJWA 3RUYA 2W7KA 2QMAA 2X3LA 1BJOA 1CJ0A 2GB3A 3WX9A 2X8UA 4ADCA 4FL0A 1TOKA 5EAAA 1O69A 4WYEA 3MADA 3EI9A 2FQ6A 4AH3A 1LKCA 1QGNA 2W7IA 2VMSA 2CJGA 3DC1A 2W7HA 2YKVA 4ZM3A 3VK3A 1E5EA 1YIYA 2CTZA 2DKBA 1LK9A 1AKBA 2DKJA 2W7LA 4GE7A 2YCTA 5M49A 4UHOA 1U08A 4RKCA 3AEOA 3QBOA 5BJ3A 1M7YA 4A0GA 3B46A 1OHWA 2CH1A 2OGEA 3KGWA 3NUBA 4ITGA 4UHMA 4CXQA 1MAQA 1YJZA 2AY6A 4W1WA 2ZYJA 2AEVA 2HOXA 4K2BA 1V2FA 1ARTA 4L0OA 4GEBA 2VI8A 3GZCA 1G7WA 1AX4A 1AKAA 3ISLA 4WXFA 2C44A 1CL2A 4WXBA 1GBNA 2AY9A 3RQ1A 1TARA 1LW4A 2D65A 3KKIA 1DJEA 1AKCA 3A8UX 3KE3A 2FNUA 4Q75A 4XK1A 1IAXA 2TPLA 1ARGA 3BV0A 3G0TA 4LW4A 8AATA 1AHFA 3OKSA 1YNUA 2BI3A 3F6TA 4R2NA 1YAAA 2D61A 2W8JA 2NMPA 1RV3A 4PVFA 5E3KA 3DXWA 4WP0A 3K7YA 5AX8A 5M46A 3BCBA 4ZSYA 4F5KA 1RV4A 4IYOB 3FRKA 4WYAA 4ZAHA 2VMRA 1W3UA 4Q6RA 1B5PA 3WCNA 1D7RA 3CAIA 1V2DA 4H51A 4W5KA 2OATA 3NRAA 1IX6A 1O4SA 1ARSA 4WB0B 2AY5A 3FTBA 4XAUA 4I8AA 1X29A 1YJSA 2HUFA 3DRDA 4WYGA 5EIGB 4IXSA 4JEYA 1S07A 3BWNA 5EUDA 3N5MA 3FDBA 1ASLA 3RBFA 4A0HA 1VEFA 2ZJGA 4XJPA 3ZRPA 3FVXA 1JS3A 1S0AA 5BJ4A 2W7JA 2VIBA 3W1JA 5EUEA 3FZ6A 5HDMA 2CB1A 2AY8A 3AEMC 2V1PA 2OQXA 3VK2A 1JG8A 1SPAA 1QIRA 1UU0A 3A9YA 2HUUA 3BC8A 4A0RA 2WK8A 4GRXA 2Z9UA 3B1CA 3FKDA 1V72A 3ELPA 1MDOA 1MDZA 4WYCA 1QZ9A 3DU4A 3LVMA 4BA5A 5EQCA 3AEPA 2PO3A 2X5DA 5D5SA 3DR4A 4E3RA 4ATQA 3CBFA 1ELQA 2FM1A 2QA3A 1BQDA 1XI9A 2YHKA 4LNMA 1AAMA 1JF9A 3L8AA 1AJSB 3E2YA 3PDXA 4PFNA 3FDDA 2OKKA 4KAMA 4ISYA 1ELUA 3AENB 3VOMA 4TN4A 3FZ7A 4BQ0A 1AY4A 3R4TA 4R5FA 1IJIA 1OXPA 1SZSA 3NX3A 3CQ5A 1AJRA 3DZZA 5EFSA 4LC3A 4OYTA 2ZY5A 5I92A 1EJIA 2HORA 4MY5A 3JU7A 1AMQA 1LC8A 2BYJA 1GEWA 3EZSA 4J8LA 4JEXA 3QHXA 1YOOA 2CSTA 3AEJC 1TATA 1ASNA 3GZDA 2W7GA 3FQ8A 2G6WA 4WYFA 5FT4A 1AHGA 4PFFA 2VGUA 1PMOA 1WKGA 1IX7A 2E7IA 3HLMA 2CFBA 4A00A 1AIAA 1KKPA 1W23A 4XQ2A 4W1XA 3UWCA 3A9XA 1J04A 3PAAA 1XEYA 1DKAA 2O0RA 3L44A 1PFFA 2WKAA 1IUGA 1QITA 2FYFA 3MAUA 3TATA 3E6GA 3PD6B 3EI8A 2OGAA 1OXOA 5LHAA 2XBNA 5G09A 3BB8A 4ZASA 1M32A 1P3WA 1ASEA 2VMPA 1LC5A 2ZSMA 4KXKA 1C7NA 4A72A 2WK9A 4OCAA 4TV7A 2CINA 5FT6A 3AOWA 5G4JA 1KMJA 2RFVA 1W7LA 2QB2A 3G7QA 3WY7A 2Z67A 4KYOA 2JJGA 1M0NA 4GE9A 1Z7DA 9AATA 4AOAA 2EZ2A 2BHXA 3BCXA 4UQVA 3COGA 2QBTA 1CQ6A 4EFFA 1RVUA 3ZZJA 5G0AA 1E5FA 3DYDA 3B8XA 3FZ8A 4A6UA 2AEUA 3N0LA 1Y4IA 4WB0A 3A2BA 3NUIA 5EIGA 3GWPA 4P7YA 4AO4A 4ZSWA 2BIGA 3E9KA 1ECXA 4ZLVA 3NYTA 3NTJA 1DJUA 4OT8A 5FT5A 3WZFA 2ZP7A 4AZJA 2VI9A 5F9SA 3M5UA 3CQ4A 1TASA 2VGVA 3ASBA 3BN1A 3P1TA 3B1EA 3FSLA 1BQAA 1ASDA 1AHYA 1KMKA 2PB2A 1N8PA 1WYTB 3USFA 1C7OA 2GQNA 4ATPA 2VGSA 4N0BA 1AMSA 2R5CA 1DGDA 2BWPA 5IWQA 2EH6A 2BYLA 1MLYA 1PMMA 5G2PA 1VJOA 1GEYA 1MGVA 1I41A 1S09A 1G4XA 4Q76A 3WCOA 2HZPA 5E5IA 1LC7A 3AATA 1FC4A 3AEMA 4OBVA 1AJSA 4ZDPA 4F5FA 3F0HA 2VMQA 2C81A 3E77A 4BA4A 3I4JA 4BHDA 3NNKA 1AHXA 1AY5A 3EI7A 3LWSA 4RKDA 4JE5D 5G4IA 1QJ5A 1LS3A 3MEBA 2D5YA 2D64A 1DJ9A 2QLRA 4WLHA 4ZWVA 2X5FA 3AOVA 4EU1A 2HOYA 3E2ZB 3H14A 4JEVA 4RIZA 1AAWA 2ZC0A 1UU2A 2GMUA 1ASMA 1BJNA 3LVJA 1GCKA 3WGBA 4LNJA 3ZRRA 4JF1A 3CQ6A 1CQ8A 1N31A 5HXXA 2JJEA 3PDBB 4MKKA 1B9IA 2VMUA 2ZY4A 4XJLA 3MC6C 1ASCA 4U2HA 4LW2A 3F9TA 5EAVA 1C4KA 2AY4A 2Z9VA 4K2IA 2BI2A 2XH1A 5G2QA 1WYVB 1N2TA 4MSOA 4ZDLA 2D66A 4R8DA 3T32A 3FD0A 1D7SA 4NOGA 2JGTA 1WYUA 1DTYA 3FQAA 2GSAA 2PB0A 2VMNA 1GC3A 1M0OA 2E7UA 3PD6A 4ZDOA 2ORDA 3BS8A 2Z61A 3HVYA 1D2FA 3EI6A 4F5MA 3AEJA 3ACZA 5FT8A 1H0CA 1SZKA 2BI1A 2OKJA 4UHNA 1SF2A 1BJ4A 1EQBA 1KL2A 1M4NA 3E2FA 3K40A 5E4ZA 1G7XA 2YKYA 3HDOA 5TF5A 1QJ3A 2WK7A 4EB7A 1MAPA 5D95A 1PG8A 4QGRA 1CZEA 2VMOA 1JS6A 3MAFB 3JW9A 1SFFA 3BCAA 3ASAA 3DXVA 3PPLA 4A6RA 3PGYA 2ZSLA 5C6UA 3UAKA 2W8WA 4RJ0A 5HHYA 3LG0A 3JWAA 2VMYA 2VMXA 1WKHA 4RITA 2Z1YA 2D63A 1QISA 1B4XA 4ZM4A 5K8BA 3LVKA 4JF0A 4A6TA 4HVKA 4RJYA 3JWBA 2O1BA 3GJUA 3OP7A 2ZY2A 1OATA 3HQTA 3RI6A 5DX5A 4TMRA 3FFHA 2YCPA 3II0A 3D6KA 4M2MA 3QN6A 3PIUA 1X2AA 3RCHB 4LNLA 4AZKA 2Z9WA 3PA9A 4CXRA 1TPLA 1VP4A 4XEWA 2CY8A 2DR1A 2VLFA 1G4VA 1GC0A 3QI6A 3AV7A 4F5IA 4CBRA 2D7ZA 1CZCA 3BWOA 2BI5A 3EIBA 4E77A 1W7MA 3TFTA 1IBJA 1UKJA 3HL2A 4UOYA 3N75A 2Z1ZA 3ZRQA 1M6SA 1AY8A 1WYTA 3ECDA 2VMWA 2YKUA 2BWOA 3NYSA 4IYOA 1GD9A 3JTXA 4ADDA 4HF8A 4B9BA 4GE4A 5M4BA 1B8GA 4W8IA 3P6KA 1YJYA 2DGMA 3TQXA 4F5GA 3WGCA 4XJMA 2EGYA 2ZUKA 2JJHA 4FFCA 3WLXA 4MQRA 2AY2A 3W1HA 4XJOA 1TOEA 2FN6A 2E7JA 3LVLB 4OMAA 4OTLA 3RBLA 4E3QA 2O7CA 2YRIA 3I5TA 5DB5A 4MQQA 3WKSA 7AATA 3DR7A 2ZY3A 1AMAA 3GETA 2FNIA 4IXZA 2F8JA 1B5OA 2EO5A 1C0NA 3EUCA 4RM1A 3WKRA 2CANA 1V2EA 2QB3A 2DGKA 2VLHA 3ELEA 4GSAA 3E2ZA 5DJ1A 4BMKA 1ASFA 1BJOB 1ASGA 2BI9A 1BS0A 1BT4A 1CQ7A 2VMTA 1IAYA 2EPJA 1AIBA 1GDEA 1SZUA 3B1DA 1O62A 1CS1A 5DJ9A 1GC2A 4RAEA 2JISA 3PDBA 3TFUA 3LV2A 5J8QA 5EUNA 1T3IA 3W1IA 4B98A 1ASAA 2BWNA 1I48A 2R5EA 1TOGA 2R0TA 2YKXA 3FFRA 2VIAA 4A0FA 3R9AA 3NU8A 1ZC9A 1CL1A 1WYVA 1B9HA 3NYUA 4OC9A 3G8MA 2DGLA 2W8UA 1I29A 3AENA 1IX8A 4RLGA 2HP1A 5F8VA 3Q8NA 1OHVA 1X28A 3JZLA 2W7FA 4MGRA 2HUIA 3HT4A 3EI5A 3FQ7A 3IHJA 4E1OA 2E54A 4CVQA 2R2NA 1M0PA 3MC6A 2JJFA 4N0WA 1Z3ZA 3QPGA 2BKWA 4Y0DA 4GDYA 4IXOA 1ARIA 3FCRA 3FVSA 4JE5A 4ADEA 3EZ1A 2YCNA 1ASBA 1ZODA 2BIAA 3MAFA 2GMSA 4PIWA 4U1TA 2AY3A 3FVUA 1TOJA 2HP2A 1FG3A 2AY7A 3VK4A 3AELA 2Z20A 2CH2A 3BWNC 1D7UA 2YRRA 3UE8A 4IW7A 3MKJA 3ZZKA 3MBBA 4F5LA 1I43A 4F4EA 4Y0HA 1ZOBA 3TCMA 1AMRA 1AHEA 3DODA 4WYDA 3VAXA
chains in the Genus database with same CATH superfamily
2BIEA 2YOBA 2R5CB 1D7VA 4M2KA 4ADBA 2CJHA 4EB5A 1WSTA 1C7GA 1YIZA 3NU7A 3QGUA 1OHYA 1ORDA 2JG2A 1C9CA 3K28A 1MDXA 1EG5A 2W7MA 1KL1A 3RCHA 4DQ6A 1RVYA 2DOUA 3EIAA 4ZWMA 3QM2A 1GC4A 1KKJA 3GSBA 2VMVA 3PJ0A 3KGXA 4WLJA 4WD2A 1X0MA 4EMYA 4WBTA 4DGTA 2CJDA 2VYCA 3GBXA 2HOZA 4Y0IA 4Q31A 4IX8A 5JAYA 1S06A 1W7NA 3GR9A 2VGZA 3H7FA 3IF2A 1M0QA 4ITXA 4R5ZA 5LH9A 1BW0A 2C0RA 2W7EA 4O6ZA 4MQPA 3I16A 1ARHA 4K2MA 1SVVA 4JEZA 4W1VA 4P3MA 1UU1A 2EZ1A 5M4DA 4OBUA 3A9ZA 4IY7A 2C7TA 1H1CA 3HBXA 1FG7A 1J32A 4F5JA 4J5UA 2D7YA 1GEXA 2W8TA 3LY1A 3HMUA 4AO9A 1DFOA 1AICA 2V0YA 2W7DA 2Z9XA 1LW5A 4F5HA 3NDNA 4WXGA 1DGEA 4M2JA 2VGWA 2VGTA 3VP6A 1S08A 2VMZA 3GZDC 1IVRA 1BKGA 4JEWA 4W91A 1O61A 2W8VA 2AY1A 1WYUB 3ATHA 4DBCA 4MKJA 2Q7WA 1MLZA 1TOIA 2AATA 4CBSA 1BJWA 3RUYA 2W7KA 2QMAA 2X3LA 3N4RA 1BJOA 1CJ0A 2GB3A 3WX9A 2X8UA 4ADCA 3N7NA 4FL0A 1TOKA 5EAAA 1O69A 4WYEA 3MADA 3EI9A 2FQ6A 4AH3A 1LKCA 1QGNA 2W7IA 2VMSA 2CJGA 3DC1A 2W7HA 2YKVA 4ZM3A 3VK3A 1E5EA 1YIYA 2CTZA 2DKBA 1LK9A 1AKBA 2DKJA 2W7LA 4GE7A 2YCTA 5M49A 4UHOA 1U08A 4RKCA 3AEOA 3QBOA 5BJ3A 1M7YA 4A0GA 3B46A 1OHWA 2CH1A 2OGEA 3KGWA 3NUBA 4ITGA 4UHMA 4CXQA 1MAQA 1YJZA 2AY6A 4W1WA 2ZYJA 2AEVA 2HOXA 4K2BA 1V2FA 1ARTA 4L0OA 4GEBA 2VI8A 3GZCA 1G7WA 1AX4A 1AKAA 3ISLA 4WXFA 2C44A 1CL2A 4WXBA 1GBNA 2AY9A 3RQ1A 1TARA 1LW4A 2D65A 3KKIA 1DJEA 1AKCA 3A8UX 3KE3A 2FNUA 4Q75A 4XK1A 1IAXA 2TPLA 1ARGA 3BV0A 3G0TA 4LW4A 8AATA 1AHFA 3OKSA 1YNUA 2BI3A 3F6TA 4R2NA 1YAAA 2D61A 2W8JA 2NMPA 1RV3A 4PVFA 5E3KA 3DXWA 4WP0A 3K7YA 5AX8A 5M46A 3BCBA 4ZSYA 4F5KA 1RV4A 4IYOB 3FRKA 4WYAA 4ZAHA 2VMRA 1W3UA 4Q6RA 1B5PA 3WCNA 1D7RA 3CAIA 1V2DA 4H51A 4W5KA 2OATA 3NRAA 1IX6A 1O4SA 1ARSA 4WB0B 2AY5A 3FTBA 4XAUA 4I8AA 1X29A 1YJSA 2HUFA 3DRDA 4WYGA 5EIGB 4IXSA 4JEYA 1S07A 3BWNA 5EUDA 3N5MA 3FDBA 1ASLA 3RBFA 4A0HA 5KTBA 1VEFA 2ZJGA 4XJPA 3ZRPA 3FVXA 1JS3A 1S0AA 5BJ4A 2W7JA 2VIBA 3W1JA 5EUEA 3FZ6A 5HDMA 2CB1A 2AY8A 3AEMC 2V1PA 2OQXA 3VK2A 1JG8A 1SPAA 1QIRA 1UU0A 3A9YA 3N4XA 2HUUA 3BC8A 4A0RA 2WK8A 4GRXA 2Z9UA 3B1CA 3FKDA 1V72A 3ELPA 1MDOA 1MDZA 4WYCA 1QZ9A 3DU4A 3LVMA 4BA5A 5EQCA 3AEPA 2PO3A 2X5DA 5D5SA 4H63Q 3DR4A 4E3RA 4ATQA 3CBFA 1ELQA 2FM1A 2QA3A 1BQDA 1XI9A 2YHKA 4LNMA 1AAMA 1JF9A 3L8AA 1AJSB 3E2YA 3PDXA 4PFNA 3FDDA 2OKKA 4KAMA 4ISYA 1ELUA 2EYQA 3AENB 3VOMA 4TN4A 3FZ7A 4BQ0A 1AY4A 3R4TA 4R5FA 1IJIA 1OXPA 1SZSA 3NX3A 3CQ5A 1AJRA 3DZZA 5EFSA 4LC3A 4OYTA 2ZY5A 5I92A 1EJIA 2HORA 4MY5A 3JU7A 1AMQA 1LC8A 2BYJA 1GEWA 3EZSA 4J8LA 4JEXA 3QHXA 1YOOA 2CSTA 3AEJC 3N4SA 1TATA 1ASNA 3GZDA 2W7GA 3FQ8A 2G6WA 4WYFA 5FT4A 1AHGA 4PFFA 2VGUA 1PMOA 1WKGA 1IX7A 2E7IA 3HLMA 2CFBA 4A00A 1AIAA 1KKPA 1W23A 4XQ2A 4W1XA 3UWCA 3A9XA 1J04A 3PAAA 1XEYA 1DKAA 2O0RA 3L44A 1PFFA 2WKAA 1IUGA 1QITA 2FYFA 3MAUA 3TATA 3E6GA 3PD6B 3EI8A 2OGAA 1OXOA 5LHAA 2XBNA 5G09A 3BB8A 3H9XA 4ZASA 1M32A 1P3WA 1ASEA 2VMPA 1LC5A 2ZSMA 4KXKA 1C7NA 4A72A 2WK9A 4OCAA 4TV7A 2CINA 5FT6A 3AOWA 5G4JA 1KMJA 2RFVA 1W7LA 2QB2A 3G7QA 3WY7A 2Z67A 4KYOA 2JJGA 1M0NA 4GE9A 1Z7DA 9AATA 4AOAA 2EZ2A 2BHXA 3BCXA 4UQVA 3COGA 2QBTA 1CQ6A 4EFFA 1RVUA 3ZZJA 5G0AA 1E5FA 3DYDA 3B8XA 3FZ8A 4A6UA 2AEUA 3N0LA 1Y4IA 4WB0A 3A2BA 3NUIA 5EIGA 3GWPA 4P7YA 4AO4A 4ZSWA 2BIGA 3E9KA 1ECXA 4ZLVA 3NYTA 3NTJA 1DJUA 4OT8A 5FT5A 3WZFA 2ZP7A 4AZJA 2VI9A 5F9SA 3M5UA 3CQ4A 1TASA 2VGVA 3ASBA 3BN1A 3P1TA 3B1EA 3FSLA 1BQAA 1ASDA 1AHYA 1KMKA 2PB2A 1N8PA 1WYTB 3USFA 1C7OA 2GQNA 4ATPA 2VGSA 4N0BA 1AMSA 2R5CA 1DGDA 2BWPA 5IWQA 2EH6A 2BYLA 1MLYA 1PMMA 5G2PA 1VJOA 1GEYA 1MGVA 1I41A 1S09A 1G4XA 4Q76A 2WB6A 3WCOA 2HZPA 5E5IA 1LC7A 3AATA 1FC4A 3AEMA 4OBVA 2KFPA 1AJSA 4ZDPA 4F5FA 3F0HA 2VMQA 2C81A 3E77A 4BA4A 3I4JA 4BHDA 3NNKA 1AHXA 1AY5A 3EI7A 3LWSA 4RKDA 4JE5D 5G4IA 1QJ5A 1LS3A 3MEBA 2D5YA 2D64A 1DJ9A 2QLRA 4WLHA 4ZWVA 2X5FA 3AOVA 4EU1A 2HOYA 3E2ZB 3H14A 4JEVA 4RIZA 1AAWA 2ZC0A 1UU2A 2GMUA 1ASMA 1BJNA 3LVJA 1GCKA 3WGBA 4LNJA 3ZRRA 4JF1A 3CQ6A 1CQ8A 1N31A 5HXXA 2JJEA 2A1VA 3PDBB 4MKKA 1B9IA 2VMUA 2ZY4A 4XJLA 3MC6C 1ASCA 4U2HA 4LW2A 3F9TA 5EAVA 1C4KA 2AY4A 2Z9VA 4K2IA 2BI2A 2XH1A 5G2QA 1WYVB 1N2TA 4MSOA 4ZDLA 2D66A 4R8DA 3T32A 3FD0A 1D7SA 4NOGA 2JGTA 1WYUA 1DTYA 3FQAA 2GSAA 2PB0A 2VMNA 1GC3A 1M0OA 2E7UA 3PD6A 4ZDOA 2ORDA 3BS8A 2Z61A 3HVYA 1D2FA 3EI6A 4F5MA 3AEJA 3ACZA 5FT8A 1H0CA 1SZKA 2BI1A 2OKJA 4UHNA 1SF2A 1BJ4A 1EQBA 1KL2A 1M4NA 3E2FA 3K40A 5E4ZA 1G7XA 2YKYA 3HDOA 5TF5A 1QJ3A 2WK7A 4EB7A 1MAPA 5D95A 1PG8A 4QGRA 1CZEA 2VMOA 1JS6A 3MAFB 3JW9A 1SFFA 3BCAA 3ASAA 3DXVA 3PPLA 4A6RA 3PGYA 2ZSLA 5C6UA 3UAKA 2W8WA 4RJ0A 5HHYA 3LG0A 3JWAA 2VMYA 2VMXA 1WKHA 4RITA 2Z1YA 2D63A 1QISA 1B4XA 4ZM4A 5K8BA 3LVKA 4JF0A 4A6TA 4HVKA 4RJYA 3JWBA 2O1BA 3GJUA 3OP7A 2ZY2A 1OATA 3HQTA 3RI6A 5DX5A 4TMRA 3FFHA 2YCPA 3II0A 3D6KA 4M2MA 3QN6A 3PIUA 1X2AA 3RCHB 4LNLA 4AZKA 2Z9WA 3PA9A 4CXRA 1TPLA 1VP4A 4XEWA 2CY8A 2DR1A 2VLFA 1G4VA 1GC0A 3QI6A 3AV7A 4F5IA 2G7JA 4CBRA 2D7ZA 1CZCA 3BWOA 2BI5A 3EIBA 4E77A 1W7MA 3TFTA 1IBJA 1UKJA 3HL2A 4UOYA 3N75A 2Z1ZA 3ZRQA 1M6SA 1AY8A 1WYTA 3ECDA 2VMWA 2YKUA 2BWOA 3NYSA 4IYOA 1GD9A 2FKIA 3JTXA 4ADDA 4HF8A 4B9BA 4GE4A 5M4BA 1B8GA 4W8IA 3P6KA 1YJYA 2DGMA 3TQXA 4F5GA 3WGCA 1KAFA 4XJMA 2EGYA 2ZUKA 2JJHA 4FFCA 3WLXA 4MQRA 2AY2A 3W1HA 4XJOA 1TOEA 2FN6A 2E7JA 3LVLB 4OMAA 4OTLA 3RBLA 4E3QA 2O7CA 2YRIA 3I5TA 5DB5A 4MQQA 3WKSA 7AATA 3DR7A 2ZY3A 1AMAA 3GETA 2QSRA 2FNIA 4IXZA 2F8JA 1B5OA 2EO5A 1C0NA 3EUCA 4RM1A 3WKRA 2CANA 1V2EA 2QB3A 2DGKA 2VLHA 3ELEA 4GSAA 3E2ZA 5DJ1A 4BMKA 1ASFA 1BJOB 4K05A 1ASGA 2BI9A 1BS0A 1BT4A 1CQ7A 2VMTA 1IAYA 2EPJA 1AIBA 1GDEA 1SZUA 3B1DA 1O62A 1CS1A 5DJ9A 1GC2A 4RAEA 2JISA 3PDBA 3TFUA 3LV2A 5J8QA 5EUNA 1T3IA 3W1IA 4B98A 1ASAA 2BWNA 1I48A 2R5EA 1TOGA 2R0TA 2YKXA 3FFRA 2VIAA 4A0FA 3R9AA 3NU8A 1ZC9A 1CL1A 1WYVA 1B9HA 3NYUA 4OC9A 3G8MA 2DGLA 2W8UA 1I29A 3AENA 1IX8A 4RLGA 2HP1A 5F8VA 3Q8NA 1OHVA 1X28A 3JZLA 2W7FA 4MGRA 2HUIA 3HT4A 3EI5A 3FQ7A 3IHJA 4E1OA 2E54A 4CVQA 2R2NA 1M0PA 3MC6A 2JJFA 4N0WA 1Z3ZA 3QPGA 2BKWA 4Y0DA 4GDYA 4IXOA 1ARIA 3FCRA 3FVSA 4JE5A 4ADEA 3EZ1A 2YCNA 1ASBA 1ZODA 2BIAA 3MAFA 2GMSA 4PIWA 4U1TA 2AY3A 3FVUA 1TOJA 2HP2A 1FG3A 2AY7A 3VK4A 3AELA 2Z20A 2CH2A 3BWNC 1D7UA 2YRRA 3UE8A 4IW7A 3MKJA 3ZZKA 3MBBA 4F5LA 1I43A 4F4EA 4Y0HA 1ZOBA 3TCMA 1AMRA 1AHEA 3DODA 4WYDA 3VAXA
chains in the Genus database with same CATH topology
2BIEA 2YOBA 2R5CB 1D7VA 4M2KA 4ADBA 2CJHA 4EB5A 1WSTA 1C7GA 1YIZA 3NU7A 3QGUA 1OHYA 1ORDA 2JG2A 1C9CA 3K28A 1MDXA 1EG5A 2W7MA 1KL1A 3RCHA 4DQ6A 1RVYA 2DOUA 3EIAA 4ZWMA 3QM2A 1GC4A 1KKJA 3GSBA 2VMVA 3PJ0A 3KGXA 4WLJA 4WD2A 1X0MA 4EMYA 4WBTA 4DGTA 2CJDA 2VYCA 3GBXA 2HOZA 4Y0IA 4Q31A 4IX8A 5JAYA 1S06A 1W7NA 3GR9A 2VGZA 3H7FA 3IF2A 1M0QA 4ITXA 4R5ZA 5LH9A 1BW0A 2C0RA 2W7EA 4O6ZA 4MQPA 3I16A 1ARHA 4K2MA 1SVVA 4JEZA 4W1VA 4P3MA 1UU1A 2EZ1A 5M4DA 4OBUA 3A9ZA 4IY7A 2C7TA 1H1CA 3HBXA 1FG7A 1J32A 4F5JA 4J5UA 2D7YA 1GEXA 2W8TA 3LY1A 3HMUA 4AO9A 1DFOA 1AICA 2V0YA 2W7DA 2Z9XA 1LW5A 4F5HA 3NDNA 4WXGA 1DGEA 4M2JA 2VGWA 2VGTA 3VP6A 1S08A 2VMZA 3GZDC 1IVRA 1BKGA 4JEWA 4W91A 1O61A 2W8VA 2AY1A 1WYUB 3ATHA 4DBCA 4MKJA 2Q7WA 1MLZA 1TOIA 2AATA 4CBSA 1BJWA 3RUYA 2W7KA 2QMAA 2X3LA 3N4RA 1BJOA 1CJ0A 2GB3A 3WX9A 2X8UA 4ADCA 3N7NA 4FL0A 1TOKA 5EAAA 1O69A 4WYEA 3MADA 3EI9A 2FQ6A 4AH3A 1LKCA 1QGNA 2W7IA 2VMSA 2CJGA 3DC1A 2W7HA 2YKVA 4ZM3A 3VK3A 1E5EA 1YIYA 2CTZA 2DKBA 1LK9A 1AKBA 2DKJA 2W7LA 4GE7A 2YCTA 5M49A 4UHOA 1U08A 4RKCA 3AEOA 3QBOA 5BJ3A 1M7YA 4A0GA 3B46A 1OHWA 2CH1A 2OGEA 3KGWA 3NUBA 4ITGA 4UHMA 4CXQA 1MAQA 1YJZA 2AY6A 4W1WA 2ZYJA 2AEVA 2HOXA 4K2BA 1V2FA 1ARTA 4L0OA 4GEBA 2VI8A 3GZCA 1G7WA 1AX4A 1AKAA 3ISLA 4WXFA 2C44A 1CL2A 4WXBA 1GBNA 2AY9A 3RQ1A 1TARA 1LW4A 2D65A 3KKIA 1DJEA 1AKCA 3A8UX 3KE3A 2FNUA 4Q75A 4XK1A 1IAXA 2TPLA 1ARGA 3BV0A 3G0TA 4LW4A 8AATA 1AHFA 3OKSA 1YNUA 2BI3A 3F6TA 4R2NA 1YAAA 2D61A 2W8JA 2NMPA 1RV3A 4PVFA 5E3KA 3DXWA 4WP0A 3K7YA 5AX8A 5M46A 3BCBA 4ZSYA 4F5KA 1RV4A 4IYOB 3FRKA 4WYAA 4ZAHA 2VMRA 1W3UA 4Q6RA 1B5PA 3WCNA 1D7RA 3CAIA 1V2DA 4H51A 4W5KA 2OATA 3NRAA 1IX6A 1O4SA 1ARSA 4WB0B 2AY5A 3FTBA 4XAUA 4I8AA 1X29A 1YJSA 2HUFA 3DRDA 4WYGA 5EIGB 4IXSA 4JEYA 1S07A 3BWNA 5EUDA 3N5MA 3FDBA 1ASLA 3RBFA 4A0HA 5KTBA 1VEFA 2ZJGA 4XJPA 3ZRPA 3FVXA 1JS3A 1S0AA 5BJ4A 2W7JA 2VIBA 3W1JA 5EUEA 3FZ6A 5HDMA 2CB1A 2AY8A 3AEMC 2V1PA 2OQXA 3VK2A 1JG8A 1SPAA 1QIRA 1UU0A 3A9YA 3N4XA 2HUUA 3BC8A 4A0RA 2WK8A 4GRXA 2Z9UA 3B1CA 3FKDA 1V72A 3ELPA 1MDOA 1MDZA 4WYCA 1QZ9A 3DU4A 3LVMA 4BA5A 5EQCA 3AEPA 2PO3A 2X5DA 5D5SA 4H63Q 3DR4A 4E3RA 4ATQA 3CBFA 1ELQA 2FM1A 2QA3A 1BQDA 1XI9A 2YHKA 4LNMA 1AAMA 1JF9A 3L8AA 1AJSB 3E2YA 3PDXA 4PFNA 3FDDA 2OKKA 4KAMA 4ISYA 1ELUA 2EYQA 3AENB 3VOMA 4TN4A 3FZ7A 4BQ0A 1AY4A 3R4TA 4R5FA 1IJIA 1OXPA 1SZSA 3NX3A 3CQ5A 1AJRA 3DZZA 5EFSA 4LC3A 4OYTA 2ZY5A 5I92A 1EJIA 2HORA 4MY5A 3JU7A 1AMQA 1LC8A 2BYJA 1GEWA 3EZSA 4J8LA 4JEXA 3QHXA 1YOOA 2CSTA 3AEJC 3N4SA 1TATA 1ASNA 3GZDA 2W7GA 3FQ8A 2G6WA 4WYFA 5FT4A 1AHGA 4PFFA 2VGUA 1PMOA 1WKGA 1IX7A 2E7IA 3HLMA 2CFBA 4A00A 1AIAA 1KKPA 1W23A 4XQ2A 4W1XA 3UWCA 3A9XA 1J04A 3PAAA 1XEYA 1DKAA 2O0RA 3L44A 1PFFA 2WKAA 1IUGA 1QITA 2FYFA 3MAUA 3TATA 3E6GA 3PD6B 3EI8A 2OGAA 1OXOA 5LHAA 2XBNA 5G09A 3BB8A 3H9XA 4ZASA 1M32A 1P3WA 1ASEA 2VMPA 1LC5A 2ZSMA 4KXKA 1C7NA 4A72A 2WK9A 4OCAA 4TV7A 2CINA 5FT6A 3AOWA 5G4JA 1KMJA 2RFVA 1W7LA 2QB2A 3G7QA 3WY7A 2Z67A 4KYOA 2JJGA 1M0NA 4GE9A 1Z7DA 9AATA 4AOAA 2EZ2A 2BHXA 3BCXA 4UQVA 3COGA 2QBTA 1CQ6A 4EFFA 1RVUA 3ZZJA 5G0AA 1E5FA 3DYDA 3B8XA 3FZ8A 4A6UA 2AEUA 3N0LA 1Y4IA 4WB0A 3A2BA 3NUIA 5EIGA 3GWPA 4P7YA 4AO4A 4ZSWA 2BIGA 3E9KA 1ECXA 4ZLVA 3NYTA 3NTJA 1DJUA 4OT8A 5FT5A 3WZFA 2ZP7A 4AZJA 2VI9A 5F9SA 3M5UA 3CQ4A 1TASA 2VGVA 3ASBA 3BN1A 3P1TA 3B1EA 3FSLA 1BQAA 1ASDA 1AHYA 1KMKA 2PB2A 1N8PA 1WYTB 3USFA 1C7OA 2GQNA 4ATPA 2VGSA 4N0BA 1AMSA 2R5CA 1DGDA 2BWPA 5IWQA 2EH6A 2BYLA 1MLYA 1PMMA 5G2PA 1VJOA 1GEYA 1MGVA 1I41A 1S09A 1G4XA 4Q76A 2WB6A 3WCOA 2HZPA 5E5IA 1LC7A 3AATA 1FC4A 3AEMA 4OBVA 2KFPA 1AJSA 4ZDPA 4F5FA 3F0HA 2VMQA 2C81A 3E77A 4BA4A 3I4JA 4BHDA 3NNKA 1AHXA 1AY5A 3EI7A 3LWSA 4RKDA 4JE5D 5G4IA 1QJ5A 1LS3A 3MEBA 2D5YA 2D64A 1DJ9A 2QLRA 4WLHA 4ZWVA 2X5FA 3AOVA 4EU1A 2HOYA 3E2ZB 3H14A 4JEVA 4RIZA 1AAWA 2ZC0A 1UU2A 2GMUA 1ASMA 1BJNA 3LVJA 1GCKA 3WGBA 4LNJA 3ZRRA 4JF1A 3CQ6A 1CQ8A 1N31A 5HXXA 2JJEA 2A1VA 3PDBB 4MKKA 1B9IA 2VMUA 2ZY4A 4XJLA 3MC6C 1ASCA 4U2HA 4LW2A 3F9TA 5EAVA 1C4KA 2AY4A 2Z9VA 4K2IA 2BI2A 2XH1A 5G2QA 1WYVB 1N2TA 4MSOA 4ZDLA 2D66A 4R8DA 3T32A 3FD0A 1D7SA 4NOGA 2JGTA 1WYUA 1DTYA 3FQAA 2GSAA 2PB0A 2VMNA 1GC3A 1M0OA 2E7UA 3PD6A 4ZDOA 2ORDA 3BS8A 2Z61A 3HVYA 1D2FA 3EI6A 4F5MA 3AEJA 3ACZA 5FT8A 1H0CA 1SZKA 2BI1A 2OKJA 4UHNA 1SF2A 1BJ4A 1EQBA 1KL2A 1M4NA 3E2FA 3K40A 5E4ZA 1G7XA 2YKYA 3HDOA 5TF5A 1QJ3A 2WK7A 4EB7A 1MAPA 5D95A 1PG8A 4QGRA 1CZEA 2VMOA 1JS6A 3MAFB 3JW9A 1SFFA 3BCAA 3ASAA 3DXVA 3PPLA 4A6RA 3PGYA 2ZSLA 5C6UA 3UAKA 2W8WA 4RJ0A 5HHYA 3LG0A 3JWAA 2VMYA 2VMXA 1WKHA 4RITA 2Z1YA 2D63A 1QISA 1B4XA 4ZM4A 5K8BA 3LVKA 4JF0A 4A6TA 4HVKA 4RJYA 3JWBA 2O1BA 3GJUA 3OP7A 2ZY2A 1OATA 3HQTA 3RI6A 5DX5A 4TMRA 3FFHA 2YCPA 3II0A 3D6KA 4M2MA 3QN6A 3PIUA 1X2AA 3RCHB 4LNLA 4AZKA 2Z9WA 3PA9A 4CXRA 1TPLA 1VP4A 4XEWA 2CY8A 2DR1A 2VLFA 1G4VA 1GC0A 3QI6A 3AV7A 4F5IA 2G7JA 4CBRA 2D7ZA 1CZCA 3BWOA 2BI5A 3EIBA 4E77A 1W7MA 3TFTA 1IBJA 1UKJA 3HL2A 4UOYA 3N75A 2Z1ZA 3ZRQA 1M6SA 1AY8A 1WYTA 3ECDA 2VMWA 2YKUA 2BWOA 3NYSA 4IYOA 1GD9A 2FKIA 3JTXA 4ADDA 4HF8A 4B9BA 4GE4A 5M4BA 1B8GA 4W8IA 3P6KA 1YJYA 2DGMA 3TQXA 4F5GA 3WGCA 4XJMA 2EGYA 2ZUKA 2JJHA 4FFCA 3WLXA 4MQRA 2AY2A 3W1HA 4XJOA 1TOEA 2FN6A 2E7JA 3LVLB 4OMAA 4OTLA 3RBLA 4E3QA 2O7CA 2YRIA 3I5TA 5DB5A 4MQQA 3WKSA 7AATA 3DR7A 2ZY3A 1AMAA 3GETA 2QSRA 2FNIA 4IXZA 2F8JA 1B5OA 2EO5A 1C0NA 3EUCA 4RM1A 3WKRA 2CANA 1V2EA 2QB3A 2DGKA 2VLHA 3ELEA 4GSAA 3E2ZA 5DJ1A 4BMKA 1ASFA 1BJOB 4K05A 1ASGA 2BI9A 1BS0A 1BT4A 1CQ7A 2VMTA 1IAYA 2EPJA 1AIBA 1GDEA 1SZUA 3B1DA 1O62A 1CS1A 5DJ9A 1GC2A 4RAEA 2JISA 3PDBA 3TFUA 3LV2A 5J8QA 5EUNA 1T3IA 3W1IA 4B98A 1ASAA 2BWNA 1I48A 2R5EA 1TOGA 2R0TA 2YKXA 3FFRA 2VIAA 4A0FA 3R9AA 3NU8A 1ZC9A 1CL1A 1WYVA 1B9HA 3NYUA 4OC9A 3G8MA 2DGLA 2W8UA 1I29A 3AENA 1IX8A 4RLGA 2HP1A 5F8VA 3Q8NA 1OHVA 1X28A 3JZLA 2W7FA 4MGRA 2HUIA 3HT4A 3EI5A 3FQ7A 3IHJA 4E1OA 2E54A 4CVQA 2R2NA 1M0PA 3MC6A 2JJFA 4N0WA 1Z3ZA 3QPGA 2BKWA 4Y0DA 4GDYA 4IXOA 1ARIA 3FCRA 3FVSA 4JE5A 4ADEA 3EZ1A 2YCNA 1ASBA 1ZODA 2BIAA 3MAFA 2GMSA 4PIWA 4U1TA 2AY3A 3FVUA 1TOJA 2HP2A 1FG3A 2AY7A 3VK4A 3AELA 2Z20A 2CH2A 3BWNC 1D7UA 2YRRA 3UE8A 4IW7A 3MKJA 3ZZKA 3MBBA 4F5LA 1I43A 4F4EA 4Y0HA 1ZOBA 3TCMA 1AMRA 1AHEA 3DODA 4WYDA 3VAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BIE A;  2YOB A;  2R5C B;  1D7V A;  4M2K A;  4ADB A;  2CJH A;  4EB5 A;  1WST A;  1C7G A;  1YIZ A;  3NU7 A;  3QGU A;  1OHY A;  1ORD A;  2JG2 A;  1C9C A;  3K28 A;  1MDX A;  1EG5 A;  2W7M A;  1KL1 A;  3RCH A;  4DQ6 A;  1RVY A;  2DOU A;  3EIA A;  4ZWM A;  3QM2 A;  1GC4 A;  1KKJ A;  3GSB A;  2VMV A;  3PJ0 A;  3KGX A;  4WLJ A;  4WD2 A;  1X0M A;  4EMY A;  4WBT A;  4DGT A;  2CJD A;  2VYC A;  3GBX A;  2HOZ A;  4Y0I A;  4Q31 A;  4IX8 A;  5JAY A;  1S06 A;  1W7N A;  3GR9 A;  2VGZ A;  3H7F A;  3IF2 A;  1M0Q A;  4ITX A;  4R5Z A;  5LH9 A;  1BW0 A;  2C0R A;  2W7E A;  4O6Z A;  4MQP A;  3I16 A;  1ARH A;  4K2M A;  1SVV A;  4JEZ A;  4W1V A;  4P3M A;  1UU1 A;  2EZ1 A;  5M4D A;  4OBU A;  3A9Z A;  4IY7 A;  2C7T A;  1H1C A;  3HBX A;  1FG7 A;  1J32 A;  4F5J A;  4J5U A;  2D7Y A;  1GEX A;  2W8T A;  3LY1 A;  3HMU A;  4AO9 A;  1DFO A;  1AIC A;  2V0Y A;  2W7D A;  2Z9X A;  1LW5 A;  4F5H A;  3NDN A;  4WXG A;  1DGE A;  4M2J A;  2VGW A;  2VGT A;  3VP6 A;  1S08 A;  2VMZ A;  3GZD C;  1IVR A;  1BKG A;  4JEW A;  4W91 A;  1O61 A;  2W8V A;  2AY1 A;  1WYU B;  3ATH A;  4DBC A;  4MKJ A;  2Q7W A;  1MLZ A;  1TOI A;  2AAT A;  4CBS A;  1BJW A;  3RUY A;  2W7K A;  2QMA A;  2X3L A;  1BJO A;  1CJ0 A;  2GB3 A;  3WX9 A;  2X8U A;  4ADC A;  4FL0 A;  1TOK A;  5EAA A;  1O69 A;  4WYE A;  3MAD A;  3EI9 A;  2FQ6 A;  4AH3 A;  1LKC A;  1QGN A;  2W7I A;  2VMS A;  2CJG A;  3DC1 A;  2W7H A;  2YKV A;  4ZM3 A;  3VK3 A;  1E5E A;  1YIY A;  2CTZ A;  2DKB A;  1LK9 A;  1AKB A;  2DKJ A;  2W7L A;  4GE7 A;  2YCT A;  5M49 A;  4UHO A;  1U08 A;  4RKC A;  3AEO A;  3QBO A;  5BJ3 A;  1M7Y A;  4A0G A;  3B46 A;  1OHW A;  2CH1 A;  2OGE A;  3KGW A;  3NUB A;  4ITG A;  4UHM A;  4CXQ A;  1MAQ A;  1YJZ A;  2AY6 A;  4W1W A;  2ZYJ A;  2AEV A;  2HOX A;  4K2B A;  1V2F A;  1ART A;  4L0O A;  4GEB A;  2VI8 A;  3GZC A;  1G7W A;  1AX4 A;  1AKA A;  3ISL A;  4WXF A;  2C44 A;  1CL2 A;  4WXB A;  1GBN A;  2AY9 A;  3RQ1 A;  1TAR A;  1LW4 A;  2D65 A;  3KKI A;  1DJE A;  1AKC A;  3A8U X;  3KE3 A;  2FNU A;  4Q75 A;  4XK1 A;  1IAX A;  2TPL A;  1ARG A;  3BV0 A;  3G0T A;  4LW4 A;  8AAT A;  1AHF A;  3OKS A;  1YNU A;  2BI3 A;  3F6T A;  4R2N A;  1YAA A;  2D61 A;  2W8J A;  2NMP A;  1RV3 A;  4PVF A;  5E3K A;  3DXW A;  4WP0 A;  3K7Y A;  5AX8 A;  5M46 A;  3BCB A;  4ZSY A;  4F5K A;  1RV4 A;  4IYO B;  3FRK A;  4WYA A;  4ZAH A;  2VMR A;  1W3U A;  4Q6R A;  1B5P A;  3WCN A;  1D7R A;  3CAI A;  1V2D A;  4H51 A;  4W5K A;  2OAT A;  3NRA A;  1IX6 A;  1O4S A;  1ARS A;  4WB0 B;  2AY5 A;  3FTB A;  4XAU A;  4I8A A;  1X29 A;  1YJS A;  2HUF A;  3DRD A;  4WYG A;  5EIG B;  4IXS A;  4JEY A;  1S07 A;  3BWN A;  5EUD A;  3N5M A;  3FDB A;  1ASL A;  3RBF A;  4A0H A;  1VEF A;  2ZJG A;  4XJP A;  3ZRP A;  3FVX A;  1JS3 A;  1S0A A;  5BJ4 A;  2W7J A;  2VIB A;  3W1J A;  5EUE A;  3FZ6 A;  5HDM A;  2CB1 A;  2AY8 A;  3AEM C;  2V1P A;  2OQX A;  3VK2 A;  1JG8 A;  1SPA A;  1QIR A;  1UU0 A;  3A9Y A;  2HUU A;  3BC8 A;  4A0R A;  2WK8 A;  4GRX A;  2Z9U A;  3B1C A;  3FKD A;  1V72 A;  3ELP A;  1MDO A;  1MDZ A;  4WYC A;  1QZ9 A;  3DU4 A;  3LVM A;  4BA5 A;  5EQC A;  3AEP A;  2PO3 A;  2X5D A;  5D5S A;  3DR4 A;  4E3R A;  4ATQ A;  3CBF A;  1ELQ A;  2FM1 A;  2QA3 A;  1BQD A;  1XI9 A;  2YHK A;  4LNM A;  1AAM A;  1JF9 A;  3L8A A;  1AJS B;  3E2Y A;  3PDX A;  4PFN A;  3FDD A;  2OKK A;  4KAM A;  4ISY A;  1ELU A;  3AEN B;  3VOM A;  4TN4 A;  3FZ7 A;  4BQ0 A;  1AY4 A;  3R4T A;  4R5F A;  1IJI A;  1OXP A;  1SZS A;  3NX3 A;  3CQ5 A;  1AJR A;  3DZZ A;  5EFS A;  4LC3 A;  4OYT A;  2ZY5 A;  5I92 A;  1EJI A;  2HOR A;  4MY5 A;  3JU7 A;  1AMQ A;  1LC8 A;  2BYJ A;  1GEW A;  3EZS A;  4J8L A;  4JEX A;  3QHX A;  1YOO A;  2CST A;  3AEJ C;  1TAT A;  1ASN A;  3GZD A;  2W7G A;  3FQ8 A;  2G6W A;  4WYF A;  5FT4 A;  1AHG A;  4PFF A;  2VGU A;  1PMO A;  1WKG A;  1IX7 A;  2E7I A;  3HLM A;  2CFB A;  4A00 A;  1AIA A;  1KKP A;  1W23 A;  4XQ2 A;  4W1X A;  3UWC A;  3A9X A;  1J04 A;  3PAA A;  1XEY A;  1DKA A;  2O0R A;  3L44 A;  1PFF A;  2WKA A;  1IUG A;  1QIT A;  2FYF A;  3MAU A;  3TAT A;  3E6G A;  3PD6 B;  3EI8 A;  2OGA A;  1OXO A;  5LHA A;  2XBN A;  5G09 A;  3BB8 A;  4ZAS A;  1M32 A;  1P3W A;  1ASE A;  2VMP A;  1LC5 A;  2ZSM A;  4KXK A;  1C7N A;  4A72 A;  2WK9 A;  4OCA A;  4TV7 A;  2CIN A;  5FT6 A;  3AOW A;  5G4J A;  1KMJ A;  2RFV A;  1W7L A;  2QB2 A;  3G7Q A;  3WY7 A;  2Z67 A;  4KYO A;  2JJG A;  1M0N A;  4GE9 A;  1Z7D A;  9AAT A;  4AOA A;  2EZ2 A;  2BHX A;  3BCX A;  4UQV A;  3COG A;  2QBT A;  1CQ6 A;  4EFF A;  1RVU A;  3ZZJ A;  5G0A A;  1E5F A;  3DYD A;  3B8X A;  3FZ8 A;  4A6U A;  2AEU A;  3N0L A;  1Y4I A;  4WB0 A;  3A2B A;  3NUI A;  5EIG A;  3GWP A;  4P7Y A;  4AO4 A;  4ZSW A;  2BIG A;  3E9K A;  1ECX A;  4ZLV A;  3NYT A;  3NTJ A;  1DJU A;  4OT8 A;  5FT5 A;  3WZF A;  2ZP7 A;  4AZJ A;  2VI9 A;  5F9S A;  3M5U A;  3CQ4 A;  1TAS A;  2VGV A;  3ASB A;  3BN1 A;  3P1T A;  3B1E A;  3FSL A;  1BQA A;  1ASD A;  1AHY A;  1KMK A;  2PB2 A;  1N8P A;  1WYT B;  3USF A;  1C7O A;  2GQN A;  4ATP A;  2VGS A;  4N0B A;  1AMS A;  2R5C A;  1DGD A;  2BWP A;  5IWQ A;  2EH6 A;  2BYL A;  1MLY A;  1PMM A;  5G2P A;  1VJO A;  1GEY A;  1MGV A;  1I41 A;  1S09 A;  1G4X A;  4Q76 A;  3WCO A;  2HZP A;  5E5I A;  1LC7 A;  3AAT A;  1FC4 A;  3AEM A;  4OBV A;  1AJS A;  4ZDP A;  4F5F A;  3F0H A;  2VMQ A;  2C81 A;  3E77 A;  4BA4 A;  3I4J A;  4BHD A;  3NNK A;  1AHX A;  1AY5 A;  3EI7 A;  3LWS A;  4RKD A;  4JE5 D;  5G4I A;  1QJ5 A;  1LS3 A;  3MEB A;  2D5Y A;  2D64 A;  1DJ9 A;  2QLR A;  4WLH A;  4ZWV A;  2X5F A;  3AOV A;  4EU1 A;  2HOY A;  3E2Z B;  3H14 A;  4JEV A;  4RIZ A;  1AAW A;  2ZC0 A;  1UU2 A;  2GMU A;  1ASM A;  1BJN A;  3LVJ A;  1GCK A;  3WGB A;  4LNJ A;  3ZRR A;  4JF1 A;  3CQ6 A;  1CQ8 A;  1N31 A;  5HXX A;  2JJE A;  3PDB B;  4MKK A;  1B9I A;  2VMU A;  2ZY4 A;  4XJL A;  3MC6 C;  1ASC A;  4U2H A;  4LW2 A;  3F9T A;  5EAV A;  1C4K A;  2AY4 A;  2Z9V A;  4K2I A;  2BI2 A;  2XH1 A;  5G2Q A;  1WYV B;  1N2T A;  4MSO A;  4ZDL A;  2D66 A;  4R8D A;  3T32 A;  3FD0 A;  1D7S A;  4NOG A;  2JGT A;  1WYU A;  1DTY A;  3FQA A;  2GSA A;  2PB0 A;  2VMN A;  1GC3 A;  1M0O A;  2E7U A;  3PD6 A;  4ZDO A;  2ORD A;  3BS8 A;  2Z61 A;  3HVY A;  1D2F A;  3EI6 A;  4F5M A;  3AEJ A;  3ACZ A;  5FT8 A;  1H0C A;  1SZK A;  2BI1 A;  2OKJ A;  4UHN A;  1SF2 A;  1BJ4 A;  1EQB A;  1KL2 A;  1M4N A;  3E2F A;  3K40 A;  5E4Z A;  1G7X A;  2YKY A;  3HDO A;  5TF5 A;  1QJ3 A;  2WK7 A;  4EB7 A;  1MAP A;  5D95 A;  1PG8 A;  4QGR A;  1CZE A;  2VMO A;  1JS6 A;  3MAF B;  3JW9 A;  1SFF A;  3BCA A;  3ASA A;  3DXV A;  3PPL A;  4A6R A;  3PGY A;  2ZSL A;  5C6U A;  3UAK A;  2W8W A;  4RJ0 A;  5HHY A;  3LG0 A;  3JWA A;  2VMY A;  2VMX A;  1WKH A;  4RIT A;  2Z1Y A;  2D63 A;  1QIS A;  1B4X A;  4ZM4 A;  5K8B A;  3LVK A;  4JF0 A;  4A6T A;  4HVK A;  4RJY A;  3JWB A;  2O1B A;  3GJU A;  3OP7 A;  2ZY2 A;  1OAT A;  3HQT A;  3RI6 A;  5DX5 A;  4TMR A;  3FFH A;  2YCP A;  3II0 A;  3D6K A;  4M2M A;  3QN6 A;  3PIU A;  1X2A A;  3RCH B;  4LNL A;  4AZK A;  2Z9W A;  3PA9 A;  4CXR A;  1TPL A;  1VP4 A;  4XEW A;  2CY8 A;  2DR1 A;  2VLF A;  1G4V A;  1GC0 A;  3QI6 A;  3AV7 A;  4F5I A;  4CBR A;  2D7Z A;  1CZC A;  3BWO A;  2BI5 A;  3EIB A;  4E77 A;  1W7M A;  3TFT A;  1IBJ A;  1UKJ A;  3HL2 A;  4UOY A;  3N75 A;  2Z1Z A;  3ZRQ A;  1M6S A;  1AY8 A;  1WYT A;  3ECD A;  2VMW A;  2YKU A;  2BWO A;  3NYS A;  4IYO A;  1GD9 A;  3JTX A;  4ADD A;  4HF8 A;  4B9B A;  4GE4 A;  5M4B A;  1B8G A;  4W8I A;  3P6K A;  1YJY A;  2DGM A;  3TQX A;  4F5G A;  3WGC A;  4XJM A;  2EGY A;  2ZUK A;  2JJH A;  4FFC A;  3WLX A;  4MQR A;  2AY2 A;  3W1H A;  4XJO A;  1TOE A;  2FN6 A;  2E7J A;  3LVL B;  4OMA A;  4OTL A;  3RBL A;  4E3Q A;  2O7C A;  2YRI A;  3I5T A;  5DB5 A;  4MQQ A;  3WKS A;  7AAT A;  3DR7 A;  2ZY3 A;  1AMA A;  3GET A;  2FNI A;  4IXZ A;  2F8J A;  1B5O A;  2EO5 A;  1C0N A;  3EUC A;  4RM1 A;  3WKR A;  2CAN A;  1V2E A;  2QB3 A;  2DGK A;  2VLH A;  3ELE A;  4GSA A;  3E2Z A;  5DJ1 A;  4BMK A;  1ASF A;  1BJO B;  1ASG A;  2BI9 A;  1BS0 A;  1BT4 A;  1CQ7 A;  2VMT A;  1IAY A;  2EPJ A;  1AIB A;  1GDE A;  1SZU A;  3B1D A;  1O62 A;  1CS1 A;  5DJ9 A;  1GC2 A;  4RAE A;  2JIS A;  3PDB A;  3TFU A;  3LV2 A;  5J8Q A;  5EUN A;  1T3I A;  3W1I A;  4B98 A;  1ASA A;  2BWN A;  1I48 A;  2R5E A;  1TOG A;  2R0T A;  2YKX A;  3FFR A;  2VIA A;  4A0F A;  3R9A A;  3NU8 A;  1ZC9 A;  1CL1 A;  1WYV A;  1B9H A;  3NYU A;  4OC9 A;  3G8M A;  2DGL A;  2W8U A;  1I29 A;  3AEN A;  1IX8 A;  4RLG A;  2HP1 A;  5F8V A;  3Q8N A;  1OHV A;  1X28 A;  3JZL A;  2W7F A;  4MGR A;  2HUI A;  3HT4 A;  3EI5 A;  3FQ7 A;  3IHJ A;  4E1O A;  2E54 A;  4CVQ A;  2R2N A;  1M0P A;  3MC6 A;  2JJF A;  4N0W A;  1Z3Z A;  3QPG A;  2BKW A;  4Y0D A;  4GDY A;  4IXO A;  1ARI A;  3FCR A;  3FVS A;  4JE5 A;  4ADE A;  3EZ1 A;  2YCN A;  1ASB A;  1ZOD A;  2BIA A;  3MAF A;  2GMS A;  4PIW A;  4U1T A;  2AY3 A;  3FVU A;  1TOJ A;  2HP2 A;  1FG3 A;  2AY7 A;  3VK4 A;  3AEL A;  2Z20 A;  2CH2 A;  3BWN C;  1D7U A;  2YRR A;  3UE8 A;  4IW7 A;  3MKJ A;  3ZZK A;  3MBB A;  4F5L A;  1I43 A;  4F4E A;  4Y0H A;  1ZOB A;  3TCM A;  1AMR A;  1AHE A;  3DOD A;  4WYD A;  3VAX A; 
#chains in the Genus database with same CATH topology
 2BIE A;  2YOB A;  2R5C B;  1D7V A;  4M2K A;  4ADB A;  2CJH A;  4EB5 A;  1WST A;  1C7G A;  1YIZ A;  3NU7 A;  3QGU A;  1OHY A;  1ORD A;  2JG2 A;  1C9C A;  3K28 A;  1MDX A;  1EG5 A;  2W7M A;  1KL1 A;  3RCH A;  4DQ6 A;  1RVY A;  2DOU A;  3EIA A;  4ZWM A;  3QM2 A;  1GC4 A;  1KKJ A;  3GSB A;  2VMV A;  3PJ0 A;  3KGX A;  4WLJ A;  4WD2 A;  1X0M A;  4EMY A;  4WBT A;  4DGT A;  2CJD A;  2VYC A;  3GBX A;  2HOZ A;  4Y0I A;  4Q31 A;  4IX8 A;  5JAY A;  1S06 A;  1W7N A;  3GR9 A;  2VGZ A;  3H7F A;  3IF2 A;  1M0Q A;  4ITX A;  4R5Z A;  5LH9 A;  1BW0 A;  2C0R A;  2W7E A;  4O6Z A;  4MQP A;  3I16 A;  1ARH A;  4K2M A;  1SVV A;  4JEZ A;  4W1V A;  4P3M A;  1UU1 A;  2EZ1 A;  5M4D A;  4OBU A;  3A9Z A;  4IY7 A;  2C7T A;  1H1C A;  3HBX A;  1FG7 A;  1J32 A;  4F5J A;  4J5U A;  2D7Y A;  1GEX A;  2W8T A;  3LY1 A;  3HMU A;  4AO9 A;  1DFO A;  1AIC A;  2V0Y A;  2W7D A;  2Z9X A;  1LW5 A;  4F5H A;  3NDN A;  4WXG A;  1DGE A;  4M2J A;  2VGW A;  2VGT A;  3VP6 A;  1S08 A;  2VMZ A;  3GZD C;  1IVR A;  1BKG A;  4JEW A;  4W91 A;  1O61 A;  2W8V A;  2AY1 A;  1WYU B;  3ATH A;  4DBC A;  4MKJ A;  2Q7W A;  1MLZ A;  1TOI A;  2AAT A;  4CBS A;  1BJW A;  3RUY A;  2W7K A;  2QMA A;  2X3L A;  3N4R A;  1BJO A;  1CJ0 A;  2GB3 A;  3WX9 A;  2X8U A;  4ADC A;  3N7N A;  4FL0 A;  1TOK A;  5EAA A;  1O69 A;  4WYE A;  3MAD A;  3EI9 A;  2FQ6 A;  4AH3 A;  1LKC A;  1QGN A;  2W7I A;  2VMS A;  2CJG A;  3DC1 A;  2W7H A;  2YKV A;  4ZM3 A;  3VK3 A;  1E5E A;  1YIY A;  2CTZ A;  2DKB A;  1LK9 A;  1AKB A;  2DKJ A;  2W7L A;  4GE7 A;  2YCT A;  5M49 A;  4UHO A;  1U08 A;  4RKC A;  3AEO A;  3QBO A;  5BJ3 A;  1M7Y A;  4A0G A;  3B46 A;  1OHW A;  2CH1 A;  2OGE A;  3KGW A;  3NUB A;  4ITG A;  4UHM A;  4CXQ A;  1MAQ A;  1YJZ A;  2AY6 A;  4W1W A;  2ZYJ A;  2AEV A;  2HOX A;  4K2B A;  1V2F A;  1ART A;  4L0O A;  4GEB A;  2VI8 A;  3GZC A;  1G7W A;  1AX4 A;  1AKA A;  3ISL A;  4WXF A;  2C44 A;  1CL2 A;  4WXB A;  1GBN A;  2AY9 A;  3RQ1 A;  1TAR A;  1LW4 A;  2D65 A;  3KKI A;  1DJE A;  1AKC A;  3A8U X;  3KE3 A;  2FNU A;  4Q75 A;  4XK1 A;  1IAX A;  2TPL A;  1ARG A;  3BV0 A;  3G0T A;  4LW4 A;  8AAT A;  1AHF A;  3OKS A;  1YNU A;  2BI3 A;  3F6T A;  4R2N A;  1YAA A;  2D61 A;  2W8J A;  2NMP A;  1RV3 A;  4PVF A;  5E3K A;  3DXW A;  4WP0 A;  3K7Y A;  5AX8 A;  5M46 A;  3BCB A;  4ZSY A;  4F5K A;  1RV4 A;  4IYO B;  3FRK A;  4WYA A;  4ZAH A;  2VMR A;  1W3U A;  4Q6R A;  1B5P A;  3WCN A;  1D7R A;  3CAI A;  1V2D A;  4H51 A;  4W5K A;  2OAT A;  3NRA A;  1IX6 A;  1O4S A;  1ARS A;  4WB0 B;  2AY5 A;  3FTB A;  4XAU A;  4I8A A;  1X29 A;  1YJS A;  2HUF A;  3DRD A;  4WYG A;  5EIG B;  4IXS A;  4JEY A;  1S07 A;  3BWN A;  5EUD A;  3N5M A;  3FDB A;  1ASL A;  3RBF A;  4A0H A;  5KTB A;  1VEF A;  2ZJG A;  4XJP A;  3ZRP A;  3FVX A;  1JS3 A;  1S0A A;  5BJ4 A;  2W7J A;  2VIB A;  3W1J A;  5EUE A;  3FZ6 A;  5HDM A;  2CB1 A;  2AY8 A;  3AEM C;  2V1P A;  2OQX A;  3VK2 A;  1JG8 A;  1SPA A;  1QIR A;  1UU0 A;  3A9Y A;  3N4X A;  2HUU A;  3BC8 A;  4A0R A;  2WK8 A;  4GRX A;  2Z9U A;  3B1C A;  3FKD A;  1V72 A;  3ELP A;  1MDO A;  1MDZ A;  4WYC A;  1QZ9 A;  3DU4 A;  3LVM A;  4BA5 A;  5EQC A;  3AEP A;  2PO3 A;  2X5D A;  5D5S A;  4H63 Q;  3DR4 A;  4E3R A;  4ATQ A;  3CBF A;  1ELQ A;  2FM1 A;  2QA3 A;  1BQD A;  1XI9 A;  2YHK A;  4LNM A;  1AAM A;  1JF9 A;  3L8A A;  1AJS B;  3E2Y A;  3PDX A;  4PFN A;  3FDD A;  2OKK A;  4KAM A;  4ISY A;  1ELU A;  2EYQ A;  3AEN B;  3VOM A;  4TN4 A;  3FZ7 A;  4BQ0 A;  1AY4 A;  3R4T A;  4R5F A;  1IJI A;  1OXP A;  1SZS A;  3NX3 A;  3CQ5 A;  1AJR A;  3DZZ A;  5EFS A;  4LC3 A;  4OYT A;  2ZY5 A;  5I92 A;  1EJI A;  2HOR A;  4MY5 A;  3JU7 A;  1AMQ A;  1LC8 A;  2BYJ A;  1GEW A;  3EZS A;  4J8L A;  4JEX A;  3QHX A;  1YOO A;  2CST A;  3AEJ C;  3N4S A;  1TAT A;  1ASN A;  3GZD A;  2W7G A;  3FQ8 A;  2G6W A;  4WYF A;  5FT4 A;  1AHG A;  4PFF A;  2VGU A;  1PMO A;  1WKG A;  1IX7 A;  2E7I A;  3HLM A;  2CFB A;  4A00 A;  1AIA A;  1KKP A;  1W23 A;  4XQ2 A;  4W1X A;  3UWC A;  3A9X A;  1J04 A;  3PAA A;  1XEY A;  1DKA A;  2O0R A;  3L44 A;  1PFF A;  2WKA A;  1IUG A;  1QIT A;  2FYF A;  3MAU A;  3TAT A;  3E6G A;  3PD6 B;  3EI8 A;  2OGA A;  1OXO A;  5LHA A;  2XBN A;  5G09 A;  3BB8 A;  3H9X A;  4ZAS A;  1M32 A;  1P3W A;  1ASE A;  2VMP A;  1LC5 A;  2ZSM A;  4KXK A;  1C7N A;  4A72 A;  2WK9 A;  4OCA A;  4TV7 A;  2CIN A;  5FT6 A;  3AOW A;  5G4J A;  1KMJ A;  2RFV A;  1W7L A;  2QB2 A;  3G7Q A;  3WY7 A;  2Z67 A;  4KYO A;  2JJG A;  1M0N A;  4GE9 A;  1Z7D A;  9AAT A;  4AOA A;  2EZ2 A;  2BHX A;  3BCX A;  4UQV A;  3COG A;  2QBT A;  1CQ6 A;  4EFF A;  1RVU A;  3ZZJ A;  5G0A A;  1E5F A;  3DYD A;  3B8X A;  3FZ8 A;  4A6U A;  2AEU A;  3N0L A;  1Y4I A;  4WB0 A;  3A2B A;  3NUI A;  5EIG A;  3GWP A;  4P7Y A;  4AO4 A;  4ZSW A;  2BIG A;  3E9K A;  1ECX A;  4ZLV A;  3NYT A;  3NTJ A;  1DJU A;  4OT8 A;  5FT5 A;  3WZF A;  2ZP7 A;  4AZJ A;  2VI9 A;  5F9S A;  3M5U A;  3CQ4 A;  1TAS A;  2VGV A;  3ASB A;  3BN1 A;  3P1T A;  3B1E A;  3FSL A;  1BQA A;  1ASD A;  1AHY A;  1KMK A;  2PB2 A;  1N8P A;  1WYT B;  3USF A;  1C7O A;  2GQN A;  4ATP A;  2VGS A;  4N0B A;  1AMS A;  2R5C A;  1DGD A;  2BWP A;  5IWQ A;  2EH6 A;  2BYL A;  1MLY A;  1PMM A;  5G2P A;  1VJO A;  1GEY A;  1MGV A;  1I41 A;  1S09 A;  1G4X A;  4Q76 A;  2WB6 A;  3WCO A;  2HZP A;  5E5I A;  1LC7 A;  3AAT A;  1FC4 A;  3AEM A;  4OBV A;  2KFP A;  1AJS A;  4ZDP A;  4F5F A;  3F0H A;  2VMQ A;  2C81 A;  3E77 A;  4BA4 A;  3I4J A;  4BHD A;  3NNK A;  1AHX A;  1AY5 A;  3EI7 A;  3LWS A;  4RKD A;  4JE5 D;  5G4I A;  1QJ5 A;  1LS3 A;  3MEB A;  2D5Y A;  2D64 A;  1DJ9 A;  2QLR A;  4WLH A;  4ZWV A;  2X5F A;  3AOV A;  4EU1 A;  2HOY A;  3E2Z B;  3H14 A;  4JEV A;  4RIZ A;  1AAW A;  2ZC0 A;  1UU2 A;  2GMU A;  1ASM A;  1BJN A;  3LVJ A;  1GCK A;  3WGB A;  4LNJ A;  3ZRR A;  4JF1 A;  3CQ6 A;  1CQ8 A;  1N31 A;  5HXX A;  2JJE A;  2A1V A;  3PDB B;  4MKK A;  1B9I A;  2VMU A;  2ZY4 A;  4XJL A;  3MC6 C;  1ASC A;  4U2H A;  4LW2 A;  3F9T A;  5EAV A;  1C4K A;  2AY4 A;  2Z9V A;  4K2I A;  2BI2 A;  2XH1 A;  5G2Q A;  1WYV B;  1N2T A;  4MSO A;  4ZDL A;  2D66 A;  4R8D A;  3T32 A;  3FD0 A;  1D7S A;  4NOG A;  2JGT A;  1WYU A;  1DTY A;  3FQA A;  2GSA A;  2PB0 A;  2VMN A;  1GC3 A;  1M0O A;  2E7U A;  3PD6 A;  4ZDO A;  2ORD A;  3BS8 A;  2Z61 A;  3HVY A;  1D2F A;  3EI6 A;  4F5M A;  3AEJ A;  3ACZ A;  5FT8 A;  1H0C A;  1SZK A;  2BI1 A;  2OKJ A;  4UHN A;  1SF2 A;  1BJ4 A;  1EQB A;  1KL2 A;  1M4N A;  3E2F A;  3K40 A;  5E4Z A;  1G7X A;  2YKY A;  3HDO A;  5TF5 A;  1QJ3 A;  2WK7 A;  4EB7 A;  1MAP A;  5D95 A;  1PG8 A;  4QGR A;  1CZE A;  2VMO A;  1JS6 A;  3MAF B;  3JW9 A;  1SFF A;  3BCA A;  3ASA A;  3DXV A;  3PPL A;  4A6R A;  3PGY A;  2ZSL A;  5C6U A;  3UAK A;  2W8W A;  4RJ0 A;  5HHY A;  3LG0 A;  3JWA A;  2VMY A;  2VMX A;  1WKH A;  4RIT A;  2Z1Y A;  2D63 A;  1QIS A;  1B4X A;  4ZM4 A;  5K8B A;  3LVK A;  4JF0 A;  4A6T A;  4HVK A;  4RJY A;  3JWB A;  2O1B A;  3GJU A;  3OP7 A;  2ZY2 A;  1OAT A;  3HQT A;  3RI6 A;  5DX5 A;  4TMR A;  3FFH A;  2YCP A;  3II0 A;  3D6K A;  4M2M A;  3QN6 A;  3PIU A;  1X2A A;  3RCH B;  4LNL A;  4AZK A;  2Z9W A;  3PA9 A;  4CXR A;  1TPL A;  1VP4 A;  4XEW A;  2CY8 A;  2DR1 A;  2VLF A;  1G4V A;  1GC0 A;  3QI6 A;  3AV7 A;  4F5I A;  2G7J A;  4CBR A;  2D7Z A;  1CZC A;  3BWO A;  2BI5 A;  3EIB A;  4E77 A;  1W7M A;  3TFT A;  1IBJ A;  1UKJ A;  3HL2 A;  4UOY A;  3N75 A;  2Z1Z A;  3ZRQ A;  1M6S A;  1AY8 A;  1WYT A;  3ECD A;  2VMW A;  2YKU A;  2BWO A;  3NYS A;  4IYO A;  1GD9 A;  2FKI A;  3JTX A;  4ADD A;  4HF8 A;  4B9B A;  4GE4 A;  5M4B A;  1B8G A;  4W8I A;  3P6K A;  1YJY A;  2DGM A;  3TQX A;  4F5G A;  3WGC A;  1KAF A;  4XJM A;  2EGY A;  2ZUK A;  2JJH A;  4FFC A;  3WLX A;  4MQR A;  2AY2 A;  3W1H A;  4XJO A;  1TOE A;  2FN6 A;  2E7J A;  3LVL B;  4OMA A;  4OTL A;  3RBL A;  4E3Q A;  2O7C A;  2YRI A;  3I5T A;  5DB5 A;  4MQQ A;  3WKS A;  7AAT A;  3DR7 A;  2ZY3 A;  1AMA A;  3GET A;  2QSR A;  2FNI A;  4IXZ A;  2F8J A;  1B5O A;  2EO5 A;  1C0N A;  3EUC A;  4RM1 A;  3WKR A;  2CAN A;  1V2E A;  2QB3 A;  2DGK A;  2VLH A;  3ELE A;  4GSA A;  3E2Z A;  5DJ1 A;  4BMK A;  1ASF A;  1BJO B;  4K05 A;  1ASG A;  2BI9 A;  1BS0 A;  1BT4 A;  1CQ7 A;  2VMT A;  1IAY A;  2EPJ A;  1AIB A;  1GDE A;  1SZU A;  3B1D A;  1O62 A;  1CS1 A;  5DJ9 A;  1GC2 A;  4RAE A;  2JIS A;  3PDB A;  3TFU A;  3LV2 A;  5J8Q A;  5EUN A;  1T3I A;  3W1I A;  4B98 A;  1ASA A;  2BWN A;  1I48 A;  2R5E A;  1TOG A;  2R0T A;  2YKX A;  3FFR A;  2VIA A;  4A0F A;  3R9A A;  3NU8 A;  1ZC9 A;  1CL1 A;  1WYV A;  1B9H A;  3NYU A;  4OC9 A;  3G8M A;  2DGL A;  2W8U A;  1I29 A;  3AEN A;  1IX8 A;  4RLG A;  2HP1 A;  5F8V A;  3Q8N A;  1OHV A;  1X28 A;  3JZL A;  2W7F A;  4MGR A;  2HUI A;  3HT4 A;  3EI5 A;  3FQ7 A;  3IHJ A;  4E1O A;  2E54 A;  4CVQ A;  2R2N A;  1M0P A;  3MC6 A;  2JJF A;  4N0W A;  1Z3Z A;  3QPG A;  2BKW A;  4Y0D A;  4GDY A;  4IXO A;  1ARI A;  3FCR A;  3FVS A;  4JE5 A;  4ADE A;  3EZ1 A;  2YCN A;  1ASB A;  1ZOD A;  2BIA A;  3MAF A;  2GMS A;  4PIW A;  4U1T A;  2AY3 A;  3FVU A;  1TOJ A;  2HP2 A;  1FG3 A;  2AY7 A;  3VK4 A;  3AEL A;  2Z20 A;  2CH2 A;  3BWN C;  1D7U A;  2YRR A;  3UE8 A;  4IW7 A;  3MKJ A;  3ZZK A;  3MBB A;  4F5L A;  1I43 A;  4F4E A;  4Y0H A;  1ZOB A;  3TCM A;  1AMR A;  1AHE A;  3DOD A;  4WYD A;  3VAX A; 
#chains in the Genus database with same CATH homology
 2BIE A;  2YOB A;  2R5C B;  1D7V A;  4M2K A;  4ADB A;  2CJH A;  4EB5 A;  1WST A;  1C7G A;  1YIZ A;  3NU7 A;  3QGU A;  1OHY A;  1ORD A;  2JG2 A;  1C9C A;  3K28 A;  1MDX A;  1EG5 A;  2W7M A;  1KL1 A;  3RCH A;  4DQ6 A;  1RVY A;  2DOU A;  3EIA A;  4ZWM A;  3QM2 A;  1GC4 A;  1KKJ A;  3GSB A;  2VMV A;  3PJ0 A;  3KGX A;  4WLJ A;  4WD2 A;  1X0M A;  4EMY A;  4WBT A;  4DGT A;  2CJD A;  2VYC A;  3GBX A;  2HOZ A;  4Y0I A;  4Q31 A;  4IX8 A;  5JAY A;  1S06 A;  1W7N A;  3GR9 A;  2VGZ A;  3H7F A;  3IF2 A;  1M0Q A;  4ITX A;  4R5Z A;  5LH9 A;  1BW0 A;  2C0R A;  2W7E A;  4O6Z A;  4MQP A;  3I16 A;  1ARH A;  4K2M A;  1SVV A;  4JEZ A;  4W1V A;  4P3M A;  1UU1 A;  2EZ1 A;  5M4D A;  4OBU A;  3A9Z A;  4IY7 A;  2C7T A;  1H1C A;  3HBX A;  1FG7 A;  1J32 A;  4F5J A;  4J5U A;  2D7Y A;  1GEX A;  2W8T A;  3LY1 A;  3HMU A;  4AO9 A;  1DFO A;  1AIC A;  2V0Y A;  2W7D A;  2Z9X A;  1LW5 A;  4F5H A;  3NDN A;  4WXG A;  1DGE A;  4M2J A;  2VGW A;  2VGT A;  3VP6 A;  1S08 A;  2VMZ A;  3GZD C;  1IVR A;  1BKG A;  4JEW A;  4W91 A;  1O61 A;  2W8V A;  2AY1 A;  1WYU B;  3ATH A;  4DBC A;  4MKJ A;  2Q7W A;  1MLZ A;  1TOI A;  2AAT A;  4CBS A;  1BJW A;  3RUY A;  2W7K A;  2QMA A;  2X3L A;  3N4R A;  1BJO A;  1CJ0 A;  2GB3 A;  3WX9 A;  2X8U A;  4ADC A;  3N7N A;  4FL0 A;  1TOK A;  5EAA A;  1O69 A;  4WYE A;  3MAD A;  3EI9 A;  2FQ6 A;  4AH3 A;  1LKC A;  1QGN A;  2W7I A;  2VMS A;  2CJG A;  3DC1 A;  2W7H A;  2YKV A;  4ZM3 A;  3VK3 A;  1E5E A;  1YIY A;  2CTZ A;  2DKB A;  1LK9 A;  1AKB A;  2DKJ A;  2W7L A;  4GE7 A;  2YCT A;  5M49 A;  4UHO A;  1U08 A;  4RKC A;  3AEO A;  3QBO A;  5BJ3 A;  1M7Y A;  4A0G A;  3B46 A;  1OHW A;  2CH1 A;  2OGE A;  3KGW A;  3NUB A;  4ITG A;  4UHM A;  4CXQ A;  1MAQ A;  1YJZ A;  2AY6 A;  4W1W A;  2ZYJ A;  2AEV A;  2HOX A;  4K2B A;  1V2F A;  1ART A;  4L0O A;  4GEB A;  2VI8 A;  3GZC A;  1G7W A;  1AX4 A;  1AKA A;  3ISL A;  4WXF A;  2C44 A;  1CL2 A;  4WXB A;  1GBN A;  2AY9 A;  3RQ1 A;  1TAR A;  1LW4 A;  2D65 A;  3KKI A;  1DJE A;  1AKC A;  3A8U X;  3KE3 A;  2FNU A;  4Q75 A;  4XK1 A;  1IAX A;  2TPL A;  1ARG A;  3BV0 A;  3G0T A;  4LW4 A;  8AAT A;  1AHF A;  3OKS A;  1YNU A;  2BI3 A;  3F6T A;  4R2N A;  1YAA A;  2D61 A;  2W8J A;  2NMP A;  1RV3 A;  4PVF A;  5E3K A;  3DXW A;  4WP0 A;  3K7Y A;  5AX8 A;  5M46 A;  3BCB A;  4ZSY A;  4F5K A;  1RV4 A;  4IYO B;  3FRK A;  4WYA A;  4ZAH A;  2VMR A;  1W3U A;  4Q6R A;  1B5P A;  3WCN A;  1D7R A;  3CAI A;  1V2D A;  4H51 A;  4W5K A;  2OAT A;  3NRA A;  1IX6 A;  1O4S A;  1ARS A;  4WB0 B;  2AY5 A;  3FTB A;  4XAU A;  4I8A A;  1X29 A;  1YJS A;  2HUF A;  3DRD A;  4WYG A;  5EIG B;  4IXS A;  4JEY A;  1S07 A;  3BWN A;  5EUD A;  3N5M A;  3FDB A;  1ASL A;  3RBF A;  4A0H A;  5KTB A;  1VEF A;  2ZJG A;  4XJP A;  3ZRP A;  3FVX A;  1JS3 A;  1S0A A;  5BJ4 A;  2W7J A;  2VIB A;  3W1J A;  5EUE A;  3FZ6 A;  5HDM A;  2CB1 A;  2AY8 A;  3AEM C;  2V1P A;  2OQX A;  3VK2 A;  1JG8 A;  1SPA A;  1QIR A;  1UU0 A;  3A9Y A;  3N4X A;  2HUU A;  3BC8 A;  4A0R A;  2WK8 A;  4GRX A;  2Z9U A;  3B1C A;  3FKD A;  1V72 A;  3ELP A;  1MDO A;  1MDZ A;  4WYC A;  1QZ9 A;  3DU4 A;  3LVM A;  4BA5 A;  5EQC A;  3AEP A;  2PO3 A;  2X5D A;  5D5S A;  4H63 Q;  3DR4 A;  4E3R A;  4ATQ A;  3CBF A;  1ELQ A;  2FM1 A;  2QA3 A;  1BQD A;  1XI9 A;  2YHK A;  4LNM A;  1AAM A;  1JF9 A;  3L8A A;  1AJS B;  3E2Y A;  3PDX A;  4PFN A;  3FDD A;  2OKK A;  4KAM A;  4ISY A;  1ELU A;  2EYQ A;  3AEN B;  3VOM A;  4TN4 A;  3FZ7 A;  4BQ0 A;  1AY4 A;  3R4T A;  4R5F A;  1IJI A;  1OXP A;  1SZS A;  3NX3 A;  3CQ5 A;  1AJR A;  3DZZ A;  5EFS A;  4LC3 A;  4OYT A;  2ZY5 A;  5I92 A;  1EJI A;  2HOR A;  4MY5 A;  3JU7 A;  1AMQ A;  1LC8 A;  2BYJ A;  1GEW A;  3EZS A;  4J8L A;  4JEX A;  3QHX A;  1YOO A;  2CST A;  3AEJ C;  3N4S A;  1TAT A;  1ASN A;  3GZD A;  2W7G A;  3FQ8 A;  2G6W A;  4WYF A;  5FT4 A;  1AHG A;  4PFF A;  2VGU A;  1PMO A;  1WKG A;  1IX7 A;  2E7I A;  3HLM A;  2CFB A;  4A00 A;  1AIA A;  1KKP A;  1W23 A;  4XQ2 A;  4W1X A;  3UWC A;  3A9X A;  1J04 A;  3PAA A;  1XEY A;  1DKA A;  2O0R A;  3L44 A;  1PFF A;  2WKA A;  1IUG A;  1QIT A;  2FYF A;  3MAU A;  3TAT A;  3E6G A;  3PD6 B;  3EI8 A;  2OGA A;  1OXO A;  5LHA A;  2XBN A;  5G09 A;  3BB8 A;  3H9X A;  4ZAS A;  1M32 A;  1P3W A;  1ASE A;  2VMP A;  1LC5 A;  2ZSM A;  4KXK A;  1C7N A;  4A72 A;  2WK9 A;  4OCA A;  4TV7 A;  2CIN A;  5FT6 A;  3AOW A;  5G4J A;  1KMJ A;  2RFV A;  1W7L A;  2QB2 A;  3G7Q A;  3WY7 A;  2Z67 A;  4KYO A;  2JJG A;  1M0N A;  4GE9 A;  1Z7D A;  9AAT A;  4AOA A;  2EZ2 A;  2BHX A;  3BCX A;  4UQV A;  3COG A;  2QBT A;  1CQ6 A;  4EFF A;  1RVU A;  3ZZJ A;  5G0A A;  1E5F A;  3DYD A;  3B8X A;  3FZ8 A;  4A6U A;  2AEU A;  3N0L A;  1Y4I A;  4WB0 A;  3A2B A;  3NUI A;  5EIG A;  3GWP A;  4P7Y A;  4AO4 A;  4ZSW A;  2BIG A;  3E9K A;  1ECX A;  4ZLV A;  3NYT A;  3NTJ A;  1DJU A;  4OT8 A;  5FT5 A;  3WZF A;  2ZP7 A;  4AZJ A;  2VI9 A;  5F9S A;  3M5U A;  3CQ4 A;  1TAS A;  2VGV A;  3ASB A;  3BN1 A;  3P1T A;  3B1E A;  3FSL A;  1BQA A;  1ASD A;  1AHY A;  1KMK A;  2PB2 A;  1N8P A;  1WYT B;  3USF A;  1C7O A;  2GQN A;  4ATP A;  2VGS A;  4N0B A;  1AMS A;  2R5C A;  1DGD A;  2BWP A;  5IWQ A;  2EH6 A;  2BYL A;  1MLY A;  1PMM A;  5G2P A;  1VJO A;  1GEY A;  1MGV A;  1I41 A;  1S09 A;  1G4X A;  4Q76 A;  2WB6 A;  3WCO A;  2HZP A;  5E5I A;  1LC7 A;  3AAT A;  1FC4 A;  3AEM A;  4OBV A;  2KFP A;  1AJS A;  4ZDP A;  4F5F A;  3F0H A;  2VMQ A;  2C81 A;  3E77 A;  4BA4 A;  3I4J A;  4BHD A;  3NNK A;  1AHX A;  1AY5 A;  3EI7 A;  3LWS A;  4RKD A;  4JE5 D;  5G4I A;  1QJ5 A;  1LS3 A;  3MEB A;  2D5Y A;  2D64 A;  1DJ9 A;  2QLR A;  4WLH A;  4ZWV A;  2X5F A;  3AOV A;  4EU1 A;  2HOY A;  3E2Z B;  3H14 A;  4JEV A;  4RIZ A;  1AAW A;  2ZC0 A;  1UU2 A;  2GMU A;  1ASM A;  1BJN A;  3LVJ A;  1GCK A;  3WGB A;  4LNJ A;  3ZRR A;  4JF1 A;  3CQ6 A;  1CQ8 A;  1N31 A;  5HXX A;  2JJE A;  2A1V A;  3PDB B;  4MKK A;  1B9I A;  2VMU A;  2ZY4 A;  4XJL A;  3MC6 C;  1ASC A;  4U2H A;  4LW2 A;  3F9T A;  5EAV A;  1C4K A;  2AY4 A;  2Z9V A;  4K2I A;  2BI2 A;  2XH1 A;  5G2Q A;  1WYV B;  1N2T A;  4MSO A;  4ZDL A;  2D66 A;  4R8D A;  3T32 A;  3FD0 A;  1D7S A;  4NOG A;  2JGT A;  1WYU A;  1DTY A;  3FQA A;  2GSA A;  2PB0 A;  2VMN A;  1GC3 A;  1M0O A;  2E7U A;  3PD6 A;  4ZDO A;  2ORD A;  3BS8 A;  2Z61 A;  3HVY A;  1D2F A;  3EI6 A;  4F5M A;  3AEJ A;  3ACZ A;  5FT8 A;  1H0C A;  1SZK A;  2BI1 A;  2OKJ A;  4UHN A;  1SF2 A;  1BJ4 A;  1EQB A;  1KL2 A;  1M4N A;  3E2F A;  3K40 A;  5E4Z A;  1G7X A;  2YKY A;  3HDO A;  5TF5 A;  1QJ3 A;  2WK7 A;  4EB7 A;  1MAP A;  5D95 A;  1PG8 A;  4QGR A;  1CZE A;  2VMO A;  1JS6 A;  3MAF B;  3JW9 A;  1SFF A;  3BCA A;  3ASA A;  3DXV A;  3PPL A;  4A6R A;  3PGY A;  2ZSL A;  5C6U A;  3UAK A;  2W8W A;  4RJ0 A;  5HHY A;  3LG0 A;  3JWA A;  2VMY A;  2VMX A;  1WKH A;  4RIT A;  2Z1Y A;  2D63 A;  1QIS A;  1B4X A;  4ZM4 A;  5K8B A;  3LVK A;  4JF0 A;  4A6T A;  4HVK A;  4RJY A;  3JWB A;  2O1B A;  3GJU A;  3OP7 A;  2ZY2 A;  1OAT A;  3HQT A;  3RI6 A;  5DX5 A;  4TMR A;  3FFH A;  2YCP A;  3II0 A;  3D6K A;  4M2M A;  3QN6 A;  3PIU A;  1X2A A;  3RCH B;  4LNL A;  4AZK A;  2Z9W A;  3PA9 A;  4CXR A;  1TPL A;  1VP4 A;  4XEW A;  2CY8 A;  2DR1 A;  2VLF A;  1G4V A;  1GC0 A;  3QI6 A;  3AV7 A;  4F5I A;  2G7J A;  4CBR A;  2D7Z A;  1CZC A;  3BWO A;  2BI5 A;  3EIB A;  4E77 A;  1W7M A;  3TFT A;  1IBJ A;  1UKJ A;  3HL2 A;  4UOY A;  3N75 A;  2Z1Z A;  3ZRQ A;  1M6S A;  1AY8 A;  1WYT A;  3ECD A;  2VMW A;  2YKU A;  2BWO A;  3NYS A;  4IYO A;  1GD9 A;  2FKI A;  3JTX A;  4ADD A;  4HF8 A;  4B9B A;  4GE4 A;  5M4B A;  1B8G A;  4W8I A;  3P6K A;  1YJY A;  2DGM A;  3TQX A;  4F5G A;  3WGC A;  4XJM A;  2EGY A;  2ZUK A;  2JJH A;  4FFC A;  3WLX A;  4MQR A;  2AY2 A;  3W1H A;  4XJO A;  1TOE A;  2FN6 A;  2E7J A;  3LVL B;  4OMA A;  4OTL A;  3RBL A;  4E3Q A;  2O7C A;  2YRI A;  3I5T A;  5DB5 A;  4MQQ A;  3WKS A;  7AAT A;  3DR7 A;  2ZY3 A;  1AMA A;  3GET A;  2QSR A;  2FNI A;  4IXZ A;  2F8J A;  1B5O A;  2EO5 A;  1C0N A;  3EUC A;  4RM1 A;  3WKR A;  2CAN A;  1V2E A;  2QB3 A;  2DGK A;  2VLH A;  3ELE A;  4GSA A;  3E2Z A;  5DJ1 A;  4BMK A;  1ASF A;  1BJO B;  4K05 A;  1ASG A;  2BI9 A;  1BS0 A;  1BT4 A;  1CQ7 A;  2VMT A;  1IAY A;  2EPJ A;  1AIB A;  1GDE A;  1SZU A;  3B1D A;  1O62 A;  1CS1 A;  5DJ9 A;  1GC2 A;  4RAE A;  2JIS A;  3PDB A;  3TFU A;  3LV2 A;  5J8Q A;  5EUN A;  1T3I A;  3W1I A;  4B98 A;  1ASA A;  2BWN A;  1I48 A;  2R5E A;  1TOG A;  2R0T A;  2YKX A;  3FFR A;  2VIA A;  4A0F A;  3R9A A;  3NU8 A;  1ZC9 A;  1CL1 A;  1WYV A;  1B9H A;  3NYU A;  4OC9 A;  3G8M A;  2DGL A;  2W8U A;  1I29 A;  3AEN A;  1IX8 A;  4RLG A;  2HP1 A;  5F8V A;  3Q8N A;  1OHV A;  1X28 A;  3JZL A;  2W7F A;  4MGR A;  2HUI A;  3HT4 A;  3EI5 A;  3FQ7 A;  3IHJ A;  4E1O A;  2E54 A;  4CVQ A;  2R2N A;  1M0P A;  3MC6 A;  2JJF A;  4N0W A;  1Z3Z A;  3QPG A;  2BKW A;  4Y0D A;  4GDY A;  4IXO A;  1ARI A;  3FCR A;  3FVS A;  4JE5 A;  4ADE A;  3EZ1 A;  2YCN A;  1ASB A;  1ZOD A;  2BIA A;  3MAF A;  2GMS A;  4PIW A;  4U1T A;  2AY3 A;  3FVU A;  1TOJ A;  2HP2 A;  1FG3 A;  2AY7 A;  3VK4 A;  3AEL A;  2Z20 A;  2CH2 A;  3BWN C;  1D7U A;  2YRR A;  3UE8 A;  4IW7 A;  3MKJ A;  3ZZK A;  3MBB A;  4F5L A;  1I43 A;  4F4E A;  4Y0H A;  1ZOB A;  3TCM A;  1AMR A;  1AHE A;  3DOD A;  4WYD A;  3VAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...