4WXBA

Crystal structure of serine hydroxymethyltransferase from streptococcus thermophilus
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
410
structure length
410
Chain Sequence
DYKAFDPELWNAIDAEAERQQNNIELIASENVVSKAVMAAQGTLLTNKYAEGYPGKRYYGGTAVIDVVETLAIERAKKLFGAKFANVQPHSGSQANAAVYMSLIQPGDTVMGMDLSAGGHLTHGAPVSFSGKTYNFVSYNVDKESELLDYDAILAQAKEVRPKLIVAGASAYSRIIDFAKFREIADAVGAYLMVDMAHIAGLVASGHHPSPVPYAHVTTTTTHKTLRGPRGGLILTDDEDIAKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPAFKEYGENVIKNAAAMADVFNQHPDFRVISGGTNNHLFLVDVTKVVENGKVAQNVLEEVNITLNKNSIPYEQLSPFKTSGIRVGSPAITSRGMGEAESRQIAEWMVEALENHDKPEVLERIRGDVKVLTDAFPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineered L-Serine Hydroxymethyltransferase from Streptococcus thermophilus for the Synthesis of alpha , alpha-Dialkyl-alpha-Amino Acids.
pubmed doi rcsb
source organism Streptococcus thermophilus
molecule tags Transferase
molecule keywords Serine hydroxymethyltransferase
total genus 150
structure length 410
sequence length 410
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.1: Glycine hydroxymethyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00464 SHMT Serine hydroxymethyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4wxbA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4wxbA01
4NOGA 3CQ4A 2JISA 2W7LA 1CS1A 4EB5A 3QN6A 3VK2A 1I48A 2VIBA 2JJGA 1OHYA 2DGLA 2HP1A 2AATA 4U2HA 2D64A 3PIUA 2CFBA 1YIZA 5G2PA 4F5LA 3CBFA 2VGUA 4LNLA 3KGWA 4Q6RA 3QGUA 2GMSA 1LK9A 3DR4A 2AY1A 3MEBA 5EQCA 2E7JA 2BI3A 1ARTA 1EQBA 2Z1YA 3A8UX 5E3KA 3ASBA 1IVRA 2Z61A 4MQQA 4WD2A 5F9SA 3AEMA 2V0YA 1S09A 3NU7A 4KYOA 1X0MA 1ZODA 1TOEA 2VYCA 2W7HA 3GJUA 3E6GA 4CBRA 4P7YA 3FSLA 3JZLA 3I16A 1UU0A 4A6UA 1S06A 3JU7A 5E5IA 2VMRA 2VMVA 2YOBA 4RLGA 4F5GA 1ORDA 3AENA 1ASDA 1ASLA 1SVVA 3EI6A 1AHYA 5EFSA 1B5OA 1UU2A 3ZRQA 3FRKA 4N0BA 3FFRA 1OATA 2W8TA 1CJ0A 4RAEA 2BWPA 1RVUA 3EI5A 1V2FA 3F9TA 3HVYA 1WYTA 2FN6A 3FFHA 3KE3A 3WKSA 3TATA 1G4XA 3FVSA 5AX8A 3IHJA 2XBNA 1MAQA 2HOYA 4LC3A 2VMQA 2W7IA 2W7FA 3HMUA 2W8JA 2D7YA 4RKCA 1GDEA 1TPLA 2VMOA 1BT4A 3EI7A 3NYSA 1VEFA 4AO9A 2O0RA 2R0TA 5HHYA 4P3MA 5D95A 3VAXA 3DXWA 3WCNA 1XEYA 1G4VA 4WLHA 2BIEA 4RITA 3AEPA 4F5HA 4UHNA 3EZSA 3ASAA 4IXZA 4RJ0A 1FG3A 1GEXA 5IWQA 3USFA 1LS3A 5EUEA 1M0NA 1BJWA 3AOVA 4N0WA 4ZWMA 1H0CA 4ITXA 2BI1A 3BB8A 2AY4A 3GETA 1AKCA 3PD6A 5HXXA 4W8IA 1BJOA 2WK9A 2VMYA 2HUIA 2DR1A 4E77A 1AY5A 4LW2A 4IW7A 3HBXA 1AJSA 2WK8A 4XK1A 2ZY5A 1SFFA 4WBTA 3IF2A 2BWNA 2D61A 4ISYA 1MDXA 5G0AA 4LNJA 4A0FA 4GE9A 1AX4A 1TOIA 2D7ZA 2CY8A 3PDBA 3TQXA 1X29A 1B4XA 1RV3A 1WYUB 1C7GA 5I92A 2ZP7A 4ADEA 4ZSWA 4ZAHA 2F8JA 1AY4A 1UKJA 3K7YA 1D7RA 4RM1A 3JW9A 5FT8A 4PFFA 4OMAA 4EB7A 1J04A 1VJOA 3AELA 3WZFA 4H51A 4A6TA 2OKJA 1GC0A 3E2YA 3L8AA 3NDNA 4LNMA 5BJ3A 1LW5A 3F6TA 3JWAA 4E1OA 1DJUA 1B5PA 3AENB 1O61A 3OP7A 4AO4A 1TOGA 2AY6A 3A9XA 3ZZJA 3FTBA 2DKJA 2VMUA 3FZ6A 2R5EA 1BJNA 2E7IA 1QZ9A 2VI9A 4OTLA 4U1TA 4CVQA 3RQ1A 2Z1ZA 1ARSA 1DKAA 4WYFA 4B9BA 1M32A 1JG8A 1AMAA 1IJIA 2VMNA 1ASNA 2JGTA 2JG2A 1D7VA 2W7JA 2G6WA 3WGCA 2ZY3A 1OXPA 3ISLA 1PMOA 2YKVA 2AY9A 3BN1A 5EIGB 3H7FA 1I43A 1N8PA 3K28A 1DFOA 2PB2A 3AEOA 1ASBA 3B46A 5EUNA 1B8GA 1W7MA 3FVUA 3K40A 1E5FA 5M49A 2HUUA 1AICA 5EAAA 2EGYA 1C4KA 3WKRA 3I4JA 3EIAA 3HL2A 2D63A 3JTXA 3MKJA 7AATA 3B1DA 3EUCA 3BCBA 1LC7A 1N31A 2JJEA 1MLYA 1WYVB 1QITA 4AZKA 2ZY2A 2YCTA 4A0HA 4HF8A 2FYFA 1C7NA 1WKGA 2NMPA 4XJMA 5J8QA 3I5TA 3MAUA 2FM1A 1LKCA 2QB3A 1ZC9A 3BCXA 2C44A 5DJ9A 2Z67A 3LVLB 1PFFA 1FC4A 4K2MA 4MY5A 2CH2A 3FQAA 3PA9A 3WCOA 1B9IA 3G0TA 4TV7A 5G2QA 1EJIA 1CL2A 4WYAA 2BYJA 1M0QA 4PVFA 1KL2A 1SZSA 2ZSLA 1W23A 3VOMA 2VI8A 1RVYA 2YCNA 3ACZA 1CZEA 3EZ1A 1SF2A 3TFUA 4Y0DA 4WYGA 3NUBA 1SZKA 4GRXA 4M2KA 2BYLA 4WB0A 3UE8A 3GR9A 3B8XA 2X3LA 1ASGA 3FD0A 4DBCA 3FKDA 1CZCA 1XI9A 1CQ6A 1DJ9A 2ZJGA 1C9CA 2VMXA 1M0OA 3LVMA 3PPLA 1AIAA 3WGBA 1WYTB 4K2BA 1W7NA 3H14A 1TASA 1GC3A 1TOKA 1B9HA 4J5UA 1QJ3A 4ZWVA 2X5FA 4GEBA 3AEMC 1IX6A 4F4EA 4RJYA 4LW4A 5FT5A 1UU1A 3CAIA 2CANA 3B1CA 4OCAA 1AJRA 1SZUA 2D65A 4IXSA 3KKIA 1BQAA 1M6SA 4JEZA 2O1BA 4Q31A 1TOJA 4KXKA 4UHOA 9AATA 5M4BA 1BQDA 1O4SA 2CB1A 1MAPA 2AY2A 5EIGA 2Z9WA 4JE5A 4Y0HA 3FVXA 4I8AA 4XJPA 1ARGA 4M2MA 1ASEA 2R5CA 2VLHA 1P3WA 2DGMA 4ZSYA 2CJGA 2VMZA 3G7QA 4IY7A 3W1JA 3GWPA 1EG5A 3T32A 2AY8A 1BKGA 3RCHB 4R8DA 4OC9A 2OQXA 1CL1A 2BWOA 3AATA 2R2NA 1KKJA 3NU8A 2YRRA 1FG7A 4ZDPA 3BWNA 1YOOA 2VMPA 4PFNA 2PO3A 1AHFA 3BWNC 1C7OA 1WYVA 3QHXA 2HOZA 1D2FA 1IAYA 2ZUKA 4BMKA 2Z20A 4XAUA 3MAFA 1PMMA 3FZ8A 4ZDOA 3QPGA 2QMAA 4A0RA 4ZASA 3QI6A 1V2EA 1ELQA 4J8LA 2V1PA 4O6ZA 1D7SA 4IX8A 4JF1A 4WYCA 1GBNA 2W7KA 2PB0A 3PDXA 4JEVA 4WXBA 2JJHA 2CINA 4MQRA 1DGEA 1Z7DA 2FQ6A 3NTJA 1OHWA 2AEVA 3FZ7A 4ADBA 3NX3A 4WXGA 2GQNA 3EIBA 1OHVA 1BS0A 2BIGA 2VLFA 3DR7A 4AZJA 4WB0B 1G7WA 4MQPA 2BKWA 3DC1A 5DX5A 2FNUA 1T3IA 4GDYA 1D7UA 2QA3A 2CJDA 4ADDA 5LHAA 4IXOA 4W91A 3HDOA 3LV2A 1G7XA 1H1CA 1TARA 1N2TA 3BCAA 4GE4A 3RBFA 3GZDC 2C0RA 4AOAA 4BHDA 4CBSA 5DJ1A 2VMSA 2TPLA 2YRIA 3WLXA 4IYOB 2W7GA 1PG8A 3OKSA 3P1TA 2Z9XA 3P6KA 1ASAA 3PAAA 4K2IA 5M4DA 4JEWA 2C81A 3R4TA 1V72A 4W5KA 3N75A 2OGEA 3D6KA 2VGTA 1O69A 1IAXA 1MLZA 3JWBA 5M46A 3DODA 3N0LA 1AHEA 4M2JA 4JE5D 3E2ZA 1V2DA 5E4ZA 4WP0A 2OATA 4EMYA 3NYUA 1YJZA 1QJ5A 1AHGA 2YKYA 2WK7A 3FDBA 2ZSMA 4F5MA 3M5UA 4DQ6A 3LY1A 1S0AA 3QBOA 4W1XA 3ZRPA 1AIBA 5EAVA 5G09A 3WY7A 1YNUA 4ZLVA 1AJSB 4PIWA 1AY8A 4JEXA 4R5FA 4A72A 3II0A 2D66A 5FT4A 3KGXA 4QGRA 3ZRRA 4ZM3A 1GC2A 1BJOB 2E54A 4ATQA 2YHKA 4UQVA 2VMWA 3COGA 1E5EA 1IUGA 3EI9A 3MAFB 1ARIA 1ZOBA 3L44A 2X8UA 2Z9UA 1IX7A 1ECXA 4FL0A 4GE7A 4MSOA 3WX9A 2GSAA 4F5JA 2QLRA 2HZPA 3A9ZA 2BHXA 3AOWA 5TF5A 3DYDA 4R2NA 1CQ8A 2HP2A 3E2FA 4CXQA 2HOXA 3VK3A 5HDMA 3G8MA 1I29A 5FT6A 1AMRA 5G4IA 3AV7A 3E9KA 1M0PA 2BI2A 2AY5A 2BI5A 1AAWA 3NRAA 1J32A 2HUFA 2VGZA 2W8VA 3NUIA 3VP6A 5K8BA 3BC8A 1GEWA 4R5ZA 3LWSA 5EUDA 4JF0A 4ADCA 4MKJA 2OGAA 2EPJA 1X28A 3DXVA 2AY3A 3MBBA 1IBJA 4ZDLA 1S07A 1RV4A 2AY7A 2ZYJA 4XQ2A 4F5KA 5JAYA 4XJOA 1LW4A 1QGNA 3Q8NA 3UWCA 2BI9A 4ITGA 3EI8A 4GSAA 1WSTA 1IX8A 2EZ1A 4TN4A 3DRDA 2C7TA 4Q76A 3GBXA 3PJ0A 4XJLA 3FDDA 4F5IA 5F8VA 1M7YA 2FNIA 1JF9A 4Y0IA 2W7DA 3MADA 5BJ4A 2VGWA 2GB3A 2O7CA 3W1IA 2OKKA 3ELEA 2ZC0A 4DGTA 1KL1A 1VP4A 2D5YA 4JEYA 1O62A 3HT4A 2W7MA 3RBLA 3BWOA 4CXRA 3PD6B 5G4JA 4MGRA 3E77A 3F0HA 1GEYA 3ZZKA 3E2ZB 2CSTA 4EU1A 1AMQA 3PGYA 1GD9A 3DZZA 1S08A 4EFFA 3RI6A 3W1HA 2W8UA 2BIAA 2E7UA 5LH9A 1C0NA 4OYTA 1AMSA 3UAKA 4E3QA 3GSBA 1U08A 1MDZA 2QBTA 3N5MA 2VGVA 2EO5A 3RUYA 4OT8A 3RCHA 4TMRA 4WYEA 2GMUA 2XH1A 4FFCA 3TFTA 3FQ8A 1YIYA 1Y4IA 1DJEA 1QISA 5D5SA 4ATPA 1LC8A 3CQ6A 4BA5A 3PDBB 1YJSA 2W7EA 1WYUA 3FQ7A 4UOYA 2RFVA 3ATHA 2ZY4A 2EH6A 1LC5A 1MDOA 1GCKA 3ELPA 4W1VA 2DKBA 1I41A 1YJYA 2CH1A 1JS3A 8AATA 1DGDA 4MKKA 4Q75A 5DB5A 1ASMA 1AKAA 2VMTA 3DU4A 1YAAA 1ARHA 3HLMA 2Q7WA 3VK4A 2WKAA 1JS6A 4A00A 1ASCA 3TCMA 3B1EA 4BQ0A 3A2BA 2CJHA 3FCRA 5C6UA 3HQTA 1OXOA 1AKBA 1SPAA 4E3RA 2HORA 1TATA 3BV0A 1DTYA 4B98A 3LVKA 1KMJA 2YCPA 1AHXA 3QM2A 4ZM4A 1M4NA 3MC6C 4IYOA 4OBVA 1WKHA 2X5DA 1KKPA 4WLJA 3MC6A 4L0OA 3LG0A 4F5FA 1CQ7A 1KMKA 1W3UA 2VIAA 3NYTA 4RIZA 4A0GA 2ORDA 2JJFA 4KAMA 2EZ2A 3R9AA 2VGSA 2DOUA 4XEWA 2AEUA 1ASFA 2CTZA 4RKDA 3GZDA 3AEJA 1W7LA 1Z3ZA 2W8WA 4WYDA 2QB2A 4UHMA 3BS8A 1BJ4A 2Z9VA 3GZCA 4W1WA 4A6RA 3AEJC 1GC4A 3ECDA 1X2AA 1AAMA 2R5CB 2YKUA 3A9YA 2DGKA 3CQ5A 1QIRA 1ELUA 1BW0A 2YKXA 3LVJA 3NNKA 4WXFA 4AH3A 4OBUA 4BA4A 1MGVA 4HVKA
chains in the Genus database with same CATH superfamily
4NOGA 3CQ4A 2JISA 2W7LA 1CS1A 4EB5A 3QN6A 3VK2A 1I48A 2VIBA 2JJGA 1OHYA 2DGLA 2HP1A 2AATA 4U2HA 2D64A 3PIUA 2CFBA 1YIZA 5G2PA 4F5LA 3CBFA 2VGUA 4LNLA 3KGWA 4Q6RA 3QGUA 2GMSA 1LK9A 3DR4A 2AY1A 3MEBA 5EQCA 2E7JA 2BI3A 1ARTA 1EQBA 2Z1YA 3A8UX 5E3KA 3ASBA 1IVRA 2Z61A 4MQQA 4WD2A 5F9SA 3AEMA 2V0YA 1S09A 3NU7A 4KYOA 1X0MA 1ZODA 1TOEA 2VYCA 2W7HA 3GJUA 3E6GA 4CBRA 4P7YA 3FSLA 3JZLA 3I16A 1UU0A 4A6UA 1S06A 3JU7A 5E5IA 2VMRA 2VMVA 2YOBA 4RLGA 4F5GA 1ORDA 3AENA 1ASDA 1ASLA 1SVVA 3EI6A 1AHYA 5EFSA 1B5OA 1UU2A 3ZRQA 3FRKA 4N0BA 3FFRA 1OATA 2W8TA 1CJ0A 4RAEA 2BWPA 1RVUA 3EI5A 1V2FA 3F9TA 3HVYA 1WYTA 2FN6A 3FFHA 3KE3A 3WKSA 3TATA 1G4XA 3FVSA 5AX8A 3IHJA 2XBNA 1MAQA 2HOYA 4LC3A 2VMQA 2W7IA 2W7FA 3HMUA 2W8JA 2D7YA 4RKCA 1GDEA 1TPLA 2VMOA 1BT4A 3EI7A 3NYSA 1VEFA 4AO9A 2O0RA 2R0TA 5HHYA 4P3MA 5D95A 3VAXA 3DXWA 3WCNA 1XEYA 1G4VA 4WLHA 2BIEA 4RITA 3AEPA 4F5HA 4UHNA 3EZSA 3ASAA 4IXZA 4RJ0A 1FG3A 1GEXA 5IWQA 3USFA 1LS3A 5EUEA 1M0NA 1BJWA 3AOVA 4N0WA 4ZWMA 1H0CA 4ITXA 2BI1A 3BB8A 2AY4A 3GETA 1AKCA 3PD6A 5HXXA 4W8IA 1BJOA 2WK9A 2VMYA 2HUIA 2DR1A 4E77A 1AY5A 4LW2A 4IW7A 3HBXA 1AJSA 2WK8A 4XK1A 2ZY5A 1SFFA 4WBTA 3IF2A 2BWNA 2D61A 4ISYA 1MDXA 5G0AA 4LNJA 4A0FA 4GE9A 1AX4A 1TOIA 2D7ZA 2CY8A 3PDBA 3TQXA 1X29A 1B4XA 1RV3A 1WYUB 1C7GA 5I92A 2ZP7A 4ADEA 4ZSWA 4ZAHA 2F8JA 1AY4A 1UKJA 3K7YA 1D7RA 4RM1A 3JW9A 5FT8A 4PFFA 4OMAA 4EB7A 1J04A 1VJOA 3AELA 3WZFA 4H51A 4A6TA 2OKJA 1GC0A 3E2YA 3L8AA 3NDNA 4LNMA 5BJ3A 1LW5A 3F6TA 3JWAA 4E1OA 1DJUA 1B5PA 3AENB 1O61A 3OP7A 4AO4A 3H9XA 1TOGA 2AY6A 3A9XA 3ZZJA 3FTBA 2DKJA 2VMUA 3FZ6A 2R5EA 1BJNA 2E7IA 1QZ9A 2VI9A 4OTLA 4U1TA 4CVQA 3RQ1A 2Z1ZA 1ARSA 1DKAA 4WYFA 4B9BA 1M32A 1JG8A 1AMAA 1IJIA 2VMNA 1ASNA 2JGTA 2JG2A 1D7VA 2W7JA 2G6WA 3WGCA 2ZY3A 1OXPA 3ISLA 1PMOA 2YKVA 2AY9A 3BN1A 5EIGB 3H7FA 1I43A 1N8PA 3K28A 1DFOA 2PB2A 3AEOA 1ASBA 3B46A 5EUNA 1B8GA 1W7MA 3FVUA 3K40A 1E5FA 5M49A 2HUUA 1AICA 5EAAA 2EGYA 1C4KA 3WKRA 3I4JA 3EIAA 3HL2A 2D63A 3JTXA 3MKJA 7AATA 3B1DA 3EUCA 3BCBA 1LC7A 1N31A 2JJEA 1MLYA 1WYVB 1QITA 4AZKA 2ZY2A 2YCTA 4A0HA 4HF8A 2FYFA 1C7NA 1WKGA 2NMPA 4XJMA 5J8QA 3I5TA 3MAUA 2FM1A 1LKCA 2QB3A 1ZC9A 3BCXA 2C44A 5DJ9A 2Z67A 3LVLB 1PFFA 1FC4A 4K2MA 4MY5A 2CH2A 3FQAA 3PA9A 3WCOA 1B9IA 3G0TA 4TV7A 5G2QA 1EJIA 1CL2A 4WYAA 2FKIA 2BYJA 1M0QA 4PVFA 1KL2A 1SZSA 2ZSLA 1W23A 3VOMA 2VI8A 1RVYA 2YCNA 3ACZA 1CZEA 3EZ1A 1SF2A 3TFUA 4Y0DA 4WYGA 3NUBA 1SZKA 4GRXA 4M2KA 2BYLA 4WB0A 3UE8A 3GR9A 3B8XA 2X3LA 1ASGA 3FD0A 4DBCA 3FKDA 1CZCA 1XI9A 1CQ6A 1DJ9A 2ZJGA 1C9CA 2VMXA 1M0OA 3LVMA 3PPLA 1AIAA 3WGBA 1WYTB 4K2BA 1W7NA 3H14A 1TASA 1GC3A 1TOKA 1B9HA 4J5UA 1QJ3A 4ZWVA 2X5FA 4GEBA 3AEMC 1IX6A 4F4EA 4RJYA 4LW4A 5FT5A 1UU1A 3CAIA 2CANA 3B1CA 4OCAA 1AJRA 1SZUA 2D65A 4IXSA 3KKIA 1BQAA 1M6SA 4JEZA 2O1BA 4Q31A 1TOJA 4KXKA 4UHOA 9AATA 5M4BA 1BQDA 1O4SA 2CB1A 1MAPA 2AY2A 5EIGA 2Z9WA 4JE5A 4Y0HA 3FVXA 4I8AA 4XJPA 1ARGA 4M2MA 1ASEA 2R5CA 2VLHA 1P3WA 2DGMA 4ZSYA 2CJGA 2VMZA 3G7QA 4IY7A 3W1JA 3GWPA 1EG5A 3T32A 2AY8A 1BKGA 3RCHB 4R8DA 4OC9A 2OQXA 1CL1A 2BWOA 3AATA 2R2NA 1KKJA 3NU8A 2YRRA 1FG7A 4ZDPA 3BWNA 1YOOA 2VMPA 4PFNA 2PO3A 1AHFA 3BWNC 1C7OA 1WYVA 3QHXA 2HOZA 2EYQA 1D2FA 1IAYA 2ZUKA 2WB6A 4BMKA 2Z20A 4XAUA 3MAFA 1PMMA 3FZ8A 4ZDOA 3QPGA 2QMAA 4A0RA 4ZASA 3QI6A 1V2EA 1ELQA 4J8LA 2V1PA 4O6ZA 1D7SA 4IX8A 4JF1A 4WYCA 1GBNA 2W7KA 2PB0A 3PDXA 4JEVA 4WXBA 2JJHA 2CINA 4MQRA 1DGEA 1Z7DA 2FQ6A 3NTJA 1OHWA 2AEVA 3FZ7A 4ADBA 3NX3A 4WXGA 2GQNA 3EIBA 1OHVA 1BS0A 2BIGA 2VLFA 3DR7A 4AZJA 4WB0B 1G7WA 4MQPA 2BKWA 3DC1A 5DX5A 2G7JA 2FNUA 1T3IA 4GDYA 1D7UA 2QA3A 2CJDA 4ADDA 5LHAA 4IXOA 4W91A 3HDOA 3LV2A 1G7XA 1H1CA 1TARA 1N2TA 3BCAA 4GE4A 3RBFA 3GZDC 2C0RA 4AOAA 4BHDA 4CBSA 5DJ1A 2VMSA 2TPLA 2YRIA 3WLXA 4IYOB 2W7GA 1PG8A 3OKSA 3P1TA 2Z9XA 3P6KA 1ASAA 3PAAA 4K2IA 5M4DA 4JEWA 2C81A 3R4TA 1V72A 4W5KA 3N75A 2OGEA 3D6KA 2VGTA 1O69A 1IAXA 1MLZA 3JWBA 5M46A 3DODA 3N0LA 1AHEA 4M2JA 4JE5D 3E2ZA 1V2DA 5E4ZA 4WP0A 2OATA 4EMYA 3NYUA 4H63Q 1YJZA 3N4XA 1QJ5A 1AHGA 2YKYA 2WK7A 3FDBA 2ZSMA 4F5MA 3M5UA 4DQ6A 3LY1A 1S0AA 3QBOA 4W1XA 3ZRPA 1AIBA 5EAVA 5G09A 3WY7A 1YNUA 4ZLVA 1AJSB 4PIWA 1AY8A 4JEXA 4R5FA 4A72A 3II0A 2D66A 5FT4A 3KGXA 4QGRA 3ZRRA 4ZM3A 1GC2A 1BJOB 2E54A 4ATQA 2YHKA 4UQVA 2VMWA 3COGA 1E5EA 1IUGA 3EI9A 3MAFB 1ARIA 1ZOBA 3L44A 2X8UA 2Z9UA 3N4RA 1IX7A 1ECXA 4FL0A 4GE7A 4MSOA 3WX9A 2GSAA 4F5JA 2QLRA 2HZPA 3A9ZA 2BHXA 3AOWA 5TF5A 3DYDA 4R2NA 1CQ8A 2HP2A 3E2FA 4CXQA 2HOXA 3VK3A 5HDMA 3G8MA 1I29A 5FT6A 1AMRA 5G4IA 3AV7A 3E9KA 1M0PA 2BI2A 2AY5A 2BI5A 1AAWA 3NRAA 1J32A 2HUFA 2VGZA 2W8VA 3NUIA 3VP6A 5K8BA 3BC8A 1GEWA 4R5ZA 3LWSA 5EUDA 4JF0A 4ADCA 4MKJA 2OGAA 2EPJA 1X28A 3DXVA 2AY3A 3MBBA 1IBJA 4ZDLA 1S07A 1RV4A 2AY7A 2ZYJA 4XQ2A 4F5KA 5JAYA 4XJOA 1LW4A 1QGNA 3Q8NA 3UWCA 2BI9A 4ITGA 3EI8A 4GSAA 1WSTA 1IX8A 2EZ1A 4TN4A 3DRDA 2C7TA 4Q76A 3GBXA 3PJ0A 4XJLA 3FDDA 4F5IA 5F8VA 1M7YA 2FNIA 1JF9A 4Y0IA 2W7DA 3MADA 5BJ4A 2VGWA 2GB3A 2O7CA 3W1IA 2OKKA 3ELEA 2ZC0A 4DGTA 2QSRA 1KL1A 1VP4A 2D5YA 4JEYA 1O62A 3HT4A 2W7MA 3RBLA 3BWOA 4CXRA 3PD6B 5G4JA 4MGRA 3E77A 3F0HA 1GEYA 3ZZKA 3E2ZB 2CSTA 4EU1A 1AMQA 3PGYA 1GD9A 3DZZA 1S08A 4EFFA 3RI6A 3W1HA 2A1VA 2W8UA 2BIAA 2E7UA 5LH9A 1C0NA 4OYTA 1AMSA 3UAKA 4E3QA 3GSBA 1U08A 1MDZA 2QBTA 3N5MA 2VGVA 2EO5A 3RUYA 4OT8A 3N7NA 3RCHA 4TMRA 4WYEA 2GMUA 2XH1A 4FFCA 3TFTA 1KAFA 3FQ8A 1YIYA 1Y4IA 1DJEA 1QISA 5D5SA 4ATPA 1LC8A 3CQ6A 4BA5A 3PDBB 1YJSA 2W7EA 1WYUA 3FQ7A 4UOYA 2RFVA 3ATHA 2ZY4A 2EH6A 1LC5A 1MDOA 1GCKA 3ELPA 4W1VA 2DKBA 1I41A 1YJYA 2CH1A 1JS3A 8AATA 1DGDA 4MKKA 4Q75A 5DB5A 1ASMA 1AKAA 2VMTA 3DU4A 1YAAA 1ARHA 3HLMA 2Q7WA 3VK4A 2WKAA 1JS6A 4A00A 1ASCA 3TCMA 3B1EA 4BQ0A 3A2BA 2CJHA 5KTBA 3FCRA 5C6UA 3HQTA 1OXOA 4K05A 1AKBA 1SPAA 4E3RA 2KFPA 2HORA 1TATA 3BV0A 1DTYA 4B98A 3LVKA 1KMJA 2YCPA 1AHXA 3QM2A 4ZM4A 1M4NA 3MC6C 4IYOA 4OBVA 1WKHA 2X5DA 1KKPA 4WLJA 3MC6A 4L0OA 3LG0A 4F5FA 1CQ7A 1KMKA 1W3UA 2VIAA 3NYTA 4RIZA 4A0GA 2ORDA 2JJFA 4KAMA 3N4SA 2EZ2A 3R9AA 2VGSA 2DOUA 4XEWA 2AEUA 1ASFA 2CTZA 4RKDA 3GZDA 3AEJA 1W7LA 1Z3ZA 2W8WA 4WYDA 2QB2A 4UHMA 3BS8A 1BJ4A 2Z9VA 3GZCA 4W1WA 4A6RA 3AEJC 1GC4A 3ECDA 1X2AA 1AAMA 2R5CB 2YKUA 3A9YA 2DGKA 3CQ5A 1QIRA 1ELUA 1BW0A 2YKXA 3LVJA 3NNKA 4WXFA 4AH3A 4OBUA 4BA4A 1MGVA 4HVKA
chains in the Genus database with same CATH topology
4NOGA 3CQ4A 2JISA 2W7LA 1CS1A 4EB5A 3QN6A 3VK2A 1I48A 2VIBA 2JJGA 1OHYA 2DGLA 2HP1A 2AATA 4U2HA 2D64A 3PIUA 2CFBA 1YIZA 5G2PA 4F5LA 3CBFA 2VGUA 4LNLA 3KGWA 4Q6RA 3QGUA 2GMSA 1LK9A 3DR4A 2AY1A 3MEBA 5EQCA 2E7JA 2BI3A 1ARTA 1EQBA 2Z1YA 3A8UX 5E3KA 3ASBA 1IVRA 2Z61A 4MQQA 4WD2A 5F9SA 3AEMA 2V0YA 1S09A 3NU7A 4KYOA 1X0MA 1ZODA 1TOEA 2VYCA 2W7HA 3GJUA 3E6GA 4CBRA 4P7YA 3FSLA 3JZLA 3I16A 1UU0A 4A6UA 1S06A 3JU7A 5E5IA 2VMRA 2VMVA 2YOBA 4RLGA 4F5GA 1ORDA 3AENA 1ASDA 1ASLA 1SVVA 3EI6A 1AHYA 5EFSA 1B5OA 1UU2A 3ZRQA 3FRKA 4N0BA 3FFRA 1OATA 2W8TA 1CJ0A 4RAEA 2BWPA 1RVUA 3EI5A 1V2FA 3F9TA 3HVYA 1WYTA 2FN6A 3FFHA 3KE3A 3WKSA 3TATA 1G4XA 3FVSA 5AX8A 3IHJA 2XBNA 1MAQA 2HOYA 4LC3A 2VMQA 2W7IA 2W7FA 3HMUA 2W8JA 2D7YA 4RKCA 1GDEA 1TPLA 2VMOA 1BT4A 3EI7A 3NYSA 1VEFA 4AO9A 2O0RA 2R0TA 5HHYA 4P3MA 5D95A 3VAXA 3DXWA 3WCNA 1XEYA 1G4VA 4WLHA 2BIEA 4RITA 3AEPA 4F5HA 4UHNA 3EZSA 3ASAA 4IXZA 4RJ0A 1FG3A 1GEXA 5IWQA 3USFA 1LS3A 5EUEA 1M0NA 1BJWA 3AOVA 4N0WA 4ZWMA 1H0CA 4ITXA 2BI1A 3BB8A 2AY4A 3GETA 1AKCA 3PD6A 5HXXA 4W8IA 1BJOA 2WK9A 2VMYA 2HUIA 2DR1A 4E77A 1AY5A 4LW2A 4IW7A 3HBXA 1AJSA 2WK8A 4XK1A 2ZY5A 1SFFA 4WBTA 3IF2A 2BWNA 2D61A 4ISYA 1MDXA 5G0AA 4LNJA 4A0FA 4GE9A 1AX4A 1TOIA 2D7ZA 2CY8A 3PDBA 3TQXA 1X29A 1B4XA 1RV3A 1WYUB 1C7GA 5I92A 2ZP7A 4ADEA 4ZSWA 4ZAHA 2F8JA 1AY4A 1UKJA 3K7YA 1D7RA 4RM1A 3JW9A 5FT8A 4PFFA 4OMAA 4EB7A 1J04A 1VJOA 3AELA 3WZFA 4H51A 4A6TA 2OKJA 1GC0A 3E2YA 3L8AA 3NDNA 4LNMA 5BJ3A 1LW5A 3F6TA 3JWAA 4E1OA 1DJUA 1B5PA 3AENB 1O61A 3OP7A 4AO4A 3H9XA 1TOGA 2AY6A 3A9XA 3ZZJA 3FTBA 2DKJA 2VMUA 3FZ6A 2R5EA 1BJNA 2E7IA 1QZ9A 2VI9A 4OTLA 4U1TA 4CVQA 3RQ1A 2Z1ZA 1ARSA 1DKAA 4WYFA 4B9BA 1M32A 1JG8A 1AMAA 1IJIA 2VMNA 1ASNA 2JGTA 2JG2A 1D7VA 2W7JA 2G6WA 3WGCA 2ZY3A 1OXPA 3ISLA 1PMOA 2YKVA 2AY9A 3BN1A 5EIGB 3H7FA 1I43A 1N8PA 3K28A 1DFOA 2PB2A 3AEOA 1ASBA 3B46A 5EUNA 1B8GA 1W7MA 3FVUA 3K40A 1E5FA 5M49A 2HUUA 1AICA 5EAAA 2EGYA 1C4KA 3WKRA 3I4JA 3EIAA 3HL2A 2D63A 3JTXA 3MKJA 7AATA 3B1DA 3EUCA 3BCBA 1LC7A 1N31A 2JJEA 1MLYA 1WYVB 1QITA 4AZKA 2ZY2A 2YCTA 4A0HA 4HF8A 2FYFA 1C7NA 1WKGA 2NMPA 4XJMA 5J8QA 3I5TA 3MAUA 2FM1A 1LKCA 2QB3A 1ZC9A 3BCXA 2C44A 5DJ9A 2Z67A 3LVLB 1PFFA 1FC4A 4K2MA 4MY5A 2CH2A 3FQAA 3PA9A 3WCOA 1B9IA 3G0TA 4TV7A 5G2QA 1EJIA 1CL2A 4WYAA 2FKIA 2BYJA 1M0QA 4PVFA 1KL2A 1SZSA 2ZSLA 1W23A 3VOMA 2VI8A 1RVYA 2YCNA 3ACZA 1CZEA 3EZ1A 1SF2A 3TFUA 4Y0DA 4WYGA 3NUBA 1SZKA 4GRXA 4M2KA 2BYLA 4WB0A 3UE8A 3GR9A 3B8XA 2X3LA 1ASGA 3FD0A 4DBCA 3FKDA 1CZCA 1XI9A 1CQ6A 1DJ9A 2ZJGA 1C9CA 2VMXA 1M0OA 3LVMA 3PPLA 1AIAA 3WGBA 1WYTB 4K2BA 1W7NA 3H14A 1TASA 1GC3A 1TOKA 1B9HA 4J5UA 1QJ3A 4ZWVA 2X5FA 4GEBA 3AEMC 1IX6A 4F4EA 4RJYA 4LW4A 5FT5A 1UU1A 3CAIA 2CANA 3B1CA 4OCAA 1AJRA 1SZUA 2D65A 4IXSA 3KKIA 1BQAA 1M6SA 4JEZA 2O1BA 4Q31A 1TOJA 4KXKA 4UHOA 9AATA 5M4BA 1BQDA 1O4SA 2CB1A 1MAPA 2AY2A 5EIGA 2Z9WA 4JE5A 4Y0HA 3FVXA 4I8AA 4XJPA 1ARGA 4M2MA 1ASEA 2R5CA 2VLHA 1P3WA 2DGMA 4ZSYA 2CJGA 2VMZA 3G7QA 4IY7A 3W1JA 3GWPA 1EG5A 3T32A 2AY8A 1BKGA 3RCHB 4R8DA 4OC9A 2OQXA 1CL1A 2BWOA 3AATA 2R2NA 1KKJA 3NU8A 2YRRA 1FG7A 4ZDPA 3BWNA 1YOOA 2VMPA 4PFNA 2PO3A 1AHFA 3BWNC 1C7OA 1WYVA 3QHXA 2HOZA 2EYQA 1D2FA 1IAYA 2ZUKA 2WB6A 4BMKA 2Z20A 4XAUA 3MAFA 1PMMA 3FZ8A 4ZDOA 3QPGA 2QMAA 4A0RA 4ZASA 3QI6A 1V2EA 1ELQA 4J8LA 2V1PA 4O6ZA 1D7SA 4IX8A 4JF1A 4WYCA 1GBNA 2W7KA 2PB0A 3PDXA 4JEVA 4WXBA 2JJHA 2CINA 4MQRA 1DGEA 1Z7DA 2FQ6A 3NTJA 1OHWA 2AEVA 3FZ7A 4ADBA 3NX3A 4WXGA 2GQNA 3EIBA 1OHVA 1BS0A 2BIGA 2VLFA 3DR7A 4AZJA 4WB0B 1G7WA 4MQPA 2BKWA 3DC1A 5DX5A 2G7JA 2FNUA 1T3IA 4GDYA 1D7UA 2QA3A 2CJDA 4ADDA 5LHAA 4IXOA 4W91A 3HDOA 3LV2A 1G7XA 1H1CA 1TARA 1N2TA 3BCAA 4GE4A 3RBFA 3GZDC 2C0RA 4AOAA 4BHDA 4CBSA 5DJ1A 2VMSA 2TPLA 2YRIA 3WLXA 4IYOB 2W7GA 1PG8A 3OKSA 3P1TA 2Z9XA 3P6KA 1ASAA 3PAAA 4K2IA 5M4DA 4JEWA 2C81A 3R4TA 1V72A 4W5KA 3N75A 2OGEA 3D6KA 2VGTA 1O69A 1IAXA 1MLZA 3JWBA 5M46A 3DODA 3N0LA 1AHEA 4M2JA 4JE5D 3E2ZA 1V2DA 5E4ZA 4WP0A 2OATA 4EMYA 3NYUA 4H63Q 1YJZA 3N4XA 1QJ5A 1AHGA 2YKYA 2WK7A 3FDBA 2ZSMA 4F5MA 3M5UA 4DQ6A 3LY1A 1S0AA 3QBOA 4W1XA 3ZRPA 1AIBA 5EAVA 5G09A 3WY7A 1YNUA 4ZLVA 1AJSB 4PIWA 1AY8A 4JEXA 4R5FA 4A72A 3II0A 2D66A 5FT4A 3KGXA 4QGRA 3ZRRA 4ZM3A 1GC2A 1BJOB 2E54A 4ATQA 2YHKA 4UQVA 2VMWA 3COGA 1E5EA 1IUGA 3EI9A 3MAFB 1ARIA 1ZOBA 3L44A 2X8UA 2Z9UA 3N4RA 1IX7A 1ECXA 4FL0A 4GE7A 4MSOA 3WX9A 2GSAA 4F5JA 2QLRA 2HZPA 3A9ZA 2BHXA 3AOWA 5TF5A 3DYDA 4R2NA 1CQ8A 2HP2A 3E2FA 4CXQA 2HOXA 3VK3A 5HDMA 3G8MA 1I29A 5FT6A 1AMRA 5G4IA 3AV7A 3E9KA 1M0PA 2BI2A 2AY5A 2BI5A 1AAWA 3NRAA 1J32A 2HUFA 2VGZA 2W8VA 3NUIA 3VP6A 5K8BA 3BC8A 1GEWA 4R5ZA 3LWSA 5EUDA 4JF0A 4ADCA 4MKJA 2OGAA 2EPJA 1X28A 3DXVA 2AY3A 3MBBA 1IBJA 4ZDLA 1S07A 1RV4A 2AY7A 2ZYJA 4XQ2A 4F5KA 5JAYA 4XJOA 1LW4A 1QGNA 3Q8NA 3UWCA 2BI9A 4ITGA 3EI8A 4GSAA 1WSTA 1IX8A 2EZ1A 4TN4A 3DRDA 2C7TA 4Q76A 3GBXA 3PJ0A 4XJLA 3FDDA 4F5IA 5F8VA 1M7YA 2FNIA 1JF9A 4Y0IA 2W7DA 3MADA 5BJ4A 2VGWA 2GB3A 2O7CA 3W1IA 2OKKA 3ELEA 2ZC0A 4DGTA 2QSRA 1KL1A 1VP4A 2D5YA 4JEYA 1O62A 3HT4A 2W7MA 3RBLA 3BWOA 4CXRA 3PD6B 5G4JA 4MGRA 3E77A 3F0HA 1GEYA 3ZZKA 3E2ZB 2CSTA 4EU1A 1AMQA 3PGYA 1GD9A 3DZZA 1S08A 4EFFA 3RI6A 3W1HA 2A1VA 2W8UA 2BIAA 2E7UA 5LH9A 1C0NA 4OYTA 1AMSA 3UAKA 4E3QA 3GSBA 1U08A 1MDZA 2QBTA 3N5MA 2VGVA 2EO5A 3RUYA 4OT8A 3N7NA 3RCHA 4TMRA 4WYEA 2GMUA 2XH1A 4FFCA 3TFTA 3FQ8A 1YIYA 1Y4IA 1DJEA 1QISA 5D5SA 4ATPA 1LC8A 3CQ6A 4BA5A 3PDBB 1YJSA 2W7EA 1WYUA 3FQ7A 4UOYA 2RFVA 3ATHA 2ZY4A 2EH6A 1LC5A 1MDOA 1GCKA 3ELPA 4W1VA 2DKBA 1I41A 1YJYA 2CH1A 1JS3A 8AATA 1DGDA 4MKKA 4Q75A 5DB5A 1ASMA 1AKAA 2VMTA 3DU4A 1YAAA 1ARHA 3HLMA 2Q7WA 3VK4A 2WKAA 1JS6A 4A00A 1ASCA 3TCMA 3B1EA 4BQ0A 3A2BA 2CJHA 5KTBA 3FCRA 5C6UA 3HQTA 1OXOA 4K05A 1AKBA 1SPAA 4E3RA 2KFPA 2HORA 1TATA 3BV0A 1DTYA 4B98A 3LVKA 1KMJA 2YCPA 1AHXA 3QM2A 4ZM4A 1M4NA 3MC6C 4IYOA 4OBVA 1WKHA 2X5DA 1KKPA 4WLJA 3MC6A 4L0OA 3LG0A 4F5FA 1CQ7A 1KMKA 1W3UA 2VIAA 3NYTA 4RIZA 4A0GA 2ORDA 2JJFA 4KAMA 3N4SA 2EZ2A 3R9AA 2VGSA 2DOUA 4XEWA 2AEUA 1ASFA 2CTZA 4RKDA 3GZDA 3AEJA 1W7LA 1Z3ZA 2W8WA 4WYDA 2QB2A 4UHMA 3BS8A 1BJ4A 2Z9VA 3GZCA 4W1WA 4A6RA 3AEJC 1GC4A 3ECDA 1X2AA 1AAMA 2R5CB 2YKUA 3A9YA 2DGKA 3CQ5A 1QIRA 1ELUA 1BW0A 2YKXA 3LVJA 3NNKA 4WXFA 4AH3A 4OBUA 4BA4A 1MGVA 4HVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NOG A;  3CQ4 A;  2JIS A;  2W7L A;  1CS1 A;  4EB5 A;  3QN6 A;  3VK2 A;  1I48 A;  2VIB A;  2JJG A;  1OHY A;  2DGL A;  2HP1 A;  2AAT A;  4U2H A;  2D64 A;  3PIU A;  2CFB A;  1YIZ A;  5G2P A;  4F5L A;  3CBF A;  2VGU A;  4LNL A;  3KGW A;  4Q6R A;  3QGU A;  2GMS A;  1LK9 A;  3DR4 A;  2AY1 A;  3MEB A;  5EQC A;  2E7J A;  2BI3 A;  1ART A;  1EQB A;  2Z1Y A;  3A8U X;  5E3K A;  3ASB A;  1IVR A;  2Z61 A;  4MQQ A;  4WD2 A;  5F9S A;  3AEM A;  2V0Y A;  1S09 A;  3NU7 A;  4KYO A;  1X0M A;  1ZOD A;  1TOE A;  2VYC A;  2W7H A;  3GJU A;  3E6G A;  4CBR A;  4P7Y A;  3FSL A;  3JZL A;  3I16 A;  1UU0 A;  4A6U A;  1S06 A;  3JU7 A;  5E5I A;  2VMR A;  2VMV A;  2YOB A;  4RLG A;  4F5G A;  1ORD A;  3AEN A;  1ASD A;  1ASL A;  1SVV A;  3EI6 A;  1AHY A;  5EFS A;  1B5O A;  1UU2 A;  3ZRQ A;  3FRK A;  4N0B A;  3FFR A;  1OAT A;  2W8T A;  1CJ0 A;  4RAE A;  2BWP A;  1RVU A;  3EI5 A;  1V2F A;  3F9T A;  3HVY A;  1WYT A;  2FN6 A;  3FFH A;  3KE3 A;  3WKS A;  3TAT A;  1G4X A;  3FVS A;  5AX8 A;  3IHJ A;  2XBN A;  1MAQ A;  2HOY A;  4LC3 A;  2VMQ A;  2W7I A;  2W7F A;  3HMU A;  2W8J A;  2D7Y A;  4RKC A;  1GDE A;  1TPL A;  2VMO A;  1BT4 A;  3EI7 A;  3NYS A;  1VEF A;  4AO9 A;  2O0R A;  2R0T A;  5HHY A;  4P3M A;  5D95 A;  3VAX A;  3DXW A;  3WCN A;  1XEY A;  1G4V A;  4WLH A;  2BIE A;  4RIT A;  3AEP A;  4F5H A;  4UHN A;  3EZS A;  3ASA A;  4IXZ A;  4RJ0 A;  1FG3 A;  1GEX A;  5IWQ A;  3USF A;  1LS3 A;  5EUE A;  1M0N A;  1BJW A;  3AOV A;  4N0W A;  4ZWM A;  1H0C A;  4ITX A;  2BI1 A;  3BB8 A;  2AY4 A;  3GET A;  1AKC A;  3PD6 A;  5HXX A;  4W8I A;  1BJO A;  2WK9 A;  2VMY A;  2HUI A;  2DR1 A;  4E77 A;  1AY5 A;  4LW2 A;  4IW7 A;  3HBX A;  1AJS A;  2WK8 A;  4XK1 A;  2ZY5 A;  1SFF A;  4WBT A;  3IF2 A;  2BWN A;  2D61 A;  4ISY A;  1MDX A;  5G0A A;  4LNJ A;  4A0F A;  4GE9 A;  1AX4 A;  1TOI A;  2D7Z A;  2CY8 A;  3PDB A;  3TQX A;  1X29 A;  1B4X A;  1RV3 A;  1WYU B;  1C7G A;  5I92 A;  2ZP7 A;  4ADE A;  4ZSW A;  4ZAH A;  2F8J A;  1AY4 A;  1UKJ A;  3K7Y A;  1D7R A;  4RM1 A;  3JW9 A;  5FT8 A;  4PFF A;  4OMA A;  4EB7 A;  1J04 A;  1VJO A;  3AEL A;  3WZF A;  4H51 A;  4A6T A;  2OKJ A;  1GC0 A;  3E2Y A;  3L8A A;  3NDN A;  4LNM A;  5BJ3 A;  1LW5 A;  3F6T A;  3JWA A;  4E1O A;  1DJU A;  1B5P A;  3AEN B;  1O61 A;  3OP7 A;  4AO4 A;  1TOG A;  2AY6 A;  3A9X A;  3ZZJ A;  3FTB A;  2DKJ A;  2VMU A;  3FZ6 A;  2R5E A;  1BJN A;  2E7I A;  1QZ9 A;  2VI9 A;  4OTL A;  4U1T A;  4CVQ A;  3RQ1 A;  2Z1Z A;  1ARS A;  1DKA A;  4WYF A;  4B9B A;  1M32 A;  1JG8 A;  1AMA A;  1IJI A;  2VMN A;  1ASN A;  2JGT A;  2JG2 A;  1D7V A;  2W7J A;  2G6W A;  3WGC A;  2ZY3 A;  1OXP A;  3ISL A;  1PMO A;  2YKV A;  2AY9 A;  3BN1 A;  5EIG B;  3H7F A;  1I43 A;  1N8P A;  3K28 A;  1DFO A;  2PB2 A;  3AEO A;  1ASB A;  3B46 A;  5EUN A;  1B8G A;  1W7M A;  3FVU A;  3K40 A;  1E5F A;  5M49 A;  2HUU A;  1AIC A;  5EAA A;  2EGY A;  1C4K A;  3WKR A;  3I4J A;  3EIA A;  3HL2 A;  2D63 A;  3JTX A;  3MKJ A;  7AAT A;  3B1D A;  3EUC A;  3BCB A;  1LC7 A;  1N31 A;  2JJE A;  1MLY A;  1WYV B;  1QIT A;  4AZK A;  2ZY2 A;  2YCT A;  4A0H A;  4HF8 A;  2FYF A;  1C7N A;  1WKG A;  2NMP A;  4XJM A;  5J8Q A;  3I5T A;  3MAU A;  2FM1 A;  1LKC A;  2QB3 A;  1ZC9 A;  3BCX A;  2C44 A;  5DJ9 A;  2Z67 A;  3LVL B;  1PFF A;  1FC4 A;  4K2M A;  4MY5 A;  2CH2 A;  3FQA A;  3PA9 A;  3WCO A;  1B9I A;  3G0T A;  4TV7 A;  5G2Q A;  1EJI A;  1CL2 A;  4WYA A;  2BYJ A;  1M0Q A;  4PVF A;  1KL2 A;  1SZS A;  2ZSL A;  1W23 A;  3VOM A;  2VI8 A;  1RVY A;  2YCN A;  3ACZ A;  1CZE A;  3EZ1 A;  1SF2 A;  3TFU A;  4Y0D A;  4WYG A;  3NUB A;  1SZK A;  4GRX A;  4M2K A;  2BYL A;  4WB0 A;  3UE8 A;  3GR9 A;  3B8X A;  2X3L A;  1ASG A;  3FD0 A;  4DBC A;  3FKD A;  1CZC A;  1XI9 A;  1CQ6 A;  1DJ9 A;  2ZJG A;  1C9C A;  2VMX A;  1M0O A;  3LVM A;  3PPL A;  1AIA A;  3WGB A;  1WYT B;  4K2B A;  1W7N A;  3H14 A;  1TAS A;  1GC3 A;  1TOK A;  1B9H A;  4J5U A;  1QJ3 A;  4ZWV A;  2X5F A;  4GEB A;  3AEM C;  1IX6 A;  4F4E A;  4RJY A;  4LW4 A;  5FT5 A;  1UU1 A;  3CAI A;  2CAN A;  3B1C A;  4OCA A;  1AJR A;  1SZU A;  2D65 A;  4IXS A;  3KKI A;  1BQA A;  1M6S A;  4JEZ A;  2O1B A;  4Q31 A;  1TOJ A;  4KXK A;  4UHO A;  9AAT A;  5M4B A;  1BQD A;  1O4S A;  2CB1 A;  1MAP A;  2AY2 A;  5EIG A;  2Z9W A;  4JE5 A;  4Y0H A;  3FVX A;  4I8A A;  4XJP A;  1ARG A;  4M2M A;  1ASE A;  2R5C A;  2VLH A;  1P3W A;  2DGM A;  4ZSY A;  2CJG A;  2VMZ A;  3G7Q A;  4IY7 A;  3W1J A;  3GWP A;  1EG5 A;  3T32 A;  2AY8 A;  1BKG A;  3RCH B;  4R8D A;  4OC9 A;  2OQX A;  1CL1 A;  2BWO A;  3AAT A;  2R2N A;  1KKJ A;  3NU8 A;  2YRR A;  1FG7 A;  4ZDP A;  3BWN A;  1YOO A;  2VMP A;  4PFN A;  2PO3 A;  1AHF A;  3BWN C;  1C7O A;  1WYV A;  3QHX A;  2HOZ A;  1D2F A;  1IAY A;  2ZUK A;  4BMK A;  2Z20 A;  4XAU A;  3MAF A;  1PMM A;  3FZ8 A;  4ZDO A;  3QPG A;  2QMA A;  4A0R A;  4ZAS A;  3QI6 A;  1V2E A;  1ELQ A;  4J8L A;  2V1P A;  4O6Z A;  1D7S A;  4IX8 A;  4JF1 A;  4WYC A;  1GBN A;  2W7K A;  2PB0 A;  3PDX A;  4JEV A;  4WXB A;  2JJH A;  2CIN A;  4MQR A;  1DGE A;  1Z7D A;  2FQ6 A;  3NTJ A;  1OHW A;  2AEV A;  3FZ7 A;  4ADB A;  3NX3 A;  4WXG A;  2GQN A;  3EIB A;  1OHV A;  1BS0 A;  2BIG A;  2VLF A;  3DR7 A;  4AZJ A;  4WB0 B;  1G7W A;  4MQP A;  2BKW A;  3DC1 A;  5DX5 A;  2FNU A;  1T3I A;  4GDY A;  1D7U A;  2QA3 A;  2CJD A;  4ADD A;  5LHA A;  4IXO A;  4W91 A;  3HDO A;  3LV2 A;  1G7X A;  1H1C A;  1TAR A;  1N2T A;  3BCA A;  4GE4 A;  3RBF A;  3GZD C;  2C0R A;  4AOA A;  4BHD A;  4CBS A;  5DJ1 A;  2VMS A;  2TPL A;  2YRI A;  3WLX A;  4IYO B;  2W7G A;  1PG8 A;  3OKS A;  3P1T A;  2Z9X A;  3P6K A;  1ASA A;  3PAA A;  4K2I A;  5M4D A;  4JEW A;  2C81 A;  3R4T A;  1V72 A;  4W5K A;  3N75 A;  2OGE A;  3D6K A;  2VGT A;  1O69 A;  1IAX A;  1MLZ A;  3JWB A;  5M46 A;  3DOD A;  3N0L A;  1AHE A;  4M2J A;  4JE5 D;  3E2Z A;  1V2D A;  5E4Z A;  4WP0 A;  2OAT A;  4EMY A;  3NYU A;  1YJZ A;  1QJ5 A;  1AHG A;  2YKY A;  2WK7 A;  3FDB A;  2ZSM A;  4F5M A;  3M5U A;  4DQ6 A;  3LY1 A;  1S0A A;  3QBO A;  4W1X A;  3ZRP A;  1AIB A;  5EAV A;  5G09 A;  3WY7 A;  1YNU A;  4ZLV A;  1AJS B;  4PIW A;  1AY8 A;  4JEX A;  4R5F A;  4A72 A;  3II0 A;  2D66 A;  5FT4 A;  3KGX A;  4QGR A;  3ZRR A;  4ZM3 A;  1GC2 A;  1BJO B;  2E54 A;  4ATQ A;  2YHK A;  4UQV A;  2VMW A;  3COG A;  1E5E A;  1IUG A;  3EI9 A;  3MAF B;  1ARI A;  1ZOB A;  3L44 A;  2X8U A;  2Z9U A;  1IX7 A;  1ECX A;  4FL0 A;  4GE7 A;  4MSO A;  3WX9 A;  2GSA A;  4F5J A;  2QLR A;  2HZP A;  3A9Z A;  2BHX A;  3AOW A;  5TF5 A;  3DYD A;  4R2N A;  1CQ8 A;  2HP2 A;  3E2F A;  4CXQ A;  2HOX A;  3VK3 A;  5HDM A;  3G8M A;  1I29 A;  5FT6 A;  1AMR A;  5G4I A;  3AV7 A;  3E9K A;  1M0P A;  2BI2 A;  2AY5 A;  2BI5 A;  1AAW A;  3NRA A;  1J32 A;  2HUF A;  2VGZ A;  2W8V A;  3NUI A;  3VP6 A;  5K8B A;  3BC8 A;  1GEW A;  4R5Z A;  3LWS A;  5EUD A;  4JF0 A;  4ADC A;  4MKJ A;  2OGA A;  2EPJ A;  1X28 A;  3DXV A;  2AY3 A;  3MBB A;  1IBJ A;  4ZDL A;  1S07 A;  1RV4 A;  2AY7 A;  2ZYJ A;  4XQ2 A;  4F5K A;  5JAY A;  4XJO A;  1LW4 A;  1QGN A;  3Q8N A;  3UWC A;  2BI9 A;  4ITG A;  3EI8 A;  4GSA A;  1WST A;  1IX8 A;  2EZ1 A;  4TN4 A;  3DRD A;  2C7T A;  4Q76 A;  3GBX A;  3PJ0 A;  4XJL A;  3FDD A;  4F5I A;  5F8V A;  1M7Y A;  2FNI A;  1JF9 A;  4Y0I A;  2W7D A;  3MAD A;  5BJ4 A;  2VGW A;  2GB3 A;  2O7C A;  3W1I A;  2OKK A;  3ELE A;  2ZC0 A;  4DGT A;  1KL1 A;  1VP4 A;  2D5Y A;  4JEY A;  1O62 A;  3HT4 A;  2W7M A;  3RBL A;  3BWO A;  4CXR A;  3PD6 B;  5G4J A;  4MGR A;  3E77 A;  3F0H A;  1GEY A;  3ZZK A;  3E2Z B;  2CST A;  4EU1 A;  1AMQ A;  3PGY A;  1GD9 A;  3DZZ A;  1S08 A;  4EFF A;  3RI6 A;  3W1H A;  2W8U A;  2BIA A;  2E7U A;  5LH9 A;  1C0N A;  4OYT A;  1AMS A;  3UAK A;  4E3Q A;  3GSB A;  1U08 A;  1MDZ A;  2QBT A;  3N5M A;  2VGV A;  2EO5 A;  3RUY A;  4OT8 A;  3RCH A;  4TMR A;  4WYE A;  2GMU A;  2XH1 A;  4FFC A;  3TFT A;  3FQ8 A;  1YIY A;  1Y4I A;  1DJE A;  1QIS A;  5D5S A;  4ATP A;  1LC8 A;  3CQ6 A;  4BA5 A;  3PDB B;  1YJS A;  2W7E A;  1WYU A;  3FQ7 A;  4UOY A;  2RFV A;  3ATH A;  2ZY4 A;  2EH6 A;  1LC5 A;  1MDO A;  1GCK A;  3ELP A;  4W1V A;  2DKB A;  1I41 A;  1YJY A;  2CH1 A;  1JS3 A;  8AAT A;  1DGD A;  4MKK A;  4Q75 A;  5DB5 A;  1ASM A;  1AKA A;  2VMT A;  3DU4 A;  1YAA A;  1ARH A;  3HLM A;  2Q7W A;  3VK4 A;  2WKA A;  1JS6 A;  4A00 A;  1ASC A;  3TCM A;  3B1E A;  4BQ0 A;  3A2B A;  2CJH A;  3FCR A;  5C6U A;  3HQT A;  1OXO A;  1AKB A;  1SPA A;  4E3R A;  2HOR A;  1TAT A;  3BV0 A;  1DTY A;  4B98 A;  3LVK A;  1KMJ A;  2YCP A;  1AHX A;  3QM2 A;  4ZM4 A;  1M4N A;  3MC6 C;  4IYO A;  4OBV A;  1WKH A;  2X5D A;  1KKP A;  4WLJ A;  3MC6 A;  4L0O A;  3LG0 A;  4F5F A;  1CQ7 A;  1KMK A;  1W3U A;  2VIA A;  3NYT A;  4RIZ A;  4A0G A;  2ORD A;  2JJF A;  4KAM A;  2EZ2 A;  3R9A A;  2VGS A;  2DOU A;  4XEW A;  2AEU A;  1ASF A;  2CTZ A;  4RKD A;  3GZD A;  3AEJ A;  1W7L A;  1Z3Z A;  2W8W A;  4WYD A;  2QB2 A;  4UHM A;  3BS8 A;  1BJ4 A;  2Z9V A;  3GZC A;  4W1W A;  4A6R A;  3AEJ C;  1GC4 A;  3ECD A;  1X2A A;  1AAM A;  2R5C B;  2YKU A;  3A9Y A;  2DGK A;  3CQ5 A;  1QIR A;  1ELU A;  1BW0 A;  2YKX A;  3LVJ A;  3NNK A;  4WXF A;  4AH3 A;  4OBU A;  4BA4 A;  1MGV A;  4HVK A; 
#chains in the Genus database with same CATH topology
 4NOG A;  3CQ4 A;  2JIS A;  2W7L A;  1CS1 A;  4EB5 A;  3QN6 A;  3VK2 A;  1I48 A;  2VIB A;  2JJG A;  1OHY A;  2DGL A;  2HP1 A;  2AAT A;  4U2H A;  2D64 A;  3PIU A;  2CFB A;  1YIZ A;  5G2P A;  4F5L A;  3CBF A;  2VGU A;  4LNL A;  3KGW A;  4Q6R A;  3QGU A;  2GMS A;  1LK9 A;  3DR4 A;  2AY1 A;  3MEB A;  5EQC A;  2E7J A;  2BI3 A;  1ART A;  1EQB A;  2Z1Y A;  3A8U X;  5E3K A;  3ASB A;  1IVR A;  2Z61 A;  4MQQ A;  4WD2 A;  5F9S A;  3AEM A;  2V0Y A;  1S09 A;  3NU7 A;  4KYO A;  1X0M A;  1ZOD A;  1TOE A;  2VYC A;  2W7H A;  3GJU A;  3E6G A;  4CBR A;  4P7Y A;  3FSL A;  3JZL A;  3I16 A;  1UU0 A;  4A6U A;  1S06 A;  3JU7 A;  5E5I A;  2VMR A;  2VMV A;  2YOB A;  4RLG A;  4F5G A;  1ORD A;  3AEN A;  1ASD A;  1ASL A;  1SVV A;  3EI6 A;  1AHY A;  5EFS A;  1B5O A;  1UU2 A;  3ZRQ A;  3FRK A;  4N0B A;  3FFR A;  1OAT A;  2W8T A;  1CJ0 A;  4RAE A;  2BWP A;  1RVU A;  3EI5 A;  1V2F A;  3F9T A;  3HVY A;  1WYT A;  2FN6 A;  3FFH A;  3KE3 A;  3WKS A;  3TAT A;  1G4X A;  3FVS A;  5AX8 A;  3IHJ A;  2XBN A;  1MAQ A;  2HOY A;  4LC3 A;  2VMQ A;  2W7I A;  2W7F A;  3HMU A;  2W8J A;  2D7Y A;  4RKC A;  1GDE A;  1TPL A;  2VMO A;  1BT4 A;  3EI7 A;  3NYS A;  1VEF A;  4AO9 A;  2O0R A;  2R0T A;  5HHY A;  4P3M A;  5D95 A;  3VAX A;  3DXW A;  3WCN A;  1XEY A;  1G4V A;  4WLH A;  2BIE A;  4RIT A;  3AEP A;  4F5H A;  4UHN A;  3EZS A;  3ASA A;  4IXZ A;  4RJ0 A;  1FG3 A;  1GEX A;  5IWQ A;  3USF A;  1LS3 A;  5EUE A;  1M0N A;  1BJW A;  3AOV A;  4N0W A;  4ZWM A;  1H0C A;  4ITX A;  2BI1 A;  3BB8 A;  2AY4 A;  3GET A;  1AKC A;  3PD6 A;  5HXX A;  4W8I A;  1BJO A;  2WK9 A;  2VMY A;  2HUI A;  2DR1 A;  4E77 A;  1AY5 A;  4LW2 A;  4IW7 A;  3HBX A;  1AJS A;  2WK8 A;  4XK1 A;  2ZY5 A;  1SFF A;  4WBT A;  3IF2 A;  2BWN A;  2D61 A;  4ISY A;  1MDX A;  5G0A A;  4LNJ A;  4A0F A;  4GE9 A;  1AX4 A;  1TOI A;  2D7Z A;  2CY8 A;  3PDB A;  3TQX A;  1X29 A;  1B4X A;  1RV3 A;  1WYU B;  1C7G A;  5I92 A;  2ZP7 A;  4ADE A;  4ZSW A;  4ZAH A;  2F8J A;  1AY4 A;  1UKJ A;  3K7Y A;  1D7R A;  4RM1 A;  3JW9 A;  5FT8 A;  4PFF A;  4OMA A;  4EB7 A;  1J04 A;  1VJO A;  3AEL A;  3WZF A;  4H51 A;  4A6T A;  2OKJ A;  1GC0 A;  3E2Y A;  3L8A A;  3NDN A;  4LNM A;  5BJ3 A;  1LW5 A;  3F6T A;  3JWA A;  4E1O A;  1DJU A;  1B5P A;  3AEN B;  1O61 A;  3OP7 A;  4AO4 A;  3H9X A;  1TOG A;  2AY6 A;  3A9X A;  3ZZJ A;  3FTB A;  2DKJ A;  2VMU A;  3FZ6 A;  2R5E A;  1BJN A;  2E7I A;  1QZ9 A;  2VI9 A;  4OTL A;  4U1T A;  4CVQ A;  3RQ1 A;  2Z1Z A;  1ARS A;  1DKA A;  4WYF A;  4B9B A;  1M32 A;  1JG8 A;  1AMA A;  1IJI A;  2VMN A;  1ASN A;  2JGT A;  2JG2 A;  1D7V A;  2W7J A;  2G6W A;  3WGC A;  2ZY3 A;  1OXP A;  3ISL A;  1PMO A;  2YKV A;  2AY9 A;  3BN1 A;  5EIG B;  3H7F A;  1I43 A;  1N8P A;  3K28 A;  1DFO A;  2PB2 A;  3AEO A;  1ASB A;  3B46 A;  5EUN A;  1B8G A;  1W7M A;  3FVU A;  3K40 A;  1E5F A;  5M49 A;  2HUU A;  1AIC A;  5EAA A;  2EGY A;  1C4K A;  3WKR A;  3I4J A;  3EIA A;  3HL2 A;  2D63 A;  3JTX A;  3MKJ A;  7AAT A;  3B1D A;  3EUC A;  3BCB A;  1LC7 A;  1N31 A;  2JJE A;  1MLY A;  1WYV B;  1QIT A;  4AZK A;  2ZY2 A;  2YCT A;  4A0H A;  4HF8 A;  2FYF A;  1C7N A;  1WKG A;  2NMP A;  4XJM A;  5J8Q A;  3I5T A;  3MAU A;  2FM1 A;  1LKC A;  2QB3 A;  1ZC9 A;  3BCX A;  2C44 A;  5DJ9 A;  2Z67 A;  3LVL B;  1PFF A;  1FC4 A;  4K2M A;  4MY5 A;  2CH2 A;  3FQA A;  3PA9 A;  3WCO A;  1B9I A;  3G0T A;  4TV7 A;  5G2Q A;  1EJI A;  1CL2 A;  4WYA A;  2FKI A;  2BYJ A;  1M0Q A;  4PVF A;  1KL2 A;  1SZS A;  2ZSL A;  1W23 A;  3VOM A;  2VI8 A;  1RVY A;  2YCN A;  3ACZ A;  1CZE A;  3EZ1 A;  1SF2 A;  3TFU A;  4Y0D A;  4WYG A;  3NUB A;  1SZK A;  4GRX A;  4M2K A;  2BYL A;  4WB0 A;  3UE8 A;  3GR9 A;  3B8X A;  2X3L A;  1ASG A;  3FD0 A;  4DBC A;  3FKD A;  1CZC A;  1XI9 A;  1CQ6 A;  1DJ9 A;  2ZJG A;  1C9C A;  2VMX A;  1M0O A;  3LVM A;  3PPL A;  1AIA A;  3WGB A;  1WYT B;  4K2B A;  1W7N A;  3H14 A;  1TAS A;  1GC3 A;  1TOK A;  1B9H A;  4J5U A;  1QJ3 A;  4ZWV A;  2X5F A;  4GEB A;  3AEM C;  1IX6 A;  4F4E A;  4RJY A;  4LW4 A;  5FT5 A;  1UU1 A;  3CAI A;  2CAN A;  3B1C A;  4OCA A;  1AJR A;  1SZU A;  2D65 A;  4IXS A;  3KKI A;  1BQA A;  1M6S A;  4JEZ A;  2O1B A;  4Q31 A;  1TOJ A;  4KXK A;  4UHO A;  9AAT A;  5M4B A;  1BQD A;  1O4S A;  2CB1 A;  1MAP A;  2AY2 A;  5EIG A;  2Z9W A;  4JE5 A;  4Y0H A;  3FVX A;  4I8A A;  4XJP A;  1ARG A;  4M2M A;  1ASE A;  2R5C A;  2VLH A;  1P3W A;  2DGM A;  4ZSY A;  2CJG A;  2VMZ A;  3G7Q A;  4IY7 A;  3W1J A;  3GWP A;  1EG5 A;  3T32 A;  2AY8 A;  1BKG A;  3RCH B;  4R8D A;  4OC9 A;  2OQX A;  1CL1 A;  2BWO A;  3AAT A;  2R2N A;  1KKJ A;  3NU8 A;  2YRR A;  1FG7 A;  4ZDP A;  3BWN A;  1YOO A;  2VMP A;  4PFN A;  2PO3 A;  1AHF A;  3BWN C;  1C7O A;  1WYV A;  3QHX A;  2HOZ A;  2EYQ A;  1D2F A;  1IAY A;  2ZUK A;  2WB6 A;  4BMK A;  2Z20 A;  4XAU A;  3MAF A;  1PMM A;  3FZ8 A;  4ZDO A;  3QPG A;  2QMA A;  4A0R A;  4ZAS A;  3QI6 A;  1V2E A;  1ELQ A;  4J8L A;  2V1P A;  4O6Z A;  1D7S A;  4IX8 A;  4JF1 A;  4WYC A;  1GBN A;  2W7K A;  2PB0 A;  3PDX A;  4JEV A;  4WXB A;  2JJH A;  2CIN A;  4MQR A;  1DGE A;  1Z7D A;  2FQ6 A;  3NTJ A;  1OHW A;  2AEV A;  3FZ7 A;  4ADB A;  3NX3 A;  4WXG A;  2GQN A;  3EIB A;  1OHV A;  1BS0 A;  2BIG A;  2VLF A;  3DR7 A;  4AZJ A;  4WB0 B;  1G7W A;  4MQP A;  2BKW A;  3DC1 A;  5DX5 A;  2G7J A;  2FNU A;  1T3I A;  4GDY A;  1D7U A;  2QA3 A;  2CJD A;  4ADD A;  5LHA A;  4IXO A;  4W91 A;  3HDO A;  3LV2 A;  1G7X A;  1H1C A;  1TAR A;  1N2T A;  3BCA A;  4GE4 A;  3RBF A;  3GZD C;  2C0R A;  4AOA A;  4BHD A;  4CBS A;  5DJ1 A;  2VMS A;  2TPL A;  2YRI A;  3WLX A;  4IYO B;  2W7G A;  1PG8 A;  3OKS A;  3P1T A;  2Z9X A;  3P6K A;  1ASA A;  3PAA A;  4K2I A;  5M4D A;  4JEW A;  2C81 A;  3R4T A;  1V72 A;  4W5K A;  3N75 A;  2OGE A;  3D6K A;  2VGT A;  1O69 A;  1IAX A;  1MLZ A;  3JWB A;  5M46 A;  3DOD A;  3N0L A;  1AHE A;  4M2J A;  4JE5 D;  3E2Z A;  1V2D A;  5E4Z A;  4WP0 A;  2OAT A;  4EMY A;  3NYU A;  4H63 Q;  1YJZ A;  3N4X A;  1QJ5 A;  1AHG A;  2YKY A;  2WK7 A;  3FDB A;  2ZSM A;  4F5M A;  3M5U A;  4DQ6 A;  3LY1 A;  1S0A A;  3QBO A;  4W1X A;  3ZRP A;  1AIB A;  5EAV A;  5G09 A;  3WY7 A;  1YNU A;  4ZLV A;  1AJS B;  4PIW A;  1AY8 A;  4JEX A;  4R5F A;  4A72 A;  3II0 A;  2D66 A;  5FT4 A;  3KGX A;  4QGR A;  3ZRR A;  4ZM3 A;  1GC2 A;  1BJO B;  2E54 A;  4ATQ A;  2YHK A;  4UQV A;  2VMW A;  3COG A;  1E5E A;  1IUG A;  3EI9 A;  3MAF B;  1ARI A;  1ZOB A;  3L44 A;  2X8U A;  2Z9U A;  3N4R A;  1IX7 A;  1ECX A;  4FL0 A;  4GE7 A;  4MSO A;  3WX9 A;  2GSA A;  4F5J A;  2QLR A;  2HZP A;  3A9Z A;  2BHX A;  3AOW A;  5TF5 A;  3DYD A;  4R2N A;  1CQ8 A;  2HP2 A;  3E2F A;  4CXQ A;  2HOX A;  3VK3 A;  5HDM A;  3G8M A;  1I29 A;  5FT6 A;  1AMR A;  5G4I A;  3AV7 A;  3E9K A;  1M0P A;  2BI2 A;  2AY5 A;  2BI5 A;  1AAW A;  3NRA A;  1J32 A;  2HUF A;  2VGZ A;  2W8V A;  3NUI A;  3VP6 A;  5K8B A;  3BC8 A;  1GEW A;  4R5Z A;  3LWS A;  5EUD A;  4JF0 A;  4ADC A;  4MKJ A;  2OGA A;  2EPJ A;  1X28 A;  3DXV A;  2AY3 A;  3MBB A;  1IBJ A;  4ZDL A;  1S07 A;  1RV4 A;  2AY7 A;  2ZYJ A;  4XQ2 A;  4F5K A;  5JAY A;  4XJO A;  1LW4 A;  1QGN A;  3Q8N A;  3UWC A;  2BI9 A;  4ITG A;  3EI8 A;  4GSA A;  1WST A;  1IX8 A;  2EZ1 A;  4TN4 A;  3DRD A;  2C7T A;  4Q76 A;  3GBX A;  3PJ0 A;  4XJL A;  3FDD A;  4F5I A;  5F8V A;  1M7Y A;  2FNI A;  1JF9 A;  4Y0I A;  2W7D A;  3MAD A;  5BJ4 A;  2VGW A;  2GB3 A;  2O7C A;  3W1I A;  2OKK A;  3ELE A;  2ZC0 A;  4DGT A;  2QSR A;  1KL1 A;  1VP4 A;  2D5Y A;  4JEY A;  1O62 A;  3HT4 A;  2W7M A;  3RBL A;  3BWO A;  4CXR A;  3PD6 B;  5G4J A;  4MGR A;  3E77 A;  3F0H A;  1GEY A;  3ZZK A;  3E2Z B;  2CST A;  4EU1 A;  1AMQ A;  3PGY A;  1GD9 A;  3DZZ A;  1S08 A;  4EFF A;  3RI6 A;  3W1H A;  2A1V A;  2W8U A;  2BIA A;  2E7U A;  5LH9 A;  1C0N A;  4OYT A;  1AMS A;  3UAK A;  4E3Q A;  3GSB A;  1U08 A;  1MDZ A;  2QBT A;  3N5M A;  2VGV A;  2EO5 A;  3RUY A;  4OT8 A;  3N7N A;  3RCH A;  4TMR A;  4WYE A;  2GMU A;  2XH1 A;  4FFC A;  3TFT A;  1KAF A;  3FQ8 A;  1YIY A;  1Y4I A;  1DJE A;  1QIS A;  5D5S A;  4ATP A;  1LC8 A;  3CQ6 A;  4BA5 A;  3PDB B;  1YJS A;  2W7E A;  1WYU A;  3FQ7 A;  4UOY A;  2RFV A;  3ATH A;  2ZY4 A;  2EH6 A;  1LC5 A;  1MDO A;  1GCK A;  3ELP A;  4W1V A;  2DKB A;  1I41 A;  1YJY A;  2CH1 A;  1JS3 A;  8AAT A;  1DGD A;  4MKK A;  4Q75 A;  5DB5 A;  1ASM A;  1AKA A;  2VMT A;  3DU4 A;  1YAA A;  1ARH A;  3HLM A;  2Q7W A;  3VK4 A;  2WKA A;  1JS6 A;  4A00 A;  1ASC A;  3TCM A;  3B1E A;  4BQ0 A;  3A2B A;  2CJH A;  5KTB A;  3FCR A;  5C6U A;  3HQT A;  1OXO A;  4K05 A;  1AKB A;  1SPA A;  4E3R A;  2KFP A;  2HOR A;  1TAT A;  3BV0 A;  1DTY A;  4B98 A;  3LVK A;  1KMJ A;  2YCP A;  1AHX A;  3QM2 A;  4ZM4 A;  1M4N A;  3MC6 C;  4IYO A;  4OBV A;  1WKH A;  2X5D A;  1KKP A;  4WLJ A;  3MC6 A;  4L0O A;  3LG0 A;  4F5F A;  1CQ7 A;  1KMK A;  1W3U A;  2VIA A;  3NYT A;  4RIZ A;  4A0G A;  2ORD A;  2JJF A;  4KAM A;  3N4S A;  2EZ2 A;  3R9A A;  2VGS A;  2DOU A;  4XEW A;  2AEU A;  1ASF A;  2CTZ A;  4RKD A;  3GZD A;  3AEJ A;  1W7L A;  1Z3Z A;  2W8W A;  4WYD A;  2QB2 A;  4UHM A;  3BS8 A;  1BJ4 A;  2Z9V A;  3GZC A;  4W1W A;  4A6R A;  3AEJ C;  1GC4 A;  3ECD A;  1X2A A;  1AAM A;  2R5C B;  2YKU A;  3A9Y A;  2DGK A;  3CQ5 A;  1QIR A;  1ELU A;  1BW0 A;  2YKX A;  3LVJ A;  3NNK A;  4WXF A;  4AH3 A;  4OBU A;  4BA4 A;  1MGV A;  4HVK A; 
#chains in the Genus database with same CATH homology
 4NOG A;  3CQ4 A;  2JIS A;  2W7L A;  1CS1 A;  4EB5 A;  3QN6 A;  3VK2 A;  1I48 A;  2VIB A;  2JJG A;  1OHY A;  2DGL A;  2HP1 A;  2AAT A;  4U2H A;  2D64 A;  3PIU A;  2CFB A;  1YIZ A;  5G2P A;  4F5L A;  3CBF A;  2VGU A;  4LNL A;  3KGW A;  4Q6R A;  3QGU A;  2GMS A;  1LK9 A;  3DR4 A;  2AY1 A;  3MEB A;  5EQC A;  2E7J A;  2BI3 A;  1ART A;  1EQB A;  2Z1Y A;  3A8U X;  5E3K A;  3ASB A;  1IVR A;  2Z61 A;  4MQQ A;  4WD2 A;  5F9S A;  3AEM A;  2V0Y A;  1S09 A;  3NU7 A;  4KYO A;  1X0M A;  1ZOD A;  1TOE A;  2VYC A;  2W7H A;  3GJU A;  3E6G A;  4CBR A;  4P7Y A;  3FSL A;  3JZL A;  3I16 A;  1UU0 A;  4A6U A;  1S06 A;  3JU7 A;  5E5I A;  2VMR A;  2VMV A;  2YOB A;  4RLG A;  4F5G A;  1ORD A;  3AEN A;  1ASD A;  1ASL A;  1SVV A;  3EI6 A;  1AHY A;  5EFS A;  1B5O A;  1UU2 A;  3ZRQ A;  3FRK A;  4N0B A;  3FFR A;  1OAT A;  2W8T A;  1CJ0 A;  4RAE A;  2BWP A;  1RVU A;  3EI5 A;  1V2F A;  3F9T A;  3HVY A;  1WYT A;  2FN6 A;  3FFH A;  3KE3 A;  3WKS A;  3TAT A;  1G4X A;  3FVS A;  5AX8 A;  3IHJ A;  2XBN A;  1MAQ A;  2HOY A;  4LC3 A;  2VMQ A;  2W7I A;  2W7F A;  3HMU A;  2W8J A;  2D7Y A;  4RKC A;  1GDE A;  1TPL A;  2VMO A;  1BT4 A;  3EI7 A;  3NYS A;  1VEF A;  4AO9 A;  2O0R A;  2R0T A;  5HHY A;  4P3M A;  5D95 A;  3VAX A;  3DXW A;  3WCN A;  1XEY A;  1G4V A;  4WLH A;  2BIE A;  4RIT A;  3AEP A;  4F5H A;  4UHN A;  3EZS A;  3ASA A;  4IXZ A;  4RJ0 A;  1FG3 A;  1GEX A;  5IWQ A;  3USF A;  1LS3 A;  5EUE A;  1M0N A;  1BJW A;  3AOV A;  4N0W A;  4ZWM A;  1H0C A;  4ITX A;  2BI1 A;  3BB8 A;  2AY4 A;  3GET A;  1AKC A;  3PD6 A;  5HXX A;  4W8I A;  1BJO A;  2WK9 A;  2VMY A;  2HUI A;  2DR1 A;  4E77 A;  1AY5 A;  4LW2 A;  4IW7 A;  3HBX A;  1AJS A;  2WK8 A;  4XK1 A;  2ZY5 A;  1SFF A;  4WBT A;  3IF2 A;  2BWN A;  2D61 A;  4ISY A;  1MDX A;  5G0A A;  4LNJ A;  4A0F A;  4GE9 A;  1AX4 A;  1TOI A;  2D7Z A;  2CY8 A;  3PDB A;  3TQX A;  1X29 A;  1B4X A;  1RV3 A;  1WYU B;  1C7G A;  5I92 A;  2ZP7 A;  4ADE A;  4ZSW A;  4ZAH A;  2F8J A;  1AY4 A;  1UKJ A;  3K7Y A;  1D7R A;  4RM1 A;  3JW9 A;  5FT8 A;  4PFF A;  4OMA A;  4EB7 A;  1J04 A;  1VJO A;  3AEL A;  3WZF A;  4H51 A;  4A6T A;  2OKJ A;  1GC0 A;  3E2Y A;  3L8A A;  3NDN A;  4LNM A;  5BJ3 A;  1LW5 A;  3F6T A;  3JWA A;  4E1O A;  1DJU A;  1B5P A;  3AEN B;  1O61 A;  3OP7 A;  4AO4 A;  3H9X A;  1TOG A;  2AY6 A;  3A9X A;  3ZZJ A;  3FTB A;  2DKJ A;  2VMU A;  3FZ6 A;  2R5E A;  1BJN A;  2E7I A;  1QZ9 A;  2VI9 A;  4OTL A;  4U1T A;  4CVQ A;  3RQ1 A;  2Z1Z A;  1ARS A;  1DKA A;  4WYF A;  4B9B A;  1M32 A;  1JG8 A;  1AMA A;  1IJI A;  2VMN A;  1ASN A;  2JGT A;  2JG2 A;  1D7V A;  2W7J A;  2G6W A;  3WGC A;  2ZY3 A;  1OXP A;  3ISL A;  1PMO A;  2YKV A;  2AY9 A;  3BN1 A;  5EIG B;  3H7F A;  1I43 A;  1N8P A;  3K28 A;  1DFO A;  2PB2 A;  3AEO A;  1ASB A;  3B46 A;  5EUN A;  1B8G A;  1W7M A;  3FVU A;  3K40 A;  1E5F A;  5M49 A;  2HUU A;  1AIC A;  5EAA A;  2EGY A;  1C4K A;  3WKR A;  3I4J A;  3EIA A;  3HL2 A;  2D63 A;  3JTX A;  3MKJ A;  7AAT A;  3B1D A;  3EUC A;  3BCB A;  1LC7 A;  1N31 A;  2JJE A;  1MLY A;  1WYV B;  1QIT A;  4AZK A;  2ZY2 A;  2YCT A;  4A0H A;  4HF8 A;  2FYF A;  1C7N A;  1WKG A;  2NMP A;  4XJM A;  5J8Q A;  3I5T A;  3MAU A;  2FM1 A;  1LKC A;  2QB3 A;  1ZC9 A;  3BCX A;  2C44 A;  5DJ9 A;  2Z67 A;  3LVL B;  1PFF A;  1FC4 A;  4K2M A;  4MY5 A;  2CH2 A;  3FQA A;  3PA9 A;  3WCO A;  1B9I A;  3G0T A;  4TV7 A;  5G2Q A;  1EJI A;  1CL2 A;  4WYA A;  2FKI A;  2BYJ A;  1M0Q A;  4PVF A;  1KL2 A;  1SZS A;  2ZSL A;  1W23 A;  3VOM A;  2VI8 A;  1RVY A;  2YCN A;  3ACZ A;  1CZE A;  3EZ1 A;  1SF2 A;  3TFU A;  4Y0D A;  4WYG A;  3NUB A;  1SZK A;  4GRX A;  4M2K A;  2BYL A;  4WB0 A;  3UE8 A;  3GR9 A;  3B8X A;  2X3L A;  1ASG A;  3FD0 A;  4DBC A;  3FKD A;  1CZC A;  1XI9 A;  1CQ6 A;  1DJ9 A;  2ZJG A;  1C9C A;  2VMX A;  1M0O A;  3LVM A;  3PPL A;  1AIA A;  3WGB A;  1WYT B;  4K2B A;  1W7N A;  3H14 A;  1TAS A;  1GC3 A;  1TOK A;  1B9H A;  4J5U A;  1QJ3 A;  4ZWV A;  2X5F A;  4GEB A;  3AEM C;  1IX6 A;  4F4E A;  4RJY A;  4LW4 A;  5FT5 A;  1UU1 A;  3CAI A;  2CAN A;  3B1C A;  4OCA A;  1AJR A;  1SZU A;  2D65 A;  4IXS A;  3KKI A;  1BQA A;  1M6S A;  4JEZ A;  2O1B A;  4Q31 A;  1TOJ A;  4KXK A;  4UHO A;  9AAT A;  5M4B A;  1BQD A;  1O4S A;  2CB1 A;  1MAP A;  2AY2 A;  5EIG A;  2Z9W A;  4JE5 A;  4Y0H A;  3FVX A;  4I8A A;  4XJP A;  1ARG A;  4M2M A;  1ASE A;  2R5C A;  2VLH A;  1P3W A;  2DGM A;  4ZSY A;  2CJG A;  2VMZ A;  3G7Q A;  4IY7 A;  3W1J A;  3GWP A;  1EG5 A;  3T32 A;  2AY8 A;  1BKG A;  3RCH B;  4R8D A;  4OC9 A;  2OQX A;  1CL1 A;  2BWO A;  3AAT A;  2R2N A;  1KKJ A;  3NU8 A;  2YRR A;  1FG7 A;  4ZDP A;  3BWN A;  1YOO A;  2VMP A;  4PFN A;  2PO3 A;  1AHF A;  3BWN C;  1C7O A;  1WYV A;  3QHX A;  2HOZ A;  2EYQ A;  1D2F A;  1IAY A;  2ZUK A;  2WB6 A;  4BMK A;  2Z20 A;  4XAU A;  3MAF A;  1PMM A;  3FZ8 A;  4ZDO A;  3QPG A;  2QMA A;  4A0R A;  4ZAS A;  3QI6 A;  1V2E A;  1ELQ A;  4J8L A;  2V1P A;  4O6Z A;  1D7S A;  4IX8 A;  4JF1 A;  4WYC A;  1GBN A;  2W7K A;  2PB0 A;  3PDX A;  4JEV A;  4WXB A;  2JJH A;  2CIN A;  4MQR A;  1DGE A;  1Z7D A;  2FQ6 A;  3NTJ A;  1OHW A;  2AEV A;  3FZ7 A;  4ADB A;  3NX3 A;  4WXG A;  2GQN A;  3EIB A;  1OHV A;  1BS0 A;  2BIG A;  2VLF A;  3DR7 A;  4AZJ A;  4WB0 B;  1G7W A;  4MQP A;  2BKW A;  3DC1 A;  5DX5 A;  2G7J A;  2FNU A;  1T3I A;  4GDY A;  1D7U A;  2QA3 A;  2CJD A;  4ADD A;  5LHA A;  4IXO A;  4W91 A;  3HDO A;  3LV2 A;  1G7X A;  1H1C A;  1TAR A;  1N2T A;  3BCA A;  4GE4 A;  3RBF A;  3GZD C;  2C0R A;  4AOA A;  4BHD A;  4CBS A;  5DJ1 A;  2VMS A;  2TPL A;  2YRI A;  3WLX A;  4IYO B;  2W7G A;  1PG8 A;  3OKS A;  3P1T A;  2Z9X A;  3P6K A;  1ASA A;  3PAA A;  4K2I A;  5M4D A;  4JEW A;  2C81 A;  3R4T A;  1V72 A;  4W5K A;  3N75 A;  2OGE A;  3D6K A;  2VGT A;  1O69 A;  1IAX A;  1MLZ A;  3JWB A;  5M46 A;  3DOD A;  3N0L A;  1AHE A;  4M2J A;  4JE5 D;  3E2Z A;  1V2D A;  5E4Z A;  4WP0 A;  2OAT A;  4EMY A;  3NYU A;  4H63 Q;  1YJZ A;  3N4X A;  1QJ5 A;  1AHG A;  2YKY A;  2WK7 A;  3FDB A;  2ZSM A;  4F5M A;  3M5U A;  4DQ6 A;  3LY1 A;  1S0A A;  3QBO A;  4W1X A;  3ZRP A;  1AIB A;  5EAV A;  5G09 A;  3WY7 A;  1YNU A;  4ZLV A;  1AJS B;  4PIW A;  1AY8 A;  4JEX A;  4R5F A;  4A72 A;  3II0 A;  2D66 A;  5FT4 A;  3KGX A;  4QGR A;  3ZRR A;  4ZM3 A;  1GC2 A;  1BJO B;  2E54 A;  4ATQ A;  2YHK A;  4UQV A;  2VMW A;  3COG A;  1E5E A;  1IUG A;  3EI9 A;  3MAF B;  1ARI A;  1ZOB A;  3L44 A;  2X8U A;  2Z9U A;  3N4R A;  1IX7 A;  1ECX A;  4FL0 A;  4GE7 A;  4MSO A;  3WX9 A;  2GSA A;  4F5J A;  2QLR A;  2HZP A;  3A9Z A;  2BHX A;  3AOW A;  5TF5 A;  3DYD A;  4R2N A;  1CQ8 A;  2HP2 A;  3E2F A;  4CXQ A;  2HOX A;  3VK3 A;  5HDM A;  3G8M A;  1I29 A;  5FT6 A;  1AMR A;  5G4I A;  3AV7 A;  3E9K A;  1M0P A;  2BI2 A;  2AY5 A;  2BI5 A;  1AAW A;  3NRA A;  1J32 A;  2HUF A;  2VGZ A;  2W8V A;  3NUI A;  3VP6 A;  5K8B A;  3BC8 A;  1GEW A;  4R5Z A;  3LWS A;  5EUD A;  4JF0 A;  4ADC A;  4MKJ A;  2OGA A;  2EPJ A;  1X28 A;  3DXV A;  2AY3 A;  3MBB A;  1IBJ A;  4ZDL A;  1S07 A;  1RV4 A;  2AY7 A;  2ZYJ A;  4XQ2 A;  4F5K A;  5JAY A;  4XJO A;  1LW4 A;  1QGN A;  3Q8N A;  3UWC A;  2BI9 A;  4ITG A;  3EI8 A;  4GSA A;  1WST A;  1IX8 A;  2EZ1 A;  4TN4 A;  3DRD A;  2C7T A;  4Q76 A;  3GBX A;  3PJ0 A;  4XJL A;  3FDD A;  4F5I A;  5F8V A;  1M7Y A;  2FNI A;  1JF9 A;  4Y0I A;  2W7D A;  3MAD A;  5BJ4 A;  2VGW A;  2GB3 A;  2O7C A;  3W1I A;  2OKK A;  3ELE A;  2ZC0 A;  4DGT A;  2QSR A;  1KL1 A;  1VP4 A;  2D5Y A;  4JEY A;  1O62 A;  3HT4 A;  2W7M A;  3RBL A;  3BWO A;  4CXR A;  3PD6 B;  5G4J A;  4MGR A;  3E77 A;  3F0H A;  1GEY A;  3ZZK A;  3E2Z B;  2CST A;  4EU1 A;  1AMQ A;  3PGY A;  1GD9 A;  3DZZ A;  1S08 A;  4EFF A;  3RI6 A;  3W1H A;  2A1V A;  2W8U A;  2BIA A;  2E7U A;  5LH9 A;  1C0N A;  4OYT A;  1AMS A;  3UAK A;  4E3Q A;  3GSB A;  1U08 A;  1MDZ A;  2QBT A;  3N5M A;  2VGV A;  2EO5 A;  3RUY A;  4OT8 A;  3N7N A;  3RCH A;  4TMR A;  4WYE A;  2GMU A;  2XH1 A;  4FFC A;  3TFT A;  3FQ8 A;  1YIY A;  1Y4I A;  1DJE A;  1QIS A;  5D5S A;  4ATP A;  1LC8 A;  3CQ6 A;  4BA5 A;  3PDB B;  1YJS A;  2W7E A;  1WYU A;  3FQ7 A;  4UOY A;  2RFV A;  3ATH A;  2ZY4 A;  2EH6 A;  1LC5 A;  1MDO A;  1GCK A;  3ELP A;  4W1V A;  2DKB A;  1I41 A;  1YJY A;  2CH1 A;  1JS3 A;  8AAT A;  1DGD A;  4MKK A;  4Q75 A;  5DB5 A;  1ASM A;  1AKA A;  2VMT A;  3DU4 A;  1YAA A;  1ARH A;  3HLM A;  2Q7W A;  3VK4 A;  2WKA A;  1JS6 A;  4A00 A;  1ASC A;  3TCM A;  3B1E A;  4BQ0 A;  3A2B A;  2CJH A;  5KTB A;  3FCR A;  5C6U A;  3HQT A;  1OXO A;  4K05 A;  1AKB A;  1SPA A;  4E3R A;  2KFP A;  2HOR A;  1TAT A;  3BV0 A;  1DTY A;  4B98 A;  3LVK A;  1KMJ A;  2YCP A;  1AHX A;  3QM2 A;  4ZM4 A;  1M4N A;  3MC6 C;  4IYO A;  4OBV A;  1WKH A;  2X5D A;  1KKP A;  4WLJ A;  3MC6 A;  4L0O A;  3LG0 A;  4F5F A;  1CQ7 A;  1KMK A;  1W3U A;  2VIA A;  3NYT A;  4RIZ A;  4A0G A;  2ORD A;  2JJF A;  4KAM A;  3N4S A;  2EZ2 A;  3R9A A;  2VGS A;  2DOU A;  4XEW A;  2AEU A;  1ASF A;  2CTZ A;  4RKD A;  3GZD A;  3AEJ A;  1W7L A;  1Z3Z A;  2W8W A;  4WYD A;  2QB2 A;  4UHM A;  3BS8 A;  1BJ4 A;  2Z9V A;  3GZC A;  4W1W A;  4A6R A;  3AEJ C;  1GC4 A;  3ECD A;  1X2A A;  1AAM A;  2R5C B;  2YKU A;  3A9Y A;  2DGK A;  3CQ5 A;  1QIR A;  1ELU A;  1BW0 A;  2YKX A;  3LVJ A;  3NNK A;  4WXF A;  4AH3 A;  4OBU A;  4BA4 A;  1MGV A;  4HVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...